1YJNP

Crystal structure of clindamycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 49
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2005-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1yjnP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1yjnP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1yjnP02
3CC4P 3CCLP 3CMAP 3CCUP 1YI2P 1QVGO 1Q81Q 3G4SP 1VQ9P 1YITP 1M1KQ 3I56P 3CMEP 1Q82Q 3CXCO 1YIJP 3CCJP 2QA4P 1M90Q 3CC2P 1YHQP 3OW2O 1S72P 3CC7P 3CD6P 3CCMP 3CCQP 1YJWP 3I55P 1JJ2O 1KC8Q 2OTJP 1KD1Q 2OTLP 1KQSO 1VQPP 1NJIQ 1K8AQ 1VQKP 1VQ7P 1Q7YQ 1Q86Q 1QVFO 1VQ6P 1VQ4P 3CPWO 3CCEP 3G6EP 1YJNP 3CCVP 1N8RQ 1K9MQ 1VQMP 3CCSP 1W2BO 1VQOP 1VQ5P 1VQ8P 1YJ9P 1VQNP 3CCRP 3G71P 1VQLP 2QEXP 1K73Q
chains in the Genus database with same CATH superfamily
4RJTA 1MV8A 1BSHA 4YXDC 2E74D 2HODA 3L70G 1HBWA 2IX7C 1YBKA 1ZP0C 4LC1A 4U0EA 5AW0B 2K93A 2JWAA 1LTGC 1SQVG 2BASA 2L5GB 5F2KA 4BPFA 4YPCA 1NU1E 3VMAA 2D2CB 1SFCC 1NTKD 3CX5D 2J5UA 2AVAA 4NPFX 2WPQA 1EDKA 4H13C 2KGDA 3CC4P 1L4AA 2KOSA 3H0DA 5KLVG 5KP7B 2FQ2A 2FADA 3BCCD 3CD6P 4IZ6A 2ZT9D 3WU2E 1QX8A 3AE2C 1DV5A 5APXA 2JYLA 4KHXA 1BE3J 1VQ6P 1OZHA 2PY8A 1T6AA 1RNIA 1M6NA 1SFCD 4XE5B 3CMAP 1H0TB 4WVZA 4W7ZA 1AQ5A 4H13D 1NTKG 4PD4E 2Y0EA 3SWKA 3R4YA 4HKZH 2PENA 1KMIZ 1QLED 1HGVA 1N7SD 2G3AA 1GK6A 1JCDA 5GTHH 1VQ5P 3BCCG 2GA1A 1JMMA 5DJTB 4ZKUA 2KGAA 2LIUA 2JP3A 5M1BA 2M3EA 3D6YA 1D1DA 1M7LA 2QA4P 1Z56A 4LGDE 1KYOE 1RF0A 1VPCA 1FJKA 2E75C 1SQVE 3H1ID 1MFZA 2JR8A 4R4MA 1SQXE 3H1LD 3BRVB 5I4TG 1N86A 2Z45A 1FC2C 1KB9H 2E5YA 2OYOA 5KLVE 3CC7P 5AW5B 2MKVA 2JU2A 1ZLLA 2Z5HA 1EQ7A 2L91A 3RK3B 2E76B 3GG2A 5B5EH 3DTJA 2N6ZA 2J59M 3KZIE 4W7YA 1SQQK 2E75D 2KLUA 1LTJA 2HR3A 3MP7B 1HJ0A 2MR7A 2PEKA 3RGUA 3H1IG 1FOSE 2D2CD 1NTKE 3CX5E 4EDFA 3H1LG 4WY4A 2WZ7A 3CCEP 3CI9A 3NY7B 1L0NJ 2GZIA 1NTZD 2AEFA 1IO4A 4XFZA 3BCCE 3IFMA 4GIFA 1W5CE 2ZVOB 1L0LJ 5H2FH 2W90A 2JBGA 1FZBA 1DH3A 2H7HA 1BGYE 2KSJA 2NO8A 3II6A 3H1JD 3SWFA 3RBXA 4BRYA 3CCUP 2NRGA 5F2NA 3L70J 2BQ1E 1IFDA 3AE8C 1KFNA 3RG2A 2N1TA 1E0HA 1NTZG 2OYIB 2LXBA 5AW4B 2V4HA 3L72D 3TYYA 1RO0A 4OVNF 3FWNA 2HPCB 4EIJA 1CI6B 3D71A 1LNQA 2FFDC 1EDLA 1M1JB 2VRSA 2K0DX 3H1JG 1ZW0A 1H8AA 2XZ1C 3NFQA 4DZOA 1P84I 3H1IE 5APTA 5JPAA 2IYPA 4H44B 3QH9A 1DD4A 1YQ3C 3A0HE 5AVYB 3B71A 5EW5E 3L74D 2GZGA 2W6BA 3BATA 1J1DB 4JYBA 4C46A 2PGDA 3T97B 3L72G 1QRJA 4UB6H 4M0IA 4GOEA 3RK2D 3I5CA 1H89A 1RE4A 1LWUC 5KP8B 4PV1C 2O01N 3L36A 2QJYB 1QL1A 4GKGA 1AVOA 1BSNA 5K5GB 4COCA 2K9YA 2Q9IA 2L22A 2BUOA 3HTKB 1NO4A 3G3ZA 2B87A 1LGHB 1R8EA 3L74G 2SPZA 3AEEC 1NTZE 3M06A 3L4FA 4PV1D 2QJPB 1LTIC 2Q6QA 1ZR2A 4L75A 4PH1A 2KIKA 3RL0B 1PEMA 3HD7C 3H1JE 4N6JA 1IJDB 1RF1B 3TDKA 2FYUD 1EOQA 2Z46A 3M1MA 1SQVK 4N3YB 2J58A 1AA0A 1SQQD 3H1LJ 1NJIQ 3USSA 1SQXK 1GL2C 3L72E 1J1EC 2AFEA 2XKMA 1D7MA 3HUSC 2N50A 1LJ2A 4ASVA 3W68A 3PTZA 2ZXXA 2R32A 2BCCD 3TNUA 2L6EA 5APSA 1U7JA 3M0DC 2PP6A 1DD3A 1LTTC 4XFXA 3OAKA 2Y0DA 1SFCA 5KKZC 4IFMA 2FYUG 1RQVA 2WTYA 3L74E 2K5XA 1GD2E 2GUSA 2PEMA 4I7ZB 1SQQG 1Q81Q 1S1CX 2YKQA 1JOCA 1NTKK 1OXZA 2PEIA 3HRNA 3M9QA 4H0LB 2A06D 4GR2A 2PNGA 2JKVA 1ZMBA 1NGMB 2BCCG 4OGQB 2Z44A 3A7OA 4AQRD 1RE3C 1SQBK 2OQQA 2FXPA 4IFDK 1S5LH 3VMZA 1EMVA 4D6TJ 4DCKA 3V5BA 3KYQA 2B87B 2P67A 3AE1C 4AUWA 1N73B 1SLQA 3H1KJ 2A06G 1PFIA 4O9BA 1EC5A 3CL3D 2VSQA 3GHGB 1X3OA 1EDJA 1VDFA 1Q90D 5KAIE 3DS4A 1X22A 4UB8H 1PP9J 3AE4C 1VQNP 5CCGC 2NPSC 2FYUE 3VTPC 3Q2YA 5HGOA 2KR5A 1YITP 3C1LA 2GZFA 5AVWB 3A0BH 1SQQE 1M6EX 1FZEA 3AEFC 2OTLP 4IFFA 1IMQA 4U3FJ 5AVSB 1OVVA 1GW4A 1RY3A 1YJNP 1KQLA 3L75J 2EG5A 5APWA 3LIEA 1HF9A 1YI2P 3P05A 1X0TA 2BCCE 3BVHA 1P84E 4K3AA 1NYHA 2WSCJ 2I1JA 4UHPB 2IFMA 5KLIB 5GTIE 1L2PA 5BS2A 3VOPA 1VF5B 1GXGA 5CBNA 1BCCJ 2KS1A 4GOFA 2A06E 2H8PD 2GYKA 1Y47A 3WUTA 2JWDA 4DT0A 1PPJE 3SFEC 4OGQD 2I8DA 5EJDA 2E74C 2KOGA 2HYNA 5F2OA 2JU1A 5L8RJ 1S3JA 3NTNA 2VLQA 1SQXD 4F37A 2K3RA 2KI7B 4DOJA 1RO2A 1OW6A 2R3CA 4Z1MH 3U59A 2EHSA 2KORA 5B66H 1Y8AA 2AXTH 2A45G 2L4BA 1IK9A 1N8RQ 2GDWA 2I1KA 3CWBD 2Q3IA 3H32A 1VQLP 1T3UA 1SQPJ 2WSFJ 1AFOA 2IPPA 2ZT9C 4H2XC 1JB0J 4BPHA 2JO1A 2FFDA 2R5BA 3B5NB 2Q7CA 4H2YC 1EZVI 3KPEA 1SQXG 1URQB 1JCCA 2WT7A 3M9BA 1JO5A 3R2PA 4NPDA 2OYHC 2UWJE 2HG5D 2MJZA 3OW2O 1S72P 2WPTA 1N7SC 1ZXGA 2IFNA 3CWBG 3GF7A 2MF4A 1SQBD 3O8ZA 2BEQD 1RHZB 4HKGA 1LWUA 3M9HA 3A2AA 4IL6H 2KZIA 1Y9BA 1BGYD 1PEUA 3VYIA 3ABVC 5KAFE 4WYMA 1NOHA 3G28A 2N5IA 1LP1A 3JC22 2R44A 1QEXA 2K2QA 3QWOC 2B88A 3UIAA 1T8KA 3CLQA 1NAYA 1JTHB 4GDOA 1EDIA 1VF5D 2WPRA 1M57D 4WBAA 2N6YA 3DS0A 4PWVB 1SQBG 3VP9A 5AW9B 2IYOA 3KDPB 3LIDA 4C7NB 4QKOA 3I55P 1X79B 2KNCA 2KS1B 1EXJA 1BGYG 3PRJA 5APVA 1HVVA 4PH0A 3HD7A 1FDIA 2E43A 4PJ0H 2R5DA 3DS1A 1KILB 1FZCB 2IBZI 2D2CC 5E79E 2MR8A 3CCJP 1NU1J 1KB9I 1CSBA 2M5AA 2WSSH 4TLFA 2G8YA 1K8AQ 1FJPA 3B8EB 2FYUK 3CWBE 2L0QA 1GL2A 1LT9B 3TGUD 3CCSP 4WB4A 3HUSA 2CWOA 3H32B 3CXHH 4DJGA 1GK4A 3B5ND 3DS2A 5AW3B 3DS5A 2HODB 1BXIA 5HGLA 3M0DA 3PP5A 4WWIA 1URQD 5DCKA 4IL6X 5CJ0A 3EFFK 2JQ4A 2YO3A 5KJ7C 2IZ1A 2WSCH 2LL8A 1OW8A 3FXDA 1L4AB 1EXIA 1N7LA 1JUNA 3TGUG 5TISH 1SQBE 2JEEA 3S4RA 2FYNB 3IAOA 2K9JA 1NTMJ 3HE4A 4A7PA 1VQMP 1FE6A 1HWTC 2PAJA 1MUUA 3VN0A 4U0CA 4CPGA 1GXHA 1NKNA 3L73D 1KV4A 1RE3A 5KJ7D 4U0DA 3MUDC 2YXRB 1FZGA 1SQVJ 1FAVA 1VQKP 2XV6A 4M3LA 2OTKE 1BDDA 3WUVA 1SQXJ 3L35A 5TJHA 3AEGC 2QEXP 1WT6A 5KLVJ 2YO2A 4JQ0D 3RK3C 2YMYA 3TSIA 2E76C 2GZEA 2WSFH 3RK2C 1X9VA 3L71D 1OFCX 3P7KA 2ZAEB 2XNDH 2KP8A 4BPGA 3L73G 4B86A 1XTCC 2E1MA 3F89A 2Q5UA 1FDMA 2QRXA 3P8CD 1KILD 2N5HA 5CCGA 3HD7B 2NPSA 3GKLC 3AECC 3LRYA 4JF7A 2Q3EA 2N98A 1NTKJ 2JGPA 2JB0A 1KB9D 3RK3D 4JYCA 1DEEG 2E76D 2M5AB 4RESB 1FU1A 3TGUE 3GF3A 2LXCB 1DEBA 2KOOA 4I1LA 3BCCJ 3E1RA 1GMJA 3W67A 3L71G 2KLVA 3Q5PA 3MGEA 2YIUB 3JCUH 1LTJB 2C0XA 1G2CA 1BGYJ 4R4LA 2AF8A 1Q86Q 1JEKA 2XDJA 1M74A 2V7QJ 3H1HD 4L74A 3Q5SA 2H43A 4WY4B 2QJKB 3V2PA 4AYCA 1BAJA 1IFMA 2OYIC 3GZLA 3CE7A 3O6QA 3TF5A 2H88C 2K9JB 3L73E 1KZUB 1CW5A 1IMPA 1Q2NA 1AV1A 3V4WA 3FGAD 1UIIA 2WSEJ 2WMMA 1ZNVA 4BRYB 1JY2N 4Y99C 3H1HG 4H44C 3H1IJ 2X2BA 2K92A 4EI2A 1VQ7P 1FZFA 4U0AA 2N1TB 1J1DC 5GTHE 2POHA 4XFJA 1YTZT 3AE7C 2KUBA 2QE7H 1WMKA 2ZYDA 3L71E 3M0AA 1AUMA 3WU2H 1JY2O 2QJYC 2MD9A 2HFED 3IN6A 2QG4A 3P8CE 4H44D 1KILE 1P84D 3A5TA 3AE5C 1CZQA 3NXSA 3CCRP 3Q20A 2LMLA 1KB9E 2BEZF 2KG9A 4HH2A 4DG9A 2OYHA 1OX3A 1HH0A 2EHTA 4NEOA 3RK3E 5DJUB 4PD4I 1PL5A 4U0BA 2VLPA 1N7SA 4PD4H 1NTZJ 1VQPP 2ZFCA 5B5EE 2NZ2A 5HGMA 3G9RA 2PFXA 2QJPC 1PPJD 2A45H 3G26A 2FAEA 2GUVA 1BE3D 5EFWB 1OVUA 3I56P 3BASA 4XROA 1DNYA 2KGCA 3H1JJ 1KYOH 2P7JA 4HYTB 3H1HE 1RF1C 2Y9ZA 4COPA 1G2CB 2KSEA 2QM8A 5CBOA 2JAZA 4WY4D 1W2BO 1A02F 1ZV8A 2RH0A 4W80A 4HJGH 1NVOA 1UJZA 4KT0J 1TU3F 3L72J 2FQ1A 1PPJG 5H2FE 3RL0D 1BE3G 3KZIH 3AE6C 5CHXA 2E74B 4QNBA 1XTGB 2W6JH 2B9BA 2JJLA 2CPSA 1KQSO 3CX5I 2N1TD 3CX5H 3L74J 4I7ZC 2LF4A 3CPWO 3Q1MA 5BS1A 2QSIA 2RMZA 5CCHC 2K0XA 4R0MA 2PEQA 5KTBA 2CNRA 1VQ9P 1GZLA 3CMEP 4GT1A 3G0VA 3EJEA 1LTSC 3EJDA 2ZT9B 3DS3A 1JMBA 4OGQC 2O3JA 3TNUB 2LR2A 1SP4A 2DNWA 2QM7A 2AEJA 1JM0A 1H0TA 2K94A 1PGQA 1A43A 3GZMA 4KJMA 1GU5A 1SFCB 5KJ7A 2V7QH 3P32A 2LKIA 1L0ND 5CCHD 1ZN5A 1GW3A 4H13B 1F80D 1S5LX 1JY2P 4H0LD 2HLOA 2CPBA 4UB6E 2DW3A 1N73C 1QVFO 2M8LA 2WPVB 3GW6A 5CMZA 5AVUB 1MZ9A 1BE3E 2P2UA 3OJAB 1R5SA 1L0LD 3GHGC 1WRGA 4I6MC 2O1KA 2P58A 2XXMA 1GTWA 1YYCA 5HV8A 2WSEH 3MUDA 2L9FA 2N9YB 3HE5A 5AVTB 2E5TA 3G6EP 2W27A 2FYUJ 1L0NG 2ZYGA 1FZAA 2PRRA 3A0HH 3GJNA 2KOPA 2K1AA 3RL0g 1SQQJ 2C9NY 2FVAA 1U7MA 2KYVA 1FOSF 4N78D 1L0LG 2P10A 2WITA 3GLMA 2M3BA 3PJSK 2M0BA 2Q1KA 1T3JA 4XFYA 1VQOP 2XU6A 2BCCJ 5KP6B 3V2RA 2FHSC 3KHUA 2E75B 5AVZB 2ZXEB 3DPHA 3AE3C 3V2QA 1VKUA 1OW7A 4K35A 3FWLA 1E6JP 2GM4A 1JY3N 1T2KD 5KLIC 3PLNA 4H2WC 1VF5C 1IUQA 1YJ9P 2LIWA 4CA3A 3C9IA 2GZJA 1AVYA 3H47A 3B5IA 5AW6B 2K37A 3L37A 2CQ8A 3JSVC 3LW5J 2KG6A 1IFJA 3EFGA 2GDXA 1AJYA 1USEA 3OA7A 1JY3O 2M5RA 3KXDA 4MRTC 1N2DC 1S9KE 2JO0A 2FXOA 3S1KA 3Q3DA 1L0NE 3AEBC 3G4SP 2M8PA 2OYIA 1ACPA 3IR9A 3A3YB 3MHVA 1KD1Q 3MD0A 4XA4A 2HPCA 2KOQA 1A02J 3CCVP 1L0LE 1NTME 1CI6A 3B5NC 1M1JA 4XRQA 2C0WA 1S5LE 3L70E 1URQC 3PHLA 3FXEA 1YTZI 4L76A 3SSUA 3HE5B 1KQFB 2YNYA 1RH5B 2Y9YA 2ONTA 2K0YA 1T8ZA 3T97A 3KQGA 3CXHI 3RBZA 2Z4EA 4N78E 2BHVA 1NQ4A 4ASWA 1IZNB 3MGNA 1PIXA 3MIWA 3B4SA 1HQBA 4UB8E 2FFDB 3RK2B 1EZVD 5AW2B 3K5BA 2WWWA 1SQPK 2CG5B 1AQTA 1K73Q 3HTKA 3MZWB 2YKOA 2WT7B 3A0BE 1YJWP 3CCQP 2FYZA 1PZQA 1HTLC 2ZVNB 1NWQA 1A8OA 2KXPB 5BU5A 4PXHB 3PH0A 3E2DA 1UIXA 1G1JA 1LWUB 4PV1B 1K04A 3B4QA 1LT1A 3CC2P 1EZVG 1NH4A 3CCMP 4U0FA 1H88A 2ITAA 1LP1B 1GU4A 3WBHA 2AEMA 2KB7P 1KILC 5KAIH 1BDCA 1FZCC 1RF1A 2KWLA 4D6TD 2XZ0D 1QVGO 2FKWB 4ZNCA 1AF8A 4OH8B 3E7KA 1LT9C 3CWBJ 1S2EA 1VL2A 3H1KD 1JY3P 3VMXA 2RN0A 1PEOA 2KNCB 1KQGB 1ZOYC 3TK1A 2OTJP 1PP9D 3LMOA 2W6AA 3ITKA 2IBZD 3CXCO 4ZKPA 1QGKB 3FX0A 3G1IA 4D6TG 2YXQB 5B66E 2AXTE 1P84H 4Y99B 2R3SA 5AW1B 1Z6MA 2PEOA 3H1LE 1PGJA 4U3FD 3G1GA 1L4AC 5CCHA 3HYBA 2M8NA 5GTIH 1GL2B 1E5WA 2MVUA 1J1EB 4ZMDA 2FYNC 5AW8B 4RO0A 3H1KG 1EIAA 5BU8B 2O01J 1NU1K 3L75D 1SQBJ 4NPEA 1CEIA 3CXHD 4Y28J 3HUSB 1ZMEC 4LLHA 5AVRB 2MY5A 1MKMA 3RG6C 2FQ0A 1EZVE 3VP8A 2M8RA 4C7RA 1OIPA 3LW5H 1PP9G 2IBZG 4TT3H 3EWKA 4MN4C 1SVFA 5KKZB 1UNKA 1LTBC 1M1KQ 2O1JA 1L4AD 2FBWC 2XZRA 3VMYA 3SFDC 4U3FG 2JYGA 1HUCA 1N73A 1SS1A 2AFDA 1BCCD 3AEDC 1IC2A 1L0NK 4IL6E 4JPZB 3L75G 1OMIA 1ZRTD 1L0IA 3HE4B 1RQUA 1M1JC 3GHGA 5HGNA 5CJ4A 2LKMA 3MTUE 2OGUA 2QNWA 1JJ2O 1RF0C 4YTPC 3WUUA 1L0LK 3V4QA 1NTMK 5APUA 4D6TE 1K9MQ 1FBMA 4IOIH 3F5HA 1YQ4C 1VHNA 3S9OA 1E79H 3G29A 1NAFA 1IK7A 4YXWH 1BCCG 2XT1A 1FR2A 1SQPD 4U7JA 1HY8A 2XNXA 3H1KE 3TGUJ 3H6PA 3U1AA 1IFIA 1IFNA 2FVFA 1PEQA 1S4XA 2GDYA 4HB1A 3EQ2A 4PJ0E 2YIUC 1LTJC 2IDBA 3IF4A 5HVCA 3HD7D 5KLVK 4GR6A 1PP9E 2ERHA 5KAFH 2IBZE 1YIJP 5AVVB 1G1IA 4I2LC 2W83C 2NPSB 2CGQA 1MFTA 4WY4C 2K88A 2QJKC 1U57A 1QL2A 3WMM0 1USDA 2C9LY 1R5LA 4U3FE 3D70A 2Z5IA 1DIPA 2EFJA 4EYYQ 1GL2D 1SQPG 2A45I 2LPKA 1X8YA 3D6ZA 3L75E 3U1CA 3CXHE 1KFMA 5AVXB 1LTAC 3RL0C 2AXCA 3M91A 5C39A 1KYOI 3P8MC 3L73J 1HGZA 1IFPA 2P9XA 2H89C 1VQ8P 3V6IA 2FY8A 3N7NA 3AEAC 7CEIA 2YMKA 4GODA 2KW2A 2RKLA 5E79H 2N1TC 3H4EA 5TISE 2QIWA 1BCCE 5APYA 1AYIA 3NMDA 2OARA 2DGYA 3HZQA 3O6QB 1ZRTE 1PGOA 3H25A 2VLOA 3B5NA 1L0HA 3L71J 1M90Q 2WQYC 2CK3H 2E42A 1URQA 3EJBA 3U43A 1KLPA 3Q5RA 2EIAA 2QVAA 1NU1D 1VQ4P 4QMAA 1GPJA 3E1IA 4BWNA 2P1JA 4H0LC 1K05A 3N4XA 4L73A 1SQPE 3C8VA 2FXMA 2O01H 1RE4C 1KTMA 1JNMA 5AW7B 1KORA 1W2EA 2MVVA 1M8OB 1HJBA 1KN7A 2LOLA 2YKPA 2FACA 2Y0CA 1S9KD 5CCGD 1K30A 1FS0E 1NKZB 1Q82Q 2WVRA 1NU1G 2NPSD 1YHQP 1ZR4A 1GDTA 3H1HJ 5BVZA 4RKUJ 1PGPA 1PV3A 2FVEA 1NHLA 4PD4D 1JTHA 2OYHB 2JDIH 5APQA 1J2JB 4BXLA 3G21A 5CZDB 1N7SB 3NTEA 2ROQA 2KGEA 2KZJA 2ZJSE 1NTMD 5AVQB 4JBZA 4C7NA 3VRLC 3AE9C 3JCUE 2IZ0A 1M56D 2ZYAA 1NTZK 3GMAA 3L70D 2VLNA 2PEJA 1Q7YQ 1KYOD 1DX7A 1KILA 2KG8A 1FZCA 2B89A 1SQVD 2W8ZA 2WPSA 1FDOA 3G71P 1MZ8A 4OWFA 3CCLP 1OR5A 2XV5A 3V2NA 2KK7A 4IPYA 1T2KC 3SWYA 2LTEA 1KC8Q 5KLVD 2KODA 1LT9A 1OVRA 1NTMG 2N9BA 1OWAA 3ZDMA 3BRTB 4EOTA
chains in the Genus database with same CATH topology
5F2OA 4GR6A 3HYBA 2M8NA 5I4TG 1BAJA 3H47A 3B5IA 1EIAA 3I56P 1EOQA 3DS0A 4XROA 2Z46A 2Z45A 1YIJP 4U0EA 3M1MA 4U0DA 1RO2A 3CC7P 1YJWP 3CCQP 3I55P 3RG6C 5F2KA 1NJIQ 1VQKP 3DS4A 2XV6A 1QVFO 1A8OA 4COPA 5JPAA 2M8LA 3DTJA 1N8RQ 4PH0A 1W2BO 2EFJA 1VQNP 1VQLP 2JO0A 3DS1A 2QEXP 3E2DA 3CC4P 3H0DA 5HGOA 3G4SP 2M8PA 1YITP 1K30A 1M1KQ 1Q82Q 3CCJP 2XXMA 3CC2P 1YHQP 2L6EA 1M6EX 2PEKA 3CD6P 3CCMP 4U0FA 1QRJA 1KD1Q 2OTLP 4M0IA 2JYGA 3WBHA 2JYLA 1K8AQ 1VQ7P 4XFXA 1VQ6P 2PY8A 4U0AA 2E1MA 3CCEP 3G6EP 1YJNP 3CCVP 3G21A 1RNIA 3CCSP 3NTEA 2P9XA 1M6NA 2EG5A 1VQ8P 2CWOA 2PEMA 3CMAP 1YI2P 1QVGO 1Q81Q 3P05A 4XFZA 5HGNA 3VRLC 4XRQA 4COCA 4QNBA 3LRYA 3OW2O 3H4EA 1S72P 2BUOA 3DS2A 2PEIA 1AUMA 1JJ2O 3DS5A 5HGLA 1KQSO 2PENA 4GR2A 2PEJA 1Q7YQ 2LF4A 3CPWO 5BS1A 1K9MQ 5DCKA 1PEOA 2OARA 1ZMBA 2DGYA 3HZQA 4XFYA 1VQ5P 1VQOP 3CCRP 3G71P 2OTJP 2Z44A 2ONTA 2PEQA 3CCLP 1PEUA 3Q20A 3CCUP 5BS2A 3DPHA 5F2NA 3G29A 1VQ9P 4IPYA 4WYMA 2BQ1E 3G28A 3CMEP 3MGEA 1D1DA 2XT1A 3CXCO 1M90Q 3G0VA 2QA4P 2BHVA 3G1IA 1E6JP 1KC8Q 2KODA 4U0BA 3DS3A 4PH1A 1VQPP 2EIAA 1Q86Q 1PEMA 1VQ4P 1PEQA 5HGMA 1M74A 1VQMP 2PEOA 1IUQA 1A43A 1YJ9P 3G1GA 1RO0A 4U0CA 3G26A 1K73Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC4 P;  3CCL P;  3CMA P;  3CCU P;  1YI2 P;  1QVG O;  1Q81 Q;  3G4S P;  1VQ9 P;  1YIT P;  1M1K Q;  3I56 P;  3CME P;  1Q82 Q;  3CXC O;  1YIJ P;  3CCJ P;  2QA4 P;  1M90 Q;  3CC2 P;  1YHQ P;  3OW2 O;  1S72 P;  3CC7 P;  3CD6 P;  3CCM P;  3CCQ P;  1YJW P;  3I55 P;  1JJ2 O;  1KC8 Q;  2OTJ P;  1KD1 Q;  2OTL P;  1KQS O;  1VQP P;  1NJI Q;  1K8A Q;  1VQK P;  1VQ7 P;  1Q7Y Q;  1Q86 Q;  1QVF O;  1VQ6 P;  1VQ4 P;  3CPW O;  3CCE P;  3G6E P;  1YJN P;  3CCV P;  1N8R Q;  1K9M Q;  1VQM P;  3CCS P;  1W2B O;  1VQO P;  1VQ5 P;  1VQ8 P;  1YJ9 P;  1VQN P;  3CCR P;  3G71 P;  1VQL P;  2QEX P;  1K73 Q; 
#chains in the Genus database with same CATH topology
 4RJT A;  1MV8 A;  1BSH A;  4YXD C;  2E74 D;  2HOD A;  3L70 G;  1HBW A;  2IX7 C;  1YBK A;  1ZP0 C;  4LC1 A;  4U0E A;  5AW0 B;  2K93 A;  2JWA A;  1LTG C;  1SQV G;  2BAS A;  2L5G B;  5F2K A;  4BPF A;  4YPC A;  1NU1 E;  3VMA A;  2D2C B;  1SFC C;  1NTK D;  3CX5 D;  2J5U A;  2AVA A;  4NPF X;  2WPQ A;  1EDK A;  4H13 C;  2KGD A;  3CC4 P;  1L4A A;  2KOS A;  3H0D A;  5KLV G;  5KP7 B;  2FQ2 A;  2FAD A;  3BCC D;  3CD6 P;  4IZ6 A;  2ZT9 D;  3WU2 E;  1QX8 A;  3AE2 C;  1DV5 A;  5APX A;  2JYL A;  4KHX A;  1BE3 J;  1VQ6 P;  1OZH A;  2PY8 A;  1T6A A;  1RNI A;  1M6N A;  1SFC D;  4XE5 B;  3CMA P;  1H0T B;  4WVZ A;  4W7Z A;  1AQ5 A;  4H13 D;  1NTK G;  4PD4 E;  2Y0E A;  3SWK A;  3R4Y A;  4HKZ H;  2PEN A;  1KMI Z;  1QLE D;  1HGV A;  1N7S D;  2G3A A;  1GK6 A;  1JCD A;  5GTH H;  1VQ5 P;  3BCC G;  2GA1 A;  1JMM A;  5DJT B;  4ZKU A;  2KGA A;  2LIU A;  2JP3 A;  5M1B A;  2M3E A;  3D6Y A;  1D1D A;  1M7L A;  2QA4 P;  1Z56 A;  4LGD E;  1KYO E;  1RF0 A;  1VPC A;  1FJK A;  2E75 C;  1SQV E;  3H1I D;  1MFZ A;  2JR8 A;  4R4M A;  1SQX E;  3H1L D;  3BRV B;  5I4T G;  1N86 A;  2Z45 A;  1FC2 C;  1KB9 H;  2E5Y A;  2OYO A;  5KLV E;  3CC7 P;  5AW5 B;  2MKV A;  2JU2 A;  1ZLL A;  2Z5H A;  1EQ7 A;  2L91 A;  3RK3 B;  2E76 B;  3GG2 A;  5B5E H;  3DTJ A;  2N6Z A;  2J59 M;  3KZI E;  4W7Y A;  1SQQ K;  2E75 D;  2KLU A;  1LTJ A;  2HR3 A;  3MP7 B;  1HJ0 A;  2MR7 A;  2PEK A;  3RGU A;  3H1I G;  1FOS E;  2D2C D;  1NTK E;  3CX5 E;  4EDF A;  3H1L G;  4WY4 A;  2WZ7 A;  3CCE P;  3CI9 A;  3NY7 B;  1L0N J;  2GZI A;  1NTZ D;  2AEF A;  1IO4 A;  4XFZ A;  3BCC E;  3IFM A;  4GIF A;  1W5C E;  2ZVO B;  1L0L J;  5H2F H;  2W90 A;  2JBG A;  1FZB A;  1DH3 A;  2H7H A;  1BGY E;  2KSJ A;  2NO8 A;  3II6 A;  3H1J D;  3SWF A;  3RBX A;  4BRY A;  3CCU P;  2NRG A;  5F2N A;  3L70 J;  2BQ1 E;  1IFD A;  3AE8 C;  1KFN A;  3RG2 A;  2N1T A;  1E0H A;  1NTZ G;  2OYI B;  2LXB A;  5AW4 B;  2V4H A;  3L72 D;  3TYY A;  1RO0 A;  4OVN F;  3FWN A;  2HPC B;  4EIJ A;  1CI6 B;  3D71 A;  1LNQ A;  2FFD C;  1EDL A;  1M1J B;  2VRS A;  2K0D X;  3H1J G;  1ZW0 A;  1H8A A;  2XZ1 C;  3NFQ A;  4DZO A;  1P84 I;  3H1I E;  5APT A;  5JPA A;  2IYP A;  4H44 B;  3QH9 A;  1DD4 A;  1YQ3 C;  3A0H E;  5AVY B;  3B71 A;  5EW5 E;  3L74 D;  2GZG A;  2W6B A;  3BAT A;  1J1D B;  4JYB A;  4C46 A;  2PGD A;  3T97 B;  3L72 G;  1QRJ A;  4UB6 H;  4M0I A;  4GOE A;  3RK2 D;  3I5C A;  1H89 A;  1RE4 A;  1LWU C;  5KP8 B;  4PV1 C;  2O01 N;  3L36 A;  2QJY B;  1QL1 A;  4GKG A;  1AVO A;  1BSN A;  5K5G B;  4COC A;  2K9Y A;  2Q9I A;  2L22 A;  2BUO A;  3HTK B;  1NO4 A;  3G3Z A;  2B87 A;  1LGH B;  1R8E A;  3L74 G;  2SPZ A;  3AEE C;  1NTZ E;  3M06 A;  3L4F A;  4PV1 D;  2QJP B;  1LTI C;  2Q6Q A;  1ZR2 A;  4L75 A;  4PH1 A;  2KIK A;  3RL0 B;  1PEM A;  3HD7 C;  3H1J E;  4N6J A;  1IJD B;  1RF1 B;  3TDK A;  2FYU D;  1EOQ A;  2Z46 A;  3M1M A;  1SQV K;  4N3Y B;  2J58 A;  1AA0 A;  1SQQ D;  3H1L J;  1NJI Q;  3USS A;  1SQX K;  1GL2 C;  3L72 E;  1J1E C;  2AFE A;  2XKM A;  1D7M A;  3HUS C;  2N50 A;  1LJ2 A;  4ASV A;  3W68 A;  3PTZ A;  2ZXX A;  2R32 A;  2BCC D;  3TNU A;  2L6E A;  5APS A;  1U7J A;  3M0D C;  2PP6 A;  1DD3 A;  1LTT C;  4XFX A;  3OAK A;  2Y0D A;  1SFC A;  5KKZ C;  4IFM A;  2FYU G;  1RQV A;  2WTY A;  3L74 E;  2K5X A;  1GD2 E;  2GUS A;  2PEM A;  4I7Z B;  1SQQ G;  1Q81 Q;  1S1C X;  2YKQ A;  1JOC A;  1NTK K;  1OXZ A;  2PEI A;  3HRN A;  3M9Q A;  4H0L B;  2A06 D;  4GR2 A;  2PNG A;  2JKV A;  1ZMB A;  1NGM B;  2BCC G;  4OGQ B;  2Z44 A;  3A7O A;  4AQR D;  1RE3 C;  1SQB K;  2OQQ A;  2FXP A;  4IFD K;  1S5L H;  3VMZ A;  1EMV A;  4D6T J;  4DCK A;  3V5B A;  3KYQ A;  2B87 B;  2P67 A;  3AE1 C;  4AUW A;  1N73 B;  1SLQ A;  3H1K J;  2A06 G;  1PFI A;  4O9B A;  1EC5 A;  3CL3 D;  2VSQ A;  3GHG B;  1X3O A;  1EDJ A;  1VDF A;  1Q90 D;  5KAI E;  3DS4 A;  1X22 A;  4UB8 H;  1PP9 J;  3AE4 C;  1VQN P;  5CCG C;  2NPS C;  2FYU E;  3VTP C;  3Q2Y A;  5HGO A;  2KR5 A;  1YIT P;  3C1L A;  2GZF A;  5AVW B;  3A0B H;  1SQQ E;  1M6E X;  1FZE A;  3AEF C;  2OTL P;  4IFF A;  1IMQ A;  4U3F J;  5AVS B;  1OVV A;  1GW4 A;  1RY3 A;  1YJN P;  1KQL A;  3L75 J;  2EG5 A;  5APW A;  3LIE A;  1HF9 A;  1YI2 P;  3P05 A;  1X0T A;  2BCC E;  3BVH A;  1P84 E;  4K3A A;  1NYH A;  2WSC J;  2I1J A;  4UHP B;  2IFM A;  5KLI B;  5GTI E;  1L2P A;  5BS2 A;  3VOP A;  1VF5 B;  1GXG A;  5CBN A;  1BCC J;  2KS1 A;  4GOF A;  2A06 E;  2H8P D;  2GYK A;  1Y47 A;  3WUT A;  2JWD A;  4DT0 A;  1PPJ E;  3SFE C;  4OGQ D;  2I8D A;  5EJD A;  2E74 C;  2KOG A;  2HYN A;  5F2O A;  2JU1 A;  5L8R J;  1S3J A;  3NTN A;  2VLQ A;  1SQX D;  4F37 A;  2K3R A;  2KI7 B;  4DOJ A;  1RO2 A;  1OW6 A;  2R3C A;  4Z1M H;  3U59 A;  2EHS A;  2KOR A;  5B66 H;  1Y8A A;  2AXT H;  2A45 G;  2L4B A;  1IK9 A;  1N8R Q;  2GDW A;  2I1K A;  3CWB D;  2Q3I A;  3H32 A;  1VQL P;  1T3U A;  1SQP J;  2WSF J;  1AFO A;  2IPP A;  2ZT9 C;  4H2X C;  1JB0 J;  4BPH A;  2JO1 A;  2FFD A;  2R5B A;  3B5N B;  2Q7C A;  4H2Y C;  1EZV I;  3KPE A;  1SQX G;  1URQ B;  1JCC A;  2WT7 A;  3M9B A;  1JO5 A;  3R2P A;  4NPD A;  2OYH C;  2UWJ E;  2HG5 D;  2MJZ A;  3OW2 O;  1S72 P;  2WPT A;  1N7S C;  1ZXG A;  2IFN A;  3CWB G;  3GF7 A;  2MF4 A;  1SQB D;  3O8Z A;  2BEQ D;  1RHZ B;  4HKG A;  1LWU A;  3M9H A;  3A2A A;  4IL6 H;  2KZI A;  1Y9B A;  1BGY D;  1PEU A;  3VYI A;  3ABV C;  5KAF E;  4WYM A;  1NOH A;  3G28 A;  2N5I A;  1LP1 A;  3JC2 2;  2R44 A;  1QEX A;  2K2Q A;  3QWO C;  2B88 A;  3UIA A;  1T8K A;  3CLQ A;  1NAY A;  1JTH B;  4GDO A;  1EDI A;  1VF5 D;  2WPR A;  1M57 D;  4WBA A;  2N6Y A;  3DS0 A;  4PWV B;  1SQB G;  3VP9 A;  5AW9 B;  2IYO A;  3KDP B;  3LID A;  4C7N B;  4QKO A;  3I55 P;  1X79 B;  2KNC A;  2KS1 B;  1EXJ A;  1BGY G;  3PRJ A;  5APV A;  1HVV A;  4PH0 A;  3HD7 A;  1FDI A;  2E43 A;  4PJ0 H;  2R5D A;  3DS1 A;  1KIL B;  1FZC B;  2IBZ I;  2D2C C;  5E79 E;  2MR8 A;  3CCJ P;  1NU1 J;  1KB9 I;  1CSB A;  2M5A A;  2WSS H;  4TLF A;  2G8Y A;  1K8A Q;  1FJP A;  3B8E B;  2FYU K;  3CWB E;  2L0Q A;  1GL2 A;  1LT9 B;  3TGU D;  3CCS P;  4WB4 A;  3HUS A;  2CWO A;  3H32 B;  3CXH H;  4DJG A;  1GK4 A;  3B5N D;  3DS2 A;  5AW3 B;  3DS5 A;  2HOD B;  1BXI A;  5HGL A;  3M0D A;  3PP5 A;  4WWI A;  1URQ D;  5DCK A;  4IL6 X;  5CJ0 A;  3EFF K;  2JQ4 A;  2YO3 A;  5KJ7 C;  2IZ1 A;  2WSC H;  2LL8 A;  1OW8 A;  3FXD A;  1L4A B;  1EXI A;  1N7L A;  1JUN A;  3TGU G;  5TIS H;  1SQB E;  2JEE A;  3S4R A;  2FYN B;  3IAO A;  2K9J A;  1NTM J;  3HE4 A;  4A7P A;  1VQM P;  1FE6 A;  1HWT C;  2PAJ A;  1MUU A;  3VN0 A;  4U0C A;  4CPG A;  1GXH A;  1NKN A;  3L73 D;  1KV4 A;  1RE3 A;  5KJ7 D;  4U0D A;  3MUD C;  2YXR B;  1FZG A;  1SQV J;  1FAV A;  1VQK P;  2XV6 A;  4M3L A;  2OTK E;  1BDD A;  3WUV A;  1SQX J;  3L35 A;  5TJH A;  3AEG C;  2QEX P;  1WT6 A;  5KLV J;  2YO2 A;  4JQ0 D;  3RK3 C;  2YMY A;  3TSI A;  2E76 C;  2GZE A;  2WSF H;  3RK2 C;  1X9V A;  3L71 D;  1OFC X;  3P7K A;  2ZAE B;  2XND H;  2KP8 A;  4BPG A;  3L73 G;  4B86 A;  1XTC C;  2E1M A;  3F89 A;  2Q5U A;  1FDM A;  2QRX A;  3P8C D;  1KIL D;  2N5H A;  5CCG A;  3HD7 B;  2NPS A;  3GKL C;  3AEC C;  3LRY A;  4JF7 A;  2Q3E A;  2N98 A;  1NTK J;  2JGP A;  2JB0 A;  1KB9 D;  3RK3 D;  4JYC A;  1DEE G;  2E76 D;  2M5A B;  4RES B;  1FU1 A;  3TGU E;  3GF3 A;  2LXC B;  1DEB A;  2KOO A;  4I1L A;  3BCC J;  3E1R A;  1GMJ A;  3W67 A;  3L71 G;  2KLV A;  3Q5P A;  3MGE A;  2YIU B;  3JCU H;  1LTJ B;  2C0X A;  1G2C A;  1BGY J;  4R4L A;  2AF8 A;  1Q86 Q;  1JEK A;  2XDJ A;  1M74 A;  2V7Q J;  3H1H D;  4L74 A;  3Q5S A;  2H43 A;  4WY4 B;  2QJK B;  3V2P A;  4AYC A;  1BAJ A;  1IFM A;  2OYI C;  3GZL A;  3CE7 A;  3O6Q A;  3TF5 A;  2H88 C;  2K9J B;  3L73 E;  1KZU B;  1CW5 A;  1IMP A;  1Q2N A;  1AV1 A;  3V4W A;  3FGA D;  1UII A;  2WSE J;  2WMM A;  1ZNV A;  4BRY B;  1JY2 N;  4Y99 C;  3H1H G;  4H44 C;  3H1I J;  2X2B A;  2K92 A;  4EI2 A;  1VQ7 P;  1FZF A;  4U0A A;  2N1T B;  1J1D C;  5GTH E;  2POH A;  4XFJ A;  1YTZ T;  3AE7 C;  2KUB A;  2QE7 H;  1WMK A;  2ZYD A;  3L71 E;  3M0A A;  1AUM A;  3WU2 H;  1JY2 O;  2QJY C;  2MD9 A;  2HFE D;  3IN6 A;  2QG4 A;  3P8C E;  4H44 D;  1KIL E;  1P84 D;  3A5T A;  3AE5 C;  1CZQ A;  3NXS A;  3CCR P;  3Q20 A;  2LML A;  1KB9 E;  2BEZ F;  2KG9 A;  4HH2 A;  4DG9 A;  2OYH A;  1OX3 A;  1HH0 A;  2EHT A;  4NEO A;  3RK3 E;  5DJU B;  4PD4 I;  1PL5 A;  4U0B A;  2VLP A;  1N7S A;  4PD4 H;  1NTZ J;  1VQP P;  2ZFC A;  5B5E E;  2NZ2 A;  5HGM A;  3G9R A;  2PFX A;  2QJP C;  1PPJ D;  2A45 H;  3G26 A;  2FAE A;  2GUV A;  1BE3 D;  5EFW B;  1OVU A;  3I56 P;  3BAS A;  4XRO A;  1DNY A;  2KGC A;  3H1J J;  1KYO H;  2P7J A;  4HYT B;  3H1H E;  1RF1 C;  2Y9Z A;  4COP A;  1G2C B;  2KSE A;  2QM8 A;  5CBO A;  2JAZ A;  4WY4 D;  1W2B O;  1A02 F;  1ZV8 A;  2RH0 A;  4W80 A;  4HJG H;  1NVO A;  1UJZ A;  4KT0 J;  1TU3 F;  3L72 J;  2FQ1 A;  1PPJ G;  5H2F E;  3RL0 D;  1BE3 G;  3KZI H;  3AE6 C;  5CHX A;  2E74 B;  4QNB A;  1XTG B;  2W6J H;  2B9B A;  2JJL A;  2CPS A;  1KQS O;  3CX5 I;  2N1T D;  3CX5 H;  3L74 J;  4I7Z C;  2LF4 A;  3CPW O;  3Q1M A;  5BS1 A;  2QSI A;  2RMZ A;  5CCH C;  2K0X A;  4R0M A;  2PEQ A;  5KTB A;  2CNR A;  1VQ9 P;  1GZL A;  3CME P;  4GT1 A;  3G0V A;  3EJE A;  1LTS C;  3EJD A;  2ZT9 B;  3DS3 A;  1JMB A;  4OGQ C;  2O3J A;  3TNU B;  2LR2 A;  1SP4 A;  2DNW A;  2QM7 A;  2AEJ A;  1JM0 A;  1H0T A;  2K94 A;  1PGQ A;  1A43 A;  3GZM A;  4KJM A;  1GU5 A;  1SFC B;  5KJ7 A;  2V7Q H;  3P32 A;  2LKI A;  1L0N D;  5CCH D;  1ZN5 A;  1GW3 A;  4H13 B;  1F80 D;  1S5L X;  1JY2 P;  4H0L D;  2HLO A;  2CPB A;  4UB6 E;  2DW3 A;  1N73 C;  1QVF O;  2M8L A;  2WPV B;  3GW6 A;  5CMZ A;  5AVU B;  1MZ9 A;  1BE3 E;  2P2U A;  3OJA B;  1R5S A;  1L0L D;  3GHG C;  1WRG A;  4I6M C;  2O1K A;  2P58 A;  2XXM A;  1GTW A;  1YYC A;  5HV8 A;  2WSE H;  3MUD A;  2L9F A;  2N9Y B;  3HE5 A;  5AVT B;  2E5T A;  3G6E P;  2W27 A;  2FYU J;  1L0N G;  2ZYG A;  1FZA A;  2PRR A;  3A0H H;  3GJN A;  2KOP A;  2K1A A;  3RL0 g;  1SQQ J;  2C9N Y;  2FVA A;  1U7M A;  2KYV A;  1FOS F;  4N78 D;  1L0L G;  2P10 A;  2WIT A;  3GLM A;  2M3B A;  3PJS K;  2M0B A;  2Q1K A;  1T3J A;  4XFY A;  1VQO P;  2XU6 A;  2BCC J;  5KP6 B;  3V2R A;  2FHS C;  3KHU A;  2E75 B;  5AVZ B;  2ZXE B;  3DPH A;  3AE3 C;  3V2Q A;  1VKU A;  1OW7 A;  4K35 A;  3FWL A;  1E6J P;  2GM4 A;  1JY3 N;  1T2K D;  5KLI C;  3PLN A;  4H2W C;  1VF5 C;  1IUQ A;  1YJ9 P;  2LIW A;  4CA3 A;  3C9I A;  2GZJ A;  1AVY A;  3H47 A;  3B5I A;  5AW6 B;  2K37 A;  3L37 A;  2CQ8 A;  3JSV C;  3LW5 J;  2KG6 A;  1IFJ A;  3EFG A;  2GDX A;  1AJY A;  1USE A;  3OA7 A;  1JY3 O;  2M5R A;  3KXD A;  4MRT C;  1N2D C;  1S9K E;  2JO0 A;  2FXO A;  3S1K A;  3Q3D A;  1L0N E;  3AEB C;  3G4S P;  2M8P A;  2OYI A;  1ACP A;  3IR9 A;  3A3Y B;  3MHV A;  1KD1 Q;  3MD0 A;  4XA4 A;  2HPC A;  2KOQ A;  1A02 J;  3CCV P;  1L0L E;  1NTM E;  1CI6 A;  3B5N C;  1M1J A;  4XRQ A;  2C0W A;  1S5L E;  3L70 E;  1URQ C;  3PHL A;  3FXE A;  1YTZ I;  4L76 A;  3SSU A;  3HE5 B;  1KQF B;  2YNY A;  1RH5 B;  2Y9Y A;  2ONT A;  2K0Y A;  1T8Z A;  3T97 A;  3KQG A;  3CXH I;  3RBZ A;  2Z4E A;  4N78 E;  2BHV A;  1NQ4 A;  4ASW A;  1IZN B;  3MGN A;  1PIX A;  3MIW A;  3B4S A;  1HQB A;  4UB8 E;  2FFD B;  3RK2 B;  1EZV D;  5AW2 B;  3K5B A;  2WWW A;  1SQP K;  2CG5 B;  1AQT A;  1K73 Q;  3HTK A;  3MZW B;  2YKO A;  2WT7 B;  3A0B E;  1YJW P;  3CCQ P;  2FYZ A;  1PZQ A;  1HTL C;  2ZVN B;  1NWQ A;  1A8O A;  2KXP B;  5BU5 A;  4PXH B;  3PH0 A;  3E2D A;  1UIX A;  1G1J A;  1LWU B;  4PV1 B;  1K04 A;  3B4Q A;  1LT1 A;  3CC2 P;  1EZV G;  1NH4 A;  3CCM P;  4U0F A;  1H88 A;  2ITA A;  1LP1 B;  1GU4 A;  3WBH A;  2AEM A;  2KB7 P;  1KIL C;  5KAI H;  1BDC A;  1FZC C;  1RF1 A;  2KWL A;  4D6T D;  2XZ0 D;  1QVG O;  2FKW B;  4ZNC A;  1AF8 A;  4OH8 B;  3E7K A;  1LT9 C;  3CWB J;  1S2E A;  1VL2 A;  3H1K D;  1JY3 P;  3VMX A;  2RN0 A;  1PEO A;  2KNC B;  1KQG B;  1ZOY C;  3TK1 A;  2OTJ P;  1PP9 D;  3LMO A;  2W6A A;  3ITK A;  2IBZ D;  3CXC O;  4ZKP A;  1QGK B;  3FX0 A;  3G1I A;  4D6T G;  2YXQ B;  5B66 E;  2AXT E;  1P84 H;  4Y99 B;  2R3S A;  5AW1 B;  1Z6M A;  2PEO A;  3H1L E;  1PGJ A;  4U3F D;  3G1G A;  1L4A C;  5CCH A;  3HYB A;  2M8N A;  5GTI H;  1GL2 B;  1E5W A;  2MVU A;  1J1E B;  4ZMD A;  2FYN C;  5AW8 B;  4RO0 A;  3H1K G;  1EIA A;  5BU8 B;  2O01 J;  1NU1 K;  3L75 D;  1SQB J;  4NPE A;  1CEI A;  3CXH D;  4Y28 J;  3HUS B;  1ZME C;  4LLH A;  5AVR B;  2MY5 A;  1MKM A;  3RG6 C;  2FQ0 A;  1EZV E;  3VP8 A;  2M8R A;  4C7R A;  1OIP A;  3LW5 H;  1PP9 G;  2IBZ G;  4TT3 H;  3EWK A;  4MN4 C;  1SVF A;  5KKZ B;  1UNK A;  1LTB C;  1M1K Q;  2O1J A;  1L4A D;  2FBW C;  2XZR A;  3VMY A;  3SFD C;  4U3F G;  2JYG A;  1HUC A;  1N73 A;  1SS1 A;  2AFD A;  1BCC D;  3AED C;  1IC2 A;  1L0N K;  4IL6 E;  4JPZ B;  3L75 G;  1OMI A;  1ZRT D;  1L0I A;  3HE4 B;  1RQU A;  1M1J C;  3GHG A;  5HGN A;  5CJ4 A;  2LKM A;  3MTU E;  2OGU A;  2QNW A;  1JJ2 O;  1RF0 C;  4YTP C;  3WUU A;  1L0L K;  3V4Q A;  1NTM K;  5APU A;  4D6T E;  1K9M Q;  1FBM A;  4IOI H;  3F5H A;  1YQ4 C;  1VHN A;  3S9O A;  1E79 H;  3G29 A;  1NAF A;  1IK7 A;  4YXW H;  1BCC G;  2XT1 A;  1FR2 A;  1SQP D;  4U7J A;  1HY8 A;  2XNX A;  3H1K E;  3TGU J;  3H6P A;  3U1A A;  1IFI A;  1IFN A;  2FVF A;  1PEQ A;  1S4X A;  2GDY A;  4HB1 A;  3EQ2 A;  4PJ0 E;  2YIU C;  1LTJ C;  2IDB A;  3IF4 A;  5HVC A;  3HD7 D;  5KLV K;  4GR6 A;  1PP9 E;  2ERH A;  5KAF H;  2IBZ E;  1YIJ P;  5AVV B;  1G1I A;  4I2L C;  2W83 C;  2NPS B;  2CGQ A;  1MFT A;  4WY4 C;  2K88 A;  2QJK C;  1U57 A;  1QL2 A;  3WMM 0;  1USD A;  2C9L Y;  1R5L A;  4U3F E;  3D70 A;  2Z5I A;  1DIP A;  2EFJ A;  4EYY Q;  1GL2 D;  1SQP G;  2A45 I;  2LPK A;  1X8Y A;  3D6Z A;  3L75 E;  3U1C A;  3CXH E;  1KFM A;  5AVX B;  1LTA C;  3RL0 C;  2AXC A;  3M91 A;  5C39 A;  1KYO I;  3P8M C;  3L73 J;  1HGZ A;  1IFP A;  2P9X A;  2H89 C;  1VQ8 P;  3V6I A;  2FY8 A;  3N7N A;  3AEA C;  7CEI A;  2YMK A;  4GOD A;  2KW2 A;  2RKL A;  5E79 H;  2N1T C;  3H4E A;  5TIS E;  2QIW A;  1BCC E;  5APY A;  1AYI A;  3NMD A;  2OAR A;  2DGY A;  3HZQ A;  3O6Q B;  1ZRT E;  1PGO A;  3H25 A;  2VLO A;  3B5N A;  1L0H A;  3L71 J;  1M90 Q;  2WQY C;  2CK3 H;  2E42 A;  1URQ A;  3EJB A;  3U43 A;  1KLP A;  3Q5R A;  2EIA A;  2QVA A;  1NU1 D;  1VQ4 P;  4QMA A;  1GPJ A;  3E1I A;  4BWN A;  2P1J A;  4H0L C;  1K05 A;  3N4X A;  4L73 A;  1SQP E;  3C8V A;  2FXM A;  2O01 H;  1RE4 C;  1KTM A;  1JNM A;  5AW7 B;  1KOR A;  1W2E A;  2MVV A;  1M8O B;  1HJB A;  1KN7 A;  2LOL A;  2YKP A;  2FAC A;  2Y0C A;  1S9K D;  5CCG D;  1K30 A;  1FS0 E;  1NKZ B;  1Q82 Q;  2WVR A;  1NU1 G;  2NPS D;  1YHQ P;  1ZR4 A;  1GDT A;  3H1H J;  5BVZ A;  4RKU J;  1PGP A;  1PV3 A;  2FVE A;  1NHL A;  4PD4 D;  1JTH A;  2OYH B;  2JDI H;  5APQ A;  1J2J B;  4BXL A;  3G21 A;  5CZD B;  1N7S B;  3NTE A;  2ROQ A;  2KGE A;  2KZJ A;  2ZJS E;  1NTM D;  5AVQ B;  4JBZ A;  4C7N A;  3VRL C;  3AE9 C;  3JCU E;  2IZ0 A;  1M56 D;  2ZYA A;  1NTZ K;  3GMA A;  3L70 D;  2VLN A;  2PEJ A;  1Q7Y Q;  1KYO D;  1DX7 A;  1KIL A;  2KG8 A;  1FZC A;  2B89 A;  1SQV D;  2W8Z A;  2WPS A;  1FDO A;  3G71 P;  1MZ8 A;  4OWF A;  3CCL P;  1OR5 A;  2XV5 A;  3V2N A;  2KK7 A;  4IPY A;  1T2K C;  3SWY A;  2LTE A;  1KC8 Q;  5KLV D;  2KOD A;  1LT9 A;  1OVR A;  1NTM G;  2N9B A;  1OWA A;  3ZDM A;  3BRT B;  4EOT A; 
#chains in the Genus database with same CATH homology
 5F2O A;  4GR6 A;  3HYB A;  2M8N A;  5I4T G;  1BAJ A;  3H47 A;  3B5I A;  1EIA A;  3I56 P;  1EOQ A;  3DS0 A;  4XRO A;  2Z46 A;  2Z45 A;  1YIJ P;  4U0E A;  3M1M A;  4U0D A;  1RO2 A;  3CC7 P;  1YJW P;  3CCQ P;  3I55 P;  3RG6 C;  5F2K A;  1NJI Q;  1VQK P;  3DS4 A;  2XV6 A;  1QVF O;  1A8O A;  4COP A;  5JPA A;  2M8L A;  3DTJ A;  1N8R Q;  4PH0 A;  1W2B O;  2EFJ A;  1VQN P;  1VQL P;  2JO0 A;  3DS1 A;  2QEX P;  3E2D A;  3CC4 P;  3H0D A;  5HGO A;  3G4S P;  2M8P A;  1YIT P;  1K30 A;  1M1K Q;  1Q82 Q;  3CCJ P;  2XXM A;  3CC2 P;  1YHQ P;  2L6E A;  1M6E X;  2PEK A;  3CD6 P;  3CCM P;  4U0F A;  1QRJ A;  1KD1 Q;  2OTL P;  4M0I A;  2JYG A;  3WBH A;  2JYL A;  1K8A Q;  1VQ7 P;  4XFX A;  1VQ6 P;  2PY8 A;  4U0A A;  2E1M A;  3CCE P;  3G6E P;  1YJN P;  3CCV P;  3G21 A;  1RNI A;  3CCS P;  3NTE A;  2P9X A;  1M6N A;  2EG5 A;  1VQ8 P;  2CWO A;  2PEM A;  3CMA P;  1YI2 P;  1QVG O;  1Q81 Q;  3P05 A;  4XFZ A;  5HGN A;  3VRL C;  4XRQ A;  4COC A;  4QNB A;  3LRY A;  3OW2 O;  3H4E A;  1S72 P;  2BUO A;  3DS2 A;  2PEI A;  1AUM A;  1JJ2 O;  3DS5 A;  5HGL A;  1KQS O;  2PEN A;  4GR2 A;  2PEJ A;  1Q7Y Q;  2LF4 A;  3CPW O;  5BS1 A;  1K9M Q;  5DCK A;  1PEO A;  2OAR A;  1ZMB A;  2DGY A;  3HZQ A;  4XFY A;  1VQ5 P;  1VQO P;  3CCR P;  3G71 P;  2OTJ P;  2Z44 A;  2ONT A;  2PEQ A;  3CCL P;  1PEU A;  3Q20 A;  3CCU P;  5BS2 A;  3DPH A;  5F2N A;  3G29 A;  1VQ9 P;  4IPY A;  4WYM A;  2BQ1 E;  3G28 A;  3CME P;  3MGE A;  1D1D A;  2XT1 A;  3CXC O;  1M90 Q;  3G0V A;  2QA4 P;  2BHV A;  3G1I A;  1E6J P;  1KC8 Q;  2KOD A;  4U0B A;  3DS3 A;  4PH1 A;  1VQP P;  2EIA A;  1Q86 Q;  1PEM A;  1VQ4 P;  1PEQ A;  5HGM A;  1M74 A;  1VQM P;  2PEO A;  1IUQ A;  1A43 A;  1YJ9 P;  3G1G A;  1RO0 A;  4U0C A;  3G26 A;  1K73 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...