1YJNP

Crystal structure of clindamycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
143
structure length
143
Chain Sequence
b'TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 49
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2005-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1yjnP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1yjnP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1yjnP02
3CMEP 1VQ8P 3CC7P 3G71P 2QA4P 1N8RQ 1VQ4P 1VQ7P 3CCQP 1Q86Q 1K9MQ 3CCSP 3CXCO 3CCMP 1VQPP 3I55P 1YIJP 3CMAP 1W2BO 1NJIQ 1KC8Q 1VQ9P 1YHQP 1VQOP 1VQKP 3CD6P 2OTLP 1YJ9P 2OTJP 1VQ5P 3CCVP 3CCEP 3CCJP 1QVFO 3I56P 3OW2O 3CCLP 3CC4P 1VQLP 1YJWP 1KQSO 2QEXP 1S72P 1Q81Q 1QVGO 1M90Q 1YITP 1VQ6P 1Q82Q 1M1KQ 1Q7YQ 3G6EP 1K8AQ 1JJ2O 1YJNP 3CCRP 1VQMP 3CCUP 1YI2P 3CC2P 1VQNP 1KD1Q 3G4SP 1K73Q 3CPWO
chains in the Genus database with same CATH superfamily
4UHPB 1KB9D 3HUSC 2K93A 2YMKA 1W2EA 2A06G 1AJYA 3BRVB 2AXCA 7CEIA 2D2CD 1EIAA 3A5TA 1SQPJ 5KLIB 2Q3EA 1FJPA 2YO2A 1X3OA 2XZ0D 1KD1Q 5APQA 3CWBG 3KZIH 1JY3N 2QM7A 1AUMA 4GOEA 3L35A 2GZGA 3KDPB 1M57D 3H1IG 1S5LH 3TYYA 1IFDA 2R3CA 2QG4A 5BS2A 2RN0A 3NY7B 2PENA 2Q7CA 1YI2P 2LXBA 1M1JC 1NHLA 2M8LA 1BE3G 1KORA 2BCCJ 5APSA 2CK3H 2FYUE 1VPCA 3H1LJ 4H0LB 3E1IA 3BCCE 4ZMDA 1RE4A 1LTSC 3L37A 2RKLA 4BXLA 5HGOA 3L75D 1H89A 2FKWB 2JB0A 4UB8H 1AVYA 4ZNCA 3EJDA 2JR8A 3SFEC 3H25A 1A02F 1DNYA 2N5HA 1IZNB 1ZXGA 1N7LA 1S5LE 2GDXA 4XFJA 2FVAA 4IOIH 3CL3D 3M0AA 2WT7B 1JOCA 1Y9BA 2AFDA 1AV1A 2NPSA 2P58A 3C9IA 3BRTB 1U57A 2K0YA 1SQVJ 2KG9A 1CZQA 3CD6P 2QSIA 2GUVA 2ITAA 2JO1A 4GOFA 4RJTA 1HUCA 1GL2C 3HE5B 3ZDMA 3H6PA 3HUSA 3RK2C 2IZ1A 3RL0g 1L0LG 3CCUP 2YXQB 3GZMA 4K3AA 2W90A 3CCSP 1L0NJ 5DCKA 3VMYA 1NKNA 1A8OA 2IBZI 2PEKA 4UB6E 1IO4A 2KOQA 2WPQA 2KZIA 2FYUG 3H32A 4HYTB 2K9YA 4U3FE 1EDKA 2AEMA 4IFDK 3CC7P 2E43A 3OA7A 1FBMA 3G29A 1M1JA 3MGEA 1NTMK 2QEXP 2MVUA 3AECC 4XE5B 1BGYE 2R5DA 1G1IA 3FXDA 3U1CA 1OIPA 4JF7A 3VTPC 3LRYA 5HGNA 2BEQD 2W6BA 2OYIB 4LLHA 2CPSA 1MFTA 4LGDE 2E75B 1N86A 1SQQJ 1DX7A 1JY2N 2KXPB 3GMAA 2P9XA 4IL6E 1VQ8P 1NTZG 2M3BA 5CCGD 5GTHH 2CWOA 1YJ9P 2OTJP 3Q2YA 5K5GB 3L70E 3MD0A 3ABVC 3L74J 1NTKE 4PH1A 2AXTE 2IFMA 1NAFA 2YO3A 1CEIA 1GDTA 1NU1J 1YJNP 1NOHA 5APVA 1KB9I 3L72E 4U3FG 2CNRA 2WWWA 1S3JA 3FX0A 1WMKA 3B5IA 2WSEJ 2EFJA 3L73J 2GDYA 2LL8A 5F2OA 5CZDB 4WB4A 1NGMB 1L0HA 1BXIA 2IBZG 1JTHA 1SVFA 1QLED 1NTMD 1XTGB 2BQ1E 3H1HD 2GZFA 4Y99C 1J1DB 2KGAA 2EG5A 1KB9E 2KSEA 1BGYG 5KAFE 3AE7C 1VQPP 1X0TA 2FYUK 3IR9A 2IYOA 1VHNA 1USDA 3OW2O 4NPEA 1YTZT 1VQ6P 2BCCD 5TJHA 1HGVA 1G2CB 2ZT9C 3H1LD 2OTKE 3G21A 2OTLP 1AFOA 3GHGB 2JO0A 1FZBA 5KAIE 1BCCJ 4RKUJ 2K37A 1EXIA 2KS1B 3B5NC 4I6MC 2WTYA 2A45G 2JQ4A 1Q82Q 1GW3A 3B8EB 3V6IA 1HF9A 3T97A 3LIEA 2HODA 2QNWA 5AVWB 2XNDH 1SFCB 1T3JA 3TK1A 2HYNA 1A02J 2FAEA 4XROA 3Q1MA 2KW2A 1SQVD 3LMOA 4D6TJ 2ZVNB 2K88A 3DS0A 2M5AA 1KYOE 2QJYB 3CCRP 1FOSF 5E79H 3JSVC 2C9NY 3A3YB 1IFJA 2MVVA 2V4HA 1Q86Q 2B9BA 1M56D 4EYYQ 2ZJSE 2E75C 1OWAA 5AVVB 2B88A 5AVQB 3TNUB 2R3SA 1NH4A 1T8ZA 5AVYB 5HVCA 3DS5A 3O8ZA 3BCCD 3SSUA 2FY8A 3KQGA 2WT7A 1N7SB 1M6NA 4OVNF 2E76B 3VP9A 4AYCA 3RL0D 3DS3A 2ZYGA 3CXHE 3D6ZA 2H88C 2KODA 3I56P 3E1RA 3HE5A 2XZRA 2KK7A 4CPGA 2JBGA 3WU2E 3RK3D 3GF7A 2LOLA 1VDFA 1FR2A 2L9FA 2PAJA 2JJLA 4DJGA 2N1TC 3JCUH 1LT1A 5CCHD 1KILE 2BEZF 2O1KA 2JWAA 5KTBA 1Z6MA 1JMMA 1RF0C 3OJAB 3L75G 1ZMEC 1SFCD 3HYBA 1Z56A 1NTKK 2OYOA 2C0XA 3SWYA 4H13B 2WITA 3NXSA 3ITKA 4DG9A 1M90Q 2KLUA 3AEGC 3H1JJ 1DV5A 2ERHA 3GHGC 3CMEP 2P7JA 2OYHC 2QJKC 1AA0A 2B89A 1EXJA 4QKOA 1YHQP 1LNQA 2D2CB 2P10A 2IYPA 1FZCC 2AFEA 1PP9D 3P8MC 3RBXA 3L73D 1OMIA 3AEAC 3QH9A 1SQBE 1VKUA 1H0TA 3G0VA 1IMQA 1K9MQ 1X9VA 4HKGA 3W67A 2QJYC 3DTJA 1LP1B 2R44A 3O6QA 2M5RA 1QEXA 2ZVOB 5BS1A 2VLQA 4PD4D 1NWQA 2XU6A 3BASA 1LGHB 2V7QH 1NAYA 1GD2E 2K5XA 2H7HA 1EDLA 1NQ4A 3L70D 1E79H 4N3YB 4H2XC 1NTKD 3OAKA 4JBZA 4PWVB 2E1MA 1K8AQ 1EQ7A 1FU1A 1KFNA 1NO4A 1GMJA 3L72D 4M0IA 3N4XA 1HJBA 3WBHA 1CI6B 2YIUB 1ZW0A 4JYBA 1GXHA 1GK4A 1IK7A 2NPSC 1Y8AA 1YJWP 1SQXJ 2JU1A 2FBWC 2BCCE 5HV8A 1DEEG 1P84E 2AVAA 3M0DC 4W7ZA 1DD3A 4H44D 3GZLA 3H1LE 2B87B 3PJSK 1LT9B 3S1KA 5CJ0A 3GHGA 2Q1KA 2XZ1C 4PXHB 2QJPC 3A0HE 3VMZA 2OYHA 1J1EB 2K0DX 1GXGA 2HPCB 3H1KJ 1L4AD 1FZCA 3GKLC 3C8VA 2FYNB 4H13C 2MD9A 2ZAEB 4PV1D 4YPCA 1IUQA 1ACPA 3H47A 4DT0A 2KWLA 4KT0J 3H1IJ 4K35A 1SQVE 1YITP 5DJUB 1EZVD 3AE9C 1NKZB 1KILB 2Z45A 1NTMG 1URQD 2K9JB 3H1HG 3V2PA 1IFNA 2Q5UA 2FFDC 1BE3J 3GW6A 2GZIA 2E42A 1R5LA 3PLNA 1KYOD 3L36A 5EFWB 2QRXA 2BCCG 5KLVD 2CG5B 4UB6H 2N6ZA 2KB7P 3CMAP 3H1LG 3A0BE 2KGDA 2L4BA 4L73A 1PFIA 2O1JA 2KG6A 1JCCA 1VF5D 1HWTC 1GL2D 2G3AA 4NEOA 3RK3E 3RK2D 1S9KD 2K1AA 3P32A 3IAOA 2I8DA 1ZLLA 1RO2A 3CXHD 1OVRA 3M0DA 3AE2C 2JWDA 2WSCJ 4WY4C 1NVOA 2IFNA 2LIUA 3U43A 3LIDA 3MZWB 5KKZC 1SQBK 1SQVG 4ZKPA 1BAJA 5B66E 2YIUC 4PJ0E 1L0LJ 1LWUC 4I7ZB 5KP8B 3CCQP 2OGUA 2KOPA 1KV4A 1X8YA 2O01N 5H2FE 1K04A 1QVFO 3F89A 5KP6B 2N5IA 2IZ0A 1JY2O 4IL6H 4EOTA 1T2KC 2PRRA 1FDOA 2LR2A 1KLPA 1KILD 1SQPK 4JPZB 3BCCG 4DOJA 3CCMP 1DH3A 1J1EC 1YIJP 1UJZA 2A45H 4R4LA 1NU1E 4ZKUA 2AXTH 5KLIC 4XFXA 1GZLA 5BU5A 4COCA 4PD4I 1PP9E 2FYNC 3L73E 2FFDA 2HR3A 2Y0EA 1LTTC 1IFPA 1RY3A 3V5BA 3P8CD 1BSNA 1JM0A 3G28A 2A45I 2M8RA 4N78E 2JP3A 2JKVA 1S72P 3V4QA 1M1KQ 1KB9H 4PD4E 2KGEA 5KAFH 2OQQA 1SQBD 3RG6C 2E74B 4XRQA 1RE3C 1PEOA 5AW1B 1G1JA 2GYKA 2FHSC 1NTZJ 3KYQA 1FZEA 4H0LC 1S2EA 4EI2A 1FAVA 2GUSA 3B71A 1DIPA 4N6JA 3BATA 4HB1A 2KR5A 1E6JP 2FXPA 2O01H 2JEEA 1BCCE 2H8PD 4QMAA 4WY4A 5KAIH 2JGPA 4I1LA 1EDIA 1SQPD 1KC8Q 4YXWH 1HBWA 1X22A 4C7NB 1CI6A 1Q2NA 3H1KD 4BWNA 2GZJA 4W7YA 2IDBA 1SQVK 2Z4EA 1LWUA 3I5CA 1U7JA 5CCGC 2FQ2A 4CA3A 3CX5D 2P1JA 3MUDC 1PP9G 3L73G 2WMMA 2KNCB 3RL0B 3AE3C 2B87A 1BGYJ 3P7KA 2ZT9D 4IFFA 1BSHA 3NTNA 1L0NK 1KYOH 1EZVI 3C1LA 3RK3B 1P84D 4BPGA 4C7RA 3B5ND 3V2NA 3Q5SA 1AQ5A 3TSIA 1RQVA 4RO0A 2XKMA 5APWA 3DS4A 3M1MA 4OGQB 3DS1A 4NPFX 3TGUJ 1R8EA 2XT1A 1IFIA 1SP4A 1LJ2A 1F80D 2N98A 5GTIE 1YTZI 3L70G 2KORA 1KYOI 1EZVE 1QL1A 2AEFA 5KJ7C 1NTKG 5APXA 5CJ4A 1UIIA 3CXHH 2E74D 1T8KA 3L72G 1MKMA 5AW5B 3R2PA 3WU2H 1RE3A 3D71A 5EJDA 2H43A 3LW5H 1ZR4A 1L0IA 1SQQK 2YKQA 2OYIC 1VQ4P 5B5EE 5KLVE 2Y9YA 1S5LX 2J59M 2J58A 3FWLA 3AEBC 5CMZA 3CXHI 2FXOA 3DS2A 2VLOA 3HD7D 3RBZA 1T6AA 1IK9A 2KSJA 4BRYB 3MTUE 1L0ND 3H4EA 1MZ9A 3MP7B 1S9KE 1FJKA 1ZNVA 1NU1K 3EJEA 5CCGA 3EFFK 4IPYA 3TDKA 3MUDA 3TF5A 2NZ2A 5AVUB 2O01J 1JEKA 3S4RA 1L2PA 1OR5A 2VSQA 2NRGA 4AQRD 2N1TD 1OZHA 1EZVG 2EHSA 1D7MA 2K3RA 1IMPA 2MR8A 4OGQD 3USSA 3PP5A 2KOOA 1J1DC 2ROQA 1U7MA 1JNMA 3EJBA 2FADA 2AEJA 1SQQD 1N73B 2PY8A 2L6EA 2Z46A 5KJ7A 5KLVG 4JQ0D 3L71J 3HUSB 1QL2A 4HJGH 3MIWA 3L75J 4ASWA 1PEQA 3AE5C 1HQBA 3GLMA 2J5UA 1RHZB 4H44B 1KTMA 3L74D 4C46A 3M9QA 1LTBC 3V4WA 1UIXA 3P8CE 1PGPA 4EIJA 1HH0A 1NU1D 1KN7A 3B4SA 3H32B 4IL6X 2PFXA 1IJDB 2OYIA 1KZUB 1CSBA 3D70A 4R0MA 3EFGA 1VQNP 2I1KA 1K30A 1L4AB 1SFCC 1SQXE 4PV1B 1PZQA 1M1JB 4GIFA 2UWJE 1M7LA 3CCJP 1HVVA 2FQ1A 3CC4P 4N78D 3LW5J 2LF4A 1AVOA 1P84H 4TT3H 2MR7A 1QRJA 1OW6A 3GG2A 4Y28J 1URQB 4WVZA 1JMBA 1J2JB 1FDIA 2FVFA 1SQPE 2DNWA 1OFCX 3A0HH 4TLFA 4U0BA 3H1KE 2PP6A 3II6A 4R4MA 5F2NA 5KP7B 1EC5A 1VQLP 2PNGA 1FOSE 1N7SC 2XXMA 2E76C 2NPSD 1P84I 3CX5E 3E2DA 1BCCD 3TGUD 3SFDC 1E0HA 2WSSH 3B4QA 3H1IE 1NYHA 5AVTB 3KPEA 1KMIZ 4MN4C 3M9BA 1AF8A 4AUWA 3WUTA 2L5GB 3FXEA 1GU5A 3E7KA 1VF5B 1GW4A 1YQ3C 1Q7YQ 1GL2B 2ONTA 2WVRA 3SWKA 3RK2B 1BE3E 5KLVK 3U59A 1M6EX 5HGMA 1G2CA 2RMZA 5AVZB 1SQBG 4D6TD 1BDDA 1RNIA 3F5HA 1JTHB 2XV6A 3PHLA 2JYLA 1LTIC 5AW2B 5HGLA 3AE1C 2KS1A 5I4TG 1VQMP 1K73Q 3NMDA 1GPJA 4H2YC 2XV5A 4NPDA 3A0BH 5JPAA 5AVXB 1DD4A 1FC2C 3CWBJ 5AW3B 1VQ5P 1HJ0A 1SQPG 2N9BA 4B86A 1SFCA 4U0DA 3H1KG 1E5WA 4H44C 4L76A 1JCDA 3HZQA 4IFMA 4OWFA 5CBOA 4U0CA 2W6AA 3VOPA 1OW8A 3KHUA 2FACA 4COPA 1NTMJ 2D2CC 3CE7A 1OW7A 3H1HJ 5EW5E 3RGUA 1PEMA 1L0LE 1L4AC 5AW8B 2GM4A 5B66H 3TNUA 4PJ0H 2K92A 4BRYA 1L0NE 3T97B 4PV1C 2HODB 5APYA 3NFQA 5H2FH 4GODA 2LTEA 1N7SA 2WSFH 2R32A 2MY5A 3G1GA 1KQLA 1EOQA 3CCVP 1QX8A 4I2LC 4MRTC 2CGQA 1Q90D 1URQC 2M5AB 2POHA 4JYCA 3VP8A 3K5BA 2V7QJ 3MHVA 4WY4D 3L71D 1JO5A 1N8RQ 3S9OA 1R5SA 3Q20A 1Y47A 1AYIA 3KZIE 4F37A 2N6YA 3H1JD 3UIAA 3A7OA 1PPJD 2M8NA 2WSEH 3V2RA 5AW4B 1RQUA 2KI7B 1X79B 2VRSA 4L74A 1SQXK 2LXCB 4LC1A 3G71P 2LPKA 2XNXA 2QIWA 1T2KD 3VRLC 1VQ9P 1SQQE 2WPSA 4Y99B 1VF5C 1N73A 2PEIA 1FDMA 4PD4H 4H2WC 2BUOA 4PH0A 1T3UA 4WBAA 2KGCA 2XDJA 3W68A 1NTZE 5TISH 1PV3A 1LT9C 2L0QA 2FYUJ 4QNBA 3M06A 1WRGA 1L0NG 2M8PA 2KZJA 3L74E 1NJIQ 3GF3A 1MUUA 3BCCJ 2ZT9B 2WPVB 4UB8E 3VN0A 2LKMA 2PEQA 1VL2A 3FGAD 1JUNA 3PRJA 4W80A 4WYMA 1HTLC 3SWFA 2Q6QA 2LIWA 1S1CX 3B5NB 3PTZA 3Q5PA 1L4AA 2VLPA 2YNYA 3G3ZA 3HE4B 2CQ8A 2EHTA 3GJNA 2IBZE 4GKGA 4GT1A 1KILC 3VMXA 2BASA 2KIKA 1LP1A 4H0LD 2L22A 1JY3P 3G4SP 2QA4P 1URQA 1SQXD 5TISE 2Z44A 2YXRB 1SQQG 3U1AA 5AVSB 4GR2A 1QGKB 2Y9ZA 2JU2A 4EDFA 2DGYA 1KQSO 3AE4C 4DZOA 1EMVA 1H0TB 2WSFJ 2Z5HA 2KP8A 3TGUE 2A06D 1LTJB 2M3EA 3AEDC 1TU3F 1DEBA 2W8ZA 4U3FJ 3L74G 1PIXA 3HD7B 5GTIH 3O6QB 2BHVA 3V2QA 2Z5IA 1NU1G 2ZYAA 2FQ0A 3CWBD 1GTWA 3G6EP 1JJ2O 2Q9IA 1IC2A 1GL2A 1ZOYC 2GA1A 1YQ4C 3D6YA 3H1ID 4YTPC 4XFZA 1PP9J 1RF1B 3IFMA 1KQGB 2E5TA 4D6TE 1VQKP 5L8RJ 4XFYA 1L0LK 1LT9A 2DW3A 1H88A 1ZV8A 2FVEA 2Y0DA 1ZR2A 1RO0A 1HY8A 2GDWA 2KYVA 2RH0A 1EDJA 4I7ZC 1ZRTD 5B5EH 2FXMA 3CC2P 2HPCA 1KQFB 3HTKB 2N1TB 2IPPA 3CPWO 2PGDA 1BE3D 1PL5A 5KJ7D 1D1DA 1M8OB 5AW9B 2HG5D 5GTHE 2VLNA 3CI9A 2KG8A 4BPFA 2ZXXA 1ZN5A 4U0AA 2K2QA 3L70J 3IN6A 2W6JH 1KILA 1NTKJ 2I1JA 2K9JA 1BCCG 1WT6A 3TGUG 1K05A 4OH8B 2OYHB 2QJKB 3L72J 2ZXEB 3DPHA 5C39A 2CPBA 2E75D 5AW6B 3VMAA 2K94A 1FZCB 2SPZA 3MGNA 2X2BA 3G9RA 1VQOP 2L91A 3IF4A 2P67A 4D6TG 1IFMA 1L0LD 1AQTA 1XTCC 4U0FA 4U0EA 1NTZK 1Q81Q 2E74C 3L71E 4WWIA 4KJMA 2KUBA 3L75E 1FS0E 4U7JA 3JC22 3G26A 2WZ7A 1PGOA 1FZGA 2FYUD 2P2UA 3H1JE 3CCEP 3NTEA 1PPJE 1JY2P 2JYGA 1QVGO 1LTJC 3QWOC 3G1IA 3CLQA 2OARA 1OVVA 3A2AA 3HD7C 1VQ7P 4HH2A 1MV8A 1OXZA 3CXCO 1W2BO 5CBNA 4RESB 3WMM0 2KLVA 1LTAC 3AEFC 2HLOA 5AVRB 1YBKA 3RL0C 1HGZA 4O9BA 3AE8C 2EIAA 1RF1C 2NPSB 3RG2A 5BVZA 1PGQA 1ZP0C 5DJTB 5E79E 4DCKA 2KOGA 1KFMA 2E5YA 3H0DA 3Q5RA 2ZFCA 2GZEA 1PGJA 5KLVJ 3RK3C 1JB0J 2G8YA 2PEMA 1NTZD 2QJPB 3HRNA 3WUUA 3VYIA 4OGQC 3Q3DA 2Q3IA 3B5NA 3M91A 2QVAA 3L71G 3AEEC 4GR6A 3HE4A 2MF4A 2H89C 2IX7C 1A43A 2JAZA 1FE6A 5AW7B 5CCHC 2JDIH 3EQ2A 3CCLP 1PEUA 3P05A 3CX5H 2WQYC 2NO8A 3H1JG 5CHXA 1PPJG 4U3FD 5AW0B 3N7NA 5APUA 2LKIA 1ZMBA 3PH0A 4XA4A 1RH5B 1SS1A 2QE7H 2WPTA 1SLQA 2IBZD 1W5CE 2MKVA 2W27A 4L75A 2KOSA 5F2KA 2W83C 3BVHA 2WPRA 1BDCA 1OVUA 2FFDB 2HFED 1BGYD 3CX5I 1GK6A 3JCUE 2PEOA 2YMYA 1N7SD 1UNKA 2E76D 2A06E 1CW5A 2M0BA 2YKPA 2O3JA 1H8AA 1LTJA 2C0WA 4M3LA 3M9HA 3FWNA 4C7NA 3HD7A 2N9YB 2LMLA 1N2DC 3L4FA 4Z1MH 3CWBE 2QM8A 4KHXA 2AF8A 3R4YA 1M74A 3AE6C 4A7PA 1MZ8A 2KNCA 2ZYDA 4YXDC 1GU4A 1RE4C 1RF1A 2MJZA 1LTGC 4IZ6A 1FZFA 5M1BA 1S4XA 4HKZH 2C9LY 1NTME 5BU8B 1USEA 3EWKA 2WSCH 2PEJA 3H1HE 1ZRTE 2FYZA 4WY4B 1MFZA 3WUVA 4GDOA 5KKZB 1JY3O 3HTKA 2N1TA 1YYCA 5APTA 3KXDA 1FZAA 3I55P 4ASVA 1SQXG 1OX3A 2N50A 1SQBJ 1LWUB 4BPHA 4H13D 1RF0A 2Y0CA 2K0XA 2R5BA 1N73C 5CCHA 2YKOA
chains in the Genus database with same CATH topology
4M0IA 1VQ8P 3G26A 4COPA 4XFZA 1NJIQ 3WBHA 3CMAP 3DS4A 3M1MA 2CWOA 1VQKP 3CD6P 4XFYA 4U0BA 1YJ9P 2OTJP 3G28A 3DS1A 2PEQA 5F2NA 3CCEP 3HYBA 1PEMA 3NTEA 2XT1A 4XROA 1VQLP 5F2KA 2JYGA 1YJWP 1EIAA 4PH1A 2XXMA 1S72P 1QVGO 1RO0A 1M90Q 4WYMA 1M1KQ 3DS0A 3G1IA 1YJNP 3CCRP 2OARA 3CCUP 3CC2P 3E2DA 1KD1Q 2PEOA 3CPWO 3RG6C 3CMEP 4U0CA 4XRQA 1VQ7P 1Q86Q 1AUMA 3CCSP 3CXCO 1W2BO 1PEOA 5DCKA 3B5IA 2EFJA 3G1GA 1YHQP 1A8OA 2L6EA 2PY8A 1RO2A 1D1DA 5F2OA 2Z46A 2PEKA 1EOQA 3CCVP 2M8PA 5BS2A 1PEQA 3DS5A 1Q7YQ 2PENA 4U0AA 1E6JP 2EIAA 2ONTA 2BQ1E 1YI2P 1BAJA 1M6NA 3G4SP 2EG5A 3CC7P 1M6EX 2QA4P 3G0VA 1N8RQ 1VQ4P 5HGMA 3CCQP 1M74A 1K9MQ 2M8LA 1VQPP 1KC8Q 1IUQA 3Q20A 1RNIA 3DS3A 3DS2A 3H0DA 3H47A 2Z44A 3G29A 3MGEA 1QVFO 2KODA 3I56P 2M8NA 2XV6A 3DTJA 4GR2A 2JYLA 3DPHA 3OW2O 2DGYA 1KQSO 5HGLA 2QEXP 1VQ6P 1YITP 5BS1A 3H4EA 2PEMA 2PEJA 5I4TG 2Z45A 1VQMP 1VQNP 1K30A 1K73Q 5HGOA 3G71P 5JPAA 3G21A 3LRYA 5HGNA 3VRLC 3I55P 3CCMP 1YIJP 1VQ9P 2OTLP 4GR6A 2JO0A 1VQOP 4IPYA 1VQ5P 1A43A 3CCJP 2BHVA 2PEIA 4XFXA 4U0DA 3CCLP 3CC4P 3P05A 1PEUA 4U0FA 2LF4A 4U0EA 2BUOA 4PH0A 1Q81Q 4COCA 1Q82Q 3HZQA 2E1MA 3G6EP 1K8AQ 1JJ2O 1QRJA 4QNBA 1ZMBA 2P9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CME P;  1VQ8 P;  3CC7 P;  3G71 P;  2QA4 P;  1N8R Q;  1VQ4 P;  1VQ7 P;  3CCQ P;  1Q86 Q;  1K9M Q;  3CCS P;  3CXC O;  3CCM P;  1VQP P;  3I55 P;  1YIJ P;  3CMA P;  1W2B O;  1NJI Q;  1KC8 Q;  1VQ9 P;  1YHQ P;  1VQO P;  1VQK P;  3CD6 P;  2OTL P;  1YJ9 P;  2OTJ P;  1VQ5 P;  3CCV P;  3CCE P;  3CCJ P;  1QVF O;  3I56 P;  3OW2 O;  3CCL P;  3CC4 P;  1VQL P;  1YJW P;  1KQS O;  2QEX P;  1S72 P;  1Q81 Q;  1QVG O;  1M90 Q;  1YIT P;  1VQ6 P;  1Q82 Q;  1M1K Q;  1Q7Y Q;  3G6E P;  1K8A Q;  1JJ2 O;  1YJN P;  3CCR P;  1VQM P;  3CCU P;  1YI2 P;  3CC2 P;  1VQN P;  1KD1 Q;  3G4S P;  1K73 Q;  3CPW O; 
#chains in the Genus database with same CATH topology
 4UHP B;  1KB9 D;  3HUS C;  2K93 A;  2YMK A;  1W2E A;  2A06 G;  1AJY A;  3BRV B;  2AXC A;  7CEI A;  2D2C D;  1EIA A;  3A5T A;  1SQP J;  5KLI B;  2Q3E A;  1FJP A;  2YO2 A;  1X3O A;  2XZ0 D;  1KD1 Q;  5APQ A;  3CWB G;  3KZI H;  1JY3 N;  2QM7 A;  1AUM A;  4GOE A;  3L35 A;  2GZG A;  3KDP B;  1M57 D;  3H1I G;  1S5L H;  3TYY A;  1IFD A;  2R3C A;  2QG4 A;  5BS2 A;  2RN0 A;  3NY7 B;  2PEN A;  2Q7C A;  1YI2 P;  2LXB A;  1M1J C;  1NHL A;  2M8L A;  1BE3 G;  1KOR A;  2BCC J;  5APS A;  2CK3 H;  2FYU E;  1VPC A;  3H1L J;  4H0L B;  3E1I A;  3BCC E;  4ZMD A;  1RE4 A;  1LTS C;  3L37 A;  2RKL A;  4BXL A;  5HGO A;  3L75 D;  1H89 A;  2FKW B;  2JB0 A;  4UB8 H;  1AVY A;  4ZNC A;  3EJD A;  2JR8 A;  3SFE C;  3H25 A;  1A02 F;  1DNY A;  2N5H A;  1IZN B;  1ZXG A;  1N7L A;  1S5L E;  2GDX A;  4XFJ A;  2FVA A;  4IOI H;  3CL3 D;  3M0A A;  2WT7 B;  1JOC A;  1Y9B A;  2AFD A;  1AV1 A;  2NPS A;  2P58 A;  3C9I A;  3BRT B;  1U57 A;  2K0Y A;  1SQV J;  2KG9 A;  1CZQ A;  3CD6 P;  2QSI A;  2GUV A;  2ITA A;  2JO1 A;  4GOF A;  4RJT A;  1HUC A;  1GL2 C;  3HE5 B;  3ZDM A;  3H6P A;  3HUS A;  3RK2 C;  2IZ1 A;  3RL0 g;  1L0L G;  3CCU P;  2YXQ B;  3GZM A;  4K3A A;  2W90 A;  3CCS P;  1L0N J;  5DCK A;  3VMY A;  1NKN A;  1A8O A;  2IBZ I;  2PEK A;  4UB6 E;  1IO4 A;  2KOQ A;  2WPQ A;  2KZI A;  2FYU G;  3H32 A;  4HYT B;  2K9Y A;  4U3F E;  1EDK A;  2AEM A;  4IFD K;  3CC7 P;  2E43 A;  3OA7 A;  1FBM A;  3G29 A;  1M1J A;  3MGE A;  1NTM K;  2QEX P;  2MVU A;  3AEC C;  4XE5 B;  1BGY E;  2R5D A;  1G1I A;  3FXD A;  3U1C A;  1OIP A;  4JF7 A;  3VTP C;  3LRY A;  5HGN A;  2BEQ D;  2W6B A;  2OYI B;  4LLH A;  2CPS A;  1MFT A;  4LGD E;  2E75 B;  1N86 A;  1SQQ J;  1DX7 A;  1JY2 N;  2KXP B;  3GMA A;  2P9X A;  4IL6 E;  1VQ8 P;  1NTZ G;  2M3B A;  5CCG D;  5GTH H;  2CWO A;  1YJ9 P;  2OTJ P;  3Q2Y A;  5K5G B;  3L70 E;  3MD0 A;  3ABV C;  3L74 J;  1NTK E;  4PH1 A;  2AXT E;  2IFM A;  1NAF A;  2YO3 A;  1CEI A;  1GDT A;  1NU1 J;  1YJN P;  1NOH A;  5APV A;  1KB9 I;  3L72 E;  4U3F G;  2CNR A;  2WWW A;  1S3J A;  3FX0 A;  1WMK A;  3B5I A;  2WSE J;  2EFJ A;  3L73 J;  2GDY A;  2LL8 A;  5F2O A;  5CZD B;  4WB4 A;  1NGM B;  1L0H A;  1BXI A;  2IBZ G;  1JTH A;  1SVF A;  1QLE D;  1NTM D;  1XTG B;  2BQ1 E;  3H1H D;  2GZF A;  4Y99 C;  1J1D B;  2KGA A;  2EG5 A;  1KB9 E;  2KSE A;  1BGY G;  5KAF E;  3AE7 C;  1VQP P;  1X0T A;  2FYU K;  3IR9 A;  2IYO A;  1VHN A;  1USD A;  3OW2 O;  4NPE A;  1YTZ T;  1VQ6 P;  2BCC D;  5TJH A;  1HGV A;  1G2C B;  2ZT9 C;  3H1L D;  2OTK E;  3G21 A;  2OTL P;  1AFO A;  3GHG B;  2JO0 A;  1FZB A;  5KAI E;  1BCC J;  4RKU J;  2K37 A;  1EXI A;  2KS1 B;  3B5N C;  4I6M C;  2WTY A;  2A45 G;  2JQ4 A;  1Q82 Q;  1GW3 A;  3B8E B;  3V6I A;  1HF9 A;  3T97 A;  3LIE A;  2HOD A;  2QNW A;  5AVW B;  2XND H;  1SFC B;  1T3J A;  3TK1 A;  2HYN A;  1A02 J;  2FAE A;  4XRO A;  3Q1M A;  2KW2 A;  1SQV D;  3LMO A;  4D6T J;  2ZVN B;  2K88 A;  3DS0 A;  2M5A A;  1KYO E;  2QJY B;  3CCR P;  1FOS F;  5E79 H;  3JSV C;  2C9N Y;  3A3Y B;  1IFJ A;  2MVV A;  2V4H A;  1Q86 Q;  2B9B A;  1M56 D;  4EYY Q;  2ZJS E;  2E75 C;  1OWA A;  5AVV B;  2B88 A;  5AVQ B;  3TNU B;  2R3S A;  1NH4 A;  1T8Z A;  5AVY B;  5HVC A;  3DS5 A;  3O8Z A;  3BCC D;  3SSU A;  2FY8 A;  3KQG A;  2WT7 A;  1N7S B;  1M6N A;  4OVN F;  2E76 B;  3VP9 A;  4AYC A;  3RL0 D;  3DS3 A;  2ZYG A;  3CXH E;  3D6Z A;  2H88 C;  2KOD A;  3I56 P;  3E1R A;  3HE5 A;  2XZR A;  2KK7 A;  4CPG A;  2JBG A;  3WU2 E;  3RK3 D;  3GF7 A;  2LOL A;  1VDF A;  1FR2 A;  2L9F A;  2PAJ A;  2JJL A;  4DJG A;  2N1T C;  3JCU H;  1LT1 A;  5CCH D;  1KIL E;  2BEZ F;  2O1K A;  2JWA A;  5KTB A;  1Z6M A;  1JMM A;  1RF0 C;  3OJA B;  3L75 G;  1ZME C;  1SFC D;  3HYB A;  1Z56 A;  1NTK K;  2OYO A;  2C0X A;  3SWY A;  4H13 B;  2WIT A;  3NXS A;  3ITK A;  4DG9 A;  1M90 Q;  2KLU A;  3AEG C;  3H1J J;  1DV5 A;  2ERH A;  3GHG C;  3CME P;  2P7J A;  2OYH C;  2QJK C;  1AA0 A;  2B89 A;  1EXJ A;  4QKO A;  1YHQ P;  1LNQ A;  2D2C B;  2P10 A;  2IYP A;  1FZC C;  2AFE A;  1PP9 D;  3P8M C;  3RBX A;  3L73 D;  1OMI A;  3AEA C;  3QH9 A;  1SQB E;  1VKU A;  1H0T A;  3G0V A;  1IMQ A;  1K9M Q;  1X9V A;  4HKG A;  3W67 A;  2QJY C;  3DTJ A;  1LP1 B;  2R44 A;  3O6Q A;  2M5R A;  1QEX A;  2ZVO B;  5BS1 A;  2VLQ A;  4PD4 D;  1NWQ A;  2XU6 A;  3BAS A;  1LGH B;  2V7Q H;  1NAY A;  1GD2 E;  2K5X A;  2H7H A;  1EDL A;  1NQ4 A;  3L70 D;  1E79 H;  4N3Y B;  4H2X C;  1NTK D;  3OAK A;  4JBZ A;  4PWV B;  2E1M A;  1K8A Q;  1EQ7 A;  1FU1 A;  1KFN A;  1NO4 A;  1GMJ A;  3L72 D;  4M0I A;  3N4X A;  1HJB A;  3WBH A;  1CI6 B;  2YIU B;  1ZW0 A;  4JYB A;  1GXH A;  1GK4 A;  1IK7 A;  2NPS C;  1Y8A A;  1YJW P;  1SQX J;  2JU1 A;  2FBW C;  2BCC E;  5HV8 A;  1DEE G;  1P84 E;  2AVA A;  3M0D C;  4W7Z A;  1DD3 A;  4H44 D;  3GZL A;  3H1L E;  2B87 B;  3PJS K;  1LT9 B;  3S1K A;  5CJ0 A;  3GHG A;  2Q1K A;  2XZ1 C;  4PXH B;  2QJP C;  3A0H E;  3VMZ A;  2OYH A;  1J1E B;  2K0D X;  1GXG A;  2HPC B;  3H1K J;  1L4A D;  1FZC A;  3GKL C;  3C8V A;  2FYN B;  4H13 C;  2MD9 A;  2ZAE B;  4PV1 D;  4YPC A;  1IUQ A;  1ACP A;  3H47 A;  4DT0 A;  2KWL A;  4KT0 J;  3H1I J;  4K35 A;  1SQV E;  1YIT P;  5DJU B;  1EZV D;  3AE9 C;  1NKZ B;  1KIL B;  2Z45 A;  1NTM G;  1URQ D;  2K9J B;  3H1H G;  3V2P A;  1IFN A;  2Q5U A;  2FFD C;  1BE3 J;  3GW6 A;  2GZI A;  2E42 A;  1R5L A;  3PLN A;  1KYO D;  3L36 A;  5EFW B;  2QRX A;  2BCC G;  5KLV D;  2CG5 B;  4UB6 H;  2N6Z A;  2KB7 P;  3CMA P;  3H1L G;  3A0B E;  2KGD A;  2L4B A;  4L73 A;  1PFI A;  2O1J A;  2KG6 A;  1JCC A;  1VF5 D;  1HWT C;  1GL2 D;  2G3A A;  4NEO A;  3RK3 E;  3RK2 D;  1S9K D;  2K1A A;  3P32 A;  3IAO A;  2I8D A;  1ZLL A;  1RO2 A;  3CXH D;  1OVR A;  3M0D A;  3AE2 C;  2JWD A;  2WSC J;  4WY4 C;  1NVO A;  2IFN A;  2LIU A;  3U43 A;  3LID A;  3MZW B;  5KKZ C;  1SQB K;  1SQV G;  4ZKP A;  1BAJ A;  5B66 E;  2YIU C;  4PJ0 E;  1L0L J;  1LWU C;  4I7Z B;  5KP8 B;  3CCQ P;  2OGU A;  2KOP A;  1KV4 A;  1X8Y A;  2O01 N;  5H2F E;  1K04 A;  1QVF O;  3F89 A;  5KP6 B;  2N5I A;  2IZ0 A;  1JY2 O;  4IL6 H;  4EOT A;  1T2K C;  2PRR A;  1FDO A;  2LR2 A;  1KLP A;  1KIL D;  1SQP K;  4JPZ B;  3BCC G;  4DOJ A;  3CCM P;  1DH3 A;  1J1E C;  1YIJ P;  1UJZ A;  2A45 H;  4R4L A;  1NU1 E;  4ZKU A;  2AXT H;  5KLI C;  4XFX A;  1GZL A;  5BU5 A;  4COC A;  4PD4 I;  1PP9 E;  2FYN C;  3L73 E;  2FFD A;  2HR3 A;  2Y0E A;  1LTT C;  1IFP A;  1RY3 A;  3V5B A;  3P8C D;  1BSN A;  1JM0 A;  3G28 A;  2A45 I;  2M8R A;  4N78 E;  2JP3 A;  2JKV A;  1S72 P;  3V4Q A;  1M1K Q;  1KB9 H;  4PD4 E;  2KGE A;  5KAF H;  2OQQ A;  1SQB D;  3RG6 C;  2E74 B;  4XRQ A;  1RE3 C;  1PEO A;  5AW1 B;  1G1J A;  2GYK A;  2FHS C;  1NTZ J;  3KYQ A;  1FZE A;  4H0L C;  1S2E A;  4EI2 A;  1FAV A;  2GUS A;  3B71 A;  1DIP A;  4N6J A;  3BAT A;  4HB1 A;  2KR5 A;  1E6J P;  2FXP A;  2O01 H;  2JEE A;  1BCC E;  2H8P D;  4QMA A;  4WY4 A;  5KAI H;  2JGP A;  4I1L A;  1EDI A;  1SQP D;  1KC8 Q;  4YXW H;  1HBW A;  1X22 A;  4C7N B;  1CI6 A;  1Q2N A;  3H1K D;  4BWN A;  2GZJ A;  4W7Y A;  2IDB A;  1SQV K;  2Z4E A;  1LWU A;  3I5C A;  1U7J A;  5CCG C;  2FQ2 A;  4CA3 A;  3CX5 D;  2P1J A;  3MUD C;  1PP9 G;  3L73 G;  2WMM A;  2KNC B;  3RL0 B;  3AE3 C;  2B87 A;  1BGY J;  3P7K A;  2ZT9 D;  4IFF A;  1BSH A;  3NTN A;  1L0N K;  1KYO H;  1EZV I;  3C1L A;  3RK3 B;  1P84 D;  4BPG A;  4C7R A;  3B5N D;  3V2N A;  3Q5S A;  1AQ5 A;  3TSI A;  1RQV A;  4RO0 A;  2XKM A;  5APW A;  3DS4 A;  3M1M A;  4OGQ B;  3DS1 A;  4NPF X;  3TGU J;  1R8E A;  2XT1 A;  1IFI A;  1SP4 A;  1LJ2 A;  1F80 D;  2N98 A;  5GTI E;  1YTZ I;  3L70 G;  2KOR A;  1KYO I;  1EZV E;  1QL1 A;  2AEF A;  5KJ7 C;  1NTK G;  5APX A;  5CJ4 A;  1UII A;  3CXH H;  2E74 D;  1T8K A;  3L72 G;  1MKM A;  5AW5 B;  3R2P A;  3WU2 H;  1RE3 A;  3D71 A;  5EJD A;  2H43 A;  3LW5 H;  1ZR4 A;  1L0I A;  1SQQ K;  2YKQ A;  2OYI C;  1VQ4 P;  5B5E E;  5KLV E;  2Y9Y A;  1S5L X;  2J59 M;  2J58 A;  3FWL A;  3AEB C;  5CMZ A;  3CXH I;  2FXO A;  3DS2 A;  2VLO A;  3HD7 D;  3RBZ A;  1T6A A;  1IK9 A;  2KSJ A;  4BRY B;  3MTU E;  1L0N D;  3H4E A;  1MZ9 A;  3MP7 B;  1S9K E;  1FJK A;  1ZNV A;  1NU1 K;  3EJE A;  5CCG A;  3EFF K;  4IPY A;  3TDK A;  3MUD A;  3TF5 A;  2NZ2 A;  5AVU B;  2O01 J;  1JEK A;  3S4R A;  1L2P A;  1OR5 A;  2VSQ A;  2NRG A;  4AQR D;  2N1T D;  1OZH A;  1EZV G;  2EHS A;  1D7M A;  2K3R A;  1IMP A;  2MR8 A;  4OGQ D;  3USS A;  3PP5 A;  2KOO A;  1J1D C;  2ROQ A;  1U7M A;  1JNM A;  3EJB A;  2FAD A;  2AEJ A;  1SQQ D;  1N73 B;  2PY8 A;  2L6E A;  2Z46 A;  5KJ7 A;  5KLV G;  4JQ0 D;  3L71 J;  3HUS B;  1QL2 A;  4HJG H;  3MIW A;  3L75 J;  4ASW A;  1PEQ A;  3AE5 C;  1HQB A;  3GLM A;  2J5U A;  1RHZ B;  4H44 B;  1KTM A;  3L74 D;  4C46 A;  3M9Q A;  1LTB C;  3V4W A;  1UIX A;  3P8C E;  1PGP A;  4EIJ A;  1HH0 A;  1NU1 D;  1KN7 A;  3B4S A;  3H32 B;  4IL6 X;  2PFX A;  1IJD B;  2OYI A;  1KZU B;  1CSB A;  3D70 A;  4R0M A;  3EFG A;  1VQN P;  2I1K A;  1K30 A;  1L4A B;  1SFC C;  1SQX E;  4PV1 B;  1PZQ A;  1M1J B;  4GIF A;  2UWJ E;  1M7L A;  3CCJ P;  1HVV A;  2FQ1 A;  3CC4 P;  4N78 D;  3LW5 J;  2LF4 A;  1AVO A;  1P84 H;  4TT3 H;  2MR7 A;  1QRJ A;  1OW6 A;  3GG2 A;  4Y28 J;  1URQ B;  4WVZ A;  1JMB A;  1J2J B;  1FDI A;  2FVF A;  1SQP E;  2DNW A;  1OFC X;  3A0H H;  4TLF A;  4U0B A;  3H1K E;  2PP6 A;  3II6 A;  4R4M A;  5F2N A;  5KP7 B;  1EC5 A;  1VQL P;  2PNG A;  1FOS E;  1N7S C;  2XXM A;  2E76 C;  2NPS D;  1P84 I;  3CX5 E;  3E2D A;  1BCC D;  3TGU D;  3SFD C;  1E0H A;  2WSS H;  3B4Q A;  3H1I E;  1NYH A;  5AVT B;  3KPE A;  1KMI Z;  4MN4 C;  3M9B A;  1AF8 A;  4AUW A;  3WUT A;  2L5G B;  3FXE A;  1GU5 A;  3E7K A;  1VF5 B;  1GW4 A;  1YQ3 C;  1Q7Y Q;  1GL2 B;  2ONT A;  2WVR A;  3SWK A;  3RK2 B;  1BE3 E;  5KLV K;  3U59 A;  1M6E X;  5HGM A;  1G2C A;  2RMZ A;  5AVZ B;  1SQB G;  4D6T D;  1BDD A;  1RNI A;  3F5H A;  1JTH B;  2XV6 A;  3PHL A;  2JYL A;  1LTI C;  5AW2 B;  5HGL A;  3AE1 C;  2KS1 A;  5I4T G;  1VQM P;  1K73 Q;  3NMD A;  1GPJ A;  4H2Y C;  2XV5 A;  4NPD A;  3A0B H;  5JPA A;  5AVX B;  1DD4 A;  1FC2 C;  3CWB J;  5AW3 B;  1VQ5 P;  1HJ0 A;  1SQP G;  2N9B A;  4B86 A;  1SFC A;  4U0D A;  3H1K G;  1E5W A;  4H44 C;  4L76 A;  1JCD A;  3HZQ A;  4IFM A;  4OWF A;  5CBO A;  4U0C A;  2W6A A;  3VOP A;  1OW8 A;  3KHU A;  2FAC A;  4COP A;  1NTM J;  2D2C C;  3CE7 A;  1OW7 A;  3H1H J;  5EW5 E;  3RGU A;  1PEM A;  1L0L E;  1L4A C;  5AW8 B;  2GM4 A;  5B66 H;  3TNU A;  4PJ0 H;  2K92 A;  4BRY A;  1L0N E;  3T97 B;  4PV1 C;  2HOD B;  5APY A;  3NFQ A;  5H2F H;  4GOD A;  2LTE A;  1N7S A;  2WSF H;  2R32 A;  2MY5 A;  3G1G A;  1KQL A;  1EOQ A;  3CCV P;  1QX8 A;  4I2L C;  4MRT C;  2CGQ A;  1Q90 D;  1URQ C;  2M5A B;  2POH A;  4JYC A;  3VP8 A;  3K5B A;  2V7Q J;  3MHV A;  4WY4 D;  3L71 D;  1JO5 A;  1N8R Q;  3S9O A;  1R5S A;  3Q20 A;  1Y47 A;  1AYI A;  3KZI E;  4F37 A;  2N6Y A;  3H1J D;  3UIA A;  3A7O A;  1PPJ D;  2M8N A;  2WSE H;  3V2R A;  5AW4 B;  1RQU A;  2KI7 B;  1X79 B;  2VRS A;  4L74 A;  1SQX K;  2LXC B;  4LC1 A;  3G71 P;  2LPK A;  2XNX A;  2QIW A;  1T2K D;  3VRL C;  1VQ9 P;  1SQQ E;  2WPS A;  4Y99 B;  1VF5 C;  1N73 A;  2PEI A;  1FDM A;  4PD4 H;  4H2W C;  2BUO A;  4PH0 A;  1T3U A;  4WBA A;  2KGC A;  2XDJ A;  3W68 A;  1NTZ E;  5TIS H;  1PV3 A;  1LT9 C;  2L0Q A;  2FYU J;  4QNB A;  3M06 A;  1WRG A;  1L0N G;  2M8P A;  2KZJ A;  3L74 E;  1NJI Q;  3GF3 A;  1MUU A;  3BCC J;  2ZT9 B;  2WPV B;  4UB8 E;  3VN0 A;  2LKM A;  2PEQ A;  1VL2 A;  3FGA D;  1JUN A;  3PRJ A;  4W80 A;  4WYM A;  1HTL C;  3SWF A;  2Q6Q A;  2LIW A;  1S1C X;  3B5N B;  3PTZ A;  3Q5P A;  1L4A A;  2VLP A;  2YNY A;  3G3Z A;  3HE4 B;  2CQ8 A;  2EHT A;  3GJN A;  2IBZ E;  4GKG A;  4GT1 A;  1KIL C;  3VMX A;  2BAS A;  2KIK A;  1LP1 A;  4H0L D;  2L22 A;  1JY3 P;  3G4S P;  2QA4 P;  1URQ A;  1SQX D;  5TIS E;  2Z44 A;  2YXR B;  1SQQ G;  3U1A A;  5AVS B;  4GR2 A;  1QGK B;  2Y9Z A;  2JU2 A;  4EDF A;  2DGY A;  1KQS O;  3AE4 C;  4DZO A;  1EMV A;  1H0T B;  2WSF J;  2Z5H A;  2KP8 A;  3TGU E;  2A06 D;  1LTJ B;  2M3E A;  3AED C;  1TU3 F;  1DEB A;  2W8Z A;  4U3F J;  3L74 G;  1PIX A;  3HD7 B;  5GTI H;  3O6Q B;  2BHV A;  3V2Q A;  2Z5I A;  1NU1 G;  2ZYA A;  2FQ0 A;  3CWB D;  1GTW A;  3G6E P;  1JJ2 O;  2Q9I A;  1IC2 A;  1GL2 A;  1ZOY C;  2GA1 A;  1YQ4 C;  3D6Y A;  3H1I D;  4YTP C;  4XFZ A;  1PP9 J;  1RF1 B;  3IFM A;  1KQG B;  2E5T A;  4D6T E;  1VQK P;  5L8R J;  4XFY A;  1L0L K;  1LT9 A;  2DW3 A;  1H88 A;  1ZV8 A;  2FVE A;  2Y0D A;  1ZR2 A;  1RO0 A;  1HY8 A;  2GDW A;  2KYV A;  2RH0 A;  1EDJ A;  4I7Z C;  1ZRT D;  5B5E H;  2FXM A;  3CC2 P;  2HPC A;  1KQF B;  3HTK B;  2N1T B;  2IPP A;  3CPW O;  2PGD A;  1BE3 D;  1PL5 A;  5KJ7 D;  1D1D A;  1M8O B;  5AW9 B;  2HG5 D;  5GTH E;  2VLN A;  3CI9 A;  2KG8 A;  4BPF A;  2ZXX A;  1ZN5 A;  4U0A A;  2K2Q A;  3L70 J;  3IN6 A;  2W6J H;  1KIL A;  1NTK J;  2I1J A;  2K9J A;  1BCC G;  1WT6 A;  3TGU G;  1K05 A;  4OH8 B;  2OYH B;  2QJK B;  3L72 J;  2ZXE B;  3DPH A;  5C39 A;  2CPB A;  2E75 D;  5AW6 B;  3VMA A;  2K94 A;  1FZC B;  2SPZ A;  3MGN A;  2X2B A;  3G9R A;  1VQO P;  2L91 A;  3IF4 A;  2P67 A;  4D6T G;  1IFM A;  1L0L D;  1AQT A;  1XTC C;  4U0F A;  4U0E A;  1NTZ K;  1Q81 Q;  2E74 C;  3L71 E;  4WWI A;  4KJM A;  2KUB A;  3L75 E;  1FS0 E;  4U7J A;  3JC2 2;  3G26 A;  2WZ7 A;  1PGO A;  1FZG A;  2FYU D;  2P2U A;  3H1J E;  3CCE P;  3NTE A;  1PPJ E;  1JY2 P;  2JYG A;  1QVG O;  1LTJ C;  3QWO C;  3G1I A;  3CLQ A;  2OAR A;  1OVV A;  3A2A A;  3HD7 C;  1VQ7 P;  4HH2 A;  1MV8 A;  1OXZ A;  3CXC O;  1W2B O;  5CBN A;  4RES B;  3WMM 0;  2KLV A;  1LTA C;  3AEF C;  2HLO A;  5AVR B;  1YBK A;  3RL0 C;  1HGZ A;  4O9B A;  3AE8 C;  2EIA A;  1RF1 C;  2NPS B;  3RG2 A;  5BVZ A;  1PGQ A;  1ZP0 C;  5DJT B;  5E79 E;  4DCK A;  2KOG A;  1KFM A;  2E5Y A;  3H0D A;  3Q5R A;  2ZFC A;  2GZE A;  1PGJ A;  5KLV J;  3RK3 C;  1JB0 J;  2G8Y A;  2PEM A;  1NTZ D;  2QJP B;  3HRN A;  3WUU A;  3VYI A;  4OGQ C;  3Q3D A;  2Q3I A;  3B5N A;  3M91 A;  2QVA A;  3L71 G;  3AEE C;  4GR6 A;  3HE4 A;  2MF4 A;  2H89 C;  2IX7 C;  1A43 A;  2JAZ A;  1FE6 A;  5AW7 B;  5CCH C;  2JDI H;  3EQ2 A;  3CCL P;  1PEU A;  3P05 A;  3CX5 H;  2WQY C;  2NO8 A;  3H1J G;  5CHX A;  1PPJ G;  4U3F D;  5AW0 B;  3N7N A;  5APU A;  2LKI A;  1ZMB A;  3PH0 A;  4XA4 A;  1RH5 B;  1SS1 A;  2QE7 H;  2WPT A;  1SLQ A;  2IBZ D;  1W5C E;  2MKV A;  2W27 A;  4L75 A;  2KOS A;  5F2K A;  2W83 C;  3BVH A;  2WPR A;  1BDC A;  1OVU A;  2FFD B;  2HFE D;  1BGY D;  3CX5 I;  1GK6 A;  3JCU E;  2PEO A;  2YMY A;  1N7S D;  1UNK A;  2E76 D;  2A06 E;  1CW5 A;  2M0B A;  2YKP A;  2O3J A;  1H8A A;  1LTJ A;  2C0W A;  4M3L A;  3M9H A;  3FWN A;  4C7N A;  3HD7 A;  2N9Y B;  2LML A;  1N2D C;  3L4F A;  4Z1M H;  3CWB E;  2QM8 A;  4KHX A;  2AF8 A;  3R4Y A;  1M74 A;  3AE6 C;  4A7P A;  1MZ8 A;  2KNC A;  2ZYD A;  4YXD C;  1GU4 A;  1RE4 C;  1RF1 A;  2MJZ A;  1LTG C;  4IZ6 A;  1FZF A;  5M1B A;  1S4X A;  4HKZ H;  2C9L Y;  1NTM E;  5BU8 B;  1USE A;  3EWK A;  2WSC H;  2PEJ A;  3H1H E;  1ZRT E;  2FYZ A;  4WY4 B;  1MFZ A;  3WUV A;  4GDO A;  5KKZ B;  1JY3 O;  3HTK A;  2N1T A;  1YYC A;  5APT A;  3KXD A;  1FZA A;  3I55 P;  4ASV A;  1SQX G;  1OX3 A;  2N50 A;  1SQB J;  1LWU B;  4BPH A;  4H13 D;  1RF0 A;  2Y0C A;  2K0X A;  2R5B A;  1N73 C;  5CCH A;  2YKO A; 
#chains in the Genus database with same CATH homology
 4M0I A;  1VQ8 P;  3G26 A;  4COP A;  4XFZ A;  1NJI Q;  3WBH A;  3CMA P;  3DS4 A;  3M1M A;  2CWO A;  1VQK P;  3CD6 P;  4XFY A;  4U0B A;  1YJ9 P;  2OTJ P;  3G28 A;  3DS1 A;  2PEQ A;  5F2N A;  3CCE P;  3HYB A;  1PEM A;  3NTE A;  2XT1 A;  4XRO A;  1VQL P;  5F2K A;  2JYG A;  1YJW P;  1EIA A;  4PH1 A;  2XXM A;  1S72 P;  1QVG O;  1RO0 A;  1M90 Q;  4WYM A;  1M1K Q;  3DS0 A;  3G1I A;  1YJN P;  3CCR P;  2OAR A;  3CCU P;  3CC2 P;  3E2D A;  1KD1 Q;  2PEO A;  3CPW O;  3RG6 C;  3CME P;  4U0C A;  4XRQ A;  1VQ7 P;  1Q86 Q;  1AUM A;  3CCS P;  3CXC O;  1W2B O;  1PEO A;  5DCK A;  3B5I A;  2EFJ A;  3G1G A;  1YHQ P;  1A8O A;  2L6E A;  2PY8 A;  1RO2 A;  1D1D A;  5F2O A;  2Z46 A;  2PEK A;  1EOQ A;  3CCV P;  2M8P A;  5BS2 A;  1PEQ A;  3DS5 A;  1Q7Y Q;  2PEN A;  4U0A A;  1E6J P;  2EIA A;  2ONT A;  2BQ1 E;  1YI2 P;  1BAJ A;  1M6N A;  3G4S P;  2EG5 A;  3CC7 P;  1M6E X;  2QA4 P;  3G0V A;  1N8R Q;  1VQ4 P;  5HGM A;  3CCQ P;  1M74 A;  1K9M Q;  2M8L A;  1VQP P;  1KC8 Q;  1IUQ A;  3Q20 A;  1RNI A;  3DS3 A;  3DS2 A;  3H0D A;  3H47 A;  2Z44 A;  3G29 A;  3MGE A;  1QVF O;  2KOD A;  3I56 P;  2M8N A;  2XV6 A;  3DTJ A;  4GR2 A;  2JYL A;  3DPH A;  3OW2 O;  2DGY A;  1KQS O;  5HGL A;  2QEX P;  1VQ6 P;  1YIT P;  5BS1 A;  3H4E A;  2PEM A;  2PEJ A;  5I4T G;  2Z45 A;  1VQM P;  1VQN P;  1K30 A;  1K73 Q;  5HGO A;  3G71 P;  5JPA A;  3G21 A;  3LRY A;  5HGN A;  3VRL C;  3I55 P;  3CCM P;  1YIJ P;  1VQ9 P;  2OTL P;  4GR6 A;  2JO0 A;  1VQO P;  4IPY A;  1VQ5 P;  1A43 A;  3CCJ P;  2BHV A;  2PEI A;  4XFX A;  4U0D A;  3CCL P;  3CC4 P;  3P05 A;  1PEU A;  4U0F A;  2LF4 A;  4U0E A;  2BUO A;  4PH0 A;  1Q81 Q;  4COC A;  1Q82 Q;  3HZQ A;  2E1M A;  3G6E P;  1K8A Q;  1JJ2 O;  1QRJ A;  4QNB A;  1ZMB A;  2P9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...