1YJNL

Crystal structure of clindamycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
150
structure length
145
Chain Sequence
b'TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAEFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 28
structure length 145
sequence length 150
ec nomenclature
pdb deposition date 2005-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 1yjnL02
4.10.990.10 Few Secondary Structures Irregular Molecule: Ribosomal Protein L15; Chain: K; domain 1 Molecule: Ribosomal Protein L15; Chain: K; domain 1 1yjnL01
1K8AP 3CD6O 1M1KP 3CMEL 1KC8M 3CC7L 1Q81M 1W2BK 1VQPL 1YIJO 1VQ4L 1VQ7L 1Q7YP 1KQSK 1YJNO 1Q86M 1Q82P 3CD6L 3CMEO 1VQML 1VQLL 3CCQO 1VQPO 3CPWK 1YIJL 1S72O 1VQ5L 3CCUL 1JJ2K 3I56O 1QVFK 3I55O 1VQMO 1Q86P 1QVGK 1VQLO 3G4SO 3CCQL 3CCVL 1VQ9O 1M90M 1S72L 1K73P 1VQ5O 2OTJL 3CC4L 3CCUO 3CC2O 2QA4O 3I56L 1NJIM 3I55L 1W2BN 3G4SL 3CCVO 3CXCK 1VQ8O 1VQ9L 1KC8P 1YITO 1Q81P 1K9MM 3CCLO 3CCEL 1KQSN 2OTJO 3CC4O 3CC2L 2OTLO 2QA4L 1M1KM 1YI2L 3G6EL 3OW2K 1YHQO 3CPWN 1VQ8L 1YITL 2QEXO 3CCLL 1VQ6O 3G71O 3CCEO 1KD1M 1VQKO 1YJ9L 1JJ2N 1Q7YM 2OTLL 1QVFN 3CCJL 1QVGN 1YI2O 3G6EO 1YHQL 2QEXL 1VQ6L 3G71L 3CCSL 1VQKL 1YJ9O 1N8RM 3CCRO 1VQOO 1K8AM 1M90P 3CCJO 1YJWL 3OW2N 1KD1P 1VQNO 3CMAO 3CCML 3CXCN 1NJIP 3CCSO 3CC7O 3CCRL 1VQOL 1K73M 1K9MP 1Q82M 1YJWO 1VQNL 3CMAL 1VQ4O 1N8RP 3CCMO 1VQ7O 1YJNL
chains in the Genus database with same CATH superfamily
1K8AP 3CD6O 1M1KP 3CMEL 1KC8M 3CC7L 1Q81M 1W2BK 1VQPL 1YIJO 1VQ4L 1VQ7L 1Q7YP 1KQSK 1YJNO 1Q86M 1Q82P 3CD6L 3CMEO 1VQML 1VQLL 3CCQO 1VQPO 3CPWK 1YIJL 4XTKA 1S72O 1VQ5L 3CCUL 1JJ2K 3I56O 1QVFK 3I55O 1VQMO 4P6IC 5DS4A 1Q86P 1QVGK 1VQLO 3G4SO 3CCQL 3CCVL 5DLJA 1VQ9O 1M90M 1S72L 1K73P 1VQ5O 2OTJL 3CC4L 3CCUO 3CC2O 2QA4O 3I56L 1NJIM 3I55L 1W2BN 3G4SL 3CCVO 4N06A 3CXCK 1VQ8O 1VQ9L 5DS5A 1KC8P 1YITO 1Q81P 1K9MM 3CCLO 3CCEL 1KQSN 2OTJO 3CC4O 3CC2L 2OTLO 2QA4L 1M1KM 1YI2L 3G6EL 3OW2K 1YHQO 3CPWN 1VQ8L 1YITL 2QEXO 3CCLL 5DS6A 3G71O 1VQ6O 3CCEO 1KD1M 1VQKO 1YJ9L 1JJ2N 5FCLA 1Q7YM 2OTLL 1QVFN 3CCJL 1QVGN 1YI2O 3G6EO 1YHQL 5DQTA 2QEXL 1VQ6L 3G71L 3CCSL 1VQKL 1YJ9O 4W8KA 1N8RM 3CCRO 1VQOO 5DQZA 1K8AM 1M90P 3CCJO 1YJWL 3OW2N 1KD1P 1VQNO 3CMAO 3CCML 3CXCN 4QDLA 2YZSA 1NJIP 3CCSO 3NKDA 3GODA 3CC7O 3CCRL 1VQOL 1K73M 1K9MP 1Q82M 1YJWO 1VQNL 3CMAL 1VQ4O 1N8RP 3CCMO 4WJ0A 1VQ7O 1YJNL
chains in the Genus database with same CATH topology
1K8AP 3CD6O 1M1KP 3CMEL 1KC8M 3CC7L 1Q81M 1W2BK 1VQPL 1YIJO 1VQ4L 1VQ7L 1Q7YP 1KQSK 1YJNO 1Q86M 1Q82P 3CD6L 3CMEO 1VQML 1VQLL 3CCQO 1VQPO 3CPWK 1YIJL 4XTKA 1S72O 1VQ5L 3CCUL 1JJ2K 3I56O 1QVFK 3I55O 1VQMO 4P6IC 5DS4A 1Q86P 1QVGK 1VQLO 3G4SO 3CCQL 3CCVL 5DLJA 1VQ9O 1M90M 1S72L 1K73P 1VQ5O 2OTJL 3CC4L 3CCUO 3CC2O 2QA4O 3I56L 1NJIM 3I55L 1W2BN 3G4SL 3CCVO 4N06A 3CXCK 1VQ8O 1VQ9L 5DS5A 1KC8P 1YITO 1Q81P 1K9MM 3CCLO 3CCEL 1KQSN 2OTJO 3CC4O 3CC2L 2OTLO 2QA4L 1M1KM 1YI2L 3G6EL 3OW2K 1YHQO 3CPWN 1VQ8L 1YITL 2QEXO 3CCLL 5DS6A 3G71O 1VQ6O 3CCEO 1KD1M 1VQKO 1YJ9L 1JJ2N 5FCLA 1Q7YM 2OTLL 1QVFN 3CCJL 1QVGN 1YI2O 3G6EO 1YHQL 5DQTA 2QEXL 1VQ6L 3G71L 3CCSL 1VQKL 1YJ9O 4W8KA 1N8RM 3CCRO 1VQOO 5DQZA 1K8AM 1M90P 3CCJO 1YJWL 3OW2N 1KD1P 1VQNO 3CMAO 3CCML 3CXCN 4QDLA 2YZSA 1NJIP 3CCSO 3NKDA 3GODA 3CC7O 3CCRL 1VQOL 1K73M 1K9MP 1Q82M 1YJWO 1VQNL 3CMAL 1VQ4O 1N8RP 3CCMO 4WJ0A 1VQ7O 1YJNL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K8A P;  3CD6 O;  1M1K P;  3CME L;  1KC8 M;  3CC7 L;  1Q81 M;  1W2B K;  1VQP L;  1YIJ O;  1VQ4 L;  1VQ7 L;  1Q7Y P;  1KQS K;  1YJN O;  1Q86 M;  1Q82 P;  3CD6 L;  3CME O;  1VQM L;  1VQL L;  3CCQ O;  1VQP O;  3CPW K;  1YIJ L;  1S72 O;  1VQ5 L;  3CCU L;  1JJ2 K;  3I56 O;  1QVF K;  3I55 O;  1VQM O;  1Q86 P;  1QVG K;  1VQL O;  3G4S O;  3CCQ L;  3CCV L;  1VQ9 O;  1M90 M;  1S72 L;  1K73 P;  1VQ5 O;  2OTJ L;  3CC4 L;  3CCU O;  3CC2 O;  2QA4 O;  3I56 L;  1NJI M;  3I55 L;  1W2B N;  3G4S L;  3CCV O;  3CXC K;  1VQ8 O;  1VQ9 L;  1KC8 P;  1YIT O;  1Q81 P;  1K9M M;  3CCL O;  3CCE L;  1KQS N;  2OTJ O;  3CC4 O;  3CC2 L;  2OTL O;  2QA4 L;  1M1K M;  1YI2 L;  3G6E L;  3OW2 K;  1YHQ O;  3CPW N;  1VQ8 L;  1YIT L;  2QEX O;  3CCL L;  1VQ6 O;  3G71 O;  3CCE O;  1KD1 M;  1VQK O;  1YJ9 L;  1JJ2 N;  1Q7Y M;  2OTL L;  1QVF N;  3CCJ L;  1QVG N;  1YI2 O;  3G6E O;  1YHQ L;  2QEX L;  1VQ6 L;  3G71 L;  3CCS L;  1VQK L;  1YJ9 O;  1N8R M;  3CCR O;  1VQO O;  1K8A M;  1M90 P;  3CCJ O;  1YJW L;  3OW2 N;  1KD1 P;  1VQN O;  3CMA O;  3CCM L;  3CXC N;  1NJI P;  3CCS O;  3CC7 O;  3CCR L;  1VQO L;  1K73 M;  1K9M P;  1Q82 M;  1YJW O;  1VQN L;  3CMA L;  1VQ4 O;  1N8R P;  3CCM O;  1VQ7 O;  1YJN L; 
#chains in the Genus database with same CATH topology
 1K8A P;  3CD6 O;  1M1K P;  3CME L;  1KC8 M;  3CC7 L;  1Q81 M;  1W2B K;  1VQP L;  1YIJ O;  1VQ4 L;  1VQ7 L;  1Q7Y P;  1KQS K;  1YJN O;  1Q86 M;  1Q82 P;  3CD6 L;  3CME O;  1VQM L;  1VQL L;  3CCQ O;  1VQP O;  3CPW K;  1YIJ L;  4XTK A;  1S72 O;  1VQ5 L;  3CCU L;  1JJ2 K;  3I56 O;  1QVF K;  3I55 O;  1VQM O;  4P6I C;  5DS4 A;  1Q86 P;  1QVG K;  1VQL O;  3G4S O;  3CCQ L;  3CCV L;  5DLJ A;  1VQ9 O;  1M90 M;  1S72 L;  1K73 P;  1VQ5 O;  2OTJ L;  3CC4 L;  3CCU O;  3CC2 O;  2QA4 O;  3I56 L;  1NJI M;  3I55 L;  1W2B N;  3G4S L;  3CCV O;  4N06 A;  3CXC K;  1VQ8 O;  1VQ9 L;  5DS5 A;  1KC8 P;  1YIT O;  1Q81 P;  1K9M M;  3CCL O;  3CCE L;  1KQS N;  2OTJ O;  3CC4 O;  3CC2 L;  2OTL O;  2QA4 L;  1M1K M;  1YI2 L;  3G6E L;  3OW2 K;  1YHQ O;  3CPW N;  1VQ8 L;  1YIT L;  2QEX O;  3CCL L;  5DS6 A;  3G71 O;  1VQ6 O;  3CCE O;  1KD1 M;  1VQK O;  1YJ9 L;  1JJ2 N;  5FCL A;  1Q7Y M;  2OTL L;  1QVF N;  3CCJ L;  1QVG N;  1YI2 O;  3G6E O;  1YHQ L;  5DQT A;  2QEX L;  1VQ6 L;  3G71 L;  3CCS L;  1VQK L;  1YJ9 O;  4W8K A;  1N8R M;  3CCR O;  1VQO O;  5DQZ A;  1K8A M;  1M90 P;  3CCJ O;  1YJW L;  3OW2 N;  1KD1 P;  1VQN O;  3CMA O;  3CCM L;  3CXC N;  4QDL A;  2YZS A;  1NJI P;  3CCS O;  3NKD A;  3GOD A;  3CC7 O;  3CCR L;  1VQO L;  1K73 M;  1K9M P;  1Q82 M;  1YJW O;  1VQN L;  3CMA L;  1VQ4 O;  1N8R P;  3CCM O;  4WJ0 A;  1VQ7 O;  1YJN L; 
#chains in the Genus database with same CATH homology
 1K8A P;  3CD6 O;  1M1K P;  3CME L;  1KC8 M;  3CC7 L;  1Q81 M;  1W2B K;  1VQP L;  1YIJ O;  1VQ4 L;  1VQ7 L;  1Q7Y P;  1KQS K;  1YJN O;  1Q86 M;  1Q82 P;  3CD6 L;  3CME O;  1VQM L;  1VQL L;  3CCQ O;  1VQP O;  3CPW K;  1YIJ L;  4XTK A;  1S72 O;  1VQ5 L;  3CCU L;  1JJ2 K;  3I56 O;  1QVF K;  3I55 O;  1VQM O;  4P6I C;  5DS4 A;  1Q86 P;  1QVG K;  1VQL O;  3G4S O;  3CCQ L;  3CCV L;  5DLJ A;  1VQ9 O;  1M90 M;  1S72 L;  1K73 P;  1VQ5 O;  2OTJ L;  3CC4 L;  3CCU O;  3CC2 O;  2QA4 O;  3I56 L;  1NJI M;  3I55 L;  1W2B N;  3G4S L;  3CCV O;  4N06 A;  3CXC K;  1VQ8 O;  1VQ9 L;  5DS5 A;  1KC8 P;  1YIT O;  1Q81 P;  1K9M M;  3CCL O;  3CCE L;  1KQS N;  2OTJ O;  3CC4 O;  3CC2 L;  2OTL O;  2QA4 L;  1M1K M;  1YI2 L;  3G6E L;  3OW2 K;  1YHQ O;  3CPW N;  1VQ8 L;  1YIT L;  2QEX O;  3CCL L;  5DS6 A;  3G71 O;  1VQ6 O;  3CCE O;  1KD1 M;  1VQK O;  1YJ9 L;  1JJ2 N;  5FCL A;  1Q7Y M;  2OTL L;  1QVF N;  3CCJ L;  1QVG N;  1YI2 O;  3G6E O;  1YHQ L;  5DQT A;  2QEX L;  1VQ6 L;  3G71 L;  3CCS L;  1VQK L;  1YJ9 O;  4W8K A;  1N8R M;  3CCR O;  1VQO O;  5DQZ A;  1K8A M;  1M90 P;  3CCJ O;  1YJW L;  3OW2 N;  1KD1 P;  1VQN O;  3CMA O;  3CCM L;  3CXC N;  4QDL A;  2YZS A;  1NJI P;  3CCS O;  3NKD A;  3GOD A;  3CC7 O;  3CCR L;  1VQO L;  1K73 M;  1K9M P;  1Q82 M;  1YJW O;  1VQN L;  3CMA L;  1VQ4 O;  1N8R P;  3CCM O;  4WJ0 A;  1VQ7 O;  1YJN L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...