1YJRA

Solution structure of the apo form of the sixth soluble domain a69p mutant of menkes protein
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
75
structure length
75
Chain Sequence
MGDGVLELVVRGMTCASCVHKIESSLTKHRGILYCSVALATNKAHIKYDPEIIGPRDIIHTIESLGFEPSLVKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An atomic-level investigation of the disease-causing A629P mutant of the Menkes protein, ATP7A
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Copper-transporting ATPase 1
total genus 17
structure length 75
sequence length 75
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2005-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1yjrA00
3QGPA 2W4DA 3MCSA 2BBEA 4YDXA 1X0PA 1KVIA 2GCFA 2OFGX 1N5QA 2PD1A 4Y2MA 1AFJA 3HHLC 2Q3PA 1FVQA 2BYCA 3KKFA 1AW0A 2XMUA 2KYZA 4OIXA 2IYIA 3FRYA 2VH7A 4Y2IA 2QLXA 1CC7A 2ZDPA 3LGMA 1W2IA 2FIUA 2QYCA 3HHLA 5K9FA 1OSDA 3IWXA 3KG1A 1FVSA 1JK9B 3LGNA 4OJHA 2OD4A 4A48A 1CPZA 3HDSA 5B08A 1GXUA 2N4DA 2LDIA 2ROPA 2W4CA 5B0EA 3BF4A 2GV1A 1N5VA 1APSA 3CJKB 4EFAC 1CC8A 4DL0C 3CJKA 5B09A 3HHLB 4ZOSA 5B0DA 1Y9OA 3TRGA 3LO3A 2LQ9A 1YRXA 2QIFA 3DCAA 2OFHX 1N5SA 2XMMA 2BJEA 3HHLD 4OJ3A 2ROEA 2RSQA 2ZDOA 1VQSA 4ZA1A 2LQBA 5F0WA 2GGPB 1URRA 2FTRA 2K2PA 2JDJA 4A4JA 4YEAA 1R6YA 1OPZA 5B0GA 1SI9A 2AW0A 1FEEA 2GFFA 3VTIA 5F0UA 1X8DA 1YJUA 4NL5A 2L3MA 1Q53A 2K7KA 2XMWA 2KT2A 5A6PA 1K0VA 4HH1A 3BDEA 1YJTA 2HIQA 2HFOA 4FNIA 5T7LA 5IXUA 5B0CA 4QOTA 4A47A 4HI2A 1YJVA 1SQEA 2K1RA 3I9ZA 4FNHA 1FESA 3BN7A 2OKQA 1TZ0A 1TL4A 1KVJA 2W4PA 3MZIA 1YG0A 1TL5A 4HL9A 3HF5A 2VV5A 3TOQA 2G9OA 2XMVA 4Y2KA 2K7JA 1LQ9A 5T7LB 1YJRA 3BGUA 2HLTA 1FE0A 1QUPA 1WD6A 4NPOA 1Q8LA 3HX9A 3TNVA 1JWWA 2AP6A 3K7RA 3KNGA 2BJDA 2OMOA 1MWZA 2PGCA 3FGVA 4OJGA 1RJJA 1ULRA 1GXTA 2N7YA 3DXSX 1TUVA 2IYGA 3IWLA 2LXFA 1Y3KA 3KG0A 1FD8A 1P8GA 2CRLA 3E8OA 1S6OA 2HQIA 1S6UA 2AJ0A 2BUNA 2KKHA 2EW9A 2XMJA 3BB5A 3FMBA 1MWYA 4HI1A 2FB0A 4A46A 4Q2LA 2QLWA 2ACYA 1VQYA 1OQ6A 3BM7A 2HFNA 1XBWA 1AFIA 1FE4A 5B0AA 1Q4RA 2RU9A 2AJ1A 2OD6A 1U7LA 1V3ZA 2XMTA 4Q2MA 3QMQA 2OAUA 3BR8A 4DN9A 2HLUA 2N4CA 1KQKA 1P6TA 1Y0HA 3F44A 2K1RB 2ROGA 4HH0A 3T9NA 4DPOA 4F67A 2OP5A 2KT3A 1SB6A 5KAKA 4OJ1A 2GO8A 2RILA 1TR0A 1OQ3A 2XMKA 3GZ7A 1X7VA 1IUJA 3UDCA 4U9RA 2RMLA 3HFKA 3WDOA 1Q8BA 5B0BA 1N5TA 2ASYA 2IFXA 5A6WA 5B0FA 2GGPA 1Y3JA 2FHMA 2GA7A
chains in the Genus database with same CATH superfamily
4RBVA 5HVGA 1XWLA 4HHHA 1GT8A 3WHIA 4F4ZA 3R5CA 4C3LA 1KVIA 3VAHA 1VRQC 4P71A 3M2UA 1L3SA 2QEXS 2B8QA 1URNA 2XSJA 3HSDA 4C6AA 2VG7B 3MPYA 2W01A 3N28A 2C1EB 2J0XA 2MY7A 3NS5A 2H1YA 2VPWB 1RAIB 4NLRA 4XTTA 4Z7CA 1LV5A 2OELA 3MEDB 1UKUA 2W1BA 2MJUA 5ETQA 3DOLB 1SC6A 1SUQA 2FGCA 3ILIA 3QWPA 2BJ3A 4FKXA 4EU0A 4QWDA 2HVEA 2LDIA 5BJRA 1Q81T 1OYDA 3CJ0A 4JI5F 5HROA 4OYWA 5EX0A 4M8LA 1VGYA 3T5LA 5L1KA 4DL5A 1UJ4A 1CC8A 2E1AA 2Z57B 2IRXA 3DLGA 4DL0C 2XYHB 2J8SA 3V81B 2UUBJ 1HNXJ 4LFBJ 1FFWB 5LMUF 4FF3A 3TRGA 1DLOB 1N5YA 2YX4A 4PG5A 1HWUA 3Q0AA 2QLBB 4QQBA 1JXEA 1ZTWA 1KRPA 2H9ZA 4I7FB 5AXLA 4KHPJ 5CYMB 1F5CA 3QAUA 4LRAA 4C8MA 4ETXA 3CCMS 2ZOGA 3TAPA 2CAJA 2KT5A 3C15B 4JI3J 2O01C 1R3NA 3MR3A 5GAEI 1NK0A 2LDYA 2KXHA 4K4XA 3DRPB 1YJUA 2NCKL 1WHXA 2ZEJA 3A8KA 2CPZA 2GVDA 3FZBA 4NASA 4P7VA 5A8WB 1VQ4S 1UVNA 3H2LA 5AT1B 1UP1A 2V4JB 2E5LF 2QFJA 3FBFA 4X4SA 2HFOA 1NDPA 2W2QP 3KMSA 2VFRA 1YWXA 3FRZA 1FKAF 1XQIA 3P45B 4K8RA 2PFFB 5AJ3F 4KSEB 4DX5A 4DZ6A 2WOMB 2GO9A 4LF7J 3BBCA 3ILOA 2W2OP 3EUNA 4W98A 3RRKA 2DNYA 2HFZA 2HHWA 1NJZA 4ED0A 5GMKa 2ALZA 1RGVA 2HK2A 4JI8F 1LW2A 3WQPA 2ZH5A 4CO3A 1R0AB 1MU2A 1U45A 4OZ3A 4Y65A 1S4EA 3TNVA 1S5ZA 5HLFA 2VFVA 2B9EA 5EWFA 3G86A 3CJ2A 1GFWB 2XHWA 4FPIA 1NDLA 2MLYA 4ZLJA 3W62A 2RHSB 2HNZA 1O5JA 2GJIA 1NDCA 2MLXA 1RU2A 2RQ4A 2LQ8A 2WVCA 1S6UA 3IRWP 4DL6A 3BO2A 2ZC4A 3L3CA 2WRMA 2DCUB 2ACYA 5AXKA 4C3KA 3GFZA 5HLFB 3CC7S 2R7TA 2BKPA 2ILZA 2JVRA 4IDKA 5KG4A 4C0HA 3KJVA 2YXLA 2DRDA 3NCRA 4MKVA 1G1XA 3IRXA 1S77D 2BJ8A 2IRYA 4IR9A 2FHJD 3DRYA 1U48A 1GTHA 5J2QA 3RBEA 1ZM2A 2ROGA 4HH0A 1VBZA 1HQEA 3OTEA 1U47A 4ZPBA 3LF0A 1HNVA 4QWCA 4X65J 2W9AA 3M8WA 4P75A 4USVA 5EWEA 4OJ1A 2FJXA 2GX8A 4LR7A 4UY85 2AGOA 2P6SA 1NSQA 1CG2A 3PJXA 5D3GA 1OJ4A 3OSNA 1KLNA 5C25B 2A6OA 1VHIA 3IRXB 4MH8A 3VALA 1X4CA 4OX6A 2CJYB 2ASYA 4QZVB 5ADZA 2W2MP 2LP4A 1HD0A 2B4PA 1SIWB 4UUWA 2UU9F 2AEFA 2UUAF 4YHHF 3FEZA 1IQTA 3N9UC 1JKHB 2M8HA 1NHKL 2VC0A 5KFDA 1IKVA 2AYGA 4NCBA 2BBEA 3ZZPA 1U09A 2W9CA 4A8KA 2G1HA 1FEHA 1RT5A 2WAQD 4YFUA 3E01A 3D2WA 4B3RF 1FRHA 2HHSA 5FJ4A 1YIJS 1WC5A 4K4TA 3LGMA 1HA1A 2PDAA 4ZS6A 3KK2B 1TVRA 1Y7PA 2QYCA 1FK9B 3AXKA 3SDEA 3W2WA 3MR7A 3J7A1 2UP1A 2LXUA 2GIFA 2NXEA 4X4VA 2CVEA 1M5SA 3DGVA 2VKRA 1KFSA 2ZC3A 1RACB 2D69A 5FDLB 4MFBA 5HMZA 4OHWA 2R9LA 3B6BA 2MMYA 4MYTA 5LSRA 4ZJLA 1IKWB 4W92B 4I67A 1N54B 1G7CB 3QYYA 3W65A 4DQQA 2OIHA 1YKWA 2HBQB 1JLQA 2Y1LB 1FWKA 3EICA 3MCOA 3BDPA 4AL5A 1FJGF 2C22A 3IGNA 4RNOA 2M0GB 1XMOJ 4IFVB 2BX6A 2R4FA 2ZVSA 3EE3A 2OPQB 3KUEA 5KFOA 2MJNA 3CCTA 2UZAA 1VR6A 1TQLA 4I2QB 4Z7YA 1YI2S 2LQJA 4JI3F 3ZTOA 2ZZTA 3OL8A 4DX6A 4X4NA 4DV5F 1WJ9A 2X7IA 2RD5C 2MEWA 5E2QA 3ZNUA 1GH8A 5IM0B 2EKYA 2GVDB 2YX1A 1S0OA 1TKXA 4YOEA 3HFZB 3G4SS 1PIEA 3HKWA 1UWBB 3JAMU 3EDQB 4DL7A 1YVFA 5ETSA 3ZTPA 4XPEA 2WK4A 3EGWB 4M5DA 2YNGB 5T7LA 2DNPA 4AQYJ 5FD1A 2C28A 5L1LA 1N0VC 2V4JA 2VFTA 4A47A 4MKYA 1SJQA 4TU7A 4B3OA 2B7BB 5GADI 1UVKA 1BQXA 4EI2A 2LKZA 1FJGJ 3P5TL 2P9EA 3DLEA 2GIQA 5K8NA 4A8YA 4EBDA 2KTQA 2VPXB 1VQ6S 1UTAA 1DQ9A 3FCWA 2ZUGA 3QSYB 2F8EX 4OYMA 5D4LA 5I4MA 1RU1A 2DHSA 1WACA 2IAJB 2V8VA 3NGSA 4WU2A 2CDRB 1HBOB 4K0KF 3TAQA 4ED6A 3AA9A 1ZM9A 5AE1A 3K7RA 3H59A 1JB0C 3GONA 1GMUA 2ZWOA 1RTZA 3OXFA 3IP0A 4MKAA 3K17A 5H9EK 3VGSA 2QMUB 1H73A 4KR0B 3BKUA 2Z2LA 3MM7B 2YKNB 2COLA 3TOQA 1KHVA 4CLSA 5BYSA 4DR2J 4UOGA 3EVWA 1R8HA 4X65F 1PJ5A 1V3RA 4K4WA 1VC6A 1IJFB 4LIRA 1RWOB 2HFNA 1SV5A 1S6QB 3J7YU 3MECB 1TVRB 3WIUA 1WF2A 1FE4A 3DRXA 4DUYF 1AFIA 5KT6A 1U02A 1TUWA 3T5KA 3T5JA 3GSDA 5KFXA 1D9DA 2AKWB 2ZOFA 2YKNA 2HGLA 3VQTA 1HIYA 4RW6A 1Q1KA 3Q86A 4TYBA 1LNQA 1T9XA 2RF2B 3MCMA 5HL7Q 1NK6A 4NCGB 3IBCB 2AJ4A 2CNKB 4DX7A 2XNQA 2J7WA 4CLZA 1RAAB 1X7VA 4ZKAA 4U8YA 2L48A 2KXNB 1GMWA 3V6KA 1FKPA 1NK7A 1NO8A 1QDUB 3DFEA 2ZUAA 4NLDA 3HSZA 3RU0A 3QPIA 4QYZK 1T03B 4ECVA 1LW0B 4NA2A 5A6WA 3ENAA 3TUZC 3UD3P 3N5BA 4UQGA 3QLHB 2HIYA 4IH6A 4UY8T 3MGJA 2XEXA 1CJTA 1WORA 2X1BA 3HXMA 4Y2MA 4B3TF 2RRBA 3QIDA 1CJKB 3OQ2A 5CCMA 5EGYA 5IM0A 1U49A 1TKDA 3NXZA 3QSIA 5LJ3Y 3JSMB 5D0HA 5AJ3J 3AODA 2FJAB 1MMNA 4RU9A 4G3IA 2ZM6F 3TA2A 2RRAA 3VZHA 9RUBA 3HLUA 4DR6J 2YNIB 3CDBA 1NBEB 4JV5F 1HWIA 2AX1A 2HEKA 3LGNA 4CLYA 1N56A 1RT2B 2V5HG 4WK1A 3DC2A 4WFBQ 4JYAJ 5LL6d 4DLGA 3D0IE 2UXBF 3BGRA 4JI8J 2OLWA 1B4SA 1X4HA 2CPHA 3DRSA 3HKZD 3M6WA 4IQMA 4JOUA 4NLGA 2K3KA 1APSA 3ZTSA 4K2JA 4TKTA 9ATCB 5HP1B 4OYOA 3UNGC 5F3ZA 2QMXA 4CQ1A 4IG3A 2YNIA 2OPPB 5DZ6A 4DCPB 1ZETA 5I3QA 3RW6A 5B0DA 2B43A 2CQPA 1U2RA 4H54A 5CH7B 1B70B 2CNNB 2U2FA 1IBCB 3K58A 4P6QA 3DRSB 5LSLA 2C2RA 4LF5J 3PW4A 2M52A 3C6TA 3JSBA 4WXOA 4EO8A 3TQ1A 1HNXF 2ZBPA 3VAKA 1IKXA 3GQCA 2UUBF 3NY0A 1S0VA 1X5SA 1OPZA 3KHRA 4YR0A 3W60A 3A3PB 1CSJA 1N32F 2HBZB 5LM7E 3TVKA 2C42A 3IA0A 2NZ4A 1T02A 3T1YJ 3M8SA 1HL6A 1ZS6A 3HCXA 3UWTA 3RBZA 3M8PB 2DNGA 5L39A 1XIQA 2YWEA 1U24A 2HGNA 2K06A 1OY6A 2IDEA 3FBEA 2CJBA 1T9VA 4LQ9A 2VQFJ 2CPDA 1CJVA 1X4FA 2CZ9A 5KFBA 2R7SA 4KT0C 1IBKF 3OSPA 4V19X 3BH7B 4J9NA 2XMAA 2RT3A 2YQ3A 3OLBA 1ROFA 3MMCA 3KLVA 1TL7B 2IA6A 1TKZB 1UJ6A 3HD1A 4ZVHA 4RNFA 1FX2A 1LQ9A 2KRBA 3WX4A 3KLFA 2KVQE 4LF1A 3UN2A 1WG5A 1IR1A 3PG9A 4UOHA 1TMMA 2H5JB 2R2RA 3V6DB 2C2DA 4FYDA 3KNGA 4K5RA 5E3QA 1VQ5S 3DN9A 3MR2A 2B0GA 5L1IA 1IN0A 2L9DA 4L74A 3C19A 3A3OB 1PYOB 2R7OA 3FMBA 1HQUA 2HWHA 3MOZA 1LW2B 4H4OB 1S6QA 4ALZA 5CABA 1UFLA 1QM9A 3PO5A 4NRTA 4NWBA 4ZPTR 3I5BA 4EYHB 1U7LA 1R27B 1YRTA 4I0WA 3U02A 4CDIA 3HVTA 1WOPA 4UZBA 3MMBA 1QY7A 4NMLA 3R6GB 4BWMA 4FVMA 3VVTA 2ZJRQ 5GVQA 1OS5A 4NLXA 2ZH6A 4F4YA 3PRDA 4DPTA 3SDEB 5L38A 5ETTA 2HVHA 2QE5A 4ZPVR 4M1KA 2BRLA 1PAUB 5JJBA 3AHPA 5K20B 4J9SA 1N48A 4RW4B 4ED1A 3AD9C 2M3DA 3TYTA 3WDOA 5DQIA 4P7TA 1Y11A 2P9GA 4YB6A 4IG0A 2JWNA 1ZAWA 4OZ0A 4TY8A 5C2GA 4Q8FA 1AXQA 3QT8A 3X3UA 2MZTA 2N7CA 3RBXA 1U8SA 2KFZA 4NYOA 1H2VZ 1XR7A 1H74A 1O51A 2VFSA 3HZEA 4LIWA 5LSOA 3MUVP 4GKKF 4JV5J 4C8LA 4URQU 2V67A 1AUSL 2GCFA 1N5QA 3HHLC 4OX8A 4TLQA 3FEXB 3MEGA 4DG1B 3KNAA 3M2VA 3MXHP 3DMJA 2DHAA 1CJKA 1WSRA 1Y00A 2XCAA 4F0HA 4OIXA 4NXMF 1QSYA 2DXEA 3NKYA 4YB1P 1Q82T 3IXQA 3O8WA 1GX5A 2AEMA 4ELTA 1U1RA 2GJFA 4OX9F 2AD9A 4ZIVA 3CE8A 2VC1A 4ED3A 3WC2A 2I6WA 2OH2A 4DQIA 3HFVA 1NZ8A 2CXEA 4IR1A 3OHAA 1VIXA 4V1Ak 1EQ0A 1UJ5A 1TFWA 2GC8A 2VHGA 2IM0A 2OPQA 4LSLB 4X64J 4OYIA 4BDPA 3Q8QB 3PJWA 3DLGB 2VQEJ 4IRCA 4N7TA 1JNRB 5D6GA 3AOCA 1HQ2A 2OPPA 4CZCA 5HROB 4OZ1A 1FRJA 2MKHA 3HHLB 1RT1B 2DRBA 1IVZA 1S48A 1TL3B 3C16B 4CO4A 4ECTA 4B3TJ 2V9KA 4EBEA 1S9EA 8AT1B 3E01B 3ZZYA 4ZA1A 1ZYQA 1KWMA 1FO1A 1BWVA 1S4FA 3MAHA 1RE1B 2K2PA 3IM9A 4HDGA 5KFYA 1KQFB 2H3EB 4O4GA 5DDOC 2BQRA 4U7UD 1JLGB 2DHGA 3I0SA 4K7QA 4PYAA 4YP3A 1FK9A 3W2WB 1X9MA 2QL5B 3K8WA 5LOQA 3L4BC 2P6TA 1YQHA 1M5HA 3DLEB 3GSIA 3G82B 2B9XA 1QE1A 3ISZA 2B3TB 2FD2A 3ISNC 1K0TA 4KO0A 3WBZA 4ED8A 2AGQA 1SUQB 3KJFB 1S1WA 3MPVA 3T1HF 3G6ES 5IV3A 1FESA 3B82A 2DNNA 4FPRA 2G0CA 3ET6B 2XY7A 4B3SJ 1NJWA 4LBIA 2RHQB 2A6MA 3TZWA 4DX8H 2EFGA 3H2VE 3KLGB 2MKJA 4JI6J 2E44A 1X9SA 2ASLA 1RKJA 3BSOA 3DOMB 3GCWP 1RK8A 3PDNA 4DEZA 1RWUA 4F0KA 2G9OA 1WC0A 5A0YA 4EZ6A 4JI1J 3GYNA 3OPKA 4M5DB 3MPWA 5T7LB 1RAFB 3Q2SC 4PXBA 4D3HA 2JHEA 5L46A 3KLFB 3EZOA 1U1KA 4ATNA 4EZ9A 2HS0A 4DMZA 2NYHA 4AT1B 1Y5LB 4MK9A 2OO4A 4DF8A 2UVUA 4PXEA 4ECQA 1H6KX 4YY3F 4MYUA 1A9NB 2JJ4D 1J27A 2B4VA 4ZMMA 4OZ5A 1YJ7A 3E8OA 3J80U 1NSAA 3L7OA 1RTIA 1JXVA 2CWXA 1D09B 1RCOB 2QGFB 3M8QB 4QIFA 3EX7B 1S10A 1UVLA 4WIIA 2CPXA 2R2SA 2FHJA 4RUCA 4O0IA 3W9HA 2Z2ZA 3DRRA 1ZA1B 1U26A 3MM9B 1CULB 2ERRA 1F3VA 2MXYA 1BHNA 3H4BA 2ZFHA 3NAHA 2XMTA 4NLPA 4M5IA 3A8IA 2C2KB 4N56A 4KYZA 1F9HA 2YNFB 1S1UB 2ZHOA 3T5HA 1FI4A 1QAJA 1XEZA 4O3SA 3BR9A 3MEEA 4KBIA 1ZTTA 4K4UA 3Q23A 2XC9A 3VR1A 4OLOA 4ETZA 2YH0A 2EG2A 3H5YA 3L7UA 1N34F 4O3OA 3OFFA 2Q1LA 1YLXA 2DNRA 5A2QY 1FFSB 2MZJA 4F2RA 1X31C 4ECZA 4KQZA 1RTIB 1FFGB 3H5UA 3EPIA 5B0FA 2Z0GA 4O0NA 5E33A 3D6MB 3M9OB 2F5GA 2W4DA 4TYAA 2J9DE 2BE9B 2BJ9A 2HQCA 1HNZJ 4YS2A 3BN4A 4H4KA 1FVQA 2QFIA 3DDNA 5E3AA 4C2MA 3RB3A 2JEGA 1S1VA 3G82A 4ZVPB 1RWWB 6AT1B 3K5NA 1LW0A 3LP2A 1QLNA 3KLIB 2HRTA 4LSZB 2DYAA 4QR1A 3ULHA 1W2IA 2RU3A 4RKUC 1Q79A 1B7YB 2VZ9A 4O4RA 1FVSA 3CMQA 4OJHA 3PEJA 4O3NA 3VF0B 5MAOA 3V6HA 1QAXA 4YMEA 1IM6A 2QA1A 1DHMA 2W4CA 2F9JA 3PCOB 2AZ1A 3R5DA 3AA8A 3T1AA 4B9SA 1LK7A 4EFAC 3J7YI 3R5JB 2K8GA 4MK8A 4DSLA 5KFHA 1FDBA 1UPPA 1VDHA 3ZZUA 3MM8B 3LP0A 5DLFA 3GIRA 2FHKA 3UDLA 4F26A 2C2NA 3M30B 4JYAF 1H3DA 5CYJA 1NKCA 4RZRA 3ZO7A 1WHWA 2YKPA 5DDRC 1RISA 1MLAA 2FJDB 1C0TA 2C2MB 3FK4A 4RU2A 2A0FB 2VKZG 2WB4A 4ZVTB 5J1EB 2ALYB 1FKOA 2BANA 2HZCA 2F8MA 1Q7LB 1JLAA 4AUKA 3DU5A 3GV8B 3SSRA 3MM7A 3AOBA 3PIPQ 3H5SA 1GXLA 1QAYA 4EK2A 2YWKA 4ZCLA 4ENOA 4QR2A 1T3NA 2H5EA 2QT7A 2RKIA 4DV0J 2NZCA 3BQ2A 4X4OA 2YKOA 2CQGA 2HS3A 2ILYA 1UFKA 4Q7AA 5HK4A 3TUPA 4RW7B 4ZHRB 3OUYA 4QPTA 3G96A 4QOTA 3G8QA 5D78A 5BR8F 2W9BA 1YJVA 4JI7J 4WCEQ 3SCIE 4LR9A 3D9BA 4MMOA 3AXMA 3LGHA 1TZ0A 3N79A 4N8OA 5I42A 3RB0A 1V5IB 3ILLA 2QV6A 2WSFC 3I32A 3LP1B 2R3VA 3P96A 4P2MA 5IT9Y 4E0DA 5L9NA 2W24A 4CLUA 4O23A 2J9DA 5HMWA 2D74B 4TY9A 2EG1A 3K0JA 4NLVA 1WD6A 4QYRA 2VASA 5KFTA 4EMDA 1AT1B 2DBBA 4FVCA 1U6ZA 4C11B 7FD1A 3SV4A 3SZ2A 1X0FA 3TUJC 4GKJJ 3G8TA 2HNDB 4P52A 2PGCA 5DDPC 3HJFA 4O3RA 1SJRA 4I2QA 3KDOA 3U1NA 4GC6A 2XBPA 2U1AA 3QT6A 4K5SA 2CYYA 4DR1F 2CDQA 1NJXA 4M95A 2HHTA 4F04B 2EC2A 3D1HA 3W5ZA 2PT0A 3CCWA 2BOPA 3O2IA 2BE7D 2YWHA 4H4MA 2XY5A 2E9ZA 2VONA 2J8AA 4FS1A 1RYRA 1VQ8S 2PMZD 2GMLA 1G3OA 4UTGA 2DB1A 3TVZA 1VQLS 2VOPA 1FWLA 2EBGA 4HHUA 3UR3C 1CS4B 3OXGA 1U1OA 1HNWF 2A2DA 3CJQA 4DR7J 1Q5YA 1IR2A 5C42A 1TU0B 3D0GE 3NWRA 2FQQB 1YJ9S 3UN5A 4CTAB 2W8KA 4DFPA 1N32J 2O66A 5EUHA 3CTRA 1TR0A 2XMKA 4EBCA 4TVAB 2WCXA 4KH1B 3M30A 2R2TA 3KYLA 3SFGA 3W3SA 4IOAQ 1FTRA 5DS7A 2N3OA 1N5TA 3C14B 1RWPB 5LXRA 1U2FA 4K2XA 5D0EA 2JEJA 2C3MA 3CC4S 1Y3JA 5GAGU 2DGSA 1HLWA 3HMJG 3TZXA 1O6XA 2E5GA 2MKCA 2OPSA 2LU2A 4RW4A 3SSQA 5K8OA 1HYSA 2AJQA 2MKSA 4PZVA 2X51A 4U6PA 1JXLA 3DDIA 3KLIA 1SCJB 3OHBA 2KDOA 2LXIA 2IYIA 1UAWA 2R8HA 2CQ2A 3DNCA 2ZDPA 3RAMA 1LFPA 2FIUA 2YQ1A 1WOOA 3KG1A 3PW7A 4IFYA 3PX0A 2ZZMA 3ENWA 3VVUA 3CJTA 4UZCA 1S0NA 2V34A 3A13A 2DISA 5DG7A 3OR1B 3R5GA 3ZTRA 3MEGB 2KH9A 5KFEA 2HHUA 5G0RB 2JEIA 2HBRB 1N5VA 2R7WA 3MF5A 2FY1A 2DY9A 3DLKA 3I31A 4KPCA 2AHOB 3GB0A 3TA0A 4ECXA 3MI7X 4J9OA 2QSFA 3ZZOA 1VCTA 2JSXA 2RB7A 3MAQA 5KFCA 1M5PC 2CPIA 5IC6B 2JLEA 3A12A 3RZAA 2XZTB 2QIFA 3DCAA 3I5CA 2M8DB 2BABA 3HHLD 2UXBJ 2FLLA 4ICLA 1HW8A 2ROEA 1QUVA 1BC6A 4ED5A 2VDHA 3PR4A 1Q86T 1N33J 2KG1A 3KXDA 3M6UA 4WBFA 3MOJB 1RT3A 2FTRA 2H4WB 1JNZB 1TMJA 3M32A 5CZVA 4F4KA 4CT8A 2JDJA 3QZ7A 4OZLA 2QN6B 3PVXA 4JI1F 1SI9A 1EB0A 4C8KA 2WBRA 4PWDA 1JJCB 3PV8A 3I87A 2NXJA 3KJQB 2K7KA 2KL8A 4G6VB 5DG8A 5CD4A 4NEYA 3JSMA 3PEHA 5FDLA 1N36F 1MWQA 1WEXA 2KHDA 3DLKB 3LH2S 1EETA 4TQRA 5F8JA 2J7KA 2EPIA 2KVIA 1B0VA 3CJ8A 3KWMA 3M8PA 4DI6A 4NI2B 5EWGA 1M1GA 1MROB 4IUFA 5CCLA 5DG9A 1M1KT 3C2PA 2FLPA 3MR6A 4OHYA 5ETRA 2BVZA 5J1PA 3MZIA 2ZH4A 4K4SA 2NLWA 1N0UA 1FX4A 1TV6A 5E3CA 3BH6B 3VCDA 1UETA 3NBPB 2ZBIA 2B6AA 2J0SD 3MM6B 4O3QA 3PX4A 4KJIA 1VS3A 4BBYA 4PG6A 4TQSA 1HBMB 1HFEL 3GWCA 3FEYB 4LREA 2XG8A 3BQ1A 2DPIA 4DU7A 4JI4J 2FVRA 3N4WA 1JWWA 3I0RB 2BZ2A 1XNRJ 1X4AA 3HHKA 1NDKA 2JL9A 1VBKA 2N7YA 3RAXA 2F4FA 1XNRF 3AQPA 3AB4B 1X5TA 4F2SA 2YKMA 2GAHC 2DGVA 2ABYA 2RIJA 2LA6A 1T03A 1NKEA 3OTCA 1S1TA 3GILA 2JLFA 3QJPA 2ZKUA 4L75A 2GQ2A 4YN3B 1OQ6A 4CIOA 3BREA 4RLEA 1Q7YT 4AE5A 4DR4F 1FDAA 4OV6A 4OI3A 4P2FA 4GO5X 2XI3A 2UV8A 4ED7A 4LF8F 1DBDA 1FNOA 2GHWA 1DTTB 1MN7A 2BACA 2DNKA 5KG6A 5HVHA 2V2VA 5C42B 1Y0HA 1JLBA 3PW0A 2CQHA 5D0GA 4UT4A 1LWEA 2ZE2B 4DR3F 5L8RC 4ZPAA 1Y5IB 2HWIA 1RWVB 3BPSP 1RAEB 2HS4A 4WTOB 2N82B 2J6TA 1CJTB 3HK2A 2M9KA 5KFAA 1PYSB 4UQTA 4YB7A 4I6YA 3TAMA 1NCLA 3QRQA 5GAEU 1R8PA 1A6LA 4LR8A 4A8FA 1F9EB 4M5NA 2WSEC 2V2ZA 3UPFA 2QL7B 2GGPA 2FHMA 4L6V3 3TO8A 1H7XA 2DH9A 5HO4A 2JZ5A 1FXLA 4DG1A 2OEMA 1RHKB 2E7VA 3IMQJ 3CT9A 4X4UA 2AX0A 4RR5A 4GVBB 3GCXP 3SQGA 5KFSA 5IFMA 3FSIA 2M70A 3DLBA 2G2YA 2J0WA 3FSXA 5GMDA 3ZZ0A 2LEBA 5F3TA 1Z4UA 5CYMA 3FRYA 4CRJA 4KGXB 2HQDA 2IM3A 3DM2B 1WKLA 4CM2A 3QZ8A 4TXSA 1MW7A 1F2GA 4LBPA 1AB8A 3FZ2A 2JX2A 4DPYA 4DUZF 2LYVA 4A8SA 1WDDA 2RKIB 4IYQA 3AOAA 3GMGA 1BD6A 2N4DA 2W25A 3UE2A 4CM0A 4XPCA 3KLGA 1DQAA 1RB0A 3CJ4A 5KG3A 4S0MA 4CLPA 4I7FA 2HRYA 4PXCA 2GZOA 2HAIA 2V8HA 3FNNA 3TEGA 4CNYA 2W9BB 1U0SA 3AJDA 1YSJA 2E5IA 4N77A 3J81U 1T7PA 2MSSA 5HJXA 2DIUA 2FLNA 1VRUB 5KFJA 4J9LA 3OFHA 2NXCA 3M1VA 1WHVA 2DH8A 2VBXA 2XSFA 3BEGB 1H2UX 5J2NB 1V9OA 3CCRS 4UF4A 3CDUA 3JSYA 4FS2A 2E1RA 3AJ2A 3CXCR 3KUHA 3G9CA 2WONA 3LPEA 5K8MA 5HANA 4O4GB 4EUVA 2Y0SD 3BS9A 4DF4A 4B9VA 2Q66A 4BC9A 3HD2A 3I56S 1I94J 2I5JA 3Q8YA 3PFOA 1U8WA 3FFIA 3M1VB 3MDFA 4Y6IA 4A8XA 5C5JA 2I9SA 2NXNA 2OUGA 1F5AA 4HH1A 4X4PA 2BEFA 2MGZA 3WC0A 3UFCX 1K0VA 2HIQA 4M5HA 3OBIA 3L9ZA 2UUAJ 2DNOA 1R89A 2MQPA 4NLUA 3G6VA 2QA4G 2B5JB 3BYRA 1LWFA 4GRSA 2VL1A 1X4GA 3M2RB 1F2HA 4ZPDA 1WTBA 4DBQA 4LSLA 3HVWA 1GQEA 5K5MA 3AT1B 2D3ZA 2XS7A 2DNZA 3GFYA 4RX6A 3Q8RB 4LF4F 3KHLA 2HHXA 2HMIB 1YZ6A 3BGUA 1RT4B 3NBPA 3NAIA 3KLHB 1U25A 2RS8A 1EIYB 3S1TA 2FC9A 2GJ2A 2Z56B 1C4CA 3DU6A 2AYBA 1XK8A 3E2EA 2J9CA 1T9WA 2UUCF 2LCWA 3DOKA 3H8YA 4B3RJ 4RWXA 4RUAA 1KQGB 1PG5B 3FCVA 3D6HB 2ZJQQ 1BQNA 3IO1A 2DEJA 2LXFA 3BGLA 1RBLA 5JXSA 5IWAJ 2BE2A 4E2FB 2BXJA 4G1QB 1U1NA 3IR7B 2UVRA 2PI4A 1S1VB 1MWYA 4LBHA 3DHXA 4KV8A 4ANCA 4CI0B 2CPEA 2IA0A 1LEOA 2BV3A 2KB2A 3NWGA 3UVJB 2VBZA 4TN2A 4CTAA 3MMAA 3N6LA 4OYBA 3HZGA 3J81Y 2W7OA 5D3GB 1F5BA 1WG4A 2FVSA 1CULA 2HNZB 2ZBCA 1NPPA 4L3NA 4DR1J 1C2PA 1R31A 2YBVA 2K1RB 3MEEB 4LRDA 2ZH8A 3BO3A 2H48B 3D7SB 4N76A 4LF6J 5DDQC 2NYIA 4PQUA 1RT7A 4CLFA 2C3UA 2HG4A 1VJQA 2NPIA 1JLFA 4KFBA 3TUIC 4G65A 5E5NA 2D7SA 4LMZA 3WZ0A 2W9CB 2H51B 2JRSA 1RHMB 2DR6A 2Z58B 1UW4A 1B0TA 3HVTB 4WTYA 2MQOA 2OMLA 2RDDA 3L95X 3OR2A 4URGA 4DV0F 2VPYB 3LALA 1YJNS 2O5DA 1E6YB 4WE1B 3AB2B 4PG7A 2LVWA 3TX0A 1TK8A 3MUMP 1ELOA 4M63A 1CPZA 4DV2F 2EI5A 4DSEA 2UXCF 5K8PA 4D3GA 1H0HB 3DLLQ 3H20A 2DGQA 2MPUA 4B3MJ 2CKWA 1HHTP 3MURP 3HHNB 4N5SA 5CQGA 4NZ0A 1HMVB 4L72B 1WKJA 1P27B 3NRBA 4LVOP 4J9UE 3RAQA 2EFOA 2MYFA 2B7CB 2AJ2A 4I69A 5JMNA 1T11A 4OX7A 4OYPA 1VRTA 1AZSB 4C48A 4WU3A 1RTHB 1W7WA 1HYSB 2ZH7A 1RT5B 1NM2A 1LWXA 3BF4A 7FDRA 2DR8A 3C3LA 2IY5B 3M6XA 3N5FA 3BQ0A 2CPFA 5ETOA 2R7VA 4WZQA 2L9NA 1NXIA 2M2BA 5KFFA 1KSPA 5B09A 3Q8VA 1PAEX 1K1SA 1PGZA 1Q5VA 3GPAA 2ASDA 2FDNA 2Z2YB 1K8AT 2E5LJ 2VG5B 1EARA 4R5PB 2IHR1 2LQ9A 1MMDA 2W2NP 2XI2A 3Q8PB 4ID8A 3GTYX 4GVLA 4KIAA 4DPUA 1VQKS 2XWYA 2BANB 2UV8G 1Y4ZB 4X66F 3H5XA 4FYYB 3IC1A 2DR7A 1W25A 3DDKA 1D9FA 1K73T 4WP9A 3B8HA 3QQCD 1U2CA 4PEOA 4H4KC 2ZH2A 2VQFF 2CUYA 4BWJA 4YDDB 2AW0A 1TL3A 2APOA 1OIAA 4IKAA 4NL5A 2MGZB 2ADBA 3MM5A 4OV1A 1DAXA 1EHWA 2WB1D 3R97A 4PG8A 1NRKA 1WDTA 3BDEA 3BKFA 1W26A 5A2QU 2ZBRA 1YJTA 4FNIA 1BWEA 1X4BA 3UQSA 2IAJA 3OTOJ 3X1LB 1IQZA 4FNHA 5C7PA 4C4WA 1MNEA 4CNZA 4LRCA 5ETVA 2QA4S 2ZD1A 1M1HA 1SKUB 4F02A 1KVJA 2FZCB 4KKOA 4PUOB 4C0BA 2DGXA 1HHQA 1WEYA 2HQFA 4Y3CA 3MMCB 4RBTA 4URSA 4KE5A 1UZDA 2BJ1A 4HT7A 3UD4P 3SMZA 1QUPA 1GNKA 3KDNA 4LT6A 3SSSA 1KEKA 2BQUA 3FC9A 2J0QD 1Z2ZA 3ITHA 3QT5A 4EEYA 3NEKA 1XR5A 4R25A 3THPA 4IH7A 1IBMF 4X66J 1M5OC 2WW8A 2AEJA 3DOMA 4LFAF 1ACMB 3PYFA 1VK3A 5L9XA 1XMOF 2M88A 2L9WA 2ATLA 3RB4A 1QTMA 4X84A 5KFRA 1FT8A 3HSGA 2DHHA 4Q2LA 5IS2A 2H65B 1VQYA 1VHFA 2CQ0A 1GMWD 2POKA 3CO9A 3ETOA 3R27A 3OD2A 2HZAA 1HARA 1HWJA 1L3KA 3VQSA 3ZZZA 2Y1RI 3OFEA 1AZSA 1V3ZA 1U0HB 2IM2A 4JI6F 3TJ9A 4AXJA 5J2QB 2SXLA 4QYZJ 4DUYJ 4DR5J 3WX8A 3SCKE 2ZZNA 1EKSA 4Q0BA 3G2XA 1JLFB 1IKWA 4WFYA 2D3O1 3CB4A 3DRRB 2GO8A 1CEZA 1R6VA 2LA4A 3R9LA 2ZM6J 1VLOA 2VG5A 2MZ1A 4R5PA 1FD2A 1P9QC 1CBKA 3EDRB 3M9NB 4DV4F 1J5OB 2EEYA 3CVKA 4MJKA 3UW1A 4PWWA 2GW8A 2R7UA 1JJ4A 3IR5B 2RNEA 1GAOA 1FNXH 3MUTP 4XK8C 4ELUA 3TQEA 1FRXA 3CC2S 3EM1A 4J5OA 3BGFA 1YK9A 3PW5A 1HR0J 3SYZA 3UCGA 2R8GA 1F9FA 1VFJA 2HBYB 2XNRA 4NA1A 1IKVB 4DR3J 4GMKA 5KFGA 3GG1A 5HVFA 1UVJA 3S01A 2MQLA 4USKA 3MEKA 5L1JA 4MIAA 2I2YA 2VH7A 1TUGB 3D4JA 4LF6F 4PWUA 2B4OA 5IQQA 3CNQP 3DHWC 1H72C 1JK9B 5I3PA 4RBUA 3ZZTA 1YRUA 1HNIB 1RHRB 1VRTB 4M5GA 1K44A 1KVKA 4KH0B 3IN5A 5HI7A 1FKPB 2QX0A 2V4QA 2JNJA 1D9AA 4F3QA 4K4ZA 4LF2A 5ETLA 3CO0P 4MKBA 3CSKA 4C7QA 3CD6S 2B5JA 3KK3A 2VICA 3CULA 3IGVA 2UXDF 3QGGA 2CQ4A 1S79A 1Y9OA 1SIZA 3DXBA 4C0OC 1SJ3P 5KFPA 3GIIA 4R0JA 1E6VB 3I82A 2OFHX 3N6MA 3M8RA 2UVWA 3C14A 2PIIA 4DSFA 3O3LA 5I3UA 3MR5A 2V2KA 1T95A 2AGPA 2LQBA 4GC7A 2C3OA 3NOCA 4MTPA 1SQFA 4WKRA 2OI2A 2RUGA 1FJ7A 2R8KA 2NSBA 3ILJA 4A8WA 4I64A 3M9MB 1J5EJ 1UEVA 2GVZA 4B9TA 4LF4J 3GJQB 1RUSA 1PC5A 1SH0A 4DR5F 2D3UA 3I96A 1I3OB 4QIWD 2VJUA 1ZBTA 4Y0FA 2OEJA 5CYQB 3Q8UA 3FDSA 4LRBA 4DFJA 2GHVC 3MM5B 5HMXA 1HBUA 2HKEA 4ECRA 4Q0BB 2KO1A 4F4XA 1JQGA 5LMUJ 4GKKJ 4XAKA 4ES2A 3OL6A 5F41A 3ELHA 2X1FA 1YX2A 4MFBB 1PYTA 4Y2CA 1ZOTA 1B99A 2YH1A 1PCAA 2EXUA 4RPFA 5GADU 2VV5A 4P73A 6FDRA 4USIA 1EX8A 1WI8A 2J7UA 2BE2B 2KG0A 1S76D 3BBBA 1N4LA 1NK4A 1Q8LA 3C15A 4ELVA 2B9YA 3LTOA 3QJJA 2NS1B 3C66A 1DY3A 2AP6A 3I6PA 5HAOA 5EDWA 3JQMA 3GP9A 4FN5A 2CQCA 3PYGA 5J2PB 2LQ5A 2ACMA 4RWWA 1Y3KA 3LANA 4IG0B 1LXJA 2PA8D 3EVMA 4X4QA 2XCPA 3OVAA 1IM4A 2FGOA 2PSZA 3HP6A 1T9TA 4EWTA 1GTEA 1HI1A 1O8BA 1WSVA 2CIMA 1MMLA 2FYXA 3H98A 2RQMA 1EP4B 1VK8A 2OD6A 3T41A 2RH3A 4WFZA 1J2VA 4DR7F 3CCQS 2IBOA 1D3WA 4RW6B 5K14A 2LECA 1C1CA 2OP5A 2KT3A 1SB6A 2MTLA 3M05A 4WP3A 4WWSA 4Y28C 1LWCA 3SBMA 2XGQA 3LPYA 1IBLJ 1B64A 3SV3A 4CP5A 2FJWA 1S6PB 3TAMB 2OJ3A 4PUOA 3ZNJ1 4HT5A 4RNNA 2CJKA 4U9RA 2RMLA 3FQLA 2AMCB 5T41A 4EGLA 4MT1A 2FJVA 1CQNA 1F1BB 1P1LA 1SXLA 2XHCA 1QSSA 2IFXA 3PHEA 3GV5B 2CZ4A 4NLSA 5ETNA 4G1PA 4KFBB 1KKHA 1DTQB 4DU8A 1RYSA 3LQVA 4AXIA 2GMJA 2F7VA 3Q8SB 4YHHJ 1IBKJ 2DT9A 2WSCC 2OFGX 3LUYA 4ZLLA 3KMQA 1AFJA 2BJ7A 1SKSA 2Q3PA 3CDAA 1S9EB 3NS7B 4N8NA 4QIEA 4B17A 2EKNA 4HKQA 2QLFB 1C1CB 4KGZB 2QLXA 3SCJE 1P9YA 4I4BA 3R1HA 2MQNA 2OSRA 3HHLA 4DOZA 1JKHA 2CQIA 4ES1A 4NOHA 1S6PA 4IO9Q 3GYXB 1KBRA 2WHOA 1PBAA 1XJWB 2Z4PA 5I42B 5KFUA 5HSPA 2QMWA 3PRVA 4FBTA 2MQMA 2BKOA 3QO9B 3JTPA 3NMAA 3NMRA 4ES3A 3CJKB 2UXCJ 3V4IA 1VOMA 2XY6A 1QVGR 4YB5A 4ECUA 4ZP6A 2AU0A 3A1YG 3J7ZT 1KFDA 2G4BA 1FA0A 1NPRA 1G6BA 1D0EA 1SPBP 3C6UB 3GJTB 1BUXA 1N5SA 1RCXB 2BJEA 4FP9A 2RQKA 1HWLA 2DNLA 2DXFA 3VGTA 2V4RA 1VQSA 2F4VF 3GJRB 5F0WA 1EETB 1FKOB 2XS2A 4NZ7A 1SJFA 1GEHA 1R6YA 3EXYA 3R6LB 4IRDA 4HVZA 4HTJA 1FEEA 1S7IA 5LMNF 4IFVA 2MSTA 1NU4A 4DV6J 1WC1A 1HPZB 2DR9A 3NNAA 1Q53A 1DJ0A 2KT2A 2ZBQA 1RLCL 4I6WA 3DKDA 3NG8A 5KFVA 4DQRA 4U7UK 5GAHU 1BMQB 1FCAA 3N01A 4K4YA 2UXDJ 3IG1A 5IXUA 1GK8A 1U1MA 4NLTA 2AIRB 2KHCA 2I38A 2LLZA 2K1RA 3I9ZA 1DRZA 1SC4B 4JI0F 1ZAVA 3R2DJ 3S6EA 4BHQA 2WVBA 3CUNA 1TAUA 1G2EA 2RRNA 4ZN3A 2XYGB 3W2VB 3DGPB 5H9EJ 3UI3A 1RT3B 4NEZA 1R7IA 2C2ZB 4LSNB 1VYAA 4RUBA 5D15A 3THVA 3ET6A 2D9OA 2HQGA 2OHDA 3KLHA 3DLHA 4QW8A 4ZVEA 2JC1A 2IIHA 2JVOA 2MY8A 3NGTA 3V6DA 3KLEB 3DOKB 1ICEB 4K4VA 4RW9B 1EZZB 1TUVA 5DJBA 5HMYA 2NREA 1T9YA 1P8GA 3AJ1A 2KM8C 3T3FA 3HSJA 5KAKA 4ZIWA 4A46A 4LSNA 3R2CJ 2EFNA 2ZNYA 2NXUA 4YR3A 3ITHB 2HSEB 5DQGA 4DPWA 2EWHA 1BXNA 2XLJA 4UOFA 5B0AA 1JJ2R 3MPUB 5DZ7A 2XQCA 4P9SA 3FKBA 4BC7A 4DV4J 4Q2MA 2JFDA 3HHDA 2OAUA 4ZJOA 4DJBA 2AYMA 3GFXA 5LXYA 1R43A 1FWPA 3FBBA 4DPOA 4JI2F 2Y9HA 3CCVS 3KJNB 1OWXA 4I2PA 1X60A 4DUZJ 4P2SA 4DSJA 3W1YC 4FF2A 3MD1A 4WFAQ 1XNQJ 4MK7A 2ADCA 2OGUA 3K59A 1I1GA 3O6QA 5HQMA 2HYIB 2BW2A 3T1HJ 3AY0A 1KQSR 2UUWA 5ITHA 3KK1A 3RJMB 1X4EA 1FERA 4B9MA 2VBYA 3IAM9 3QRPA 2YWGA 4R8UA 1DURA 2KJVA 3MCSA 3MM9A 4X4RA 1RT2A 1VRUA 1X0PA 3QBCA 4DLEA 2FVPA 2BYCA 2XMUA 2EBEA 5KFZA 3W63A 4LF5F 3OFGA 4F3OA 1SJ1A 1G4CA 2KYZA 1DZ5A 3PTWA 2BDPA 3JQKA 2HHVA 5K9FA 2VF3A 4LJMA 1PO6A 2EVZA 2RUSA 3TP2A 4BCAA 2HFVA 2ZH3A 1WELA 2HHHJ 3K5OA 2LU1A 1RHQB 1A7GE 4WPAA 2B9WA 3ZTQA 1GXUA 1KTVA 1TL1A 2GMHA 1RWMB 1ZPVA 2N3LA 2ROPA 3CCZA 5DETA 3HO1A 3GR0A 5C2CA 3FCHA 4WYWA 3HPOA 4OI2A 3CJKA 2ZJPQ 4RNHA 2JFKA 1CJVB 5IT9U 3G8SA 4IQXA 3B4MA 3DI6B 3CCJS 3CJ5A 3PXGa 3C6UA 4ED4A 5KOXA 1HNWJ 2VOOA 1IXKA 1HHSA 3H40A 4IO1A 4OZNA 4HEA9 1FRMA 2DXDA 2QO3A 3JSRA 4TY8B 2P2CB 4ER8A 4UW2A 2ZDOA 3K89A 3QRRA 1U4BA 1WWHA 4CLTA 1HI8A 1WF0A 2EFQA 4AQYF 1NK8A 1T9UA 4NXNF 1TTHB 4DQPA 3TWZA 3GIJA 1W2BR 1GX6A 1RHJB 2MQ8A 1SL0A 1R8CA 3SFUA 4USWA 4ILMA 2EFVA 4YY3J 3MECA 5IOLA 5F9LA 5ETMA 4Z37A 2HZVA 3A3NB 2ZKTA 2DKOB 1SL1A 3F41A 1LK5A 2MLZA 1OSCA 4BS2A 4RW8A 1SQEA 1R0CB 4DXLA 4WF9Q 2MKYA 3BN7A 3MM8A 2KM8B 3MHYA 4B08A 3VAFA 2F4VJ 1FNMA 2RE1A 4HACB 2D41A 4FYVB 4M5LA 4Y2AA 1VBYA 5D77A 2R7XA 4PCQA 4PQUB 2PEHA 2KXFA 4ZPWR 2HHQA 2A18A 1VLYA 4C8YA 1FRKA 2QLJB 1UA1A 2V9WA 2E9TA 1EQMA 4DDFA 2XM3A 2XYPB 3TARA 4WP8A 4E8UA 1TKTB 1M5VC 5BR8J 3DXSX 3I0RA 3IWLA 2BM0A 3KG0A 1TKZA 4NLYA 1T94A 3L7PA 5M2RA 4F25A 1UW9A 4CCHA 3NNHA 1FDNA 4F0MA 4U7CA 4DV7J 4A4JA 3BB5A 3PYEA 1UL3A 3EMTA 1RAHB 3FMWA 4RW7A 4ZHRA 3OUYB 2YKMB 5CXTA 1WHYA 2QLWA 1IKYB 1LWCB 1RLDA 2VDIA 3BM7A 3M4XA 3HT3A 2GS8A 1VI7A 4X2BA 1VQPS 4F7VA 5AE2A 4A8QA 4LFCF 2HVDA 2YY3A 3M2VB 2Z30B 3DYAA 4DN9A 2O1PA 2WBMA 4OI6A 3T6BA 4QWAA 2ZNZA 4CO5A 1XMBA 4DV1F 1RWKB 2QSWA 1KC8T 3Q22A 4AL7A 2V68A 2BR0A 3O44A 2BA9A 1JIHA 3NCPA 1RTHA 4RO0A 4OYZA 3PW2A 1ZAXA 2Q6BA 3A8JA 3CJSA 1IUJA 3W2VA 5J2MB 2OTLS 4WXWA 1YBAA 5HN0A 3LA0A 3H4DA 2JH3A 2KI2A 2QA2A 1B3TA 1HQUB 4PQAA 1XC9A 3M6VA 3CIMA 5CHCB 1ZZFA 2GA7A 3HVAA 4I68A 2C2OB 3UVJA 5F8NA 3RG6A 1NHVA 5KOWA 4OI1A 1FJEB 3LWMA 2DCLA 2DTJA 2IMOA 3TA1A 5EN1A 1X5OA 2MKKA 1B7FA 2HVZA 5G0RA 1PJ7A 3MFIA 1PBUA 3ENQA 1X9WA 3T6JA 4BLGA 4LFAJ 4ANDA 2RVJA 2QJ3A 3R7SB 3T9ZA 2K3IA 3NGUA 4CLWA 2XO6A 4DWIA 4DS5A 1NB2A 1HBUB 1TFYA 2NUHA 1WNEA 4A48A 2Y1IA 3IR6B 3NCQA 4Q8EA 1CJUA 2CQ1A 2HURA 3HDSA 4DSIA 1ZM3A 4AL6A 1M0SA 1K47A 4OI4A 3S8SA 4LQ3A 3TJ8A 4ZCMA 2Z8QA 5HP1A 1SC3B 2YKQA 2M7SA 4TLRA 2VBWA 5E7OB 1KR4A 3U27A 4A8MP 3U1LA 4DL4A 4LRFA 4KGMA 1REGX 4WIQA 2XZWA 3RB6A 2GQQA 1E6VA 1IWGA 2FY8A 2OPRA 1CJUB 3CD7A 4NX9A 4HR2A 5D4PA 1FXDA 3AAWB 1UWBA 1TV6B 2G2ZA 2R8IA 4ZP8A 1I94F 3QJLA 4JI2J 1RQ0A 1RP5A 4JI5J 4ZVFA 4O44A 3AD7C 2Y8YA 4WFXA 5FLXU 3FQKA 3RYLA 1XR6A 4NI2A 1S9GA 4MIWA 5B0GA 2WONB 3FFIB 3VTIA 1EKRA 4FF4A 2HQ3A 2FLOA 4IDKB 4W4MA 2ZOMA 1XNQF 2M5YA 3PACA 5A8KA 2EC0A 2MB0B 2CJQA 3DGPA 3I9V9 3M8QA 2HVIA 3GV7B 3OLAA 4HI2A 3NL0A 4USUA 4K50A 4FZVA 1V5VA 4RW8B 1JMTA 3NGDA 4U8VA 2Q43A 2LMIA 2W4PA 4XIUA 3K2YA 5F8HA 5KFQA 3C16A 1JLEB 3L09A 5EHHA 2GQCA 1JLCA 3D67A 2Y0BB 3W7BA 1RXOB 1DFDA 2K7JA 3BSCA 3IM8A 5SUHA 4ECSA 2KN4A 3IWNC 1YJRA 2B8PA 3QIPB 2HLTA 3LAMA 3UD5A 5HQLA 3RR8A 3QGHA 5KG2A 4CT9A 1RZMA 2XO7A 1UFWA 2YQ0A 4XDDA 4CO1A 4DCJB 2OMOA 3JS9A 3FVYA 1N6QA 1NKBA 4L3KA 3N0VA 8RUCA 1XERA 4ECWA 4WYLA 2J6SA 1FD8A 1Q8IA 2CRLA 3CD5A 4ZCKA 1S6OA 2WTFA 3GIMA 2KFNA 3NOGA 4PXDA 4CLLA 3QAEA 3W64A 4TU9A 2L41A 2FB0A 5CD4H 5I3UB 2XZDB 4ILRA 4OI0A 5BYRA 2JLGA 4X64F 4LF9J 2F40A 3EGNA 3S7RA 1Q4RA 1D1UA 4OFZA 4KKOB 1FHTA 2D9PA 4RW9A 1HBNA 2HPUA 3P5BP 4ZVGA 4AD6A 3JYTB 3OR1A 3Q83A 3ETMA 8ATCB 1AYEA 3AQOA 4PR6A 2DRAA 2DGTA 2IPOB 4Q5VA 1Q78A 2V63A 1HNVB 1ZPWX 2V50A 3FBCA 4HDHA 2DY1A 5KTQA 5GAHI 1FRIA 1VQMS 2QL9B 2CG4A 1I6JA 1Q0NA 1X4DA 3CCES 2VFUA 2NSCA 1T05B 4LF8J 1DTTA 1NPKA 2CADA 2E7WA 1TP7A 2CPJA 4NZ6A 2VODA 5KG7A 4J9MA 1L5UA 2CJAA 2DO4A 4ZCIA 2AQ4A 3QWUA 5KFNA 2CQDA 1LWEB 2ZE2A 1QVFR 2G0IA 1SKRA 2DGOA 4LUBA 5JVGQ 2RF2A 3LP0B 2HHPA 2YNHB 1F3FA 5D4NA 5U47A 2Y8WA 2AT1B 1SBRA 2R42A 5AXMA 4ANEA 1DLOA 1N5YB 2V2QA 1YDLA 2UUTA 3EZ5A 1HKAA 3B54A 1HR0F 3VZIA 3D66A 1NSPA 2F65A 1RKIA 3PX6A 1JLAB 4IOCQ 1QSLA 4J37A 2IVFB 4Y2IA 5E3RA 1RAOA 2IRUA 5RUBA 2CG8A 2YNHA 3IWXA 2VG6A 2OD4A 4DL2A 1F0XA 1WG1A 4X62F 1IR0A 1BE4A 4PPDA 5DQHA 4FXWA 2ZVIA 3TZYA 5ETKA 4M5JA 2VU5A 2GV1A 4B9UA 3OXLA 1KP6A 2RJZA 1KHWA 1UPMB 4JV2A 2RQCA 3F56A 4ZP9A 2M4MA 3MEDA 4B9NA 2HHHF 2NR0A 3I5AA 4Q44A 1WOSA 3OW2R 4DV3F 4QBUA 1VQ9S 2BRKA 1OMSA 1YRXA 2NQPA 1FF2A 2BM1A 1OO0B 2F63A 1BY9A 4OJ3A 3SXLA 5A8WA 1TK5A 5F8LA 3KLEA 4KC5A 4J9RA 3MCNA 2R8JA 2YTCA 1REVA 2ZWPA 3MAAA 1KOHA 5KFWA 4NXNJ 2KRRA 2PE8A 2PMWA 3GFHA 1N52B 1AA1B 3DI6A 4YEAA 1VJWA 3W8GA 1X5PA 3SQOP 3PIOQ 1UEUA 1WF1A 1I5OB 2GFFA 5LT5A 1RABB 1NMEB 2O3DA 4PWDB 4KO0B 2FC8A 3MFHA 1NH7A 2PC6A 2DVIA 1QE1B 5JUMA 3R1LA 1FTCA 2HRUA 2WVEA 3POTB 4H4OA 5H9FK 4G1IA 3GR1A 1S1UA 1KLMA 3E3XA 4CH0S 4ZPCA 3V81A 2DIVA 2OKQA 5IQ6A 4NA3A 1TL4A 3UCZP 1VQOS 1K9MT 1SH2A 4NCAA 1TL5A 4LF9F 3T1YF 1VC5A 2IC3B 3MD3A 4HL9A 2UVVA 3SCLE 2MZQA 2E29A 1FRLA 2XMVA 1JLEA 4Y2KA 3W9JA 4DV7F 1J5OA 1HQEB 1KTQA 2VB6A 3C6TB 3EZUA 2PO4A 3GG0A 4NLOA 3TJAA 3JQJA 4Y34A 4Z2XA 4F4AA 1FE0A 2B56A 1RA6A 4NPOA 5M2PA 4B3MF 2DEIA 3R5BA 4C98A 2CZVC 3NGKA 2G13A 2I1RA 1Q95G 4NRUA 5A76A 7AT1B 1RJJA 3W9IA 3MPDA 1Y5NB 4B9LA 3OR2B 4ZDNA 3DYAB 4P10A 4RUHA 2VA2A 3PR5B 3NP5A 5CA5A 1QAIA 5SZTA 2BUNA 4ZVOB 3I4PA 4B3SF 4DV5J 4J9PA 3VAMA 5F8IA 1Z2LA 2DGWA 4C3MA 4CO2A 3BZQA 5E41A 4JV1A 4YUDA 1RT7B 3IBWA 4C11A 1S1TB 4I56A 4KY3A 4PABA 2VIHA 1HPZA 3TANA 3DM2A 1N8RT 2E9RX 4Q43A 4CLKA 4J90A 2FZKB 5HJYA 1NK5A 2YPYA 5A8KB 3QMQA 4MIBA 1DARA 1UVIA 1TL7A 3ISND 2E5JA 3DMJB 4QR0A 3U1MA 5KT4A 3H25A 5LMNJ 1RHUB 1SL2A 3F44A 1S1WB 3HULA 4G1QA 4ZK7M 1SKWA 2HMIA 1NUEA 3P49B 3R5AA 1YBUA 2ZD1B 1R8BA 3Q2TC 2BQ3A 1RADB 2ZITA 3AH6A 3D0HE 4NE9C 4J7CA 4OZJA 1U1LA 4GKJF 1SH3A 2OPSB 1RT6A 3BJYA 2DH7A 4ERDA 3Q24A 3G87A 3HFKA 5B0BA 2CWKA 1CS4A 2LFVA 3PO4A 1MSWD 4ZVSB 2IJRA 4E98A 1L3TA 4NYZA 2X1GA 2X1AA 3C46A 1DQ8A 3V2UC 2ZHAA 1IJEB 2YVSA 4F36A 4QW9A 1BGXT 1RT1A 3CJ3A 3HHEA 3OTDA 1NLKL 4H4MB 1IKXB 5KFIA 1S1XA 4DZDA 2VQEF 4CYUA 4MAKA 3TZZA 3KJVB 2D1CA 3LW5C 3MTKA 4QWBA 4QWEA 1KOOA 2PD1A 2Y3YA 4HTIA 1VBXA 1NH8A 4DV1J 3KKFA 4JI7F 1AW0A 2HW3A 4USHA 2EK1A 2C3YA 3M2UB 1MN9A 3TI0A 4P74A 2AV5A 4C9DA 1HD1A 1CQMA 2JEFA 2FPHX 3TEHB 2DR5A 4I6AA 4LF7F 3EJMA 1WC6A 4N41A 2PN6A 3EGZA 4ITSA 3BSNA 2MHEA 2MZRA 2V8PA 1WEZA 5KT7A 1NJIT 2VUGA 2YPZA 4ICLB 2DNHA 2V8GA 1SVDA 3LP1A 5J1NA 4OL8A 2MKIA 1Q8KA 4LFBF 3KK3B 4PRFA 5THWA 2CJ9A 3UR0A 1S9GB 1R0AA 2V94A 3LO3A 3H90A 2Q79A 4ECYA 3D3CJ 1L3UA 3JTNA 5DGBA 5JVHQ 5HBMB 4KHPF 4KB7A 3R7NB 3OL9A 5J2PA 2XWXA 1S57A 5DRKA 3PM9A 2GGPB 1URRA 1RDRA 2A2CA 4KAIA 3G71S 2FVQA 3IBFB 5KG0A 4K0KJ 3EYZA 2AF6A 3QT7A 3P8BB 3PRBA 1MROA 3DRPA 3BBFA 3SQGB 3TX8A 3ZXWA 1RBAA 1WKKA 2AWZA 2W8LA 3VAJA 2XMWA 4FYWB 4ED2A 2XTJP 4PAAA 3QO9A 4C8OA 3CCUS 4DR2F 2UUCJ 2BMBA 3BV8A 4JB8B 1Y10A 2LEAA 3T19A 1T8EA 4OHXA 3EWGA 3QIPA 1LWFB 5GMEA 1XTZA 1C0UA 3NLCA 1M90T 1JLQB 2C2EA 3WIVA 1S49A 2A10A 1OPIA 3BGOP 3BPDA 3CWJA 2QRRA 3GYGA 3H2UB 1TKXB 3QFHA 4OQJA 5DM7Q 1SJ4P 2YKAA 4USJC 4USMA 2R2UA 3RRGA 4IRKA 1S59A 3HF5A 2PEBA 2V69A 3QGIA 1P1TA 4HACA 2XGPA 2IC3A 1RAJA 2A1BA 3LAKA 3OT9A 2NPFA 4ZLPA 5AXNA 3JB9k 3TR5A 3ENVA 1VISA 3B4DA 5CAAA 4ZJQA 2P9CA 1AUDA 3OVBA 1JLGA 3I0SB 2DNQA 4I2PB 1D8ZA 3HX9A 5KG5A 5IC4B 3D1OA 4FXDA 1S1XB 1YTYA 3OTOF 3I4HX 1GXTA 3R3TA 4X62J 4RJVA 4RNMA 4KPYA 3KOAA 5A8RA 1T0TV 3VAIA 2DHXA 2FVCA 1FXRA 1TAQA 4HI1A 1JLBB 3BKTA 2EW9A 2YNGA 4A8OA 1RSCA 1YJWS 2KJWA 4KTQA 3MMAB 3RGIA 1C0UB 1NZAA 2HWTA 3D3BJ 4DV3J 2F1FA 2I8EA 1HWKA 1XBWA 2V8DA 2YWFA 4UUXA 2OTJS 2AJ1A 3V6JA 3BO4A 3FSYA 3VWSA 5AE3A 3BR8A 5T14A 3H42A 4FBUA 4UOCA 3PKMA 4WZMA 4QPXA 3OL7A 2N4CA 1UWAA 4OYXA 4F67A 4OZ2A 2X3DA 2HNYB 2HK3A 2YX7A 3F0NA 3MM6A 3SEOA 3MTJA 2VJVA 1J5EF 1PC4A 4DN0A 1ZA2B 3D28A 2XS5A 5H1SV 5LJ5Y 2CQ3A 3ICLA 4FF1A 3PHTA 2G2OA 1RT6B 2FJBB 2RILA 1OQ3A 5D0RA 1OYEA 2F9DA 3CW2C 1V6HA 1HBNB 4QIGA 3JYTA 1VMBA 1U6FA 5GAGI 3W5YA 1UVMA 4ILLA 1F60B 1VQ7S 2YWWA 1A0OB 4F50A 3NS6A 2WVFA 3LOUA 4YR2A 4ZLNA 2CQBA 3CJRA 3K57A 3K5PA 4IG3B 1NAQA 4QU7A 3THTA 3I55S 4DFKA 4DL3A 2XLKA 3P3DA 2E1MC 3HI9A 3QGPA 4PYDA 1RTJB 5F8GA 5FLXY 1XMQJ 1NK9A 4FYXB 3KHHA 5D8HB 1UMJA 3W5XA 1KONA 1TL1B 4DV6F 3MWBA 4JP8A 1WUUA 2E66A 2V6AA 2QC3A 2IVYA 4J91A 3IS9A 5IZHA 3LWLA 5E3PA 4DR6F 5ETPA 1CC7A 4U67Q 2LEPA 2RAQA 2V0NA 4DSKA 1QTNB 4AFFA 2MZSA 2JC0A 2AZ3A 1OY9A 2IJFA 2B51A 3ZFVA 3CPWR 4OX9J 2DPJA 2IBKA 3PFEA 4U96A 2DITA 3TW0A 5B08A 2UU9J 2W7AA 1C0TB 2Z2MA 1WTFA 2D3OR 1RWNB 5FIIA 3OJUA 5DM6Q 5DO2A 2O67A 3ADAC 4JI4F 3POTA 4FKYA 4DCOB 4C8ZA 3GJSB 2E1CA 1CVJA 4P72A 3CCLS 4L76A 3KK1B 2KZZA 2EFPA 4ZVUB 4ZOSA 3VAGA 5J2MA 5C25A 2GAGC 4LVNP 3HVRA 4C97A 1HNIA 2BOAA 3G6YA 2J6UA 3V5RA 2KZMA 2QYGA 3K5LA 3QNWB 4IH5A 3PY8A 1HW9A 5J2NA 2PA3A 3ZC4A 1IWAA 4TU8A 1EJ7L 3NGRA 1H7WA 1R8AA 2J76E 3CIZA 4EO6A 4DV2J 1JJHA 2C3PA 3OVSA 2CFXA 4JV0A 1NHUA 2F8HA 5F8MA 1PSDA 3PZPA 1NB7A 4I1TA 4HLBA 1RI7A 1YHQS 1IBLF 4JI0J 4NLQA 2HFUA 1TKTA 2H5IB 1HMVA 3W8PA 4QCLA 2L3MA 2ASJA 4OHVA 3SI8A 3QFWA 1D8YA 3K8VA 1C1BB 4HYKA 4NXMJ 5IWAF 3RRHA 1PILA 1REVB 3MAAB 1CLFA 2RDJA 3PYDA 4IFYB 5BXIA 1YZ7A 2AJFE 4Y00A 4KHMA 3D68A 4NLWA 5B7WA 3A4TA 3CD0A 4NCGA 3P6YC 1HNZF 4FDFA 3KUGA 3MMBB 5HATA 2CVIA 1XN9A 2FUG9 2QTWA 1H98A 4OHZA 1JLCB 3VGVA 5KG1A 1VC0A 4L73A 1PKUA 3CMES 4DQSA 5IV4A 3CDWA 2NUUG 1OY8A 3RR7A 4C8NA 3IFEA 4XDCA 1VQNS 2WOMA 1MWZA 3EVOA 2PMHA 2E5HA 3BSAA 3FGVA 4OJGA 1TK0A 1N34J 3PNIA 4KHRA 2Q6CA 3GLJA 4FXVA 2DNMA 1YGYA 1C1BA 1LFWA 4CO0A 3RBDA 3D5MA 4KGVB 4O3PA 3J7AN 3NNCA 1RA7A 2XMJA 3CMAS 1KS2A 5BYQA 2L08A 1KLMB 1KDNA 4TNOA 3TVYA 1UEKA 3CDEA 3W61A 3JAMY 3D54A 4ZN1A 2RS2A 4W90B 1S99A 2IM1A 2HNDA 2J5AA 1BQMB 2RU9A 3D6TB 2VD3A 3JTOA 1BQNB 3W66A 1SQGA 2HLUA 3HJVA 4YQWA 2AYEA 1U0HA 2CPYA 1KQKA 1P6TA 1KD1T 4JBCA 1N88A 2HAFA 3T9NA 1ZM4A 1S0MA 3CF5Q 1UA0A 3CEDA 4V19J 3OV7A 2E1PA 1T05A 3KFWX 5KT3A 1UZHA 5C24A 4NMXA 1EP4A 1BQMA 1K1QA 5F9NA 4X4TA 1PJ6A 3EPGA 2CJXB 5G4DA 2G0JA 1L3VA 1Q16B 3C8YA 4NYPA 1NSKL 3D6FB 3B78A 4DHVA 1FDDA 1QD1A 2RDIA 4R8UB 5IT4A 3GZ7A 1IKYA 4GO7X 3ONQA 4DPXA 3RTVA 1LKZA 4J9QA 1S72S 2VA3A 1TELA 1KN6A 4WK3A 3QATA 1N6QB 1YBTA 3O1LA 4YDXA 3UNYA 5A8RB 2FHOB 5KT2A 4LFCJ 3IS9B 1RBOB 1S12A 1SC1B 5HBMA 1MG7A 4PKDB 2J9EA 4GVBA 1LOUA 2PFDA 4F4WA 1O0PA 1B0PA 4M5KA 3G6XA 4OYAA 2MDAA 1SV5B 2VG7A 2KYXA 1H38A 1OSDA 5H9FJ 4ZVQB 1S97A 1QJHA 3R7BB 3KHGA 1NJYA 2P8IA 3KTQA 3DOLA 2FZGB 5KFKA 4F8RA 1UCNA 2KU7A 5B0EA 1FJCA 1RWXB 4PG4A 1Z1ZA 3BGRB 3VGUA 4M94A 1ITPA 1E6YA 4WE1A 3AD8C 5D4OA 3R8YA 3N6NA 3F73A 3H7HB 3UCUP 1LXNA 2E7XA 5KT5A 2WW4A 4ZITA 1WC3A 1MU2B 2I0XA 3GIKA 4CYUB 2ZH1A 2OSQA 2XMMA 1V3SA 5J1EA 4KRWA 2ZHBA 2IMWP 1GMVA 4IOBA 2RSQA 2HGMA 5A0YB 4ID5A 5MLCV 2DK2A 3PKYA 4M5MA 4DR4J 2QZ8A 3ZZRA 3GU0A 3E51A 4USTA 2G1DA 3UN3A 5IT0A 2CNOB 1HBOA 1JX4A 4B3OB 2DO0A 2IVMA 2P5VA 2B4UA 1M5KC 5EX3A 1VIOA 3D1QA 1WC4A 2GHPA 2DGUA 1X8DA 2GNKA 1F6TA 4K59A 4P2XA 4QJVA 5F0UA 4DFMA 4F3MA 4N47A 2PI5A 2Y1JA 5A6PA 1S7HA 3LP2B 2QG9B 3M8YA 4O44B 3P4UB 2B6AB 4JUZA 3SIPB 4B02A 4KGKA 4Q45A 5B0CA 2H54B 2XLIA 3OJSA 2BKNA 2CA9A 2VG6B 2EK6A 4XO0A 1HBMA 5KFMA 2ZH9A 2R7QA 3BYPA 4QIVA 2A3JA 2OPRB 2XULA 1YG0A 4AYBD 2IJNA 3M2RA 4J9VA 4OMFG 2X3GA 3CCSS 3A8EA 2JOQA 3CGIA 1H2TZ 4R0EA 1HI0P 3M32B 1R0BG 3JXOA 4CH7A 2DJWA 4DUTA 4HHJA 3J80Y 3J81j 2MQQA 1XMQF 1I51B 3GE9A 1IBMJ 2VPZB 3MMJA 1EAYC 2MHNA 2BJDA 3J7Z5 5DLGA 1ULRA 2F3JA 3O5TB 2HFSA 2IYGA 1U6BA 3US5A 1T3OA 4ZVRB 3OTBA 4KV8B 2KKHA 2HQIA 2AJ0A 2YNFA 2WZ1A 4WJBA 3IG1B 4QU6A 2WVDA 2GVZB 2KFYA 3FUYA 3QLHA 3VV2B 4CH1A 3KK2A 4ZP7A 2I5JB 3EXCX 3HT0A 1NNDA 1RTJA 3IAS9 3RW7A 4J9KA 4WFNQ 1BLUA 3H0PA 1C4AA 3Q89A 5CYQA 5K14B 3RUBL 3K5MA 2CNLB 2XSJB 3VHQA 3V4MA 3KG4A 5KFLA 2W7PA 1N33F 3AFGA 5CZXA 3M7VA 5HQ8A 3V4IB 3EGVA 1U1QA 4U95A 4RL1A 1S9FA 3HM9A 1YITS 3UDVA 1RTDB 2R7RA 3UO0A 4DS4A 3M8ZA 5M2UA 2DD8S 2XB2D 1NEEA 4EYIB 3PJ9A 1N36J 3UDCA 5C24B 3DLJA 2BW7A 1Q8BA 3FJ2A 1WI6A 2H4YB 2IDLA 4PPZA 1AROP 1RT4A 2OEKA 2FJEB 3UDEA 4WKYA 5DGAA 2HNYA 2GIRA 1ZZNA 5E0OA 1U1PA 1ZH5A 4ID5B 3U7JA 1KNZA 2W2PP 4OLPA 1DTQA 2ATCB 4CWBA 6FD1A 1RAGB 1RTDA
chains in the Genus database with same CATH topology
4RBVA 1XWLA 1GT8A 1KVIA 4F4ZA 3R5CA 4C3LA 3VAHA 3M2UA 1L3SA 2QEXS 1URNA 2XSJA 2VG7B 3MPYA 3N28A 3NS5A 2J0XA 2MY7A 1LV5A 2VPWB 4NLRA 3MEDB 1UKUA 2MJUA 3DOLB 1SC6A 1SUQA 2FGCA 3QWPA 4EU0A 4QWDA 2LDIA 5BJRA 1Q81T 3CJ0A 4JI5F 5HROA 5EX0A 3T5LA 4M8LA 1VGYA 4DL5A 5L1KA 1UJ4A 1CC8A 2E1AA 4DL0C 2IRXA 3DLGA 3V81B 5LMUF 4FF3A 3TRGA 1DLOB 1N5YA 2YX4A 4PG5A 1HWUA 3Q0AA 4QQBA 1JXEA 1ZTWA 2H9ZA 4I7FB 5AXLA 5CYMB 1F5CA 3QAUA 4ETXA 4C8MA 3CCMS 2ZOGA 3TAPA 2KT5A 2O01C 1R3NA 3MR3A 5GAEI 1NK0A 2LDYA 2KXHA 4K4XA 3DRPB 1YJUA 3FZBA 1WHXA 5D77A 2CPZA 4P7VA 5A8WB 1VQ4S 1UVNA 3H2LA 1UP1A 2V4JB 2E5LF 2QFJA 4X4SA 2HFOA 3KMSA 2VFRA 1YWXA 3FRZA 1FKAF 5AJ3F 4KSEB 2WOMB 2GO9A 3EUNA 3RRKA 2DNYA 2HFZA 1NJZA 4ED0A 5GMKa 2ALZA 1RGVA 4JI8F 1LW2A 2ZH5A 4CO3A 1R0AB 1MU2A 1U45A 4Y65A 3TNVA 5HLFA 2VFVA 5EWFA 3G86A 3CJ2A 2XHWA 2HNZA 1O5JA 2GJIA 2RQ4A 3IRWP 1KQSR 1S6UA 3BO2A 2ZC4A 3L3CA 2WRMA 2DCUB 2ACYA 5AXKA 4C3KA 3GFZA 5HLFB 3CC7S 2R7TA 2ILZA 2JVRA 4IDKA 5KG4A 4C0HA 3KJVA 3NCRA 1G1XA 3IRXA 1S77D 2IRYA 4IR9A 2FHJD 3DRYA 1U48A 1GTHA 5J2QA 3RBEA 1ZM2A 2ROGA 4HH0A 1VBZA 1HQEA 3OTEA 1U47A 4ZPBA 3LF0A 1HNVA 4QWCA 2W9AA 5EWEA 2FJXA 4OJ1A 2GX8A 4UY85 2AGOA 2P6SA 5D3GA 1CG2A 3PJXA 3OSNA 1KLNA 5C25B 3IRXB 4MH8A 3VALA 1X4CA 4OX6A 2ASYA 4QZVB 5ADZA 1HD0A 2B4PA 1SIWB 4UUWA 2UU9F 2UUAF 4YHHF 3FEZA 1IQTA 3N9UC 1JKHB 2M8HA 5KFDA 2VC0A 1IKVA 2AYGA 4NCBA 2BBEA 3ZZPA 1U09A 2W9CA 4A8KA 2WAQD 1FEHA 1RT5A 4YFUA 3E01A 3D2WA 4B3RF 1FRHA 2HHSA 5FJ4A 1YIJS 4K4TA 3LGMA 1HA1A 2PDAA 4ZS6A 3KK2B 1TVRA 1Y7PA 2QYCA 1FK9B 3SDEA 3W2WA 3J7A1 2UP1A 2LXUA 4X4VA 2CVEA 1M5SA 2VKRA 1KFSA 2ZC3A 5FDLB 4MFBA 5HMZA 4OHWA 2R9LA 4MYTA 2MMYA 5LSRA 4W92B 1IKWB 4I67A 1N54B 1G7CB 3QYYA 4DQQA 2OIHA 1JLQA 3BDPA 4AL5A 1FJGF 2C22A 3IGNA 4RNOA 2M0GB 4IFVB 2R4FA 2ZVSA 5KFOA 2OPQB 2MJNA 3CCTA 2UZAA 4I2QB 1TQLA 1YI2S 2LQJA 4JI3F 3OL8A 4X4NA 4DV5F 2RD5C 5E2QA 1GH8A 5IM0B 2EKYA 2YX1A 1S0OA 1TKXA 4YOEA 3G4SS 3HKWA 1UWBB 4DL7A 1YVFA 4XPEA 2WK4A 3EGWB 4M5DA 2YNGB 5T7LA 2DNPA 2C28A 5FD1A 3QJLA 5L1LA 1N0VC 2VFTA 2V4JA 4A47A 4MKYA 1SJQA 4TU7A 4B3OA 2B7BB 5GADI 1UVKA 1BQXA 2LKZA 3P5TL 2P9EA 3DLEA 2GIQA 5K8NA 4A8YA 4EBDA 2KTQA 2VPXB 1VQ6S 1DQ9A 2ZUGA 2F8EX 5D4LA 5I4MA 2DHSA 2IAJB 1WACA 2V8VA 4K0KF 4WU2A 1HBOB 3TAQA 4ED6A 3AA9A 1ZM9A 5AE1A 3K7RA 3H59A 1JB0C 3OXFA 4MKAA 4KR0B 3TOQA 2Z2LA 3MM7B 2YKNB 2COLA 1KHVA 5BYSA 4X65F 1R8HA 1V3RA 4K4WA 1VC6A 1IJFB 4LIRA 2HFNA 1SV5A 1S6QB 3J7YU 3MECB 1TVRB 1AFIA 1WF2A 1FE4A 3DRXA 5KT6A 3T5KA 3T5JA 3GSDA 5KFXA 1D9DA 2ZOFA 2YKNA 2HGLA 3VQTA 4RW6A 1Q1KA 4TYBA 2RF2B 5HL7Q 1NK6A 4NCGB 2AJ4A 2XNQA 2J7WA 1X7VA 4ZKAA 2L48A 2KXNB 3V6KA 1FKPA 1NK7A 1NO8A 3DFEA 4NLDA 3RU0A 3QPIA 1T03B 4ECVA 1LW0B 4NA2A 5A6WA 3TUZC 3UD3P 3N5BA 4UQGA 3QLHB 4IH6A 4UY8T 3MGJA 2XEXA 2X1BA 3HXMA 4Y2MA 4B3TF 2RRBA 3QIDA 3OQ2A 5CCMA 5EGYA 5IM0A 3QJPA 1U49A 1TKDA 5LJ3Y 3JSMB 2FJAB 1MMNA 4RU9A 4G3IA 2ZM6F 3TA2A 2RRAA 3VZHA 3HLUA 2YNIB 3CDBA 4JV5F 1HWIA 2AX1A 3LGNA 1N56A 1RT2B 2V5HG 4WK1A 3DC2A 4WFBQ 5LL6d 4DLGA 3D0IE 2UXBF 3BGRA 2OLWA 3HKZD 1X4HA 2CPHA 3DRSA 3M6WA 4IQMA 4NLGA 4JOUA 1APSA 2K3KA 4TKTA 5HP1B 3UNGC 5F3ZA 2QMXA 4CQ1A 4IG3A 2YNIA 2OPPB 3RW6A 1ZETA 5I3QA 5B0DA 2B43A 2CQPA 1U2RA 4H54A 5CH7B 2U2FA 3K58A 4P6QA 3DRSB 5LSLA 2C2RA 3PW4A 3C6TA 2M52A 3JSBA 4WXOA 4EO8A 3TQ1A 1HNXF 3VAKA 1IKXA 3GQCA 2UUBF 1S0VA 1X5SA 1OPZA 3KHRA 4YR0A 1CSJA 1N32F 3TVKA 2C42A 3IA0A 1T02A 3M8SA 1HL6A 3UWTA 3M8PB 2DNGA 5L39A 2YWEA 1U24A 2HGNA 4LQ9A 2CJBA 2CPDA 1X4FA 5KFBA 2R7SA 4KT0C 1IBKF 3OSPA 4V19X 4J9NA 2RT3A 2YQ3A 3OLBA 1ROFA 3MMCA 3KLVA 2IA6A 1TKZB 1UJ6A 4ZVHA 4RNFA 3KLFA 1LQ9A 2KRBA 3WX4A 1WG5A 3V6DB 2C2DA 2R2RA 4FYDA 3KNGA 4K5RA 5E3QA 1VQ5S 3DN9A 3MR2A 2B0GA 5L1IA 1IN0A 2L9DA 2R7OA 3FMBA 1HQUA 2HWHA 3MOZA 1LW2B 4H4OB 1S6QA 4ALZA 1UFLA 1QM9A 3PO5A 4NRTA 4NWBA 4ZPTR 3I5BA 4EYHB 1U7LA 1R27B 1YRTA 4I0WA 3U02A 3HVTA 3MMBA 1QY7A 4NMLA 4BWMA 4FVMA 2ZJRQ 5GVQA 1OS5A 4NLXA 2ZH6A 4F4YA 3PRDA 3SDEB 5L38A 2HVHA 2QE5A 4ZPVR 4M1KA 2BRLA 5JJBA 3AHPA 4J9SA 1N48A 4RW4B 4ED1A 2M3DA 3TYTA 3WDOA 5DQIA 4P7TA 2P9GA 4YB6A 4IG0A 2JWNA 1ZAWA 4OZ0A 4TY8A 4Q8FA 1AXQA 3X3UA 2MZTA 2N7CA 1U8SA 2KFZA 4NYOA 1H2VZ 1XR7A 1O51A 2VFSA 3HZEA 4LIWA 5LSOA 3MUVP 4GKKF 2HHWA 4C8LA 4URQU 2GCFA 1N5QA 3HHLC 4OX8A 4TLQA 3FEXB 3MEGA 4DG1B 3M2VA 3MXHP 3DMJA 2DHAA 1Y00A 2XCAA 4OIXA 4NXMF 1QSYA 3NKYA 1Q82T 4YB1P 3IXQA 3O8WA 1GX5A 4ELTA 1U1RA 2AD9A 4OX9F 3CE8A 2VC1A 4ED3A 3WC2A 2OH2A 4DQIA 4IR1A 3OHAA 1VIXA 1UJ5A 1TFWA 2GC8A 2IM0A 2OPQA 4LSLB 4BDPA 4LF9F 3Q8QB 3PJWA 3DLGB 4IRCA 5D6GA 1JNRB 2OPPA 4CZCA 5HROB 4OZ1A 1FRJA 2MKHA 3HHLB 1RT1B 2DRBA 1S48A 1TL3B 4CO4A 4ECTA 2V9KA 4EBEA 1S9EA 3E01B 3ZZYA 4ZA1A 1ZYQA 3MAHA 1FO1A 4HDGA 1S4FA 5I3UB 2K2PA 2RS2A 5KFYA 1KQFB 2BQRA 4O4GA 5DDOC 1JLGB 2DHGA 3I0SA 4YP3A 1FK9A 3W2WB 1X9MA 3K8WA 2P6TA 1YQHA 1M5HA 3DLEB 2B9XA 1QE1A 3ISZA 2B3TB 2FD2A 3ISNC 1K0TA 4KO0A 3WBZA 4ED8A 2AGQA 1SUQB 3MPVA 1S1WA 3T1HF 3G6ES 1FESA 3B82A 2DNNA 4FPRA 2G0CA 2XY7A 1NJWA 4DX8H 2EFGA 3H2VE 3KLGB 2MKJA 2E44A 1X9SA 2ASLA 1RKJA 3BSOA 4DEZA 1RK8A 3PDNA 1RWUA 2G9OA 5A0YA 4EZ6A 3GYNA 3OPKA 4M5DB 3MPWA 5T7LB 3Q2SC 4PXBA 4D3HA 2JHEA 3KLFB 1U1KA 4ATNA 4EZ9A 2HS0A 4DMZA 1Y5LB 4MK9A 2OO4A 4DF8A 2UVUA 4PXEA 4ECQA 1H6KX 4YY3F 4MYUA 1A9NB 2B4VA 2JJ4D 4ZMMA 4OZ5A 3E8OA 4QIFA 3L7OA 1RTIA 1S10A 3M8QB 3EX7B 1UVLA 4WIIA 2CPXA 2R2SA 2FHJA 4RUCA 4O0IA 3DRRA 1U26A 3MM9B 2ERRA 2MXYA 3H4BA 2ZFHA 3NAHA 2XMTA 4NLPA 4N56A 2YNFB 1S1UB 2ZHOA 3T5HA 1QAJA 1XEZA 4O3SA 3BR9A 3MEEA 4KBIA 1ZTTA 4K4UA 3Q23A 2XC9A 3VR1A 4OLOA 4ETZA 2YH0A 2EG2A 3H5YA 1N34F 4O3OA 3OFFA 2Q1LA 5A2QY 2DNRA 4F2RA 2MZJA 4ECZA 4KQZA 1RTIB 3H5UA 3EPIA 5B0FA 2Z0GA 5E33A 3M9OB 2W4DA 4TYAA 2J9DE 3BN4A 4H4KA 1FVQA 3DDNA 5E3AA 4C2MA 3RB3A 2JEGA 1S1VA 3K5NA 1LW0A 3LP2A 1QLNA 3KLIB 3ULHA 4QR1A 2RU3A 1W2IA 4RKUC 1Q79A 2VZ9A 4O4RA 1FVSA 4O3NA 4OJHA 3PEJA 3VF0B 5MAOA 3V6HA 1QAXA 4YMEA 2QA1A 1DHMA 2W4CA 2F9JA 3R5DA 3AA8A 3T1AA 4B9SA 1LK7A 4EFAC 3J7YI 2K8GA 4MK8A 4DSLA 5KFHA 1FDBA 3ZZUA 3MM8B 3LP0A 5DLFA 4JYAF 2FHKA 3UDLA 4F26A 3M30B 1H3DA 5CYJA 1NKCA 4RZRA 1WHWA 2YKPA 5DDRC 1RISA 2FJDB 1C0TA 4RU2A 2VKZG 2WB4A 5J1EB 1FKOA 2BANA 2HZCA 2F8MA 1Q7LB 1JLAA 4AUKA 3DU5A 3GV8B 3SSRA 3MM7A 3PIPQ 3H5SA 1GXLA 1QAYA 2YWKA 4ZCLA 4QR2A 1T3NA 2H5EA 2QT7A 2RKIA 3BQ2A 4X4OA 2YKOA 2CQGA 2HS3A 2ILYA 4Q7AA 4RW7B 4ZHRB 3OUYA 4QPTA 3G96A 4QOTA 3G8QA 5D78A 5BR8F 2W9BA 1YJVA 4WCEQ 3SCIE 4MMOA 3N79A 1TZ0A 4N8OA 5I42A 3RB0A 2QV6A 2WSFC 3I32A 3LP1B 3P96A 5IT9Y 4E0DA 5L9NA 2W24A 4O23A 2J9DA 5HMWA 2D74B 4TY9A 2EG1A 3K0JA 4NLVA 1WD6A 4QYRA 2VASA 5KFTA 4IQXA 4FVCA 2DBBA 4C11B 1U6ZA 7FD1A 3SV4A 3SZ2A 1X0FA 3TUJC 3G8TA 2HNDB 5DDPC 2PGCA 3HJFA 4O3RA 1SJRA 4I2QA 3U1NA 4GC6A 2XBPA 2U1AA 4K5SA 4DR1F 2CYYA 4M95A 2CDQA 1NJXA 2HHTA 3D1HA 2BOPA 2PT0A 3CCWA 3O2IA 2YWHA 2E9ZA 4H4MA 2XY5A 2J8AA 4FS1A 1RYRA 1VQ8S 2PMZD 2GMLA 1G3OA 2DB1A 3TVZA 1VQLS 2VOPA 2EBGA 3UR3C 1U1OA 3OXGA 1HNWF 2A2DA 5C42A 3D0GE 1YJ9S 4CTAB 2W8KA 4DFPA 2O66A 5EUHA 3CTRA 1TR0A 2XMKA 4EBCA 2WCXA 3M30A 2R2TA 3KYLA 3SFGA 3W3SA 4IOAQ 1FTRA 5DS7A 2N3OA 1N5TA