1YJRA

Solution structure of the apo form of the sixth soluble domain a69p mutant of menkes protein
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
75
structure length
75
Chain Sequence
MGDGVLELVVRGMTCASCVHKIESSLTKHRGILYCSVALATNKAHIKYDPEIIGPRDIIHTIESLGFEPSLVKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-transporting ATPase 1
publication title An atomic-level investigation of the disease-causing A629P mutant of the Menkes protein, ATP7A
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 17
structure length 75
sequence length 75
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2005-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1yjrA00
2N4CA 2BJDA 2BBEA 4A47A 3TOQA 4YEAA 5B0BA 3TRGA 3BR8A 1FVQA 2GCFA 2W4PA 1R6YA 2AP6A 3T9NA 1S6UA 4EFAC 2HFOA 2QYCA 4OJGA 2GA7A 1CC8A 2ACYA 3BDEA 1N5VA 2HQIA 2W4CA 2XMKA 2GGPA 5B09A 1LQ9A 1YJRA 2BYCA 3DXSX 2RU9A 2N7YA 1FE0A 2KT2A 5A6WA 5KAKA 2GFFA 2L3MA 3FMBA 3KKFA 3FGVA 2AW0A 3HHLC 3DCAA 4FNHA 2OD4A 2ROGA 4OJ1A 1Q8LA 1FEEA 2GV1A 2IFXA 4Q2MA 2LQBA 1VQYA 1Q8BA 2EW9A 2HIQA 2OD6A 3LGNA 4NL5A 5A6PA 4ZA1A 5K9FA 4HI1A 1KVJA 1YRXA 4A4JA 4DL0C 1X7VA 2QLWA 1YJVA 2XMMA 5F0UA 2HLTA 1AFJA 2K2PA 2Q3PA 2W4DA 2AJ1A 2RILA 2KYZA 1N5QA 2ROPA 4Y2KA 5B0AA 1YJUA 1CC7A 1P6TA 1S6OA 2QIFA 1YG0A 3MCSA 2VH7A 1CPZA 4OJHA 2FB0A 1FD8A 2OFGX 3BN7A 1AFIA 1N5SA 2K1RB 5T7LB 1TR0A 2IYIA 3K7RA 4F67A 2JDJA 1X0PA 2LDIA 1Q4RA 3HHLB 1AW0A 2XMJA 3FRYA 5F0WA 3LO3A 1RJJA 2FHMA 1OPZA 4Y2MA 2IYGA 3CJKA 1N5TA 1TUVA 2ZDPA 1MWYA 2XMTA 1ULRA 1SB6A 1FE4A 2GO8A 2KT3A 1U7LA 3HDSA 1KQKA 2K7JA 1Y3JA 2OAUA 4HH0A 3BF4A 1VQSA 1XBWA 1OQ6A 3I9ZA 2RSQA 5B0FA 2HFNA 3GZ7A 1TL4A 3F44A 2QLXA 1JK9B 1FESA 1Y9OA 4U9RA 2XMWA 3MZIA 1KVIA 4OJ3A 2LQ9A 3KG0A 2CRLA 2KKHA 2OMOA 4HI2A 2FTRA 2BJEA 3WDOA 2OP5A 3HX9A 1WD6A 2BUNA 2HLUA 3IWXA 4HL9A 5IXUA 2ASYA 4ZOSA 2OFHX 1Y3KA 2PGCA 1OQ3A 3BB5A 1OSDA 5B0DA 3IWLA 2XMUA 4QOTA 3HF5A 3QMQA 4YDXA 3TNVA 3BGUA 1Y0HA 4NPOA 1X8DA 4FNIA 1TZ0A 3UDCA 2G9OA 1Q53A 1TL5A 2K7KA 4HH1A 2AJ0A 4DN9A 1FVSA 2FIUA 1V3ZA 3KG1A 3HFKA 2LXFA 2GGPB 3VTIA 1P8GA 1QUPA 1APSA 1K0VA 1W2IA 2ZDOA 1YJTA 3LGMA 1IUJA 2PD1A 3E8OA 2N4DA 3BM7A 2VV5A 3KNGA 1MWZA 4A48A 3HHLD 4Q2LA 4Y2IA 5B0CA 1SI9A 5B0GA 1SQEA 5B08A 2K1RA 1GXTA 5T7LA 3CJKB 4A46A 4OIXA 2OKQA 4DPOA 2RMLA 2ROEA 3HHLA 1JWWA 5B0EA 1URRA 3QGPA 2XMVA 1GXUA
chains in the Genus database with same CATH superfamily
2EFQA 1UA0A 1Z4UA 2IHR1 2W4PA 3ETMA 4OJGA 1F2GA 1D9DA 2DK2A 2RUGA 3FMBA 2FJVA 2Z8QA 1NM2A 3M32A 2QT7A 3AOCA 2E1CA 4ZA1A 2FUG9 1PIEA 4MIWA 3QQCD 2BW2A 2J9DE 3H5YA 3R2CJ 4DPYA 3EDQB 3BN7A 4L74A 4Y34A 5BR8J 5A8WA 2GJ2A 3C46A 4ZLNA 2PEBA 1SUQA 3DLGB 2VPYB 3OVSA 3FBBA 4ECZA 2B6AB 4ZVEA 1L3UA 5FDLA 1KDNA 4ED0A 2BKOA 4OYAA 3OVAA 4UUXA 3W5XA 3LP1B 2EFPA 2FJEB 1CLFA 4KHPF 5B0DA 3EX7B 3N6NA 3C6UA 4USUA 4QWEA 2R7TA 3A3OB 5C25B 3DGPB 4NLDA 1WWHA 1NCLA 3ENQA 2ZDOA 1U09A 4A48A 2MQ8A 1T11A 4DR3F 2AT1B 2KFYA 2ZH9A 3JSMA 3LH2S 2MKYA 4PWDA 3T9NA 3Q2SC 4KPYA 3JYTA 3CEDA 1N5VA 1SC1B 2GGPA 4M95A 5KAKA 3C16B 2OSQA 4YMEA 4C8NA 4LF7J 2OD6A 2FJXA 3CDWA 4HHHA 4NLRA 4CT9A 4EU0A 2VD3A 2HKEA 1NHVA 1FI4A 4B9SA 4WE1A 5LSOA 1JLCA 2OPRA 3DM2A 1KLMB 5ETMA 3DRRA 4F4XA 3GG1A 1S97A 1S49A 3VCDA 3VQSA 1X4GA 2ZD1A 4K8RA 4LF6F 2KU7A 2B8QA 3MZIA 1CULA 1FKPB 5IXUA 3OTOJ 3Q8PB 5JJBA 4NLVA 3ZNJ1 4PG8A 3KOAA 2H65B 1P27B 2VBZA 3SDEA 2OTJS 2I9SA 1HWUA 1P9YA 1HA1A 1RWXB 4QPXA 4DUZF 4DN0A 1Q5YA 3CC7S 1LFWA 3OFEA 1U4BA 3RB4A 1H2UX 2MQMA 1FD2A 1HBMA 1LWFA 2C28A 1BQMA 4WP9A 3PR4A 1UL3A 1S4EA 5A6WA 2HRYA 1KLNA 1LW0A 1RTIA 1UVNA 2IRUA 3J7Z5 4U7UD 2ZC4A 4PPDA 5AXNA 2ZH8A 3AXKA 2FLNA 1I94J 2LEBA 3JAMY 2P9GA 3ENAA 3PW7A 4OLOA 3AJ2A 1F5BA 2SXLA 4G65A 1N36F 3M8SA 1L3TA 2IYGA 1N5TA 4C8MA 5A0YA 3HXMA 1IR0A 1M5PC 4HT7A 2LCWA 3BZQA 1U49A 2XI2A 3W65A 2DR8A 4HT5A 1HPZA 2CNOB 2XMUA 2YTCA 2YWHA 1WOOA 2R8HA 1SV5B 1E6VB 1TUWA 2CYYA 3THVA 4K4UA 1YX2A 4JI6F 3MM8A 3MPYA 3TOQA 2QYCA 2M9KA 3CWJA 4PXBA 4G3IA 3KK3B 1SL2A 1H72C 3GLJA 4AUKA 4MFBB 4JP8A 1S59A 2ZNZA 4XTTA 2C3PA 5K8NA 2J9DA 3T1HJ 4DSLA 2DNQA 1S1TB 4IFVA 2H1YA 5MLCV 3M6UA 1SQFA 4NWBA 2WVEA 4OHZA 2W9AA 1T9TA 3U27A 5KFZA 1RI7A 5KFUA 2PMZD 1RBOB 5B0FA 5DLFA 3PRDA 1YJNS 2C2EA 1QD1A 3S7RA 3HMJG 3W9IA 2DHAA 2HHVA 3CE8A 1T94A 2DR5A 2I0XA 3W63A 1X4EA 1BE4A 2KTQA 2K06A 1ACMB 3DFEA 2D3O1 4C8KA 1CEZA 2J9CA 1X5TA 2DPJA 1CJTB 1TK0A 3TUZC 3TRGA 3DI6A 7FD1A 3US5A 5L38A 3J81U 4ED1A 1VRUB 4KIAA 2DCUB 1NO8A 3TVYA 1FRMA 1R0CB 4XPEA 4PUOB 2CQBA 3NBPB 4IRCA 1RU2A 1J2VA 1NK4A 3GMGA 2MTLA 2MKKA 3HHLB 2Z58B 2QJ3A 5KT5A 2WRMA 5KFHA 3W9HA 4LRFA 2VG5A 3PXGa 2GHPA 1RGVA 5K8OA 3TAMB 4NLOA 3Q24A 2HHHJ 2OP5A 2VG6A 4P2XA 4ELTA 3FCWA 4LF1A 4JI1J 3DLJA 3FFIB 3D6TB 4RBUA 5D0RA 2N7CA 4HH1A 3KLEA 3FCHA 3UDLA 3G9CA 1SJ3P 4JI5J 5SZTA 3TVKA 3P5BP 5GAEI 4DV7J 3ZZZA 1XQIA 3IRXA 4JI0F 2RU9A 4C7QA 2E5HA 4RUAA 3E01A 2CPZA 2HG4A 4P74A 3HVAA 5B09A 3QWUA 2O5DA 4DPTA 1S1UB 3GV7B 3ZZUA 2J0WA 4X62J 5HJXA 4DR5J 1Q8KA 2W7OA 2BM0A 2G4BA 1DTQA 2PFDA 1CPZA 3THPA 3ZZRA 3IS9B 5F9LA 3MUTP 2B4OA 2BQRA 2KFZA 3KJNB 1WC5A 2EFNA 3AOBA 2HNDA 2IDLA 4FN5A 2KJWA 4B3OB 1JJ4A 2Z30B 4FF1A 2WB4A 5J2QB 1YJ7A 3MMAA 3HP6A 1O5JA 1S57A 2E5IA 3BB5A 4DX8H 5KOWA 2DGTA 4URSA 1IN0A 2XC9A 2DEIA 4DV1F 3W8PA 4C4WA 2OLWA 2YX7A 2DJWA 2C2MB 1SPBP 5KG0A 5HVFA 2XSJA 2GAHC 3C66A 2FZCB 2OMLA 3ELHA 4ETZA 2AD9A 1YZ6A 9RUBA 3BDEA 1VI7A 2NXEA 1RBAA 2MDAA 4HKQA 4I2PA 4QR2A 2GS8A 1HBNA 1EKSA 5A6PA 4DR1F 1AFJA 3LF0A 2QIFA 4B08A 2YKAA 1N5SA 2Y0SD 2BQUA 1DBDA 4KHMA 4B9TA 4HACB 1XMOJ 1RAAB 5F0WA 3JTPA 3MR6A 4ZMMA 2HGMA 3LWLA 2X7IA 1TVRB 2AZ1A 3TX8A 4LJMA 1XMBA 2VJUA 4B9VA 3AJ1A 1FRIA 2VBXA 4P10A 2H48B 3TA0A 3OHAA 1NMEB 2EXUA 3M30B 1WEXA 3SQGA 3Q22A 1U2RA 4ZCLA 1TUGB 2XO6A 4RJVA 3A8IA 2KG0A 4UUWA 3AD8C 1VCTA 2A0FB 3HVWA 3K5OA 4ID5A 3QGPA 4JV5J 2R8GA 4RW8A 3VGSA 3SYZA 1HKAA 3U1MA 3G86A 4ZVGA 2JVOA 4DL7A 2YX1A 3R6LB 1S0NA 3V6JA 2VKRA 4O4GA 4O3RA 4AL7A 5IS2A 3CCES 2AV5A 1Q1KA 4Y0FA 2B5JB 2HK3A 3VZHA 3D67A 4NXNF 3ISND 4DX5A 2OPQA 1I5OB 5HP1B 3RRKA 4OI1A 4J9PA 3VVTA 5DDRC 4ZVOB 4WU3A 1R8HA 2L08A 3CCVS 1C1BB 2B9WA 3QT5A 3CJ4A 1NHUA 1Q8IA 5C5JA 1U48A 4E8UA 2GC8A 1T8EA 3I5CA 5DJBA 2PE8A 4NYOA 5L46A 5J2PB 4C0OC 4DPWA 1WDTA 4DI6A 2IMWP 4NEYA 5HBMA 2BE2A 2VJVA 3KUHA 2YNGB 4N41A 4J9UE 4EYIB 3H40A 2CPIA 1VHIA 1H7WA 1TV6B 1GMWA 2H3EB 1NJIT 1YKWA 3H7HB 3SFUA 3IP0A 2B4PA 1YJVA 3V4IB 4C8ZA 2VH7A 1Q7LB 3O2IA 2R8JA 1RT2A 2CQGA 2W9CB 5F3TA 1F1BB 2R2SA 1RT3B 2WOMB 1WELA 3HSDA 1IJEB 2M5YA 4DX7A 3EVOA 1X4AA 1VRTA 5KG6A 3IBWA 3D6HB 1K8AT 2CVEA 2VL1A 2FHJA 3F44A 2UXCJ 4C11B 3PV8A 2DEJA 1EB0A 2V9KA 2HZCA 1HQUB 2OFHX 1QAIA 1WG1A 3VWSA 4ZHRB 1FDNA 1HQ2A 2K7KA 3G8TA 3B54A 4B3TF 2VFVA 3DLGA 3C6TB 1QUPA 3I87A 4LF8F 2B6AA 3MMCA 1VQ7S 3PIOQ 5ETPA 3TEHB 3D7SB 5C25A 4DFPA 2Q43A 2CADA 3PIPQ 3P45B 3HI9A 3EGZA 4ZP6A 4EZ6A 2J6TA 2YXLA 1S7HA 1GTHA 2HIQA 3MCNA 1X5OA 4PG7A 1HBOA 3ENWA 2GNKA 3Q8RB 2RE1A 1WC1A 2Q6CA 4F67A 4W92B 4X4QA 1R8CA 3H4BA 4ZVSB 1TK8A 3C16A 3KK1A 4QIFA 5C7PA 4YDDB 2FC9A 4UOHA 4USHA 3KK2A 1TKZB 2BVZA 3BSNA 1ZZFA 3TUIC 2MY7A 3R3TA 3LW5C 1KLMA 3M8QB 4DCJB 1V3ZA 2OELA 3RW6A 3GE9A 5ETVA 2QSWA 3UDEA 2F40A 4FDFA 4Q5VA 1Y5NB 2B7BB 5KG5A 2MYFA 5B08A 3IRWP 2QLJB 1VBXA 1FKPA 2OGUA 5CYQB 3FCVA 2YNFA 4DUTA 1RA6A 1QSLA 2QV6A 3K5LA 4Z7CA 2V4JB 1RT4B 3SCKE 1RT5B 2QA4G 2CNLB 1CQNA 3MR7A 5EX0A 2IJFA 4JI7F 3MAAB 4HI1A 2U2FA 2HPUA 2RILA 3CCJS 1LK5A 1RYRA 2XCPA 1VK8A 3J81Y 2NS1B 4A8XA 2HYIB 4KRWA 3MM6A 4LR8A 2ZDPA 2F9DA 4LUBA 4ZS6A 5CCLA 1PYSB 3UCGA 2JEGA 1FF2A 1H2TZ 4GRSA 1JLQA 4F8RA 1RCXB 4OYWA 2XULA 2QG9B 1VS3A 2CAJA 4JOUA 3WDOA 4B9UA 3DU5A 1TFYA 4NXMJ 2V8DA 2MLYA 1NJZA 1N32J 2D69A 1WF1A 2D1CA 5L1KA 3K59A 4DV4F 4H4OB 2I6WA 8RUCA 3GR0A 3WX4A 4TQSA 5B0GA 4GKJF 2RDIA 4CO2A 2FJWA 2DB1A 1M1KT 2MGZB 3OL8A 2IMOA 3C14B 3MPUB 5HLFB 4H4MB 3IG1B 3NG8A 2J7KA 1NK9A 3PM9A 3CW2C 3HHKA 2PA3A 3O1LA 3QGIA 4OYMA 1GX5A 3I5BA 4X4VA 2WVBA 4ANDA 2DGWA 4RNNA 3AH6A 5M2UA 1F2HA 3ZZ0A 3NGSA 4KSEB 4CIOA 3MCSA 2GJFA 3CJ2A 4NZ6A 5CZVA 1R27B 1U1LA 3KK3A 2UVRA 1EX8A 4MFBA 3DC2A 2XZDB 3PX0A 2G2ZA 1K0TA 3IA0A 3NL0A 1XTZA 1KQFB 1SCJB 5LOQA 1X0FA 4OJ3A 4B02A 4CT8A 2C42A 4LF9J 4Y2CA 4RPFA 1VJQA 2KL8A 4O23A 2OI2A 2XG8A 3R7SB 3ET6B 5DZ7A 2EC2A 5AE1A 4EK2A 5B0EA 3SSRA 2LEAA 4BDPA 2RQ4A 2P5VA 1IKXB 1JLEB 3IM9A 2CZVC 3CDEA 1CC8A 3CCWA 5THWA 5EDWA 2XMKA 2J0XA 2Y0BB 1F9EB 1VBZA 3TUPA 4NA2A 4RUHA 1N5YB 2M8DB 1U1OA 1XNQF 1HNXF 4LBIA 2GHWA 2BRKA 1X9WA 4DR7J 4KQZA 1FJGF 3QFWA 3ADAC 3HZEA 1VRUA 3I0SA 3V81A 3P8BB 1IKWB 2E66A 5D8HB 2O1PA 5IFMA 2CQ4A 3FMWA 3OJSA 1RJJA 4ZN1A 2W7PA 3GQCA 4CLUA 3Q8SB 3NBPA 3F41A 3NP5A 4UZCA 3I4PA 4DJBA 3RB3A 2YQ1A 3EGVA 3S8SA 3CD0A 4FZVA 4OHYA 3KTQA 2Y8WA 3E51A 2FYXA 1P8GA 5D4LA 4NYPA 2XSFA 2VV5A 4OV6A 4C8YA 3TAMA 4HHJA 2OKQA 2RJZA 1RABB 2NYIA 3T6BA 3KLVA 3U1LA 4F4YA 3P96A 4OI6A 3OL6A 1VQ6S 5DLGA 2GA7A 1OWXA 5LJ3Y 1JQGA 4J37A 3MCMA 2BYCA 2R7VA 2FJBB 1WTBA 3M9MB 3RR7A 1TQLA 3EZUA 4OZ1A 2HNYB 3CD7A 3FVYA 3GYXB 1Q8BA 5KFYA 2CQ2A 2DXFA 3PYDA 1UPMB 3OSNA 2OEMA 2LA6A 5BYQA 5FIIA 3ZTOA 1R89A 3DYAA 1I1GA 3SCIE 2BW7A 4QR1A 3IBCB 5I3UB 1UZDA 3DRPB 3NY0A 1Z2LA 2XO7A 1RHUB 3HVRA 4M5DB 5HVGA 2KFNA 4DWIA 3L9ZA 2NXNA 3O5TB 3IS9A 4PEOA 4TLRA 2F8MA 4IOAQ 4YDXA 1RU1A 3MEEA 2NZ4A 4HTJA 5E0OA 4B3OA 3MM9A 4DR3J 2WSCC 3MEGB 2LQJA 1EQMA 3N28A 1NDKA 3KLHB 1PJ6A 1RHJB 1BD6A 3NLCA 1CJUB 4LREA 1GXUA 1Y11A 3UVJA 4DR6F 4LIWA 3VAIA 1GMWD 3R27A 5CD4A 2ZOFA 5BJRA 4C8OA 4DUYF 1FE0A 1LW2B 1KKHA 3MM7B 2CJAA 4NLXA 2VFTA 2A10A 3BPDA 1WC3A 1GEHA 3R5BA 1C0UB 1CC7A 5KFDA 3PX4A 3BQ0A 4KBIA 4JI3J 2ZC3A 4B3SJ 2IBKA 2B7CB 3G87A 2BX6A 4U95A 3DLEA 2D7SA 3OR2B 5ETNA 2VASA 4LF6J 4LR7A 3QIPB 2ZM6F 4B9MA 3GJTB 1TL7B 1NU4A 2XWXA 2C3OA 2OEKA 4OYIA 2CRLA 2VODA 2M52A 1WC6A 2LECA 1CJVB 1WNEA 3S6EA 3IWLA 4ZKAA 1O6XA 2E29A 1FVSA 5GMKa 1TVRA 4UOGA 4QWCA 1S1WB 3A4TA 3EXCX 1W2IA 4CP5A 4DLGA 4RW6B 4ZLLA 4JYAF 4X4UA 3ZNUA 1YZ7A 4KHRA 2H4WB 1RYSA 4OI0A 2EK6A 4GO5X 4C3MA 2ZH7A 2YPYA 3M30A 1UWAA 1B0TA 5K8MA 4WFAQ 2D41A 4NLUA 5DG7A 3PO5A 1F9HA 2G0CA 5DM7Q 3ZTPA 3V4MA 4RL1A 5GAHI 1DQ9A 1YJRA 5E2QA 2AJQA 1CS4A 3JXOA 5JMNA 5GVQA 1AUSL 3TZXA 2W2QP 3B6BA 1FDBA 1GAOA 4DDFA 2YWEA 3EE3A 3Q8YA 5MAOA 4KH1B 4KGVB 4N47A 4X66F 4K59A 3ZTSA 3R1LA 5F41A 1K9MT 3MEDB 2AYBA 5D77A 5E7OB 2BQ3A 3O6QA 3CCMS 4IG0B 1YGYA 3H2UB 5IT9U 3HSJA 3NWRA 2W2PP 3IWXA 2AJFE 4NYZA 3EJMA 1DRZA 2MSTA 1TFWA 1UZHA 1YK9A 2HHTA 5KFAA 3W2VA 4TQRA 1APSA 1NKEA 2UUCF 4YY3F 1HYSA 4IOBA 2CWXA 1C1BA 5KFTA 5F3ZA 3LANA 3PRVA 5D0EA 2NLWA 4NLPA 2LXIA 1NLKL 3EMTA 2IVFB 4IYQA 4U8VA 1R8AA 4CI0B 5CABA 2HVEA 4ILRA 2CPHA 1V3SA 2CJXB 1YRUA 1WTFA 1UKUA 4NE9C 1NDCA 1RTZA 3OXFA 4ZVRB 3W5YA 4DF4A 2QTWA 5IT0A 1TV6A 4XDDA 3PX6A 3GIKA 5F8HA 3G6XA 3V4IA 1VQLS 4Q43A 1UEUA 2A3JA 2W9CA 3D66A 2ADCA 2HURA 4GVLA 2WOMA 3T1YF 5D4OA 3MM5A 2KXHA 4U7CA 1HW8A 4W4MA 2QA4S 2F9JA 2C2ZB 2EWHA 4NMXA 1M90T 1ZPWX 4WFXA 3TX0A 2RMLA 3GCXP 3K8WA 1RISA 1X5PA 4LQ3A 4ZHRA 4A8KA 2RB7A 1BXNA 1WG4A 5GADI 1HR0F 2JL9A 2ZITA 1M1GA 2QLBB 3N01A 5E3RA 2CQ1A 5K9FA 2M8HA 5KFNA 3IR6B 2HFVA 2V5HG 2IYIA 1RT7B 4IH7A 2HS3A 4MK8A 3I9V9 4KFBA 4ECTA 2GO9A 1HBUA 1RWVB 2ILZA 1NJWA 2J0QD 3PHEA 3I9ZA 4MKYA 4QBUA 1F3VA 3J80U 4DZDA 2PFFB 3C2PA 2ZUGA 3I6PA 4USJC 1XIQA 4AE5A 2C2NA 4TU7A 1RT6B 3PNIA 1R6VA 4ZPDA 3R5CA 1XJWB 2ASJA 5K20B 3PFOA 1KS2A 1K0VA 2EBEA 1KQSR 4X84A 1RKIA 1ZPVA 4IH6A 4JI0J 2DXDA 1SI9A 1TKZA 1GXTA 5T7LA 3FEXB 1K73T 2BZ2A 2BR0A 3EDRB 4ELUA 5JXSA 4K4YA 1FX2A 4K4XA 2VDIA 1FRXA 5CH7B 4J9OA 1SC4B 2ZVIA 1HL6A 2RU3A 1IBCB 2XZTB 4K4WA 2UUBF 3R5GA 3I82A 4I1TA 3CXCR 3NCPA 1XNRF 5CYQA 2R3VA 1IKYA 2CFXA 4AD6A 3HSGA 4MKBA 3F73A 4C48A 2R7SA 3HDSA 1UJ4A 4I69A 1YBAA 4NA3A 2DH7A 5G4DA 1REGX 3M32B 3OBIA 2DPIA 4DBQA 4DV1J 2N3LA 3HF5A 4Y3CA 3DU6A 4BBYA 1RT1B 2YKPA 5E5NA 4U7UK 3OLBA 3MDFA 2N82B 1EHWA 1YJTA 5U47A 5HMZA 3CB4A 5IWAF 1QSSA 3CSKA 4DQSA 4LFBJ 3M8YA 2QRRA 1C2PA 3NAIA 1Y10A 5FDLB 5SUHA 2IPOB 3FUYA 4M5GA 3CJ0A 3C19A 1C4CA 4DEZA 2RH3A 4OZ3A 4H4OA 5AE2A 4FYXB 1S1VB 1S9EB 5ITHA 2AEMA 2MGZA 4DL6A 4P7VA 2VG7A 4JV0A 4PG5A 1ZOTA 3QJLA 4H4MA 1HNZJ 2B9EA 2V2QA 2ZH4A 2X3DA 1BUXA 3RU0A 1TKXA 3NAHA 1NKCA 3NNAA 3ENVA 3CUNA 4QU6A 4XO0A 5FLXY 4AFFA 3MD1A 3W2WB 1YJ9S 4PWDB 4RUBA 4RNFA 1B0PA 2OAUA 3MMBB 1CBKA 1LWEA 5L1IA 5LXYA 1RWKB 4OFZA 1IJFB 3PKYA 2VA3A 2V0NA 4PWWA 3D6MB 3KMSA 5AT1B 2DGOA 4WE1B 3NEKA 3CJTA 1FK9B 4DF8A 1G6BA 1JLCB 2OPRB 3VF0B 3CDUA 3DRRB 3T5KA 5LM7E 3JS9A 2GQCA 2E1RA 4RX6A 1ROFA 3NRBA 2ZD1B 3TWZA 2VFUA 1RWUA 4F36A 4QWDA 2Q79A 4CO3A 1VHFA 2QL7B 2CVIA 2QYGA 5KOXA 4PQUA 3HHLC 4ZP9A 4RW7B 5D3GB 3QO9B 5BYRA 2ASDA 1LEOA 4NXNJ 2FVPA 1JLEA 3QBCA 2VQEF 1H98A 1SL0A 1Q4RA 1IVZA 1FCAA 1N5YA 4LFAF 4QU7A 3RBXA 1MWYA 1HBMB 2BEFA 1RLDA 1VIXA 1D9FA 5KT6A 1LW0B 4KJIA 1RTIB 2CQIA 3TAQA 2XBPA 3MPWA 3M7VA 1X8DA 3M8PB 4WYWA 3BDPA 3FDSA 3HSZA 2ZKUA 4MIAA 2K1RA 4OIXA 3V6HA 1T02A 3I32A 5A0YB 3BSAA 2WTFA 1KWMA 4ES1A 2R2RA 2JFKA 1A0OB 1U0HA 4UZBA 2JLEA 4OI3A 2WW8A 1FEHA 3N5FA 2KJVA 1U6FA 3GV5B 2YKNB 3Q2TC 3LQVA 2BXJA 3BGFA 2H4YB 1HPZB 1Q79A 4ZPTR 1VIOA 2HAIA 2QMUB 5KFWA 5HROB 1IBLJ 2D3UA 1N5QA 4KY3A 3QSIA 2DCLA 2DTJA 1VQNS 5AJ3F 2F4VF 1JLAB 3V6KA 2A2CA 3RAXA 3MM8B 3PO4A 3TANA 2I1RA 5KFEA 3RRGA 4L72B 3FZ2A 2HNYA 4A8MP 1ICEB 5J2MB 1ZBTA 2HFNA 1U02A 1XN9A 1PJ7A 3KHLA 4F02A 2MKIA 2VC0A 4HI2A 2ZWPA 5I3UA 3DRPA 5I3QA 3FSYA 4C6AA 1VK3A 1OJ4A 1IM4A 1HQEA 2ZNYA 1MROA 3GFXA 1H38A 1RAHB 1HIYA 3GYGA 1KNZA 5IQQA 1N4LA 1J5EF 2Y1RI 3OFGA 3D0HE 2R7OA 4RW9B 5IT9Y 3W60A 2OSRA 2GX8A 1S9FA 5DDPC 1H7XA 5ETOA 3MEGA 4I56A 5A2QU 1R0BG 1X4HA 4L3KA 4QIWD 4ZLJA 3NKYA 2W4DA 3Q8UA 2YWGA 2R9LA 1DARA 3M9OB 4DV6F 1QLNA 1A7GE 2HRTA 1TR0A 3CT9A 4CYUB 2VOPA 3OSPA 4RW4B 1WOSA 2HWHA 1LW2A 4ILLA 3MM7A 4K0KF 3P4UB 2FC8A 3BKFA 3VGVA 1Y3JA 3KDOA 5EWFA 5KT2A 4M8LA 5DO2A 1C0UA 3JQMA 4GO7X 3TUJC 4FYVB 3FBCA 3VGTA 1NAQA 2LU1A 4P2SA 4FVMA 3OR2A 3DLKB 3BYPA 4KO0B 4CLWA 3H5SA 3A3NB 1UCNA 2DNRA 2LDYA 3QIPA 3IXQA 4P72A 1EP4B 1TL7A 3Q86A 4K5SA 4CNYA 2IDEA 1D9AA 1HNWF 2ZJPQ 4PKDB 1WKLA 4UT4A 2VG5B 4EGLA 4B3RF 4MMOA 3ZO7A 1VQ5S 1N0UA 1URNA 2DHSA 4WZQA 2RS2A 4JI7J 4RW6A 1FWPA 2AWZA 2HEKA 3K5MA 2YX4A 1KHVA 1X7VA 1SC3B 1D8YA 4NI2A 2PMHA 3DDKA 3N9UC 4LSLB 1U45A 5A8KB 3IRXB 3K7RA 1IQTA 5IQ6A 1X0PA 2BACA 3DOKB 1N0VC 3DLBA 3OD2A 3JTNA 1TUVA 3MR2A 1PYOB 2G1DA 3E01B 1M5HA 1SB6A 3NGUA 1LWXA 2JNJA 1SXLA 4ED8A 3EVWA 3LPYA 3SCJE 2F63A 4B9NA 2CIMA 4DSFA 5B7WA 3MUMP 1O0PA 2M0GB 1M0SA 3GFYA 2JWNA 4HL9A 3M05A 2RRAA 2C2RA 3KJVB 2V8HA 1DTQB 5ETLA 4C0HA 3MEDA 1NSKL 4LF2A 4E2FB 4GKJJ 3H5UA 4IG0A 2L9NA 2MZTA 2MKHA 4Z2XA 3PY8A 1FWKA 2PMWA 4DFKA 2D9OA 2DRAA 3MMAB 3MOZA 3R1HA 1ZAWA 1EKRA 3KMQA 3CC4S 3AB4B 4LRCA 3CCZA 2FJAB 5J2NA 1UFWA 2DGVA 5ADZA 3D28A 3AB2B 3K8VA 1RZMA 1F6TA 3QJJA 2VIHA 2IVMA 3J7YI 2V34A 5KFSA 2Q1LA 2F4FA 2XYGB 4I2PB 3HKWA 3JQKA 3UNYA 2PDAA 1ZAVA 4ED7A 2CG8A 2HZAA 2CPJA 2CQ3A 1WF2A 2HAFA 3ZZYA 1JWWA 4YR2A 1HFEL 2W9BB 1HNVB 4CTAB 1QDUB 3HHDA 2HQIA 1XNQJ 4A8QA 4ZVHA 2XGPA 4LIRA 1MN7A 4YB7A 4ZVFA 1FJGJ 2VBYA 2GIQA 3AA8A 1G1XA 2O67A 2LEPA 4WK3A 2HHPA 4RZRA 3AQPA 3M4XA 2FVQA 1U1NA 3UO0A 1AW0A 1WHXA 2V94A 4ID5B 3CVKA 2DNOA 4RW8B 4I7FB 2FHKA 2M7SA 4ANEA 3G6ES 1VQSA 2VB6A 2XYHB 5F8MA 2XYPB 3W64A 1FXDA 2UVUA 5D6GA 1LK7A 4HLBA 1RT7A 4O4GB 1NK5A 4CLYA 2WB1D 2EFGA 2KO1A 2AEFA 2RD5C 3AAWB 4M94A 2WAQD 3TJ8A 2DISA 3BH7B 1XMQF 5B0CA 2PEHA 4JBCA 2LA4A 4E98A 3ZC4A 3PRBA 4F7VA 4OZ5A 1RT6A 3SMZA 3IC1A 2M4MA 2Z2MA 2HBRB 1LXJA 5L1LA 5KFCA 3B4DA 3FQLA 3BEGB 1NPPA 3OXGA 1Q8LA 4TY8B 3EGWB 4ZP7A 4DU8A 4NL5A 1S6PB 4TVAB 5HAOA 1H6KX 2YH1A 1FWLA 7FDRA 5GMEA 4HVZA 3DLLQ 1F5AA 3CGIA 1UETA 1RHKB 1OPZA 1KP6A 5CYMA 3I31A 4CRJA 2ZH1A 2CZ4A 3BKTA 5KG1A 4KKOA 3MXHP 3ILOA 1VOMA 1KVIA 5CQGA 2BJEA 2GHVC 3QWPA 4M5MA 1DAXA 1FDAA 4V19X 4AYBD 3PYEA 1RT2B 3IR5B 3CD5A 4L73A 2H9ZA 3POTB 2CJKA 2BRLA 2CPDA 3FQKA 4Y00A 1UVJA 3BSCA 4JI4J 3GIIA 1VRTB 5HO4A 2EPIA 3RBDA 3GB0A 2V8VA 4N7TA 3RBZA 5F8JA 5KFBA 1RAGB 2ADBA 2DVIA 3HO1A 4DV3F 2HFOA 4CO1A 1RT1A 3LOUA 4TU8A 5D78A 4ECYA 2GFFA 2O66A 2IM2A 3PJXA 3LP0B 2DKOB 4FF3A 4DL0C 2JHEA 2QA2A 2HGLA 2YWWA 3TR5A 3ZTQA 1IM6A 4PZVA 4CWBA 5J1EA 3MMCB 4L75A 2LDIA 3TZWA 2BJ7A 4YHHF 4OZLA 2DH8A 4DQPA 3AODA 1S1VA 1VQKS 1O8BA 1AXQA 1S9EA 4JI2F 3HFZB 2QZ8A 1RWWB 3EZ5A 2FLPA 2AQ4A 2ZE2B 1IXKA 5D4NA 1GXLA 3K17A 1H3DA 4KGZB 1HBOB 3W2WA 2PA8D 3VAMA 3PDNA 2MQOA 2MZJA 3MMBA 5GAGI 2WK4A 1BGXT 2HK2A 5FJ4A 4N8OA 3KK1B 2MQPA 3UN2A 1RDRA 3H0PA 4WKYA 4IR1A 2VQFF 2Z2LA 4ECRA 1V3RA 1REVB 4NASA 1RWNB 3CJ3A 2J9EA 2RQCA 3KK2B 3I4HX 2DY1A 1JXLA 5DQGA 1FK9A 4RU2A 1VISA 2HZVA 4ES2A 2YQ0A 1QM9A 3MCOA 3ZZPA 3BO3A 3UD5A 1OY9A 3L7UA 4R8UB 3ZZTA 3DLHA 1TU0B 1HI1A 1MG7A 3M6VA 5BYSA 2IRXA 4RW7A 5D3GA 2HBZB 2YNFB 1U26A 3QO9A 4F4ZA 1TK5A 3JSRA 3LUYA 4JB8B 2IBOA 5D4PA 1T9UA 2R2TA 1N56A 2ZH5A 1T95A 1NK8A 2PI4A 3GJQB 4CLKA 2YVSA 5L8RC 2QL5B 3KHGA 1HMVA 1WOPA 2V63A 1NNDA 3DMJB 2UUCJ 4YY3J 4U96A 3M2RA 1UVMA 1FERA 2I2YA 1TL1A 3PYFA 3AT1B 1GMUA 2JOQA 1SQEA 1UJ6A 3MM6B 4A46A 2VZ9A 1S6QB 1R0AB 2CNKB 2HHHF 1JLQB 2YBVA 3M8PA 4JI8F 3OFHA 1GNKA 4MJKA 2E44A 2P6TA 2MZ1A 1IWAA 3V2UC 1Y00A 3CULA 3QRRA 4X4RA 1ZTTA 3D6FB 3BREA 2B4UA 2E7VA 3W3SA 2DIVA 1BQNB 2C3UA 1Z1ZA 1KFSA 4PXDA 4C0BA 2KYZA 4GKKJ 2BABA 1P6TA 3OTCA 1FKOB 3H2VE 1XR5A 4H4KA 5E3AA 2K8GA 2LP4A 3FSXA 2WZ1A 1KR4A 3CJ5A 2C2DA 2YKNA 5DQHA 3FK4A 4ECWA 1C0TB 4EEYA 4GVBB 2ZUAA 5HROA 4K4TA 4ZJQA 1FRKA 1F9FA 3J81j 1ZH5A 2R7WA 2HWIA 3T1YJ 3BBBA 1JLAA 3NXZA 2FTRA 4DLEA 2Y1JA 2B43A 2J76E 1OSDA 3OTEA 4A8FA 1TZ0A 2UV8A 1WC4A 1YBTA 4QR0A 3GFHA 5A8RB 5J2MA 2AMCB 1S0VA 3QRQA 3L7PA 2EFVA 3PYGA 5IV3A 2KRBA 4UY85 2EFOA 1HR0J 3N5BA 2MQLA 5I42B 2ROGA 2A6MA 3NS7B 4RU9A 4RW9A 4BS2A 2BMBA 3H5XA 3GIMA 1KEKA 3MMJA 4A8YA 3THTA 2OPSB 3C15B 1K47A 3NNHA 3DDIA 2KXFA 3KUEA 4IFYB 2UU9J 2CQHA 1HD1A 1OQ6A 2RAQA 3MPVA 3BO4A 4ED6A 1QE1A 4CYUA 4RW4A 3TNVA 4FNIA 4J9QA 8AT1B 3EPGA 1KRPA 1OY6A 3I0SB 2VONA 3V81B 2ZWOA 2H51B 2MEWA 1SKUB 2RQKA 3D3BJ 2AX1A 2W8KA 2JH3A 4B3MF 2B9XA 4RNOA 2GCFA 3DLKA 4KO0A 3BO2A 3AA9A 1TAUA 3EVMA 4NCAA 5LJ5Y 3HPOA 4DFMA 2UUBJ 1EP4A 4FNHA 4OYPA 2DGQA 2VBWA 2ABYA 1UVKA 4F50A 2PSZA 3MFHA 1K44A 1SH2A 2B56A 2D3ZA 3L95X 3IN5A 1QTNB 3H42A 1SJFA 4JV5F 4WBFA 2YPZA 3DDNA 2AYGA 1FFGB 4WTOB 1RACB 2VKZG 2AGPA 3LPEA 2LQ8A 4TXSA 2JLFA 2Z0GA 2CQ0A 3RAMA 1JJCB 1AT1B 3KLIA 4NRUA 1FESA 2ZHAA 4LSLA 3JSYA 5L9XA 5E33A 5HATA 5A8KA 2JEIA 1SJ1A 5KFRA 4A8SA 3HX9A 3MOJB 3H8YA 5J1PA 3DOKA 3GR1A 3UD4P 3DYAB 3W61A 3CO0P 3SV4A 4HEA9 1QAYA 2PD1A 1U1QA 5KT3A 4ZJOA 4F3MA 2NPFA 3IAS9 4XPCA 4NLGA 2F7VA 1OIAA 3KJVA 3AJDA 3DHXA 1WKJA 2J6UA 1JLBA 4QQBA 4P7TA 3HD2A 4IUFA 3MEEB 4OJ1A 1YDLA 4NMLA 3PEHA 2MPUA 3CMQA 3MM9B 4UQGA 2P9CA 2QSFA 4WJBA 4ANCA 4OJHA 4LBPA 4WTYA 3BBCA 4A8OA 4F2SA 2DNGA 1VYAA 3UVJB 2LU2A 2H54B 3CO9A 2RT3A 1RA7A 2COLA 2LMIA 2NXCA 5K8PA 3NOCA 2J0SD 2V67A 2FQQB 3VVUA 3AFGA 4B9LA 1IBMF 4MK9A 4I6WA 5LT5A 3HJVA 1KHWA 4CQ1A 3A13A 5KFVA 3V6DB 3KNGA 3CCSS 3DLEB 2YWFA 2ZOMA 4USWA 5DG9A 1I3OB 4OYZA 2IA0A 4HDGA 1YJWS 3HK2A 4A47A 4J9LA 1RP5A 2UXCF 1M1HA 2GW8A 1KTQA 4EYHB 5BXIA 4HR2A 5HN0A 4PQAA 4IH5A 3NS6A 2FGOA 1LWCB 1FRLA 4HTIA 2RQMA 4AT1B 1JMTA 3UE2A 3JAMU 2VQEJ 2FLOA 1UJ5A 4C9DA 1YG0A 1W2BR 3K57A 4LFAJ 3IGVA 2W9BA 1HNVA 4CTAA 2RIJA 2VHGA 3JB9k 3MWBA 3Q89A 1Q78A 1E6YA 4RLEA 1VQOS 2CPYA 4S0MA 3PG9A 3DGVA 1XBWA 2MKCA 3PACA 3D2WA 4O44B 1Y9OA 1FJEB 1CS4B 3V5RA 5K14B 3PJWA 2LFVA 2DXEA 4K7QA 2A6OA 2AF6A 2DR9A 2QEXS 1FJCA 2KVIA 4I7FA 2BOAA 2AJ0A 2W2OP 3D1QA 3I0RB 4FS1A 3KG1A 2UXDF 2UUAF 1RB0A 2UXBF 1X31C 3R6GB 3ITHA 2QMWA 3D5MA 2ILYA 2ALZA 1JLFB 1XR6A 3I55S 1FRHA 3PR5B 1OMSA 4WF9Q 5LMUJ 4LSZB 2V8GA 3M2UA 4MAKA 4I68A 1KOHA 4ZIVA 2W8LA 3G96A 4JV1A 1YITS 4QIGA 2DYAA 5C42A 2PT0A 4PABA 4LBHA 2GMHA 3W2VB 2BE9B 4YB1P 5GAEU 1J27A 2ROPA 4Y2KA 2V2KA 4FBUA 1HYSB 1T3OA 5HMWA 1NK7A 3MAQA 4U6PA 1OSCA 4DHVA 4TY8A 1FE4A 3DOMB 1S6PA 3BJYA 1DQ8A 1S4FA 2E5JA 4UTGA 4RWXA 3CJQA 1AB8A 1Q0NA 4QIEA 2BUNA 2M3DA 1WC0A 1ZYQA 1UVIA 3UDCA 5KFXA 2YKMB 1J5EJ 5L9NA 2MZQA 1FTRA 3VTIA 4X4PA 4R25A 4I67A 2BV3A 2HSEB 4DV2F 4LMZA 5G0RA 4BWMA 3EXYA 3KDNA 3LAMA 2IRYA 3CIZA 2RHSB 3AXMA 4CM0A 1VRQC 5KG7A 1HNIA 3POTA 4EO8A 4D3GA 1NBEB 3SCLE 1XC9A 2RF2A 1IWGA 4EI2A 3MM5B 1ITPA 1X4DA 2LQBA 3QZ8A 4DV6J 4OZNA 1KVJA 1JNRB 4LF4F 1XWLA 2XMMA 1RAJA 2JFDA 1U2CA 1YJUA 2DNNA 1PO6A 2FY8A 2QLFB 3IGNA 3RJMB 2E1AA 3JSBA 3OFFA 2ZH3A 3PW5A 4CLSA 1CVJA 3LP0A 2KT3A 1H0HB 4NCGA 4ZLPA 1SKRA 3RB0A 5CHCB 1N54B 3IAM9 1DJ0A 2L9DA 4F4WA 2IC3B 3ISNC 1U1PA 4J90A 4J5OA 5LMNF 4DR2F 1TL5A 1K1QA 3SQOP 2UVVA 4YOEA 2GJIA 2ZE2A 4Y2IA 2XMAA 4KFBB 5I3PA 3CMAS 1HD0A 4B3RJ 3DRSB 4X65F 1HBUB 3GP9A 2GVZA 3R5JB 2EVZA 1FNOA 2KHCA 5E3PA 1PBAA 5J1NA 4AL5A 2FZGB 1N88A 2E7XA 4X64F 2HQGA 1DURA 1FHTA 1RAFB 1RHMB 3D9BA 4DFJA 2OEJA 1REVA 5B0AA 1TMJA 1H73A 4Q45A 5T7LB 1PILA 2CDQA 1QVGR 2FHMA 5HMYA 1RADB 3QIDA 2XMTA 3NNCA 2C2OB 1TTHB 3W5ZA 3RW7A 4R8UA 5KFMA 1OS5A 1RK8A 3UFCX 1HLWA 3CPWR 4D3HA 4CDIA 2CPXA 4MH8A 4F0KA 3FC9A 3QMQA 3FSIA 1M5KC 3JQJA 4DN9A 3UWTA 1IKYB 5HJYA 1ZS6A 5AXLA 1QY7A 2A1BA 2E5LF 3OXLA 1Y5IB 2HQDA 4O4RA 4DU7A 2L9WA 3KJFB 1S77D 1PKUA 3TA2A 3PTWA 4IO9Q 3G8QA 1K1SA 3DMJA 3D68A 4KB7A 4OI4A 2H5IB 3GPAA 3RR8A 1HHTP 1S9GA 2WW4A 2NSBA 2UZAA 4K5RA 2F1FA 3KWMA 3UI3A 5AXMA 1TL3A 3EPIA 2W1BA 4FBTA 1IKVB 4OX9J 1S6QA 1R0AA 3UN5A 5F0UA 2KM8C 4Y65A 4IOCQ 3WBZA 3HCXA 2Z57B 2FB0A 3PJ9A 3HZGA 4PWUA 3T9ZA 2E5GA 4M5JA 5EUHA 3DXBA 3JTOA 1FRJA 1NPRA 2X1AA 2RDDA 1KQKA 1BQNA 3CDAA 4TU9A 3T5LA 3W66A 3FEYB 1FKOA 2MSSA 1LV5A 4NLQA 4WPAA 4ILMA 4F4KA 1FFSB 1YHQS 2PGCA 3DRXA 2VG7B 1C0TA 2ACMA 4GVBA 1WJ9A 4DL3A 1TKXB 4OI2A 3M2VB 3BKUA 1HWKA 3PHTA 2VOOA 1JJ2R 4DPOA 2R8IA 3BYRA 4FKYA 3A1YG 3M1VB 1X9MA 2MMYA 2BBEA 2BM1A 3FRZA 4ZDNA 2IM0A 1LWEB 2ALYB 2R42A 2QX0A 4H54A 1OO0B 1DZ5A 2E9RX 5A8RA 2G2YA 2KT2A 2AW0A 2DO0A 3MR3A 2NR0A 4L76A 2K2PA 3OTBA 3QT6A 1FD8A 1D0EA 3TW0A 4ED2A 5I42A 2ZBIA 4CCHA 2FVSA 1G4CA 2ZH6A 3VAFA 4PYDA 4LR9A 3K58A 4PQUB 3G4SS 4EBEA 2OPSA 1KQGB 2AGQA 3BGOP 4WZMA 3C15A 1NPKA 4JI3F 3WIUA 4B3SF 2B51A 1XMQJ 4IFYA 1Q5VA 3LALA 3QFHA 5F8GA 5AE3A 1VC0A 1H2VZ 1HHQA 3UCZP 2IAJB 1F3FA 4CLFA 4OHVA 3G2XA 4WXWA 4KH0B 1T9WA 1PCAA 4DSEA 2D9PA 3OVBA 4YEAA 2WHOA 5M2RA 3OUYB 3VAJA 3WQPA 2L3MA 4OX7A 4ZVTB 2JEFA 4KR0B 1RAIB 4LRBA 4ZPAA 3B8HA 2NUHA 2QE5A 5DRKA 2K1RB 4I2QB 3PW0A 4DV0F 1T7PA 3IO1A 3QSYB 3EGNA 2VFSA 2J8AA 1NUEA 3PVXA 1U0HB 5LSRA 1U7LA 3G6YA 1FXRA 2DT9A 4U9RA 4WFYA 1QVFR 2BJ1A 3CCTA 2AX0A 1VBKA 1Q53A 3RTVA 5ETQA 3GSIA 4O3QA 3W62A 4CM2A 3N79A 4UF4A 3BQ1A 5KG4A 4LT6A 3Q0AA 1YLXA 4DMZA 3K0JA 1UAWA 4DV3J 4U67Q 1DY3A 2GQQA 4BLGA 1VBYA 3UR3C 3NCQA 4F26A 1YVFA 3H98A 3D54A 4J9MA 1CQMA 1JLGA 1L5UA 5KFPA 4KAIA 2KB2A 2Y1IA 2OD4A 5JUMA 5HVHA 5E3QA 1HQEB 2DD8S 1MROB 4FKXA 3U1NA 2ZEJA 2L48A 3FJ2A 4YHHJ 5KFJA 3PW4A 4KHPJ 2F65A 4V19J 4JI2J 2ZVSA 3CJ8A 2OIHA 1L3KA 3MECA 3WC0A 3MFIA 2WSFC 2RSQA 1MMNA 3LWMA 2AEJA 2XS5A 3GJRB 2CNNB 5KG3A 2QA1A 1GFWB 2HFZA 2NXUA 2VQFJ 2CXEA 1I6JA 3I96A 6AT1B 2V2VA 5DQIA 3M8ZA 4DQRA 1T9YA 1UFKA 2RDJA 1MMLA 3TJAA 3HT3A 3MURP 2VICA 3N0VA 1WG5A 4G1QB 1PC5A 1CG2A 4EBCA 5E3CA 2IJNA 1FVQA 1KVKA 3R7BB 5CA5A 4LFCF 1ZTWA 4DG1B 3V6DA 1R31A 4ATNA 3DXSX 1FT8A 2X3GA 2WVFA 3K5PA 4R0EA 4IDKB 4AXIA 2ZHBA 1AYEA 2XY5A 1U0SA 4DPUA 1X4BA 4C8LA 1S0OA 4UOFA 3WIVA 2VA2A 2XLIA 1LWCA 3UCUP 4CH0S 4WFNQ 1N8RT 4DUZJ 1JXVA 4J9NA 4OHXA 4O3SA 2J5AA 2GVDB 1G7CB 4NI2B 2UV8G 2FIUA 1R8PA 3X1LB 1TP7A 3NOGA 2FY1A 1VGYA 4RWWA 4O44A 4F0HA 3S1TA 4JI8J 5K14A 1DLOB 4ALZA 5B0BA 5A76A 1WEZA 2AIRB 4KC5A 1ZA1B 3KXDA 2RKIB 1N36J 3I0RA 1AZSA 2VDHA 2V4RA 4NA1A 2GIRA 2FLLA 3KJQB 3ETOA 5GMDA 4O0IA 3FZBA 1LNQA 1J5OB 1IR2A 4ERDA 2ZZMA 2BANB 4WYLA 1JLFA 1RWMB 3OR1B 3E3XA 3PKMA 1OYDA 2HNZB 5HQLA 4QPTA 2XZWA 3TI0A 1XEZA 3IMQJ 3UNGC 4USKA 2XMJA 2WONA 3PEJA 1ZA2B 5HSPA 2UUTA 5EWEA 3G71S 1MLAA 1N6QB 2DNKA 4JI6J 2DNPA 1YTYA 3DKDA 4G1PA 4J91A 4ER8A 4F04B 2DITA 2Z2YB 2MQNA 5J2NB 1RE1B 3DOMA 1FXLA 1BMQB 2ZKTA 2XI3A 1IUJA 3F0NA 1RBLA 1MU2B 3VAGA 4EZ9A 5CD4H 2JSXA 3R5AA 1S12A 2XMVA 4USVA 4OYOA 2CUYA 3LTOA 5DS7A 1IQZA 2AP6A 4P52A 2K3IA 2WBMA 2YKMA 2IY5B 4R5PB 1LOUA 2AJ2A 4ICLA 4FXVA 4OZ0A 4W90B 1U1RA 2R2UA 2AKWB 4IO1A 1NB2A 4NLWA 4LFBF 2DNHA 2KG1A 4O3OA 2QO3A 3FRYA 1NKBA 3CJKA 2W25A 2BJ3A 2K7JA 2VC1A 2XS7A 3EICA 1Q95G 3HVTB 2F5GA 2ZBPA 1HNZF 4ZITA 1R8BA 1WD6A 2EG2A 3GJSB 1IBKF 4QCLA 4AXJA 3QLHB 1KFDA 2ZBCA 1RKJA 2CA9A 2FGCA 2V2ZA 3LGMA 3QT7A 3GIRA 4YB5A 2YY3A 4B3MJ 4J7CA 2EKNA 1PBUA 4P6QA 3KYLA 3UR0A 3KUGA 2IC3A 3BR8A 2C3MA 3H25A 5L39A 2D3OR 2E1PA 3MD3A 4OMFG 4O3PA 2GV1A 3UD3P 3R8YA 3DRSA 4WKRA 2DGUA 2QGFB 3EUNA 1S99A 3HJFA 1RTHB 3A12A 2ZFHA 2B3TB 3P3DA 4MYUA 1AFIA 1YWXA 2XY7A 4ED3A 4OHWA 3WHIA 1BWVA 1GT8A 1TKTA 2NCKL 4NRTA 5LL6d 5GAHU 3R97A 5I4MA 2HS4A 1X60A 4F3QA 5CAAA 2YNHA 2KH9A 4L6V3 2KKHA 2OMOA 1D1UA 4KGXB 3BGUA 2UUWA 5D0GA 4ZPBA 5H1SV 2APOA 3BN4A 5EGYA 2HVDA 4LRDA 1HWLA 3QNWB 3OV7A 4BHQA 4ENOA 3UDVA 1T3NA 5CYMB 3H4DA 2DNLA 4FPRA 2Q6BA 4KKOB 3QJPA 5IT4A 2G0IA 2W2NP 4RUCA 1AUDA 3QZ7A 1B7FA 3M6XA 4WFZA 5RUBA 3QAEA 3LGNA 1WKKA 1S6OA 4USTA 3L09A 2XHCA 4NOHA 3Q83A 1HI8A 3KHHA 2HW3A 4M1KA 4WXOA 4V1Ak 3SV3A 3Q8VA 1SH3A 4LSNA 4YR3A 1IKVA 1NH8A 1S72S 3ZFVA 5H9FK 1KONA 2JX2A 3QAUA 2QLXA 2HQCA 1IBLF 5FD1A 1QTMA 1IBMJ 2R7RA 2ZOGA 2EK1A 3H2LA 1Y3KA 3M6WA 4M5HA 4EUVA 1LXNA 5KFGA 5J1EB 3HFVA 2NYHA 3BR9A 1UP1A 4ITSA 3TARA 4DR1J 3ONQA 1N33F 1MMDA 1JKHB 4CLTA 2KT5A 2HIYA 4WU2A 2IM3A 2I5JB 1S6UA 2E9TA 2ACYA 3M9NB 3T3FA 3M2VA 2HVHA 1RTDB 4IQMA 1GH8A 3LP1A 1P1LA 1N48A 1DTTB 2MZSA 1BC6A 3M1VA 1OY8A 3D3CJ 2B8PA 2HBYB 3DGPA 4KT0C 3T5JA 1SKWA 3D4JA 1UA1A 3BH6B 4Z7YA 3TYTA 4Y2AA 3P6YC 1W26A 2M70A 3KNAA 2GO8A 1U8SA 2CPEA 5GADU 1OYEA 1FTCA 2VU5A 1TELA 4K50A 4X4TA 4ECUA 3TO8A 1SJQA 3CCRS 4CNZA 3R2DJ 3P49B 3D0IE 2ASYA 2UXDJ 1PC4A 2UUAJ 4FF4A 1SJRA 2UXBJ 1G3OA 2QC3A 4KPCA 2KN4A 3N6LA 2BOPA 3A3PB 4MT1A 4MTPA 1QSYA 4DX6A 2XCAA 1EQ0A 5EN1A 1TAQA 4DZ6A 1MSWD 2LQ5A 1NDPA 2R4FA 4TLQA 1HMVB 3DCAA 1Q7YT 2IAJA 1LKZA 4CO0A 3GILA 1EJ7L 3M2RB 4AQYF 1TL1B 4CH1A 4ZVPB 1X4CA 2CJBA 3OUYA 2R7XA 3GSDA 5KTQA 4DV5F 4LF5F 1PAUB 2HHQA 1NDLA 3CDBA 1Y4ZB 1VLYA 5M2PA 3OJUA 4P73A 2XHWA 1T9VA 4X4SA 4M5IA 2W01A 1WI8A 4NCBA 4F4AA 2ZZTA 2B0GA 2JC0A 3P5TL 2HS0A 3KG0A 4ES3A 4I2QA 4Q8FA 1YQHA 1GTEA 3HHNB 4K2XA 4M63A 1NSQA 1Y0HA 5EHHA 3U02A 3B82A 4XK8C 5HK4A 1EETB 4LVOP 4TN2A 4DV2J 1B64A 3IR7B 1NSAA 5F8IA 3J7ZT 2BJDA 4DR4F 1C1CB 2YWKA 4CZCA 3MR5A 1SIWB 2MLXA 5IZHA 1EAYC 4LF4J 3O3LA 3RRHA 1SQGA 4ZPVR 3T6JA 1WACA 4ZN3A 1D3WA 4WP8A 5KFLA 3QGGA 1C4AA 1MW7A 1RXOB 1SV5A 1T9XA 3A8JA 4UW2A 1E6VA 3KHRA 4ZJLA 3G82B 4B3TJ 1ZM9A 4FF2A 4Y2MA 4LF8J 4F25A 3R7NB 3NMAA 1U25A 3TVZA 2X1GA 2RNEA 5DG8A 2AZ3A 3CCLS 1WSVA 4PG6A 2FVRA 3HLUA 2FDNA 2F3JA 5LMNJ 4DR2J 4ELVA 1S76D 3W7BA 4NPOA 2POKA 1V9OA 4N8NA 2MKSA 4OQJA 4X65J 2OTLS 4DL4A 1VC5A 3CJRA 2EKYA 1S1TA 1HI0P 3MEKA 2AU0A 4Q0BB 2VPWB 4IQXA 1Y7PA 2BJ9A 1L3VA 2CQCA 4DS4A 4BC7A 4UY8T 3CF5Q 5KT7A 4X64J 1S10A 3HULA 2L41A 1JJHA 3IWNC 1QE1B 1VLOA 4BC9A 1O51A 2J7UA 3VALA 4USMA 5IM0B 1LFPA 4K4SA 3DN9A 1F0XA 2Q3PA 2AJ1A 1WHVA 4G1QA 4B17A 2QN6B 1JIHA 2AYEA 4KTQA 1P1TA 4DG1A 4KGKA 2XQCA 1FFWB 4W98A 4WCEQ 3J7A1 1UEKA 2J6SA 4IDKA 3RAQA 1WHYA 2B9YA 1CJTA 2VFRA 4ZCKA 1U24A 1S1XB 3TZZA 1AA1B 2XMWA 1KSPA 1UEVA 2GIFA 3CCQS 2HWTA 4DCOB 2XNRA 3GG0A 3R9LA 2RS8A 4E0DA 2PC6A 4PUOA 4PRFA 2E5LJ 2HQ3A 4GMKA 2Y9HA 2V69A 2G2OA 1U1MA 3DNCA 3G6VA 2CDRB 3CC2S 1JX4A 3HHLA 2GVDA 1D8ZA 2DGXA 1YIJS 3KLIB 1NB7A 1UW4A 3BGLA 2LXUA 1S7IA 5ETRA 4QWBA 3J7AN 4MK7A 4DL2A 1DQAA 1DLOA 3FFIA 2MZRA 3VZIA 2H5EA 2JC1A 2G0JA 2FPHX 1Q86T 2RKIA 2X51A 5FLXU 1N34F 4GC6A 2XLJA 4P9SA 4Q44A 3SZ2A 4PAAA 2RRBA 1B99A 4DV4J 3H59A 4DSJA 1J5OA 2BANA 1JLBB 2D74B 3GZ7A 3OR1A 1XK8A 1X9SA 4FYYB 2HNZA 1KBRA 4QYRA 2VF3A 1ZM3A 3SEOA 4CO5A 3J80Y 1UWBB 2CWKA 3OLAA 1EZZB 1R43A 1OQ3A 1S1UA 2Z2ZA 3SI8A 1UPPA 1SVDA 5C2GA 1NRKA 1S0MA 3NGKA 4DCPB 2AGOA 5KT4A 1N6QA 1T05B 2LKZA 3FBFA 4HHUA 5CZXA 4ZP8A 1WI6A 5EX3A 3IM8A 1YSJA 3OTDA 2OUGA 1WEYA 5DM6Q 1IR1A 1QUVA 4ZCIA 4XDCA 3RGIA 5J2QA 1MU2A 3NGDA 4CO4A 1Y5LB 1T03B 1VMBA 4K2JA 4RBTA 4TYAA 2EW9A 2CJ9A 2QLWA 3OT9A 4JI4F 2YNIB 3M8RA 2OFGX 3OL9A 4R5PA 1UW9A 2DHXA 4YS2A 1FX4A 2LLZA 1B70B 2OPPB 1VQ9S 5BR8F 3IBFB 5IOLA 2EG1A 2VPZB 4C3KA 5CCMA 3WX8A 1FO1A 2FHJD 2JLGA 2KHDA 1U47A 1HNXJ 2YH0A 3HVTA 4Q2LA 2UVWA 1HHSA 1E6YB 1CJKB 5KFIA 4HACA 1YBUA 3QYYA 5IC6B 3KLGB 3ZXWA 3GONA 3ILJA 3AD9C 1V6HA 1SJ4P 1WORA 3MF5A 4F3OA 2XB2D 3QLHA 5KFFA 1VJWA 4ECVA 2CQDA 3GU0A 3LGHA 4DQQA 2CJQA 3PZPA 2MKJA 4O3NA 2DIUA 9ATCB 2ATLA 4F2RA 4P2FA 2HLTA 5F8NA 2HMIB 1WSRA 4LF7F 4DV0J 3RB6A 2ASLA 2A2DA 4WWSA 3ITHB 3OHBA 2WVCA 1W7WA 4PG4A 1V5IB 1ZM2A 2MHEA 4YFUA 3K2YA 2G1HA 3N6MA 1BHNA 3M2UB 3Q23A 2IJRA 2RUSA 1KOOA 2RRNA 3EM1A 2GMJA 5C42B 3K89A 1RTHA 2V8PA 4K4VA 3UQSA 2KXNB 1R7IA 2HHUA 1G2EA 3OTOF 2LXFA 4QJVA 2EEYA 3PFEA 2B5JA 3KLFB 4NLYA 2P9EA 3TAPA 1B0VA 1GK8A 2CQPA 2N4CA 3ILLA 3NS5A 2B4VA 5C24B 4IRDA 5HP1A 5F8LA 4EWTA 3E2EA 4I6AA 2HHXA 4JV2A 3CNQP 3TA1A 2RHQB 4N5SA 1ELOA 3TZYA 3NMRA 2XNQA 4RNHA 1VR6A 4TNOA 3MGJA 4J9RA 1I94F 1EARA 4PXCA 4I4BA 5G0RB 5J2PA 3ILIA 3OPKA 4ETXA 2XTJP 4IG3B 1HNIB 1X4FA 2J8SA 3HHEA 2YNGA 2RF2B 2GQ2A 4QYZK 4DR6J 2KVQE 4GKKF 2CG4A 2XWYA 4OL8A 5L1JA 2K3KA 2VUGA 2VPXB 2OHDA 4DUYJ 5H9EK 4ZPWR 1UVLA 2N4DA 4FPIA 2AHOB 1B7YB 3J7YU 4DOZA 1WUUA 1RT3A 2MHNA 2GZOA 4ID8A 4MYTA 4NCGB 4LFCJ 1BY9A 3HD1A 1KTVA 2Y3YA 4ZIWA 1XR7A 2JJ4D 2C2KB 4FVCA 2AYMA 1PJ5A 3S01A 2HVIA 1NZAA 1M5SA 3T41A 1RTJB 4C11A 2ZM6J 5H9FJ 1HQUA 1JKHA 2WBRA 5DDQC 4DXLA 2I5JA 1B3TA 3C6TA 3T1HF 3AQOA 3CTRA 3NGRA 1RTDA 2GVZB 4KV8B 4JYAJ 1ULRA 1RHQB 1UTAA 4OZJA 1DTTA 4Q8EA 3F56A 2DNMA 3ICLA 3AOAA 3WZ0A 4ZPCA 2NREA 2Z56B 3RBEA 2LQ9A 4O0NA 1L3SA 1SC6A 2QFJA 1WDDA 3CD6S 3RZAA 3VQTA 3LP2B 1HW9A 1MWZA 2Y1LB 4P2MA 3GV8B 3TJ9A 2UU9F 2PIIA 3U7JA 5HANA 1SIZA 1Z2ZA 1BQXA 2HGNA 2G13A 3FKBA 1RQ0A 2PO4A 2FVCA 3DOLB 4X66J 1YI2S 4FXDA 2W7AA 1FEEA 5A2QY 4YQWA 3CJSA 1RHRB 6FDRA 3RG6A 2DHHA 3M8QA 4OYXA 3QPIA 2R8KA 3BGRB 3UN3A 4CLLA 5KFKA 1N52B 2O3DA 3VAKA 2C1EB 3BPSP 4TY9A 3EYZA 4CH7A 1S9GB 3AD7C 3B4MA 1TL3B 3T19A 1HARA 2V4JA 1RT4A 1RT5A 4ZOSA 8ATCB 4URGA 2WVDA 4ED4A 4F0MA 5C2CA 3MAAA 4JI1F 3HHLD 4NEZA 2ZHOA 4JI5F 2DNZA 3DRYA 2ROEA 4DV7F 2NPIA 3QGHA 3VR1A 2HHSA 4U8YA 5ETKA 2Q66A 1EETA 3KKFA 4NZ7A 2M2BA 5A8WB 2E9ZA 1KN6A 4C3LA 3BSOA 1ZETA 1SUQB 2R7QA 5ETSA 1NSPA 4USIA 1C1CA 4X62F 4DR5F 4UQTA 2ZZNA 2V4QA 3EWGA 5DGAA 2P6SA 5D0HA 2E1MC 5KFQA 2ZH2A 3C6UB 2DR7A 1EIYB 3C14A 4J9SA 4WIIA 5HLFA 3IG1A 4TKTA 1IBKJ 2XS2A 2BJ8A 2BE7D 3D1HA 3ULHA 2HBQB 2HFUA 3GFZA 3TEGA 3ISZA 3JSMB 4JUZA 5DGBA 3G82A 3VV2B 4PXEA 4FP9A 4X4NA 3GWCA 3JYTB 1QAJA 3H90A 3HFKA 2GGPB 4C97A 1VDHA 1S48A 4QW9A 1PYTA 1CSJA 2YKQA 2ERRA 4M5KA 5LXRA 5HQ8A 4ZVQB 2NXJA 4ECXA 2CJYB 4P71A 3FBEA 4UOCA 2FZKB 2ZJRQ 5HMXA 1FDDA 1RWPB 3GYNA 3HT0A 3SFGA 3OW2R 1KC8T 5KFOA 1RWOB 3DM2B 2ZJQQ 4Q0BA 2MJUA 2HVZA 3D1OA 5GAGU 5EWGA 1U6ZA 4CLPA 3QATA 2BKNA 2V9WA 2NQPA 4X4OA 1CULB 2I8EA 2WSEC 3TQEA 3ET6A 5JVGQ 3LO3A 2PN6A 5IM0A 4M5NA 1ZAXA 3N4WA 3VHQA 1XMOF 2BDPA 3SDEB 1IKXA 1TKDA 1JK9B 2U1AA 2DBBA 1HWIA 4DS5A 1LWFB 2LVWA 1BQMB 1AROP 4MKVA 1FJ7A 4KE5A 1S1XA 5T14A 2EI5A 2V50A 1IKWA 1XNRJ 2MLZA 5HQMA 2F8EX 2QFIA 2R7UA 5DETA 2JEJA 3NCRA 4KGMA 5F9NA 2N7YA 1U2FA 1DFDA 1PG5B 2EC0A 2KRRA 5HL7Q 4KYZA 3SIPB 2A18A 4DQIA 3O8WA 4URQU 1M5VC 2LYVA 3A8EA 3GIJA 4DSKA 1U6BA 1UMJA 3IFEA 5LMUF 5JVHQ 4DL5A 1X5SA 4LQ9A 4QIVA 3QRPA 4NLSA 3HKZD 2HFSA 3CIMA 3SSQA 3HM9A 2XLKA 1JLGB 1VFJA 2ZBRA 5IWAJ 1H74A 4J9KA 4G1IA 1F5CA 2ATCB 2HLUA 5E41A 1SKSA 5HI7A 2NUUG 2IIHA 1M5OC 2KM8B 2DRDA 4N76A 1VQPS 4PYAA 4FS2A 1N33J 3UW1A 3E8OA 1NHKL 3AY0A 3MECB 1FNMA 1B4SA 1UWBA 3O44A 3SBMA 2W2MP 3OQ2A 3L3CA 5IC4B 1R6YA 4IFVB 1Q82T 3FNNA 4M5DA 4X2BA 4QW8A 2Y8YA 2W4CA 4PCQA 1ZZNA 1VQMS 2CPFA 2F8HA 1T05A 2CZ9A 4LRAA 1VQYA 1YRXA 1OPIA 2YQ3A 4BCAA 3SSSA 1GQEA 1HWJA 1U8WA 1W25A 1Q81T 2MQQA 5LSLA 4R0JA 3UPFA 4IR9A 3KLHA 3C8YA 1UFLA 4N56A 1T03A 1VC6A 1CJUA 4Y28C 4J9VA 5K5MA 2JVRA 2YNIA 3W9JA 1SBRA 3L7OA 4NX9A 1NJXA 1RSCA 3DI6B 3X3UA 2BKPA 2XY6A 4RKUC 4C2MA 4OX8A 2OPPA 1SL1A 2FD2A 2EBGA 7AT1B 2JZ5A 3BM7A 4WIQA 2HQFA 3MI7X 1VQ4S 2BA9A 4AL6A 4ZCMA 5KG2A 3MTJA 3EZOA 4NZ0A 3W1YC 2NSCA 1ZM4A 2XGQA 3A8KA 4RR5A 4A8WA 4YP3A 3SXLA 4DSIA 4AQYJ 4L3NA 1CJKA 1CJVA 1NK0A 1RCOB 3KLGA 2GMLA 4DV5J 4LF5J 4IRKA 4IKAA 2E7WA 4K4ZA 1FNXH 1F60B 5CYJA 3LAKA 1S1WA 1RAOA 2VG6B 4PPZA 3MAHA 5T41A 3AHPA 3KLEB 4RO0A 3BBFA 4NLTA 4M5LA 1AZSB 3NWGA 2HMIA 3GCWP 2IM1A 2V6AA 2ZBQA 4I64A 2IVYA 4ED5A 3ZZOA 1S5ZA 5AXKA 3I56S 3W8GA 1QJHA 2WCXA 3QT8A 3ZTRA 2MB0B 1WHWA 2G9OA 2KZMA 3OL7A 3VGUA 3MPDA 2PI5A 2P8IA 2WONB 3H20A 4DR4J 4RNMA 1MN9A 3KG4A 3R5DA 5AJ3J 4OX6A 2F4VJ 3B78A 3TQ1A 1NH7A 4EFAC 3I5AA 1NJYA 4RBVA 2NZCA 1JNZB 1NK6A 2HNDB 3Q8QB 4Q2MA 1GX6A 2MXYA 3FEZA 3KLFA 1R3NA 2UP1A 1WF0A 5DZ6A 3MTKA 5C24A 2C22A 4OZ2A 2W24A 2JDJA 1JXEA 3PCOB 4Z37A 1NXIA 4DPXA 1QAXA 1BLUA 4OLPA 3D0GE 1XERA 1PGZA 3BF4A 1RLCL 1A9NB 4OX9F 2DO4A 2P2CB 4MKAA 4TYBA 2DGSA 2GAGC 2YKOA 2AJ4A 4ICLB 1VQ8S 4PR6A 2DR6A 2XSJB 4Y6IA 3T1AA 2OO4A 2Z4PA 3M8WA 3DHWC 5DDOC 1MNEA 1S79A 2N3OA 4LVNP 4WK1A 4NXMF 4IG3A 4YR0A 1N32F 1I51B 2KYXA 1P9QC 2HHWA 1HBNB 3CJKB 1URRA 1YRTA 2RVJA 3BV8A 3GTYX 1KD1T 1DHMA 2DH9A 2HRUA 2MY8A 4K0KJ 2J7WA 3FGVA 2DY9A 2IFXA 3T5HA 3L4BC 1A6LA 4MIBA 2DNYA 3TP2A 2XM3A 2M88A 4QYZJ 4FYWB 4CLZA 2FJDB 2CKWA 3NGTA 3CCUS 1BWEA 4ZVUB 2FHOB 3RUBL 3SQGB 3CMES 4I0WA 5H9EJ 1RTJA 2MJNA 3G8SA 3VAHA 4HH0A 2DRBA 2V68A 2JRSA 2KDOA 1HNWJ 3MUVP 1GMVA 4HYKA 2I38A 4G6VB 5CXTA 2DHGA 5D15A 1Q16B 4QOTA 1PAEX 2O01C 2X1BA 4KV8A 4LF9F 1TMMA 4EO6A 4FYDA 2KI2A 1TKTB 1RAEB 4ZK7M 1RUSA 4Q7AA 4HDHA 2IA6A 2C3YA 1FA0A 2YNHB 2QL9B 1LQ9A 1PSDA 3LP2A 1MWQA 3PW2A 4FXWA 2OPQB 3BQ2A 4P75A 4OV1A 6FD1A 4A4JA 2X1FA 1N34J 4WFBQ 4I6YA 1V5VA 4XIUA 3DOLA 3MHYA 3RYLA 2XEXA 4DR7F 4WP3A 1NZ8A 4ECSA 4YN3B 2KZZA 4ECQA 4OYBA 1D09B 4C98A 4QZVB 3BS9A 5IV4A 4H4KC 4YB6A 2QMXA 1TL4A 1T0TV 3KFWX 3K5NA 1U1KA 2OJ3A 5HBMB 2BE2B 3BGRA 4GC7A 4XAKA 4N77A 1NEEA 1FKAF 1SH0A 3C3LA 2H5JB 3LA0A 4LSNB 3WC2A 1JB0C 2OH2A 4EMDA 4QWAA 5ETTA 4YUDA 4BWJA 4EBDA
chains in the Genus database with same CATH topology
4NLGA 3J7ZT 2BJDA 2NLWA 2EFQA 4NLPA 2F7VA 1OIAA 4DR4F 2LXIA 3KJVA 1UA0A 1Z4UA 1C1CB 2IHR1 2W4PA 2YWKA 4CZCA 4OJGA 3MR5A 3DHXA 1F2GA 2J6UA 1D9DA 1SIWB 2DK2A 2IVFB 1JLBA 2RUGA 4QQBA 4IYQA 5IZHA 1R8AA 4CI0B 3FMBA 4P7TA 4ILRA 2FJVA 2CPHA 3O3LA 4CO1A 3RRHA 4IUFA 4ZPVR 1V3SA 3T6JA 3MEEB 1WACA 2Z8QA 4OJ1A 1D3WA 4NMLA 3PEHA 3M32A 5KFLA 2QT7A 2MPUA 2E1CA 3MM9B 4ZA1A 2FUG9 3QGGA 4UQGA 1YRUA 2P9CA 1WTFA 1UKUA 2QSFA 4WJBA 4MIWA 2BW2A 2J9DE 1C4AA 1MW7A 3H5YA 4OJHA 4WTYA 1SV5A 3BN7A 4A8OA 4UW2A 4F2SA 1E6VA 3KHRA 2DNGA 3OXFA 4DF4A 5IT0A 4Y34A 1ZM9A 1TV6A 4FF2A 4Y2MA 5A8WA 2GJ2A 3C46A 4F25A 4XDDA 2LU2A 1SUQA 3PX6A 3GIKA 3NMAA 3DLGB 1U25A 2VPYB 3TVZA 3OVSA 2X1GA 5F8HA 3G6XA 3CO9A 4ECZA 2RNEA 2B6AB 3V4IA 1VQLS 4ZVEA 2RT3A 5DG8A 5FDLA 1L3UA 3CCLS 4ED0A 4PG6A 4Q43A 2FVRA 3HLUA 1RA7A 2COLA 3OVAA 1UEUA 2A3JA 4UUXA 2W9CA 2LMIA 2FDNA 2ADCA 5K8PA 2J0SD 2F3JA 3LP1B 2EFPA 2FJEB 2WOMA 4ELVA 1CLFA 3T1YF 1S76D 5B0DA 4KHPF 3W7BA 5D4OA 3EX7B 1IBMF 4B9LA 4NPOA 3MM5A 2KXHA 3N6NA 4MK9A 4I6WA 3C6UA 2POKA 5LT5A 4QWEA 2R7TA 5C25B 4NLDA 4U7CA 1KHWA 1V9OA 1WWHA 4CQ1A 4N8NA 5KFVA 1HW8A 2MKSA 3V6DB 3ENQA 2ZDOA 4OQJA 2OTLS 2QA4S 4DL4A 2F9JA 1VC5A 1U09A 2EKYA 1S1TA 2EWHA 3KNGA 4A48A 1M90T 1ZPWX 1HI0P 3CCSS 3MEKA 3DLEB 4WFXA 4DR3F 2AU0A 2YWFA 2ZOMA 5DG9A 2KFYA 2RMLA 2ZH9A 4Q0BB 2IA0A 2VPWB 3JSMA 4IQXA 4HDGA 1YJWS 1Y7PA 3K8WA 3HK2A 4A47A 1RISA 1RP5A 3LH2S 4J9LA 2UXCF 1L3VA 2CQCA 4DS4A 2GW8A 1X5PA 4LQ3A 4PWDA 4ZHRA 4BC7A 1KTQA 3T9NA 4A8KA 4UY8T 2RB7A 5KT7A 3CF5Q 1S10A 4EYHB 3Q2SC 4KPYA 2L41A 1JJHA 5HN0A 3JYTA 3CEDA 1N5VA 4PQAA 4IH5A 2GGPA 4M95A 3NS6A 1WG4A 3IWNC 5GADI 1QE1B 2FGOA 4BC9A 1HR0F 2JL9A 2ZITA 5KAKA 1O51A 2J7UA 3VALA 5IM0B 1Q82T 2OSQA 4YMEA 1LWCB 1LFPA 4C8NA 4K4SA 1FRLA 2OD6A 3N01A 4HTIA 3CDWA 2RQMA 2FJXA 5E3RA 4NLRA 2CQ1A 5K9FA 3DN9A 1JMTA 4CT9A 1F0XA 3UE2A 2M8HA 5KFNA 2FLOA 3IR6B 2Q3PA 4EU0A 1UJ5A 2AJ1A 1WHVA 4C9DA 4G1QA 2VD3A 1YG0A 1W2BR 3K57A 4B17A 1NHVA 3IGVA 2W9BA 1HNVA 4CTAA 1JIHA 2AYEA 2V5HG 4KTQA 4B9SA 2IYIA 1P1TA 4DG1A 4WE1A 2RIJA 1RT7B 4IH7A 3JB9k 2HS3A 4KGKA 4MK8A 3I9V9 5LSOA 3MWBA 4KFBA 1Q78A 1E6YA 4WCEQ 4ECTA 1JLCA 2OPRA 3DM2A 3J7A1 1KLMB 4RLEA 1VQOS 2J6SA 2CPYA 2GO9A 3DRRA 1HBUA 4IDKA 3RAQA 1WHYA 2ILZA 2B9YA 4F4XA 1NJWA 3GG1A 1S97A 1S49A 2J0QD 3PHEA 1XBWA 2MKCA 3I9ZA 3VCDA 3VQSA 2VFRA 4MKYA 4ZCKA 1X4GA 1U24A 1S1XB 4QBUA 2ZD1A 3PACA 3D2WA 4O44B 1Y9OA 4LF6F 2KU7A 2XMWA 3MZIA 1KSPA 1UEVA 3C2PA 2PFFB 1FJEB 2ZUGA 3CCQS 3I6PA 2HWTA 4USJC 3V5RA 5K14B 1FKPB 5IXUA 3PJWA 3Q8PB 4AE5A 2XNRA 4TU7A 1RT6B 3GG0A 3PNIA 2AF6A 5JJBA 4NLVA 2RS8A 4PG8A 2DR9A 2QEXS 4E0DA 1FJCA 4ZPDA 2KVIA 2PC6A 3R5CA 4I7FA 4PUOA 3KOAA 2AJ0A 2ASJA 4PRFA 1P27B 3D1QA 3I0RB 3PFOA 1KS2A 3KG1A 4FS1A 2VBZA 2UXDF 2HQ3A 3SDEA 1K0VA 2EBEA 2UUAF 2OTJS 4GMKA 2I9SA 1KQSR 4X84A 2UXBF 1RKIA 1ZPVA 4IH6A 1HWUA 1U1MA 1SI9A 3DNCA 1TKZA 3ITHA 2QMWA 1GXTA 5T7LA 3D5MA 3G6VA 1HA1A 2ILYA 3CC2S 1JX4A 4QPXA 4DUZF 4DN0A 3CC7S 3FEXB 3HHLA 1LFWA 3OFEA 2BZ2A 1K73T 2ALZA 1JLFB 2BR0A 1XR6A 1U4BA 3I55S 1D8ZA 5JXSA 3RB4A 4ELUA 1H2UX 2MQMA 1FRHA 2DGXA 3PR5B 4K4YA 1FD2A 1YIJS 4WF9Q 3KLIB 1NB7A 1HBMA 2V8GA 3M2UA 4K4XA 4MAKA 1LWFA 1FRXA 2C28A 1BQMA 4I68A 5CH7B 1KOHA 3PR4A 1UW4A 3BGLA 4J9OA 2W8LA 3G96A 4JV1A 1YITS 1UL3A 4QIGA 5A6WA 1HL6A 2HRYA 5C42A 2LXUA 2RU3A 1LW0A 1KLNA 1RTIA 2PT0A 1UVNA 2IRUA 4QWBA 4K4WA 3J7Z5 2GMHA 3W2VB 2ZC4A 4PPDA 4YB1P 2UUBF 5AXNA 4MK7A 4DL2A 1DQAA 3I82A 5GAEU 2ZH8A 4I1TA 1DLOA 3CXCR 2ROPA 2MZRA 3FFIA 4Y2KA 2FLNA 3VZIA 3NCPA 2H5EA 2LEBA 2JC1A 3JAMY 1XNRF 2V2KA 5CYQA 2P9GA 2FPHX 3PW7A 1Q86T 1IKYA 4FBUA 1HYSB 2CFXA 1T3OA 2RKIA 4OLOA 5HMWA 2X51A 3AJ2A 1N34F 1F5BA 2SXLA 4GC6A 2XLJA 4Q44A 1NK7A 3MAQA 1N36F 4MKBA 4U6PA 3F73A 1OSCA 4DHVA 3M8SA 2IYGA 3SZ2A 1L3TA 2RRBA 1N5TA 4TY8A 4DSJA 3H59A 1J5OA 4C8MA 5A0YA 2R7SA 1FE4A 2BANA 1S6PA 3HDSA 1UJ4A 3HXMA 1DQ8A 1S4FA 2E5JA 3BJYA 4I69A 1IR0A 1JLBB 1YBAA 4NA3A 2D74B 3GZ7A 3OR1A 1XK8A 2DH7A 1M5PC 4HT7A 2LCWA 4RWXA 1X9SA 3BZQA 2HNZA 1U49A 4QYRA 5G4DA 4CO5A 1ZM3A 3SEOA 2XI2A 3J80Y 4QIEA 3M32B 3OBIA 2DPIA 2BUNA 1UWBB 2M3DA 4DBQA 3OLAA 2DR8A 1R43A 1HPZA 1OQ3A 4HT5A 2XMUA 2N3LA 3HF5A 1ZYQA 2YTCA 4Y3CA 2YWHA 1S1UA 1UVIA 3DU6A 3UDCA 3SI8A 5KFXA 4BBYA 1RT1B 2YKPA 5E5NA 2YKMB 4U7UK 3OLBA 2R8HA 1SV5B 3MDFA 5L9NA 2MZQA 2N82B 1FTRA 1NRKA 3VTIA 1S0MA 3NGKA 2AGOA 4X4PA 5KT4A 1E6VB 1YJTA 1N6QA 4R25A 5U47A 4I67A 2CYYA 3THVA 4K4UA 2BV3A 5HMZA 1T05B 3CB4A 5IWAF 2LKZA 1QSSA 4JI6F 3CSKA 4DQSA 3MM8A 5CZXA 4ZP8A 4DV2F 2QRRA 1WI6A 4LMZA 1C2PA 5EX3A 3MPYA 3NAIA 5G0RA 4BWMA 3TOQA 1YSJA 3OTDA 3EXYA 1WEYA 5FDLB 5DM6Q 2QYCA 3LAMA 2M9KA 2IRYA 5SUHA 1QUVA 3CIZA 3CWJA 5KG7A 3CJ0A 1HNIA 1C4CA 4PXBA 4ZCIA 3POTA 4G3IA 3KK3B 4XDCA 4DEZA 4EO8A 5J2QA 1SL2A 2RH3A 4D3GA 4AUKA 4H4OA 3SCLE 5AE2A 1MU2A 1XC9A 2RF2A 1S1VB 4MFBB 3NGDA 4CO4A 1Y5LB 3MM5B 1T03B 2ZNZA 1S9EB 5ITHA 1VMBA 1X4DA 4RBTA 2LQBA 2C3PA 2EW9A 4TYAA 3QZ8A 4OZNA 5K8NA 1KVJA 1JNRB 4LF4F 2CJ9A 2MGZA 4DL6A 4P7VA 1XWLA 2QLWA 2XMMA 2J9DA 1RAJA 2VG7A 4JV0A 4DSLA 4JI4F 4PG5A 1ZOTA 2JFDA 3QJLA 4H4MA 2YNIB 2ZH4A 1YJUA 2DNQA 2DNNA 1PO6A 1S1TB 4IFVA 3M8RA 2OFGX 3RU0A 5MLCV 3M6UA 3OL9A 4R5PA 1TKXA 3IGNA 3NAHA 2DHXA 1NKCA 4NWBA 4OHZA 3NNAA 2E1AA 3ENVA 3JSBA 3CUNA 4XO0A 2W9AA 4QU6A 3OFFA 5FLXY 4AFFA 2ZH3A 3PW5A 3MD1A 3W2WB 1YJ9S 4PWDB 3U27A 2LLZA 1CVJA 3LP0A 2KT3A 5KFZA 1RI7A 1B0PA 1H0HB 2OPPB 2OAUA 2PMZD 4NCGA 5KFUA 4RNFA 1VQ9S 3MMBB 5BR8F 1LWEA 5B0FA 3PRDA 5L1IA 5DLFA 4ZLPA 1YJNS 1SKRA 2C2EA 5LXYA 3S7RA 3RB0A 2EG1A 3HMJG 5CHCB 2DHAA 4OFZA 2VPZB 1IJFB 4C3KA 5CCMA 2HHVA 3PKYA 1N54B 3CE8A 2VA3A 1T94A 3IAM9 1DJ0A 2DR5A 2I0XA 2L9DA 2V0NA 4F4WA 1FO1A 2IC3B 3ISNC 1U1PA 1X4EA 2FHJD 4J5OA 5LMNF 4DR2F 1TL5A 3KMSA 2JLGA 1K1QA 2DGOA 2KTQA 2UVVA 2KHDA 1U47A 4WE1B 4YOEA 2YH0A 2GJIA 2ZE2A 1FK9B 3HVTA 4DF8A 1G6BA 4Q2LA 4Y2IA 2UVWA 3DFEA 1HHSA 4KFBB 1E6YB 5I3PA 1JLCB 2OPRB 4C8KA 3CMAS 1HD0A 3VF0B 1CEZA 3DRSB 2J9CA 3CDUA 4X65F 3DRRB 5KFIA 1HBUB 1X5TA 3T5KA 2DPJA 3QYYA 3KLGB 2GQCA 1V6HA 1TK0A 1SJ4P 2E1RA 3TUZC 4RX6A 3TRGA 3DI6A 1ROFA 3MF5A 4F3OA 3NRBA 2ZD1B 7FD1A 3US5A 5L38A 2XB2D 2EVZA 3QLHA 2VFUA 1RWUA 1FNOA 1VRUB 2KHCA 1VJWA 4KIAA 5E3PA 5KFFA 4ED1A 4ECVA 2DCUB 2Q79A 5J1NA 4QWDA 4CO3A 2CQDA 4AL5A 1VHFA 2CVIA 4DQQA 5KOXA 2CJQA 1N88A 1NO8A 3TVYA 1FRMA 4PQUA 2E7XA 4X64F 3HHLC 4ZP9A 3PZPA 2MKJA 4O3NA 2DIUA 4RW7B 5D3GB 1DURA 4XPEA 1FHTA 2ATLA 4PUOB 4F2RA 2CQBA 3QO9B 3NBPB 4DFJA 4IRCA 2HLTA 1REVA 5F8NA 2HMIB 5BYRA 2ASDA 5B0AA 1J2VA 4LF7F 1NK4A 2FVPA 1JLEA 3RB6A 4Q45A 2ASLA 2A2DA 3GMGA 3ITHB 3OHBA 2VQEF 5T7LB 2MKKA 1PILA 2CDQA 1H98A 1SL0A 1Q4RA 3HHLB 4PG4A 1FCAA 1QVGR 5KT5A 2WRMA 5KFHA 1ZM2A 2FHMA 2MHEA 5HMYA 1N5YA 4LFAF 4YFUA 4QU7A 3K2YA 3QIDA 1MWYA 3N6MA 2XMTA 1HBMB 3M2UB 3Q23A 3NNCA 2VG5A 1VIXA 1KOOA 3PXGa 3RW7A 2RRNA 2GHPA 1RGVA 2GMJA 4R8UA 5KFMA 5KT6A 1D9FA 1OS5A 5C42B 5K8OA 1LW0B 4KJIA 1RK8A 1RTIB 1RTHA 4NLOA 3TAMB 2CQIA 3TAQA 3UFCX 3Q24A 3CPWR 2XBPA 4D3HA 2OP5A 2VG6A 2CPXA 4K4VA 3MPWA 4MH8A 4ELTA 3UQSA 2KXNB 1R7IA 3QMQA 3FSIA 3DLJA 1M5KC 2HHUA 3FFIB 1X8DA 1G2EA 3M8PB 4RBUA 4WYWA 2N7CA 3BDPA 4HH1A<