1YJNP

Crystal structure of clindamycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 49
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2005-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1yjnP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1yjnP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1yjnP02
3CXCO 1Q7YQ 1VQ8P 3CCQP 2QA4P 1YJWP 1VQ6P 1YITP 1VQOP 1YI2P 1VQLP 1VQPP 2OTLP 1Q86Q 1YJNP 2OTJP 3OW2O 1K8AQ 1K9MQ 3CC7P 3CMEP 1VQ4P 3G4SP 1K73Q 3CD6P 3I56P 3CCVP 3G6EP 1YHQP 3CC4P 3CMAP 2QEXP 3G71P 1JJ2O 3CCSP 1KD1Q 3CCLP 1KC8Q 1W2BO 1M1KQ 3CCEP 1VQ7P 3CCUP 1YIJP 1S72P 1VQ5P 1N8RQ 1Q82Q 3CC2P 3CCRP 1VQ9P 1QVFO 1NJIQ 3CPWO 1M90Q 1Q81Q 1KQSO 3CCMP 3I55P 1VQMP 1VQKP 1YJ9P 1QVGO 3CCJP 1VQNP
chains in the Genus database with same CATH superfamily
1BDDA 1M1JA 1SFCB 2NO8A 2LMLA 4HKZH 5EJDA 1EZVE 2M5RA 2JDIH 5APQA 2D2CC 3EWKA 3G71P 1L0LG 2R5BA 1ZR2A 2W90A 2M3BA 4W7ZA 1J1EC 1SQPK 5APTA 2B9BA 2FAEA 1NTZD 3CX5D 2XNXA 3OAKA 1BCCG 1NO4A 1GL2D 3CMAP 1S4XA 1QGKB 3AEDC 4OGQD 1RE3A 4H44D 1QL2A 3RL0g 4GR6A 1KFMA 2G8YA 3V4WA 1VQNP 1JTHA 1SQXD 1GL2A 1FZBA 2KR5A 2OTLP 1A02J 2NPSA 3TK1A 3GHGA 1RO0A 1FJKA 3DS4A 2GZGA 1LWUB 1LT9A 2P2UA 2KZJA 3D6ZA 1PP9G 5TISE 3RL0B 3V2NA 2Z5IA 5B66E 2IX7C 1BAJA 1L0LD 1PL5A 2QJYC 3L72G 2MR7A 2YIUC 2B88A 5EW5E 3AE8C 4TT3H 1USDA 3M06A 1M8OB 3BCCG 2YKOA 1BE3E 4YTPC 3H32B 2N9YB 3KDPB 1KILA 3E7KA 1CZQA 3LMOA 1KB9I 1L4AC 1S9KD 5KP6B 3H1JD 2FXMA 1AVYA 1BCCD 3KQGA 2KP8A 1JY2P 5BU5A 3FXEA 4O9BA 3L71D 2IZ1A 3EQ2A 4PH1A 3T97B 3A0BE 3V6IA 1BGYD 1E6JP 1PV3A 5KP8B 1SFCA 4YXDC 2L9FA 1VQ5P 1NJIQ 3IN6A 1NTKJ 1YTZT 3B4SA 2KODA 1ZR4A 2XU6A 3KPEA 5L8RJ 4XFZA 2K9JB 5TISH 2CQ8A 2XV6A 2OTJP 1NYHA 1RE4C 2ZVNB 3L73E 5B66H 2PNGA 3RK2C 5KLIC 4EOTA 2LXCB 3NMDA 2OYHB 2OYIA 1BDCA 1S72P 3L75E 3E1RA 1T2KC 3TGUE 3TNUB 1ZLLA 3AECC 3G26A 1TU3F 2A45G 2GM4A 3HTKB 2LPKA 1AVOA 2ZVOB 1NTMK 2AEJA 2GZIA 1JO5A 3B5IA 1LTGC 2AXTE 3RL0D 3EFGA 2A45H 2DNWA 1Q81Q 2YNYA 2L5GB 3P05A 1JEKA 5HVCA 4JQ0D 1M6NA 3L75G 3TGUG 3SFEC 2FFDC 4U3FJ 3JC22 3CCLP 3D70A 4R4LA 3WU2H 4H0LB 1GK4A 3M0AA 3DS5A 3L74E 5AVRB 1HF9A 2JGPA 1U7MA 2HFED 1JOCA 2J58A 2LR2A 1IMQA 1IMPA 3U43A 1SQPE 3K5BA 4YXWH 1KB9E 1T3JA 1L0LJ 1X22A 2HODB 1SQBG 4MRTC 1RQVA 1GPJA 3T97A 3V2QA 1KZUB 1OZHA 2AXTH 1FZCB 1L0NE 1FZAA 4LLHA 1S1CX 1URQD 5AVXB 2JO0A 1NU1G 1LNQA 1YHQP 3L74G 2OQQA 1JJ2O 1VPCA 1BCCJ 1SQVG 1ZN5A 5F2KA 2YKQA 2WTYA 3E1IA 2KORA 2R32A 1RQUA 2QNWA 4EYYQ 2XZ0D 1YI2P 1UIIA 1YYCA 2JU1A 2FYZA 4W80A 1JY2N 4NPEA 1LTSC 1L0NG 2MJZA 2PEQA 2KYVA 1KB9H 1PP9J 3M0DA 3M9QA 2B87B 1PPJE 3HD7B 2E74D 3L72J 2KOOA 4IL6E 2E76D 1YJNP 4PV1B 2BCCG 2WMMA 3BCCJ 1N7SC 1M6EX 4GIFA 1MFTA 3H1LE 2IPPA 1CW5A 2JWAA 3RK3B 3H1HD 5KLVD 5KJ7A 1G1IA 1Q82Q 1T8ZA 2NRGA 4L75A 1AF8A 1NU1D 1NTZK 4BPHA 2GZFA 3B5NB 3MGEA 2VLPA 1VQOP 3M91A 3NTEA 4AQRD 1WRGA 1EDLA 1KYOD 2K88A 2WPTA 1NQ4A 1J1DC 3L70D 1JCCA 3KYQA 3FX0A 1M1JC 1BE3J 2FYUK 2BASA 2QA4P 5AW2B 1HGZA 3H1IE 3H1LG 2N50A 4IFFA 2VRSA 4N78E 3RBXA 2GDWA 1T2KD 1NTME 1FZCA 3GKLC 1U57A 4LC1A 2BCCD 2IBZI 2Z5HA 1LP1B 1HH0A 3CCQP 3W68A 1DV5A 1L2PA 1HJBA 2WVRA 1M7LA 3V2PA 3VMYA 3H1IG 5CMZA 4WY4D 2H8PD 1GL2C 5CBOA 3HD7D 4OGQC 3GHGC 1NTMG 2M8RA 3VRLC 4H44C 4PV1D 5CCHD 4K35A 4UB8E 3MUDA 3L75J 3TGUJ 1USEA 2N98A 2B87A 1WT6A 3HD7A 3QH9A 2P9XA 3BVHA 2QM7A 2Q7CA 2KWLA 1W5CE 3C9IA 3B5ND 2E75B 2CPBA 1FOSE 1GZLA 5AW0B 3AEAC 2JO1A 4I6MC 1YQ4C 1DIPA 1A43A 4KT0J 5AW3B 3HZQA 2EHSA 2KOSA 1JMBA 1SQBJ 3Q5PA 2K5XA 2XDJA 1M90Q 3EJEA 2V7QH 3KXDA 1SQQG 2B89A 2KOGA 3FWLA 4XA4A 2LXBA 4PH0A 1IFDA 5AW5B 5TJHA 4RESB 1IO4A 4RKUJ 5CCGD 3CWBE 2KZIA 4B86A 2ONTA 2EFJA 3L74J 1SQVJ 3ZDMA 4XROA 3VMAA 3VTPC 2Q3IA 1VF5B 2A06E 1YJWP 2J5UA 4HYTB 1OR5A 3P8MC 1DX7A 4RJTA 1FBMA 1LP1A 4Y28J 1EXIA 4M3LA 5H2FE 2KB7P 2FVFA 3RG6C 4HKGA 3M1MA 1JTHB 2IBZE 1L0NJ 2CGQA 3P7KA 2NPSB 1IFJA 1PEOA 2JB0A 2OGUA 5E79E 1E0HA 2HPCB 2LTEA 1NTZE 2YXRB 1LT9B 2LKMA 1FZFA 2ZYDA 3CMEP 1N2DC 3GMAA 2C9LY 1LWUC 2KI7B 2POHA 2ZJSE 2E75D 1RF1A 3RL0C 3B71A 3H1KE 2FYUE 2AVAA 3RG2A 3E2DA 2IBZG 3CXHI 4JPZB 1P84H 1NTKD 2Q3EA 2BEZF 4C7NA 3H0DA 1ZXGA 2QSIA 4WVZA 2Y9ZA 4PD4D 2EG5A 2WPRA 1GXGA 4JYCA 3WBHA 2P1JA 1N73A 5H2FH 2KG6A 2Z45A 3HUSB 3B8EB 2Y0EA 3WUTA 2XXMA 3H1LJ 3VP9A 4BPFA 1Q90D 4QMAA 3GW6A 5E79H 4WB4A 2W8ZA 1X79B 2PEKA 4WBAA 1VF5D 2YO2A 2MF4A 2KG8A 3L35A 2SPZA 3L71E 4Y99C 2OYIB 5AW7B 2YMYA 3P8CE 1LTTC 1X3OA 1URQC 3A0HH 3AE2C 1NWQA 2NPSD 2Q5UA 1IK7A 3H1IJ 4A7PA 2OYHC 1CI6A 4OWFA 4U3FD 1YBKA 4D6TE 1EZVG 5AVWB 2BEQD 2FVEA 1MZ8A 1AUMA 1NTMJ 3TSIA 1DH3A 3WUUA 3KHUA 1ZRTD 2JP3A 4NPDA 3A3YB 2ZYGA 2DW3A 2HPCA 3O6QB 3WMM0 3A7OA 4AYCA 1H8AA 2PEJA 2N5IA 1KILD 1ZMBA 1R8EA 3S4RA 4XRQA 2V7QJ 4ZKPA 4COPA 7CEIA 4EI2A 2E74C 2L6EA 1AYIA 4UB6E 5KAFE 2PEOA 3CCSP 4D6TG 1S3JA 2E76C 1S5LE 4ASWA 1LTAC 2E43A 3GZMA 2ROQA 1RY3A 4JBZA 4L73A 4TLFA 1OW7A 1SQQJ 3EFFK 5AW8B 1SFCD 2WPVB 3CXHE 5CJ4A 1GTWA 1KYOI 2M3EA 4YPCA 1N7LA 2FQ2A 2FY8A 2IDBA 3HUSA 1EZVD 5AVQB 3SWYA 3GLMA 3CE7A 3G29A 2FXOA 4COCA 2QJPB 4M0IA 2R44A 5GTIE 1BE3G 3SSUA 3GZLA 2C0XA 3CI9A 2D2CB 2WWWA 1EQ7A 1PP9D 1PEMA 1MUUA 1VDFA 3Q5RA 1W2BO 1EOQA 3HRNA 3L72D 1DEEG 1OVUA 1MV8A 3BCCD 4UB6H 5KAFH 1H89A 3U1CA 3CWBJ 3Q5SA 1ZMEC 4DG9A 4IL6X 3CCVP 3CXHH 2IFNA 4N3YB 1IK9A 3MIWA 5DCKA 1AQ5A 1ZOYC 1RH5B 1HQBA 3A0BH 3L73G 3O6QA 2PENA 4WY4C 2PRRA 3Q20A 3DPHA 2WITA 3HD7C 2R3CA 1UNKA 4PV1C 1BE3D 2K0XA 5CCHC 4I7ZC 4R0MA 1M1KQ 3TF5A 1BXIA 5AW6B 3R2PA 5HGLA 2QJYB 4EIJA 2FVAA 3SWFA 4H2XC 3NXSA 1FR2A 2QG4A 2CG5B 1OX3A 3B5NC 4U0BA 4BRYB 1K73Q 1UJZA 2XT1A 1G1JA 3LIEA 1FS0E 2EHTA 3NY7B 3PJSK 3CCUP 2O01H 3H4EA 1NH4A 2VLQA 2FYUJ 2KGCA 3CCMP 2LIWA 4JF7A 5CHXA 1A8OA 1KYOE 5APVA 1H88A 3DS0A 2GDXA 5HGMA 2FXPA 1SP4A 1QRJA 2XZ1C 5BU8B 3G6EP 1PEQA 1R5SA 2FHSC 2LOLA 5CCGC 2AFEA 2P58A 2IZ0A 3L75D 3EJDA 3TGUD 1OFCX 4MN4C 1NTKK 1SQPG 2FADA 2PY8A 2GZJA 2JQ4A 3GJNA 4GT1A 5K5GB 2UWJE 1ACPA 1VHNA 5AW4B 2WSFH 3SFDC 1N8RQ 1MKMA 1FZGA 4XFJA 3L4FA 5KJ7D 2WSEH 5BVZA 3BATA 4U0DA 2K37A 1SQBD 3V4QA 4GKGA 1K9MQ 1L0IA 2Y0CA 4H0LD 4D6TJ 1YIJP 1SLQA 5KAIE 1EDJA 3OJAB 2Z4EA 1M57D 3S1KA 4I2LC 1FDIA 3L74D 1FDOA 1SQVD 2O3JA 2E75C 1Y47A 2I8DA 4HH2A 1SQPD 2FACA 1KB9D 5EFWB 3G9RA 2H88C 1PPJG 2O1JA 1SQXK 4BRYA 1L4AA 2P7JA 2JWDA 1NGMB 4KJMA 3CXCO 2O01N 1K04A 1L0ND 4H2WC 3D71A 2AEMA 3DS3A 1DD3A 3A5TA 2PEIA 2OYOA 3N7NA 4IL6H 1L0LK 1KLPA 4F37A 1W2EA 2QJKC 3MGNA 2I1KA 2CPSA 1T6AA 4I1LA 2KGAA 1VF5C 2OARA 5KAIH 4ZKUA 2Z44A 2JR8A 3CX5I 1HY8A 2PAJA 4LGDE 1RE3C 2WSCH 2ZXEB 2FYNC 3G3ZA 2PEMA 2NPSC 1HGVA 3L73J 2CK3H 2IFMA 1GD2E 1LT9C 1IUQA 3RK3D 1RHZB 5I4TG 1RF1B 4BXLA 3H1LD 2P67A 1LTJB 2KS1A 4GR2A 4PJ0E 5AVVB 2C9NY 1Q7YQ 4C7NB 2O01J 2K92A 2Y9YA 3Q1MA 4IZ6A 3NFQA 1FOSF 1KILC 2KOQA 2P10A 1T3UA 1N73B 3LW5H 2L22A 3G1GA 1GW4A 2ERHA 1X8YA 1JUNA 5DJUB 1NAFA 1NTKE 2QVAA 1K30A 3F5HA 3HUSC 4H2YC 3H1ID 3MD0A 4GDOA 1SFCC 5KKZB 1RF0A 3LIDA 4WYMA 3M9HA 2GYKA 1NTMD 3PP5A 2CWOA 2WZ7A 4UB8H 1PEUA 1CSBA 2WSFJ 3RGUA 1IJDB 4H13B 1SQPJ 1XTCC 2WQYC 4PJ0H 3PLNA 1MFZA 2WSEJ 2OYIC 1CI6B 2QEXP 3H6PA 3CCEP 1GK6A 2VLOA 1EXJA 1GU5A 2N9BA 3CWBG 4L74A 1IFMA 3AEEC 1KV4A 3U1AA 3CX5E 1PGQA 3G0VA 3JCUE 3OW2O 4U0CA 1JY3O 1GU4A 1RNIA 1N86A 1SQQD 2A06G 2BHVA 1LT1A 1S5LX 2LKIA 4OGQB 2YKPA 2K0DX 1KQSO 1SQXE 4H44B 2IYPA 5AVZB 2ZAEB 3DTJA 1LTJA 1D1DA 4Z1MH 2JKVA 2W6JH 1VQ4P 1U7JA 1EDKA 1DEBA 2N1TB 1VQ7P 1N7SA 1VKUA 1NTZG 4ZMDA 1KILE 5F2NA 5GTHE 4KHXA 3EJBA 3ITKA 1L0LE 2H43A 3IF4A 2KGEA 3PTZA 2KSEA 4UHPB 3DS1A 1E5WA 1PFIA 3CWBD 1S9KE 1AQTA 3CX5H 1KC8Q 4WWIA 3H1JE 4HB1A 1F80D 3JCUH 1HUCA 2JYLA 4ASVA 3CCRP 4BPGA 1BCCE 3H1KG 2FYUG 1SQBK 2WSCJ 1X9VA 2VLNA 3CCJP 2A06D 1P84D 2QJPC 1NKNA 1PGOA 1JCDA 3GF7A 1K8AQ 3DS2A 5KLVK 3CC7P 1BGYE 3FGAD 1NVOA 1NU1K 1QX8A 2H7HA 3AE1C 3LRYA 1SQVK 2M8NA 1MZ9A 3IAOA 2IBZD 3PHLA 4IOIH 1YJ9P 1Y9BA 1PZQA 1PP9E 2KSJA 5GTHH 3H1JG 3H25A 5CJ0A 1NKZB 2Q1KA 2KUBA 3L72E 5JPAA 3BCCE 2K2QA 1KMIZ 1M56D 3M0DC 3L71G 3LW5J 1L0NK 3FXDA 2LL8A 2K3RA 1AV1A 5DJTB 1BGYG 1VQ8P 2ZT9B 3VN0A 1LJ2A 5F2OA 1GMJA 1M74A 3H1KD 2FYUD 2EIAA 2BQ1E 3G4SP 4IFDK 5KJ7C 2N1TD 2HG5D 2KOPA 3BRVB 3II6A 1NAYA 1OMIA 3AE5C 1VQMP 1IC2A 4H0LC 4R4MA 1YTZI 2N1TA 1KQFB 3VP8A 3B4QA 2HYNA 5M1BA 3TYYA 3HE4B 3I5CA 2XV5A 2R5DA 2JEEA 2I1JA 4HJGH 2BUOA 4L76A 1HJ0A 2YO3A 1QVGO 4U0AA 3IFMA 1FJPA 1YITP 3Q3DA 1FZCC 1S2EA 4N6JA 2KK7A 3P8CD 1CEIA 1OXZA 5AVSB 2FBWC 2V4HA 1J1EB 4DJGA 2KNCB 2JBGA 4Y99B 2JAZA 2J59M 1IFIA 1S5LH 4D6TD 3HE5B 3WU2E 1QL1A 2JYGA 1URQB 3AE3C 5KP7B 3I56P 1DD4A 3MP7B 3D6YA 3AE4C 1KD1Q 3N4XA 2GUVA 2WT7B 1KQGB 1PGPA 4W7YA 2N6ZA 1JB0J 2ZT9D 3I55P 2HLOA 3G21A 1IFPA 3AE6C 3MUDC 3G1IA 1IZNB 4U0FA 2MKVA 4XFXA 1NOHA 2ZFCA 4OVNF 5GTIH 2K1AA 2PGDA 2YXQB 1ZP0C 1OWAA 1NTZJ 2KLVA 3RK3C 1LWUA 3V5BA 1ZNVA 3CL3D 2YIUB 1SQBE 1Z56A 1E79H 3HYBA 2E74B 3CXHD 1LTIC 2MVVA 2E76B 1L4AB 3H1HE 5KLVE 2KXPB 3M9BA 1SQXJ 1NU1E 3H32A 2RN0A 3F89A 1FDMA 2QRXA 3AEFC 3HE4A 1T8KA 1SQVE 3H1KJ 2MR8A 4CPGA 1GXHA 5AVYB 5AW9B 2D2CD 1SQQK 3PRJA 1RF0C 1LTBC 3AEBC 3VOPA 1FAVA 1Q2NA 3Q2YA 3L70E 1FE6A 2PP6A 3H47A 2GA1A 4EDFA 5CZDB 3L73D 3NTNA 1G2CB 2M8LA 2H89C 5CBNA 5B5EE 1AA0A 2WSSH 1HWTC 3C8VA 1JY3P 3OA7A 1EMVA 3H1HG 5KLVG 4GODA 4CA3A 2K9YA 1Q86Q 4NPFX 2L91A 5APWA 3H1JJ 4RO0A 3SWKA 2JU2A 3RK2B 2JJLA 3MTUE 2KNCA 2AXCA 5KLIB 3JSVC 3A2AA 2K9JA 2W83C 3HE5A 2BCCE 3S9OA 1VQ9P 1URQA 5APXA 4OH8B 3L71J 2LIUA 3L70G 2OYHA 1BGYJ 1GDTA 3TNUA 3PH0A 2WT7A 4DZOA 2QE7H 3VYIA 2KS1B 4XE5B 1XTGB 3HTKA 1GW3A 1KYOH 3WUVA 3CC2P 1RF1C 4AUWA 4WY4B 2ZYAA 1LTJC 1HTLC 1R5LA 2KGDA 4PWVB 5B5EH 2N6YA 4JYBA 1QLED 2FFDB 5AVUB 1L4AD 3RK3E 4I7ZB 4C46A 4IPYA 2E5TA 2N5HA 2AEFA 4PD4I 2E42A 1N73C 5APSA 2XNDH 2C0WA 2PFXA 1VQ6P 4QNBA 1ZW0A 1NHLA 2K93A 5HGNA 3CD6P 5APYA 2XKMA 5KKZC 2M0BA 1D7MA 1HBWA 1J2JB 1LGHB 3RBZA 3TDKA 1FC2C 1KN7A 1WMKA 1OVRA 1G2CA 1P84I 2HODA 1PIXA 1OVVA 3IR9A 3RK2D 4H13C 2E5YA 2KW2A 1YQ3C 5HV8A 1VL2A 2KLUA 2YMKA 2GZEA 1JY2O 1RE4A 2R3SA 1JNMA 1OW6A 2Q6QA 1PGJA 4GOFA 3O8ZA 2VSQA 1A02F 1UIXA 2G3AA 2Y0DA 2WPSA 2MD9A 2M5AB 2OTKE 1AFOA 1KFNA 5HGOA 2L0QA 2L4BA 2W6AA 3C1LA 1OIPA 1HVVA 1ZV8A 1VQPP 1SVFA 1PPJD 3UIAA 3KZIE 2IYOA 4DT0A 1EDIA 2FQ0A 4ZNCA 2M8PA 2LF4A 4DCKA 1JM0A 4QKOA 1KORA 2RKLA 1JY3N 1N7SB 3BASA 1SQQE 4WY4A 4XFYA 2O1KA 5AW1B 2FFDA 1Z6MA 5CCHA 2QIWA 1QVFO 2N1TC 2Z46A 1QEXA 1H0TB 5KTBA 1AJYA 2HR3A 3R4YA 3QWOC 3G28A 3ABVC 4PXHB 1J1DB 2DGYA 4DOJA 1L0HA 4PD4E 4BWNA 3B5NA 1EZVI 4N78D 1EIAA 5AVTB 3L36A 2MVUA 1M1JB 1KTMA 3CLQA 3KZIH 2AF8A 1VQKP 4IFMA 4C7RA 4NEOA 2W6BA 2K94A 1K05A 3H1HJ 5KLVJ 2GDYA 2RH0A 2AFDA 1DNYA 1NU1J 2XZRA 3CC4P 2QJKB 1NTKG 2ZXXA 5CCGA 2E1MA 1P84E 2FQ1A 3GF3A 1Y8AA 2X2BA 4GOEA 2QM8A 3BRTB 3L70J 3FWNA 1SS1A 5BS2A 2M5AA 1FZEA 2FYNB 3V2RA 1GL2B 2CNRA 1BSNA 1X0TA 2MY5A 4U3FE 3GG2A 3GHGB 4PD4H 3U59A 1OW8A 1IFNA 1N7SD 1ZRTE 2KIKA 3P32A 2W27A 2FKWB 2ZT9C 5APUA 2BCCJ 3AE7C 3VMXA 3W67A 3AEGC 2Q9IA 2GUSA 5BS1A 1BSHA 2KG9A 4U7JA 2NZ2A 3CPWO 2WPQA 3USSA 3MZWB 3VMZA 4K3AA 1KILB 3AE9C 1EC5A 2RMZA 3A0HE 2K0YA 1VQLP 5C39A 1H0TA 4U3FG 1JMMA 1RO2A 3MHVA 1KQLA 2A45I 1SQXG 2ITAA 1FU1A 4U0EA 4H13D 3L37A
chains in the Genus database with same CATH topology
2PENA 3MGEA 1VQOP 4XRQA 3NTEA 3Q20A 3DPHA 4U0DA 3G0VA 1Q86Q 3E2DA 4COPA 3OW2O 2JYGA 1K9MQ 1IUQA 1A43A 4U0CA 1RNIA 3H0DA 3I56P 3HZQA 2L6EA 4PH1A 3CC4P 3G71P 2PEOA 3CCSP 5I4TG 5JPAA 1E6JP 1KD1Q 2BHVA 1M1KQ 2EG5A 1YIJP 1VQ5P 5HGLA 1VQ9P 1NJIQ 3WBHA 4GR2A 1M90Q 1KQSO 2E1MA 2Z45A 3I55P 2KODA 1Q7YQ 3G21A 1VQ8P 5HGOA 2QA4P 4PH0A 4XFZA 3G1IA 2XXMA 3DTJA 5F2OA 1VQPP 4U0FA 1D1DA 2XV6A 4XFXA 2OTJP 1M74A 2JO0A 5BS2A 4U0BA 2EIAA 2BQ1E 1VQ4P 3G4SP 1K73Q 2XT1A 1YHQP 3CMAP 1JJ2O 2ONTA 2EFJA 3G1GA 5F2KA 2PEKA 1VQ7P 3CCUP 1S72P 4XROA 3CC2P 3G29A 3H4EA 5F2NA 2M8PA 3G26A 4COCA 2LF4A 3CCMP 4GR6A 1VQMP 4M0IA 1VQNP 3CXCO 3CCQP 1A8OA 1YJWP 1YI2P 1K30A 3DS0A 3HYBA 2OTLP 5HGMA 1RO0A 3DS1A 3DS3A 1QRJA 4XFYA 4IPYA 3DS4A 1PEMA 3G6EP 4WYMA 1PEQA 3B5IA 2PEIA 3RG6C 1KC8Q 1W2BO 1EOQA 3M1MA 2CWOA 2JYLA 2PEQA 5BS1A 3CCRP 1QVFO 2Z46A 3CPWO 1Q81Q 1PEUA 2BUOA 1PEOA 1QVGO 4U0AA 3CCJP 1BAJA 3P05A 1VQ6P 2OARA 2PY8A 1YITP 3VRLC 1AUMA 4QNBA 3G28A 1VQLP 1M6NA 1YJNP 2Z44A 1K8AQ 3DS2A 2DGYA 3CC7P 3CMEP 5HGNA 3CD6P 1M6EX 1RO2A 3CCVP 3H47A 3CCLP 2QEXP 1EIAA 2P9XA 2M8LA 3CCEP 3LRYA 5DCKA 1N8RQ 1Q82Q 2M8NA 4U0EA 2PEJA 3DS5A 2PEMA 1VQKP 1YJ9P 1ZMBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CXC O;  1Q7Y Q;  1VQ8 P;  3CCQ P;  2QA4 P;  1YJW P;  1VQ6 P;  1YIT P;  1VQO P;  1YI2 P;  1VQL P;  1VQP P;  2OTL P;  1Q86 Q;  1YJN P;  2OTJ P;  3OW2 O;  1K8A Q;  1K9M Q;  3CC7 P;  3CME P;  1VQ4 P;  3G4S P;  1K73 Q;  3CD6 P;  3I56 P;  3CCV P;  3G6E P;  1YHQ P;  3CC4 P;  3CMA P;  2QEX P;  3G71 P;  1JJ2 O;  3CCS P;  1KD1 Q;  3CCL P;  1KC8 Q;  1W2B O;  1M1K Q;  3CCE P;  1VQ7 P;  3CCU P;  1YIJ P;  1S72 P;  1VQ5 P;  1N8R Q;  1Q82 Q;  3CC2 P;  3CCR P;  1VQ9 P;  1QVF O;  1NJI Q;  3CPW O;  1M90 Q;  1Q81 Q;  1KQS O;  3CCM P;  3I55 P;  1VQM P;  1VQK P;  1YJ9 P;  1QVG O;  3CCJ P;  1VQN P; 
#chains in the Genus database with same CATH topology
 1BDD A;  1M1J A;  1SFC B;  2NO8 A;  2LML A;  4HKZ H;  5EJD A;  1EZV E;  2M5R A;  2JDI H;  5APQ A;  2D2C C;  3EWK A;  3G71 P;  1L0L G;  2R5B A;  1ZR2 A;  2W90 A;  2M3B A;  4W7Z A;  1J1E C;  1SQP K;  5APT A;  2B9B A;  2FAE A;  1NTZ D;  3CX5 D;  2XNX A;  3OAK A;  1BCC G;  1NO4 A;  1GL2 D;  3CMA P;  1S4X A;  1QGK B;  3AED C;  4OGQ D;  1RE3 A;  4H44 D;  1QL2 A;  3RL0 g;  4GR6 A;  1KFM A;  2G8Y A;  3V4W A;  1VQN P;  1JTH A;  1SQX D;  1GL2 A;  1FZB A;  2KR5 A;  2OTL P;  1A02 J;  2NPS A;  3TK1 A;  3GHG A;  1RO0 A;  1FJK A;  3DS4 A;  2GZG A;  1LWU B;  1LT9 A;  2P2U A;  2KZJ A;  3D6Z A;  1PP9 G;  5TIS E;  3RL0 B;  3V2N A;  2Z5I A;  5B66 E;  2IX7 C;  1BAJ A;  1L0L D;  1PL5 A;  2QJY C;  3L72 G;  2MR7 A;  2YIU C;  2B88 A;  5EW5 E;  3AE8 C;  4TT3 H;  1USD A;  3M06 A;  1M8O B;  3BCC G;  2YKO A;  1BE3 E;  4YTP C;  3H32 B;  2N9Y B;  3KDP B;  1KIL A;  3E7K A;  1CZQ A;  3LMO A;  1KB9 I;  1L4A C;  1S9K D;  5KP6 B;  3H1J D;  2FXM A;  1AVY A;  1BCC D;  3KQG A;  2KP8 A;  1JY2 P;  5BU5 A;  3FXE A;  4O9B A;  3L71 D;  2IZ1 A;  3EQ2 A;  4PH1 A;  3T97 B;  3A0B E;  3V6I A;  1BGY D;  1E6J P;  1PV3 A;  5KP8 B;  1SFC A;  4YXD C;  2L9F A;  1VQ5 P;  1NJI Q;  3IN6 A;  1NTK J;  1YTZ T;  3B4S A;  2KOD A;  1ZR4 A;  2XU6 A;  3KPE A;  5L8R J;  4XFZ A;  2K9J B;  5TIS H;  2CQ8 A;  2XV6 A;  2OTJ P;  1NYH A;  1RE4 C;  2ZVN B;  3L73 E;  5B66 H;  2PNG A;  3RK2 C;  5KLI C;  4EOT A;  2LXC B;  3NMD A;  2OYH B;  2OYI A;  1BDC A;  1S72 P;  3L75 E;  3E1R A;  1T2K C;  3TGU E;  3TNU B;  1ZLL A;  3AEC C;  3G26 A;  1TU3 F;  2A45 G;  2GM4 A;  3HTK B;  2LPK A;  1AVO A;  2ZVO B;  1NTM K;  2AEJ A;  2GZI A;  1JO5 A;  3B5I A;  1LTG C;  2AXT E;  3RL0 D;  3EFG A;  2A45 H;  2DNW A;  1Q81 Q;  2YNY A;  2L5G B;  3P05 A;  1JEK A;  5HVC A;  4JQ0 D;  1M6N A;  3L75 G;  3TGU G;  3SFE C;  2FFD C;  4U3F J;  3JC2 2;  3CCL P;  3D70 A;  4R4L A;  3WU2 H;  4H0L B;  1GK4 A;  3M0A A;  3DS5 A;  3L74 E;  5AVR B;  1HF9 A;  2JGP A;  1U7M A;  2HFE D;  1JOC A;  2J58 A;  2LR2 A;  1IMQ A;  1IMP A;  3U43 A;  1SQP E;  3K5B A;  4YXW H;  1KB9 E;  1T3J A;  1L0L J;  1X22 A;  2HOD B;  1SQB G;  4MRT C;  1RQV A;  1GPJ A;  3T97 A;  3V2Q A;  1KZU B;  1OZH A;  2AXT H;  1FZC B;  1L0N E;  1FZA A;  4LLH A;  1S1C X;  1URQ D;  5AVX B;  2JO0 A;  1NU1 G;  1LNQ A;  1YHQ P;  3L74 G;  2OQQ A;  1JJ2 O;  1VPC A;  1BCC J;  1SQV G;  1ZN5 A;  5F2K A;  2YKQ A;  2WTY A;  3E1I A;  2KOR A;  2R32 A;  1RQU A;  2QNW A;  4EYY Q;  2XZ0 D;  1YI2 P;  1UII A;  1YYC A;  2JU1 A;  2FYZ A;  4W80 A;  1JY2 N;  4NPE A;  1LTS C;  1L0N G;  2MJZ A;  2PEQ A;  2KYV A;  1KB9 H;  1PP9 J;  3M0D A;  3M9Q A;  2B87 B;  1PPJ E;  3HD7 B;  2E74 D;  3L72 J;  2KOO A;  4IL6 E;  2E76 D;  1YJN P;  4PV1 B;  2BCC G;  2WMM A;  3BCC J;  1N7S C;  1M6E X;  4GIF A;  1MFT A;  3H1L E;  2IPP A;  1CW5 A;  2JWA A;  3RK3 B;  3H1H D;  5KLV D;  5KJ7 A;  1G1I A;  1Q82 Q;  1T8Z A;  2NRG A;  4L75 A;  1AF8 A;  1NU1 D;  1NTZ K;  4BPH A;  2GZF A;  3B5N B;  3MGE A;  2VLP A;  1VQO P;  3M91 A;  3NTE A;  4AQR D;  1WRG A;  1EDL A;  1KYO D;  2K88 A;  2WPT A;  1NQ4 A;  1J1D C;  3L70 D;  1JCC A;  3KYQ A;  3FX0 A;  1M1J C;  1BE3 J;  2FYU K;  2BAS A;  2QA4 P;  5AW2 B;  1HGZ A;  3H1I E;  3H1L G;  2N50 A;  4IFF A;  2VRS A;  4N78 E;  3RBX A;  2GDW A;  1T2K D;  1NTM E;  1FZC A;  3GKL C;  1U57 A;  4LC1 A;  2BCC D;  2IBZ I;  2Z5H A;  1LP1 B;  1HH0 A;  3CCQ P;  3W68 A;  1DV5 A;  1L2P A;  1HJB A;  2WVR A;  1M7L A;  3V2P A;  3VMY A;  3H1I G;  5CMZ A;  4WY4 D;  2H8P D;  1GL2 C;  5CBO A;  3HD7 D;  4OGQ C;  3GHG C;  1NTM G;  2M8R A;  3VRL C;  4H44 C;  4PV1 D;  5CCH D;  4K35 A;  4UB8 E;  3MUD A;  3L75 J;  3TGU J;  1USE A;  2N98 A;  2B87 A;  1WT6 A;  3HD7 A;  3QH9 A;  2P9X A;  3BVH A;  2QM7 A;  2Q7C A;  2KWL A;  1W5C E;  3C9I A;  3B5N D;  2E75 B;  2CPB A;  1FOS E;  1GZL A;  5AW0 B;  3AEA C;  2JO1 A;  4I6M C;  1YQ4 C;  1DIP A;  1A43 A;  4KT0 J;  5AW3 B;  3HZQ A;  2EHS A;  2KOS A;  1JMB A;  1SQB J;  3Q5P A;  2K5X A;  2XDJ A;  1M90 Q;  3EJE A;  2V7Q H;  3KXD A;  1SQQ G;  2B89 A;  2KOG A;  3FWL A;  4XA4 A;  2LXB A;  4PH0 A;  1IFD A;  5AW5 B;  5TJH A;  4RES B;  1IO4 A;  4RKU J;  5CCG D;  3CWB E;  2KZI A;  4B86 A;  2ONT A;  2EFJ A;  3L74 J;  1SQV J;  3ZDM A;  4XRO A;  3VMA A;  3VTP C;  2Q3I A;  1VF5 B;  2A06 E;  1YJW P;  2J5U A;  4HYT B;  1OR5 A;  3P8M C;  1DX7 A;  4RJT A;  1FBM A;  1LP1 A;  4Y28 J;  1EXI A;  4M3L A;  5H2F E;  2KB7 P;  2FVF A;  3RG6 C;  4HKG A;  3M1M A;  1JTH B;  2IBZ E;  1L0N J;  2CGQ A;  3P7K A;  2NPS B;  1IFJ A;  1PEO A;  2JB0 A;  2OGU A;  5E79 E;  1E0H A;  2HPC B;  2LTE A;  1NTZ E;  2YXR B;  1LT9 B;  2LKM A;  1FZF A;  2ZYD A;  3CME P;  1N2D C;  3GMA A;  2C9L Y;  1LWU C;  2KI7 B;  2POH A;  2ZJS E;  2E75 D;  1RF1 A;  3RL0 C;  3B71 A;  3H1K E;  2FYU E;  2AVA A;  3RG2 A;  3E2D A;  2IBZ G;  3CXH I;  4JPZ B;  1P84 H;  1NTK D;  2Q3E A;  2BEZ F;  4C7N A;  3H0D A;  1ZXG A;  2QSI A;  4WVZ A;  2Y9Z A;  4PD4 D;  2EG5 A;  2WPR A;  1GXG A;  4JYC A;  3WBH A;  2P1J A;  1N73 A;  5H2F H;  2KG6 A;  2Z45 A;  3HUS B;  3B8E B;  2Y0E A;  3WUT A;  2XXM A;  3H1L J;  3VP9 A;  4BPF A;  1Q90 D;  4QMA A;  3GW6 A;  5E79 H;  4WB4 A;  2W8Z A;  1X79 B;  2PEK A;  4WBA A;  1VF5 D;  2YO2 A;  2MF4 A;  2KG8 A;  3L35 A;  2SPZ A;  3L71 E;  4Y99 C;  2OYI B;  5AW7 B;  2YMY A;  3P8C E;  1LTT C;  1X3O A;  1URQ C;  3A0H H;  3AE2 C;  1NWQ A;  2NPS D;  2Q5U A;  1IK7 A;  3H1I J;  4A7P A;  2OYH C;  1CI6 A;  4OWF A;  4U3F D;  1YBK A;  4D6T E;  1EZV G;  5AVW B;  2BEQ D;  2FVE A;  1MZ8 A;  1AUM A;  1NTM J;  3TSI A;  1DH3 A;  3WUU A;  3KHU A;  1ZRT D;  2JP3 A;  4NPD A;  3A3Y B;  2ZYG A;  2DW3 A;  2HPC A;  3O6Q B;  3WMM 0;  3A7O A;  4AYC A;  1H8A A;  2PEJ A;  2N5I A;  1KIL D;  1ZMB A;  1R8E A;  3S4R A;  4XRQ A;  2V7Q J;  4ZKP A;  4COP A;  7CEI A;  4EI2 A;  2E74 C;  2L6E A;  1AYI A;  4UB6 E;  5KAF E;  2PEO A;  3CCS P;  4D6T G;  1S3J A;  2E76 C;  1S5L E;  4ASW A;  1LTA C;  2E43 A;  3GZM A;  2ROQ A;  1RY3 A;  4JBZ A;  4L73 A;  4TLF A;  1OW7 A;  1SQQ J;  3EFF K;  5AW8 B;  1SFC D;  2WPV B;  3CXH E;  5CJ4 A;  1GTW A;  1KYO I;  2M3E A;  4YPC A;  1N7L A;  2FQ2 A;  2FY8 A;  2IDB A;  3HUS A;  1EZV D;  5AVQ B;  3SWY A;  3GLM A;  3CE7 A;  3G29 A;  2FXO A;  4COC A;  2QJP B;  4M0I A;  2R44 A;  5GTI E;  1BE3 G;  3SSU A;  3GZL A;  2C0X A;  3CI9 A;  2D2C B;  2WWW A;  1EQ7 A;  1PP9 D;  1PEM A;  1MUU A;  1VDF A;  3Q5R A;  1W2B O;  1EOQ A;  3HRN A;  3L72 D;  1DEE G;  1OVU A;  1MV8 A;  3BCC D;  4UB6 H;  5KAF H;  1H89 A;  3U1C A;  3CWB J;  3Q5S A;  1ZME C;  4DG9 A;  4IL6 X;  3CCV P;  3CXH H;  2IFN A;  4N3Y B;  1IK9 A;  3MIW A;  5DCK A;  1AQ5 A;  1ZOY C;  1RH5 B;  1HQB A;  3A0B H;  3L73 G;  3O6Q A;  2PEN A;  4WY4 C;  2PRR A;  3Q20 A;  3DPH A;  2WIT A;  3HD7 C;  2R3C A;  1UNK A;  4PV1 C;  1BE3 D;  2K0X A;  5CCH C;  4I7Z C;  4R0M A;  1M1K Q;  3TF5 A;  1BXI A;  5AW6 B;  3R2P A;  5HGL A;  2QJY B;  4EIJ A;  2FVA A;  3SWF A;  4H2X C;  3NXS A;  1FR2 A;  2QG4 A;  2CG5 B;  1OX3 A;  3B5N C;  4U0B A;  4BRY B;  1K73 Q;  1UJZ A;  2XT1 A;  1G1J A;  3LIE A;  1FS0 E;  2EHT A;  3NY7 B;  3PJS K;  3CCU P;  2O01 H;  3H4E A;  1NH4 A;  2VLQ A;  2FYU J;  2KGC A;  3CCM P;  2LIW A;  4JF7 A;  5CHX A;  1A8O A;  1KYO E;  5APV A;  1H88 A;  3DS0 A;  2GDX A;  5HGM A;  2FXP A;  1SP4 A;  1QRJ A;  2XZ1 C;  5BU8 B;  3G6E P;  1PEQ A;  1R5S A;  2FHS C;  2LOL A;  5CCG C;  2AFE A;  2P58 A;  2IZ0 A;  3L75 D;  3EJD A;  3TGU D;  1OFC X;  4MN4 C;  1NTK K;  1SQP G;  2FAD A;  2PY8 A;  2GZJ A;  2JQ4 A;  3GJN A;  4GT1 A;  5K5G B;  2UWJ E;  1ACP A;  1VHN A;  5AW4 B;  2WSF H;  3SFD C;  1N8R Q;  1MKM A;  1FZG A;  4XFJ A;  3L4F A;  5KJ7 D;  2WSE H;  5BVZ A;  3BAT A;  4U0D A;  2K37 A;  1SQB D;  3V4Q A;  4GKG A;  1K9M Q;  1L0I A;  2Y0C A;  4H0L D;  4D6T J;  1YIJ P;  1SLQ A;  5KAI E;  1EDJ A;  3OJA B;  2Z4E A;  1M57 D;  3S1K A;  4I2L C;  1FDI A;  3L74 D;  1FDO A;  1SQV D;  2O3J A;  2E75 C;  1Y47 A;  2I8D A;  4HH2 A;  1SQP D;  2FAC A;  1KB9 D;  5EFW B;  3G9R A;  2H88 C;  1PPJ G;  2O1J A;  1SQX K;  4BRY A;  1L4A A;  2P7J A;  2JWD A;  1NGM B;  4KJM A;  3CXC O;  2O01 N;  1K04 A;  1L0N D;  4H2W C;  3D71 A;  2AEM A;  3DS3 A;  1DD3 A;  3A5T A;  2PEI A;  2OYO A;  3N7N A;  4IL6 H;  1L0L K;  1KLP A;  4F37 A;  1W2E A;  2QJK C;  3MGN A;  2I1K A;  2CPS A;  1T6A A;  4I1L A;  2KGA A;  1VF5 C;  2OAR A;  5KAI H;  4ZKU A;  2Z44 A;  2JR8 A;  3CX5 I;  1HY8 A;  2PAJ A;  4LGD E;  1RE3 C;  2WSC H;  2ZXE B;  2FYN C;  3G3Z A;  2PEM A;  2NPS C;  1HGV A;  3L73 J;  2CK3 H;  2IFM A;  1GD2 E;  1LT9 C;  1IUQ A;  3RK3 D;  1RHZ B;  5I4T G;  1RF1 B;  4BXL A;  3H1L D;  2P67 A;  1LTJ B;  2KS1 A;  4GR2 A;  4PJ0 E;  5AVV B;  2C9N Y;  1Q7Y Q;  4C7N B;  2O01 J;  2K92 A;  2Y9Y A;  3Q1M A;  4IZ6 A;  3NFQ A;  1FOS F;  1KIL C;  2KOQ A;  2P10 A;  1T3U A;  1N73 B;  3LW5 H;  2L22 A;  3G1G A;  1GW4 A;  2ERH A;  1X8Y A;  1JUN A;  5DJU B;  1NAF A;  1NTK E;  2QVA A;  1K30 A;  3F5H A;  3HUS C;  4H2Y C;  3H1I D;  3MD0 A;  4GDO A;  1SFC C;  5KKZ B;  1RF0 A;  3LID A;  4WYM A;  3M9H A;  2GYK A;  1NTM D;  3PP5 A;  2CWO A;  2WZ7 A;  4UB8 H;  1PEU A;  1CSB A;  2WSF J;  3RGU A;  1IJD B;  4H13 B;  1SQP J;  1XTC C;  2WQY C;  4PJ0 H;  3PLN A;  1MFZ A;  2WSE J;  2OYI C;  1CI6 B;  2QEX P;  3H6P A;  3CCE P;  1GK6 A;  2VLO A;  1EXJ A;  1GU5 A;  2N9B A;  3CWB G;  4L74 A;  1IFM A;  3AEE C;  1KV4 A;  3U1A A;  3CX5 E;  1PGQ A;  3G0V A;  3JCU E;  3OW2 O;  4U0C A;  1JY3 O;  1GU4 A;  1RNI A;  1N86 A;  1SQQ D;  2A06 G;  2BHV A;  1LT1 A;  1S5L X;  2LKI A;  4OGQ B;  2YKP A;  2K0D X;  1KQS O;  1SQX E;  4H44 B;  2IYP A;  5AVZ B;  2ZAE B;  3DTJ A;  1LTJ A;  1D1D A;  4Z1M H;  2JKV A;  2W6J H;  1VQ4 P;  1U7J A;  1EDK A;  1DEB A;  2N1T B;  1VQ7 P;  1N7S A;  1VKU A;  1NTZ G;  4ZMD A;  1KIL E;  5F2N A;  5GTH E;  4KHX A;  3EJB A;  3ITK A;  1L0L E;  2H43 A;  3IF4 A;  2KGE A;  3PTZ A;  2KSE A;  4UHP B;  3DS1 A;  1E5W A;  1PFI A;  3CWB D;  1S9K E;  1AQT A;  3CX5 H;  1KC8 Q;  4WWI A;  3H1J E;  4HB1 A;  1F80 D;  3JCU H;  1HUC A;  2JYL A;  4ASV A;  3CCR P;  4BPG A;  1BCC E;  3H1K G;  2FYU G;  1SQB K;  2WSC J;  1X9V A;  2VLN A;  3CCJ P;  2A06 D;  1P84 D;  2QJP C;  1NKN A;  1PGO A;  1JCD A;  3GF7 A;  1K8A Q;  3DS2 A;  5KLV K;  3CC7 P;  1BGY E;  3FGA D;  1NVO A;  1NU1 K;  1QX8 A;  2H7H A;  3AE1 C;  3LRY A;  1SQV K;  2M8N A;  1MZ9 A;  3IAO A;  2IBZ D;  3PHL A;  4IOI H;  1YJ9 P;  1Y9B A;  1PZQ A;  1PP9 E;  2KSJ A;  5GTH H;  3H1J G;  3H25 A;  5CJ0 A;  1NKZ B;  2Q1K A;  2KUB A;  3L72 E;  5JPA A;  3BCC E;  2K2Q A;  1KMI Z;  1M56 D;  3M0D C;  3L71 G;  3LW5 J;  1L0N K;  3FXD A;  2LL8 A;  2K3R A;  1AV1 A;  5DJT B;  1BGY G;  1VQ8 P;  2ZT9 B;  3VN0 A;  1LJ2 A;  5F2O A;  1GMJ A;  1M74 A;  3H1K D;  2FYU D;  2EIA A;  2BQ1 E;  3G4S P;  4IFD K;  5KJ7 C;  2N1T D;  2HG5 D;  2KOP A;  3BRV B;  3II6 A;  1NAY A;  1OMI A;  3AE5 C;  1VQM P;  1IC2 A;  4H0L C;  4R4M A;  1YTZ I;  2N1T A;  1KQF B;  3VP8 A;  3B4Q A;  2HYN A;  5M1B A;  3TYY A;  3HE4 B;  3I5C A;  2XV5 A;  2R5D A;  2JEE A;  2I1J A;  4HJG H;  2BUO A;  4L76 A;  1HJ0 A;  2YO3 A;  1QVG O;  4U0A A;  3IFM A;  1FJP A;  1YIT P;  3Q3D A;  1FZC C;  1S2E A;  4N6J A;  2KK7 A;  3P8C D;  1CEI A;  1OXZ A;  5AVS B;  2FBW C;  2V4H A;  1J1E B;  4DJG A;  2KNC B;  2JBG A;  4Y99 B;  2JAZ A;  2J59 M;  1IFI A;  1S5L H;  4D6T D;  3HE5 B;  3WU2 E;  1QL1 A;  2JYG A;  1URQ B;  3AE3 C;  5KP7 B;  3I56 P;  1DD4 A;  3MP7 B;  3D6Y A;  3AE4 C;  1KD1 Q;  3N4X A;  2GUV A;  2WT7 B;  1KQG B;  1PGP A;  4W7Y A;  2N6Z A;  1JB0 J;  2ZT9 D;  3I55 P;  2HLO A;  3G21 A;  1IFP A;  3AE6 C;  3MUD C;  3G1I A;  1IZN B;  4U0F A;  2MKV A;  4XFX A;  1NOH A;  2ZFC A;  4OVN F;  5GTI H;  2K1A A;  2PGD A;  2YXQ B;  1ZP0 C;  1OWA A;  1NTZ J;  2KLV A;  3RK3 C;  1LWU A;  3V5B A;  1ZNV A;  3CL3 D;  2YIU B;  1SQB E;  1Z56 A;  1E79 H;  3HYB A;  2E74 B;  3CXH D;  1LTI C;  2MVV A;  2E76 B;  1L4A B;  3H1H E;  5KLV E;  2KXP B;  3M9B A;  1SQX J;  1NU1 E;  3H32 A;  2RN0 A;  3F89 A;  1FDM A;  2QRX A;  3AEF C;  3HE4 A;  1T8K A;  1SQV E;  3H1K J;  2MR8 A;  4CPG A;  1GXH A;  5AVY B;  5AW9 B;  2D2C D;  1SQQ K;  3PRJ A;  1RF0 C;  1LTB C;  3AEB C;  3VOP A;  1FAV A;  1Q2N A;  3Q2Y A;  3L70 E;  1FE6 A;  2PP6 A;  3H47 A;  2GA1 A;  4EDF A;  5CZD B;  3L73 D;  3NTN A;  1G2C B;  2M8L A;  2H89 C;  5CBN A;  5B5E E;  1AA0 A;  2WSS H;  1HWT C;  3C8V A;  1JY3 P;  3OA7 A;  1EMV A;  3H1H G;  5KLV G;  4GOD A;  4CA3 A;  2K9Y A;  1Q86 Q;  4NPF X;  2L91 A;  5APW A;  3H1J J;  4RO0 A;  3SWK A;  2JU2 A;  3RK2 B;  2JJL A;  3MTU E;  2KNC A;  2AXC A;  5KLI B;  3JSV C;  3A2A A;  2K9J A;  2W83 C;  3HE5 A;  2BCC E;  3S9O A;  1VQ9 P;  1URQ A;  5APX A;  4OH8 B;  3L71 J;  2LIU A;  3L70 G;  2OYH A;  1BGY J;  1GDT A;  3TNU A;  3PH0 A;  2WT7 A;  4DZO A;  2QE7 H;  3VYI A;  2KS1 B;  4XE5 B;  1XTG B;  3HTK A;  1GW3 A;  1KYO H;  3WUV A;  3CC2 P;  1RF1 C;  4AUW A;  4WY4 B;  2ZYA A;  1LTJ C;  1HTL C;  1R5L A;  2KGD A;  4PWV B;  5B5E H;  2N6Y A;  4JYB A;  1QLE D;  2FFD B;  5AVU B;  1L4A D;  3RK3 E;  4I7Z B;  4C46 A;  4IPY A;  2E5T A;  2N5H A;  2AEF A;  4PD4 I;  2E42 A;  1N73 C;  5APS A;  2XND H;  2C0W A;  2PFX A;  1VQ6 P;  4QNB A;  1ZW0 A;  1NHL A;  2K93 A;  5HGN A;  3CD6 P;  5APY A;  2XKM A;  5KKZ C;  2M0B A;  1D7M A;  1HBW A;  1J2J B;  1LGH B;  3RBZ A;  3TDK A;  1FC2 C;  1KN7 A;  1WMK A;  1OVR A;  1G2C A;  1P84 I;  2HOD A;  1PIX A;  1OVV A;  3IR9 A;  3RK2 D;  4H13 C;  2E5Y A;  2KW2 A;  1YQ3 C;  5HV8 A;  1VL2 A;  2KLU A;  2YMK A;  2GZE A;  1JY2 O;  1RE4 A;  2R3S A;  1JNM A;  1OW6 A;  2Q6Q A;  1PGJ A;  4GOF A;  3O8Z A;  2VSQ A;  1A02 F;  1UIX A;  2G3A A;  2Y0D A;  2WPS A;  2MD9 A;  2M5A B;  2OTK E;  1AFO A;  1KFN A;  5HGO A;  2L0Q A;  2L4B A;  2W6A A;  3C1L A;  1OIP A;  1HVV A;  1ZV8 A;  1VQP P;  1SVF A;  1PPJ D;  3UIA A;  3KZI E;  2IYO A;  4DT0 A;  1EDI A;  2FQ0 A;  4ZNC A;  2M8P A;  2LF4 A;  4DCK A;  1JM0 A;  4QKO A;  1KOR A;  2RKL A;  1JY3 N;  1N7S B;  3BAS A;  1SQQ E;  4WY4 A;  4XFY A;  2O1K A;  5AW1 B;  2FFD A;  1Z6M A;  5CCH A;  2QIW A;  1QVF O;  2N1T C;  2Z46 A;  1QEX A;  1H0T B;  5KTB A;  1AJY A;  2HR3 A;  3R4Y A;  3QWO C;  3G28 A;  3ABV C;  4PXH B;  1J1D B;  2DGY A;  4DOJ A;  1L0H A;  4PD4 E;  4BWN A;  3B5N A;  1EZV I;  4N78 D;  1EIA A;  5AVT B;  3L36 A;  2MVU A;  1M1J B;  1KTM A;  3CLQ A;  3KZI H;  2AF8 A;  1VQK P;  4IFM A;  4C7R A;  4NEO A;  2W6B A;  2K94 A;  1K05 A;  3H1H J;  5KLV J;  2GDY A;  2RH0 A;  2AFD A;  1DNY A;  1NU1 J;  2XZR A;  3CC4 P;  2QJK B;  1NTK G;  2ZXX A;  5CCG A;  2E1M A;  1P84 E;  2FQ1 A;  3GF3 A;  1Y8A A;  2X2B A;  4GOE A;  2QM8 A;  3BRT B;  3L70 J;  3FWN A;  1SS1 A;  5BS2 A;  2M5A A;  1FZE A;  2FYN B;  3V2R A;  1GL2 B;  2CNR A;  1BSN A;  1X0T A;  2MY5 A;  4U3F E;  3GG2 A;  3GHG B;  4PD4 H;  3U59 A;  1OW8 A;  1IFN A;  1N7S D;  1ZRT E;  2KIK A;  3P32 A;  2W27 A;  2FKW B;  2ZT9 C;  5APU A;  2BCC J;  3AE7 C;  3VMX A;  3W67 A;  3AEG C;  2Q9I A;  2GUS A;  5BS1 A;  1BSH A;  2KG9 A;  4U7J A;  2NZ2 A;  3CPW O;  2WPQ A;  3USS A;  3MZW B;  3VMZ A;  4K3A A;  1KIL B;  3AE9 C;  1EC5 A;  2RMZ A;  3A0H E;  2K0Y A;  1VQL P;  5C39 A;  1H0T A;  4U3F G;  1JMM A;  1RO2 A;  3MHV A;  1KQL A;  2A45 I;  1SQX G;  2ITA A;  1FU1 A;  4U0E A;  4H13 D;  3L37 A; 
#chains in the Genus database with same CATH homology
 2PEN A;  3MGE A;  1VQO P;  4XRQ A;  3NTE A;  3Q20 A;  3DPH A;  4U0D A;  3G0V A;  1Q86 Q;  3E2D A;  4COP A;  3OW2 O;  2JYG A;  1K9M Q;  1IUQ A;  1A43 A;  4U0C A;  1RNI A;  3H0D A;  3I56 P;  3HZQ A;  2L6E A;  4PH1 A;  3CC4 P;  3G71 P;  2PEO A;  3CCS P;  5I4T G;  5JPA A;  1E6J P;  1KD1 Q;  2BHV A;  1M1K Q;  2EG5 A;  1YIJ P;  1VQ5 P;  5HGL A;  1VQ9 P;  1NJI Q;  3WBH A;  4GR2 A;  1M90 Q;  1KQS O;  2E1M A;  2Z45 A;  3I55 P;  2KOD A;  1Q7Y Q;  3G21 A;  1VQ8 P;  5HGO A;  2QA4 P;  4PH0 A;  4XFZ A;  3G1I A;  2XXM A;  3DTJ A;  5F2O A;  1VQP P;  4U0F A;  1D1D A;  2XV6 A;  4XFX A;  2OTJ P;  1M74 A;  2JO0 A;  5BS2 A;  4U0B A;  2EIA A;  2BQ1 E;  1VQ4 P;  3G4S P;  1K73 Q;  2XT1 A;  1YHQ P;  3CMA P;  1JJ2 O;  2ONT A;  2EFJ A;  3G1G A;  5F2K A;  2PEK A;  1VQ7 P;  3CCU P;  1S72 P;  4XRO A;  3CC2 P;  3G29 A;  3H4E A;  5F2N A;  2M8P A;  3G26 A;  4COC A;  2LF4 A;  3CCM P;  4GR6 A;  1VQM P;  4M0I A;  1VQN P;  3CXC O;  3CCQ P;  1A8O A;  1YJW P;  1YI2 P;  1K30 A;  3DS0 A;  3HYB A;  2OTL P;  5HGM A;  1RO0 A;  3DS1 A;  3DS3 A;  1QRJ A;  4XFY A;  4IPY A;  3DS4 A;  1PEM A;  3G6E P;  4WYM A;  1PEQ A;  3B5I A;  2PEI A;  3RG6 C;  1KC8 Q;  1W2B O;  1EOQ A;  3M1M A;  2CWO A;  2JYL A;  2PEQ A;  5BS1 A;  3CCR P;  1QVF O;  2Z46 A;  3CPW O;  1Q81 Q;  1PEU A;  2BUO A;  1PEO A;  1QVG O;  4U0A A;  3CCJ P;  1BAJ A;  3P05 A;  1VQ6 P;  2OAR A;  2PY8 A;  1YIT P;  3VRL C;  1AUM A;  4QNB A;  3G28 A;  1VQL P;  1M6N A;  1YJN P;  2Z44 A;  1K8A Q;  3DS2 A;  2DGY A;  3CC7 P;  3CME P;  5HGN A;  3CD6 P;  1M6E X;  1RO2 A;  3CCV P;  3H47 A;  3CCL P;  2QEX P;  1EIA A;  2P9X A;  2M8L A;  3CCE P;  3LRY A;  5DCK A;  1N8R Q;  1Q82 Q;  2M8N A;  4U0E A;  2PEJ A;  3DS5 A;  2PEM A;  1VQK P;  1YJ9 P;  1ZMB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...