1YJRA

Solution structure of the apo form of the sixth soluble domain a69p mutant of menkes protein
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
75
structure length
75
Chain Sequence
MGDGVLELVVRGMTCASCVHKIESSLTKHRGILYCSVALATNKAHIKYDPEIIGPRDIIHTIESLGFEPSLVKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-transporting ATPase 1
publication title An atomic-level investigation of the disease-causing A629P mutant of the Menkes protein, ATP7A
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 17
structure length 75
sequence length 75
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2005-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1yjrA00
1VQYA 4F67A 1N5QA 2FHMA 3LO3A 4NPOA 4HL9A 1X8DA 2ROEA 2QLWA 2K1RA 1VQSA 2BYCA 3DXSX 4FNHA 4OIXA 4A48A 2OMOA 1W2IA 3BR8A 1LQ9A 2W4DA 1Q4RA 2K7KA 4YDXA 3UDCA 4QOTA 1IUJA 2G9OA 3HHLB 1TR0A 4FNIA 4DPOA 2ASYA 2N4DA 3WDOA 4HH0A 3MCSA 1K0VA 2OFHX 2LQ9A 3BB5A 2VV5A 2K2PA 2N7YA 1CC7A 2LXFA 1Q8BA 1Y9OA 2RILA 3BM7A 2EW9A 1V3ZA 1YJTA 2W4CA 3IWXA 4ZA1A 5KAKA 1GXUA 3FGVA 2LDIA 1N5TA 3HHLA 5B08A 4EFAC 3FMBA 2BBEA 2K1RB 1CC8A 2KT2A 1KVIA 2CRLA 1MWYA 1KVJA 5F0UA 1SB6A 2OKQA 5B0DA 1SI9A 3HX9A 2ZDPA 1FEEA 2HLUA 2QLXA 5B0AA 2Q3PA 2W4PA 4OJHA 1P8GA 2KYZA 3HF5A 3T9NA 2VH7A 2ZDOA 1S6OA 5B0CA 4HI1A 4OJ3A 1WD6A 3KG1A 1CPZA 2RSQA 1YJVA 2BUNA 2GV1A 2IFXA 3DCAA 3LGNA 4Y2MA 4ZOSA 5B0FA 5B0BA 3QGPA 3LGMA 4U9RA 3HDSA 2HQIA 5A6WA 2RMLA 1JWWA 1FD8A 1FVQA 2HLTA 2LQBA 3FRYA 4YEAA 1TUVA 2RU9A 1OPZA 1FVSA 2OP5A 3TNVA 4DL0C 1TL5A 3I9ZA 3KNGA 2PGCA 2FIUA 1Q53A 2QYCA 4Y2KA 4DN9A 1OSDA 2N4CA 2GO8A 1AFJA 1FE4A 3KG0A 3CJKA 2GGPA 1N5VA 3MZIA 4Y2IA 3BN7A 3VTIA 2ACYA 2XMTA 2IYIA 2OD4A 2OD6A 4A46A 1ULRA 2GFFA 2KKHA 4NL5A 5IXUA 1AW0A 2GA7A 3TOQA 4OJGA 1RJJA 4A47A 2HFOA 2QIFA 3HFKA 2KT3A 1YRXA 3TRGA 3QMQA 3IWLA 1OQ6A 2XMUA 4HH1A 1Y3KA 3E8OA 1URRA 1X7VA 5T7LB 3CJKB 1R6YA 2GGPB 2XMVA 5B0EA 1X0PA 1Y0HA 4HI2A 1QUPA 1OQ3A 2ROGA 1TZ0A 3F44A 2AW0A 1Q8LA 2FB0A 5B09A 2HFNA 4Q2LA 5A6PA 2BJDA 3BF4A 2XMJA 2AP6A 2IYGA 2XMKA 3BGUA 3K7RA 5T7LA 1YJUA 2L3MA 1N5SA 5B0GA 2AJ0A 1FESA 1YG0A 1SQEA 1FE0A 1XBWA 3HHLD 2HIQA 1JK9B 2K7JA 5F0WA 1YJRA 2BJEA 4OJ1A 1APSA 4A4JA 2JDJA 2FTRA 1Y3JA 1MWZA 2GCFA 2AJ1A 1S6UA 2PD1A 3BDEA 2OAUA 1P6TA 3HHLC 5K9FA 1U7LA 3KKFA 2OFGX 2XMWA 2ROPA 1TL4A 4Q2MA 1AFIA 1KQKA 2XMMA 3GZ7A 1GXTA
chains in the Genus database with same CATH superfamily
5DJBA 2X1GA 1F9HA 3SEOA 1PC5A 4G1IA 1TKDA 2H3EB 1XNQJ 2ZOFA 1TK5A 4JI4J 3O2IA 4JYAJ 1HQ2A 4KHPF 2DHGA 3VWSA 3JAMU 2X7IA 4QIWD 4DCJB 3G71S 3K0JA 1WTBA 2WW8A 3VGSA 1RAEB 2WVDA 3DCAA 2AEJA 4DUTA 3KJVA 7FD1A 2ZZTA 1Z2ZA 4IQXA 2RU9A 2VF3A 1F9EB 3PFEA 4M63A 3ILIA 2F3JA 1T05B 2KJWA 1TL3B 1HQUB 4RNNA 1MWQA 2D41A 2M2BA 2M7SA 1YJWS 3QFWA 5EX0A 4C0HA 3DLLQ 3E8OA 3ZNUA 2VFVA 2E5LJ 1SPBP 1RAIB 3NP5A 3PW0A 5ETNA 2DR5A 4C0OC 3ZTPA 4GO7X 1O8BA 1C0UB 4MKAA 2ZE2B 2HNYB 1WC0A 4ANCA 1JNZB 1CVJA 2RF2B 3QJJA 4L76A 4C8ZA 3PYGA 2XNRA 3MMAB 3QIPA 3KMSA 2O5DA 3PM9A 1HNWF 1TL7B 3TYTA 1AROP 2DNKA 3FSXA 3NGDA 4ELVA 2E5JA 4CLSA 1UTAA 5F8MA 3HLUA 2UUCF 5C2CA 3UR0A 4B3TF 4JI8J 1NHVA 4G65A 5A76A 4R0JA 3G82B 5J2MA 4Y6IA 3T6JA 1LWFB 5AXLA 4IQMA 2R7OA 1T03A 1WEXA 1GAOA 1UJ4A 1RWVB 3NAHA 2DNPA 2ZH6A 2GAGC 2HYIB 4B3MF 2NQPA 4ITSA 3A13A 3HK2A 3QATA 5LMUJ 2WOMA 4KR0B 4JV5F 3M8QB 3PX4A 2IYIA 2V63A 3V6KA 3PRVA 4PXCA 3CCSS 4ES1A 3KHRA 2J7KA 4CO2A 1HYSB 3TUPA 1Q78A 1W2BR 2KG1A 4IO1A 2VA3A 1FKPB 4TY9A 2JVRA 1DZ5A 1VRQC 2V9WA 2X3GA 8ATCB 1XMQF 4AL5A 4N77A 1PAEX 3FZ2A 3EGWB 1RDRA 4GKJJ 4K8RA 4DV4F 2VL1A 2FHMA 2CYYA 4HL9A 5KFBA 2FY1A 4X65J 3NGUA 2R2RA 1S59A 3CE8A 1ZM9A 4RW4B 5ETTA 3WDOA 2YNHB 1F6TA 3SV4A 1FJ7A 3BM7A 1RT1A 5B08A 5I3UB 2QL7B 1S0VA 4NE9C 4QWBA 1N88A 4MFBB 4WTOB 3V4MA 2PIIA 3C15A 3NEKA 1N6QB 1QE1A 1U8SA 3ETOA 4CNYA 1OPZA 3NOCA 3R97A 2QMWA 3I5CA 2PA8D 3GCWP 2ATCB 3X3UA 4I0WA 2DTJA 1TK0A 2EC0A 1ZAWA 2VG7A 1F5BA 5K14B 3DDKA 2IDLA 2KM8C 2DRBA 2W7PA 2XLIA 2DGVA 1S76D 4WZMA 5B09A 1YIJS 2A2DA 1IKWB 2EEYA 4JV5J 4C97A 1U1OA 3FCVA 3HT0A 2JEFA 1H7XA 3TA0A 1X31C 1R8CA 3Q8PB 3I9V9 1RUSA 3W2VA 2HHVA 3FEXB 2OELA 2V2QA 1WI8A 4DR3F 2KU7A 5KFKA 2W2OP 1XJWB 2Z57B 2EFGA 5ADZA 4F2SA 5HK4A 2BZ2A 3KK3A 2MZQA 2AD9A 4MIWA 2GVDA 5F8NA 2YKMB 5KT3A 5D0GA 3ZC4A 3OXGA 1IKXB 3DYAB 3B4MA 1M5SA 4BCAA 4B17A 2FYXA 4HR2A 1S79A 3SZ2A 5HN0A 1RT3B 4PUOB 1VRUA 3KG0A 2RDIA 2HK2A 4DR4J 3OV7A 1NK0A 2OSRA 2J6SA 1PILA 5E3PA 3TRGA 1TL1A 2VDIA 2I1RA 4NXMF 2XYPB 2GZOA 1TZ0A 1U0HB 3OFEA 3V6HA 3D4JA 2H5EA 3I31A 2V4QA 2V4JB 4ZCMA 2V67A 4TNOA 3DU6A 1UW4A 4RNMA 4Q43A 1EZZB 1Y4ZB 4NRUA 5HO4A 4AT1B 4JV1A 5D0HA 1U24A 3KWMA 3NWRA 2QC3A 5G0RB 1KLNA 1CULB 3GP9A 4OX9J 4PXDA 2R8KA 5K8MA 1I6JA 5D0RA 2MXYA 1AUSL 1JLCB 3T1HF 2C3YA 2RQKA 1OY9A 5A8KA 5L38A 3N9UC 2WSEC 3KUGA 4DBQA 2JZ5A 1MNEA 1TKXB 1C1CA 2HQIA 2ZWOA 4U7CA 4Q8EA 4CCHA 2L9WA 3PKYA 2MDAA 2NR0A 5ETVA 5F8LA 4NL5A 1FX2A 1Y5NB 1WC5A 1WKKA 1TMMA 5ETSA 4C8YA 4NYZA 3EVWA 4IG0A 4F3QA 2GIQA 4FN5A 4DV1J 1LWXA 4DPWA 4A8MP 1WG1A 4O3QA 3KLGB 3AB4B 2DEJA 2E1RA 5BR8J 3DLEB 4DPXA 5HLFB 2MKHA 1SH0A 3LOUA 5KT7A 3NOGA 1KN6A 1FDNA 1S6UA 2HBZB 2MZJA 2JHEA 3H5UA 4NXMJ 4P10A 4LF9J 2M9KA 1GXTA 1B64A 2BYCA 4DSKA 5EN1A 3W5XA 3PV8A 3EX7B 2OTJS 4NWBA 1FA0A 3LP2A 3W8PA 1HW8A 1QAXA 3OTOF 2DCUB 3PIOQ 1RAOA 1FRLA 4QYZK 2DISA 1MMNA 1NHKL 4DG1B 2XS7A 4U7UD 4WJBA 1TV6B 3CCQS 3TX8A 1R6VA 1HBOA 2FPHX 2FIUA 1BWVA 2C3UA 2ZH1A 1RT7A 2Z56B 3UD4P 3QNWB 1XMOJ 2RS8A 3QBCA 3ZTSA 1U25A 5HSPA 3G6XA 3H4BA 4ETZA 2I8EA 4LFCF 3RW6A 4AQYJ 2V8HA 3J81U 2RKIB 4NA2A 5F8HA 1W25A 1QTNB 3D1OA 1RT4A 2FZCB 2C1EB 1RT2B 4LF4F 2ILYA 4W92B 1ZS6A 2CDRB 3FBFA 2RDDA 2ASYA 4LF6F 2ZH5A 4EWTA 1U1MA 3T19A 3ZTRA 2BQUA 1Z2LA 5HL7Q 4DUYF 3W5YA 4IR9A 3D6FB 2YY3A 1GT8A 2QA2A 5EUHA 2ZH3A 4FF4A 1YZ6A 1HWUA 1T05A 4TYAA 1TL3A 2DGTA 2HHPA 4ZP7A 2VG6A 4F8RA 4RPFA 3NG8A 2GX8A 3OW2R 4XO0A 3JYTB 5DDOC 5HVHA 3IBWA 1U1KA 3OTOJ 2EG2A 4XAKA 2HAFA 2WVEA 4JB8B 4RR5A 1YQHA 4L3KA 5D0EA 2PEHA 1E6VB 3I82A 1C0UA 4N7TA 2RF2A 3FBCA 5HP1A 3OPKA 3BSAA 3BDPA 1UL3A 1TL7A 1KONA 4K5SA 2DJWA 5IFMA 3MMBB 3A8IA 2YWWA 3D6MB 3TQEA 1OIAA 2XQCA 2V0NA 3OL9A 1S7IA 4YHHF 3G82A 3JSRA 4CLTA 2AEMA 3QLHB 1S1TB 4FNHA 1LWFA 3AD7C 5CZVA 4DQIA 3NLCA 4KH1B 3CCES 1BE4A 2XO7A 4DV7F 2KYZA 4O0IA 2Y8WA 1L5UA 2H4YB 1CPZA 2PFDA 3G9CA 3FEYB 4TU8A 5KFYA 1SJ1A 1IBMJ 3NS6A 1WELA 2OHDA 4CLKA 5F3TA 2VBYA 2UXBF 3TA2A 2J0SD 4ZVEA 2R42A 4DUYJ 4CLPA 1F2HA 2XMUA 4E0DA 2GGPB 2AW0A 3SBMA 4KGKA 2I2YA 1HWLA 4DR1J 3GIRA 1YG0A 3KLIB 2G0CA 3CMQA 2HIQA 2VKRA 1APSA 4P71A 4RW6B 4RW4A 3D0GE 3N5BA 4DV6F 2CIMA 4M8LA 3LALA 4L74A 5E0OA 2OMOA 5HMZA 2YNFB 4DL3A 1YRUA 4MFBA 3BV8A 5BJRA 2N7YA 1DFDA 1N6QA 2VBWA 5IWAF 4F0KA 2LDYA 2CQ4A 2G1DA 1IKYB 1VBXA 3I4PA 1WF0A 4OHXA 4NLWA 5IV4A 2JX2A 4KAIA 3I9ZA 3R7BB 5K14A 3B82A 2XMAA 1HWIA 2XSJA 3TUZC 4DCOB 5FDLB 3Q24A 3H25A 4OJGA 4F36A 1Y00A 4BHQA 2AJ2A 1SUQA 3GFZA 1TKTB 5AJ3F 1I94J 1V5IB 1UFLA 1CJTB 4OZNA 1SL1A 3QO9B 2VBZA 3H2UB 1XBWA 3GV5B 3KK2B 4PRFA 1Y3JA 3MR2A 2ZWPA 3LP1A 1LKZA 5HJYA 3A1YG 2KDOA 3CMES 1XTZA 1RWUA 1A7GE 3UDCA 2N7CA 3QRQA 3IRXB 1N34J 4Y65A 1BLUA 3FSIA 4F3MA 2K2PA 4V19X 2LXFA 3CCUS 2FC8A 4IRDA 5D3GA 2X51A 2DB1A 2ZDPA 1WOPA 4OJHA 3L09A 4YP3A 1RHKB 4PUOA 4KO0A 1IBLF 3UO0A 3B6BA 3KLVA 4XTTA 1ZM4A 3THPA 4MKVA 2VQEJ 4UF4A 4F26A 1U0HA 4WKRA 2B0GA 3T1YJ 5IT4A 1FKOB 4Z2XA 5IV3A 3J7Z5 4K0KJ 1YITS 4HHUA 4X62F 2V9KA 4DQSA 4Y2CA 2RNEA 2BJDA 4F2RA 1SL2A 4FYVB 2IA6A 3Q89A 1NB2A 2WSFC 5LSRA 5KG2A 1N48A 4Q5VA 3DOLB 1KHWA 2E9RX 3G8TA 1CLFA 4X84A 4U6PA 4MT1A 2IM2A 2G2YA 3MECA 1Q4RA 4H4MB 1PYSB 1TR0A 6FDRA 4EGLA 4C98A 2CQHA 5SUHA 2HNZA 4L75A 2BABA 4JI0J 1TKXA 2W9BB 3V6DB 4J9NA 1VIXA 3R5AA 5L9XA 2C22A 3PFOA 2AGQA 1U0SA 4F4YA 4ICLB 5EX3A 2W2NP 4ZVUB 1ZTTA 4L72B 2UVUA 4M5DB 5KFUA 5CCMA 4RJVA 3DLEA 2NZCA 3U1MA 4FYXB 1T02A 5A6PA 3ZTOA 3K5LA 5D77A 1KEKA 3FMWA 2UVVA 4IFVA 3PR4A 1F1BB 4OYWA 1X4EA 1RT6B 1H73A 1T0TV 2RUSA 4A8SA 1VBYA 2KM8B 2C2ZB 1PSDA 3RG6A 4DG1A 2DH7A 4Y2AA 4C8MA 4UY8T 2UUTA 2NUHA 2Q3PA 4ENOA 2WVBA 1VHIA 4LR7A 1BMQB 2IFXA 3DRPB 1FWPA 1HQEA 2DRDA 5AT1B 2WZ1A 4RNFA 2GFFA 3QGHA 2HMIB 1N8RT 4DUZJ 3V81A 1F5CA 4HYKA 2X1AA 1UMJA 1U02A 2ZNYA 1Q8LA 1S99A 2KXFA 3GFHA 1DQ9A 2FQQB 1RT2A 3R2DJ 1C0TB 4DS4A 5CYMB 2A3JA 2WB4A 3ZO7A 3FCWA 4ED8A 3CO0P 1RKIA 1WC6A 3QRRA 4WYLA 3CF5Q 1VQ5S 2JDJA 2JC1A 3BKFA 2CJBA 2XMMA 2R7QA 3CC2S 2CQBA 4FP9A 3KTQA 2EK6A 3M1VB 1F3VA 4LQ3A 5H9EJ 5CA5A 3J80Y 1UWBB 4UT4A 5MAOA 2DR6A 3HT3A 3IWXA 5A8WA 2UXDF 4C2MA 4URQU 2C3MA 1QSSA 4DLGA 4V1Ak 1IBKF 3E3XA 2EK1A 1LW2B 1PCAA 3GWCA 3TAMA 4KC5A 2B9YA 3IFEA 4OYMA 3MCMA 1PIEA 3DHXA 2X3DA 5AXMA 3FBEA 4OI4A 4CH7A 2XULA 3CCVS 1XK8A 4F25A 3HM9A 4E2FB 4WWSA 3QJLA 4DN0A 1DJ0A 2QA1A 4QQBA 1EP4B 2MQ8A 3MMBA 3PYFA 2GC8A 3BF4A 4EU0A 4HT7A 3OFHA 3EWGA 1S1TA 1RU2A 3GB0A 3DLKB 1RB0A 1U4BA 2ZD1B 4Q2MA 2IM3A 4TQSA 4RZRA 4GKKF 1SH3A 4MK7A 4YR3A 1KR4A 3QJPA 2W2QP 2UUBF 3D0IE 3NY0A 4Y3CA 5GAEU 4CH1A 4KV8B 1GMUA 4WFBQ 2YWGA 3I4HX 2HLUA 3K5OA 2V50A 2VDHA 3AJDA 3LA0A 1Q5VA 3I0SB 1RE1B 2FHKA 4IFYB 2KZMA 2W1BA 4ZVSB 4DL0C 1X4GA 2JWNA 2HKEA 4LIWA 1MSWD 2GGPA 1T9VA 4EMDA 2M8DB 2DY9A 3FC9A 1AUDA 1FFWB 2YWEA 2P8IA 2FVCA 3KLIA 3QPIA 5KT2A 2Q66A 1N5YB 1AT1B 5U47A 1ZA2B 1ZTWA 4NEYA 4P6QA 1RWWB 5HQ8A 1SQGA 1H2TZ 2NXEA 4FF2A 4J5OA 3Q83A 2ILZA 5D4OA 3DC2A 2YNFA 2J6TA 5GMKa 2B8PA 3MR3A 3HKWA 4AD6A 2K8GA 1ITPA 1XMBA 5EGYA 4UQTA 4LBIA 1RZMA 3HP6A 2CDQA 3C66A 4MIBA 4DF8A 2V8PA 2QA4G 1PAUB 3UVJB 1XNRF 3BGLA 3HHLA 3PRDA 3VAKA 1MWYA 4K7QA 2ZUGA 4O4GB 1REGX 3KDNA 4USHA 1NEEA 5FDLA 4D3GA 2J0WA 3QT6A 2LXIA 1TKTA 4RUHA 2CQ0A 4Q7AA 3QQCD 2KJVA 4FYYB 1B0PA 1CJTA 3GR1A 4DR2J 3D0HE 4ALZA 2K3KA 2BDPA 1X0PA 5KG4A 4W90B 2ZC3A 2AP6A 2FC9A 4OFZA 4R8UB 1KDNA 2IJRA 2AJ0A 3LH2S 2PDAA 9RUBA 2R7WA 3SI8A 1HNXJ 4A4JA 3T5LA 1NB7A 4Z37A 2NCKL 1WKLA 4PPZA 1B70B 2KFYA 4ECWA 1NXIA 2B8QA 2AT1B 3HFZB 3PZPA 2CG4A 1UW9A 2G2ZA 4OYPA 1U8WA 1RTHB 4BC7A 1S5ZA 4YB7A 1NK7A 3ZZZA 1FJGJ 4I56A 1UZHA 2KVIA 1AB8A 3GFXA 4EYIB 2DPJA 1J5OB 4ECUA 3HDSA 1H6KX 1WUUA 5F3ZA 2QFJA 4LF5F 2VODA 3P4UB 2G0JA 2ASLA 2H48B 4CIOA 1IR1A 3C6UB 1DHMA 1A9NB 4ECSA 2U2FA 2E5IA 1LNQA 5CCLA 2Y0BB 3NGTA 4DSEA 1C4CA 3EVMA 2NXCA 3I96A 2MHEA 4LUBA 1HNIB 2UVWA 4KGXB 1T9UA 3NKYA 2VA2A 2XM3A 2QLJB 2YNIB 3BO4A 4WP8A 1VQYA 2J9EA 2QG9B 4IOBA 3SMZA 4J9QA 2PE8A 1T3OA 4DPOA 1OPIA 1K0VA 2UV8A 4JOUA 1KFDA 1FXDA 1NUEA 2HHTA 2BQ3A 1UJ5A 3OQ2A 3UN3A 3MEGB 2CKWA 2ZH4A 4ICLA 1RWNB 2F4VJ 4U8VA 1RLCL 3VGVA 5LMNF 4B9UA 3ISND 3W7BA 3CDBA 3AQPA 4X4RA 2NXNA 3E2EA 1NH7A 2HRYA 1Q8IA 1G7CB 2CJKA 2YXLA 1W26A 1LWEB 1DQ8A 4M1KA 2MKYA 5B0EA 1OS5A 1FNMA 1ZH5A 3M30B 1XERA 1RT6A 2NPIA 1I3OB 5DGBA 4WPAA 4PPDA 4CM2A 1X5TA 2KHCA 1U7LA 4PXBA 4WYWA 2CPDA 3MPDA 4W98A 3O6QA 2XCPA 4NCAA 2VZ9A 4HKQA 4TXSA 1CC8A 2FHJA 4K50A 5DO2A 2BE9B 2ALZA 3BKUA 2HHHJ 3JQMA 2V34A 1QUVA 3TZZA 1S9FA 1TFWA 3LGNA 4DQQA 8AT1B 7FDRA 1XN9A 4U9RA 4GRSA 4MMOA 4WFYA 2GHPA 3CGIA 1DTTA 3G8QA 1UCNA 3ULHA 3UCUP 3OBIA 1RBAA 1EARA 2GQCA 4DLEA 1S57A 2GVZB 2R8JA 3L7PA 3UQSA 4ZHRB 4JI2J 3NNAA 4IR1A 1HBNB 2UU9J 2AWZA 5LMNJ 4DSJA 2B4PA 1VFJA 2IM1A 3PIPQ 3IAS9 1IQZA 2UXCJ 1WTFA 3KXDA 4LF7J 2DBBA 4OZ2A 5GMEA 2CVEA 4NYOA 4ZVTB 4LSNB 5H9EK 1L3TA 3GIMA 3BR9A 2B9XA 2DD8S 5B7WA 3M2RB 4OLPA 4B9NA 4G1PA 2HEKA 1KSPA 3DOKA 2M4MA 2BJ9A 5ETOA 4P73A 4A8WA 2CJAA 3GV8B 2DYAA 4OX8A 1F60B 2QLXA 4PKDB 3QIDA 1KP6A 5D4NA 3W64A 4F3OA 4OHYA 3AH6A 2HG4A 3IM8A 4K4TA 2DHHA 3Q22A 3KMQA 2OD6A 2IM0A 5KFWA 2K06A 1RTZA 5DLGA 4X4TA 3MFHA 1Q86T 2VFSA 2E1MC 2X1BA 3A8KA 3TX0A 4X4OA 1VRTB 1G1XA 4HI2A 3EUNA 2G2OA 2HFNA 3R5GA 2CQPA 3POTA 4NRTA 1F2GA 4PQUA 1VC0A 3EPIA 1TU0B 5DM7Q 5F0WA 2YQ0A 1YJNS 3D6HB 2QMUB 4NI2B 4KV8A 2ASJA 4LFAJ 1KBRA 1UVIA 4FF1A 5IT9U 4IYQA 2W4DA 3HI9A 1IUJA 3CJ4A 2D3O1 9ATCB 1DTQB 4PABA 1MROA 3CJRA 1N33J 4UOFA 2O3DA 2VPYB 4ID5A 2F9DA 1ZM3A 2ZHAA 1HARA 2QRRA 4N5SA 3AOAA 1P8GA 2AU0A 4MK9A 3EGNA 4ES3A 4ECYA 1RWOB 4AXIA 2IMWP 3ET6B 3RR7A 1JLAB 1Y5IB 5A8RA 1P1LA 3R1HA 2PSZA 2OSQA 2XS2A 2OIHA 3G96A 3HVAA 1VJQA 2YWHA 1UA0A 1JX4A 4QWDA 1CS4B 3I56S 5ETPA 5CD4H 1IWAA 1YJUA 3I5AA 5K8NA 1GQEA 4J9VA 3R5CA 3P5TL 3HJFA 3UN5A 1JLEA 3S8SA 3TUJC 2IIHA 4I2PB 4X2BA 4RU2A 1S48A 3G86A 4DR5F 3OR2B 5BYRA 1FKAF 4O4GA 3IBFB 4RUAA 1RHJB 4O44A 2EVZA 1PKUA 2JL9A 2XG8A 4JI1F 3IXQA 3R9LA 3L7OA 5LJ3Y 2XEXA 5FLXY 1GXUA 2RU3A 4OV6A 2HRUA 1TAUA 1SB6A 2QLBB 1QAIA 2XNQA 5K5MA 2DH8A 1TKZB 2VH7A 4DDFA 5B0CA 5F9NA 1CQMA 1VQ8S 1EIYB 1KD1T 4IRCA 4URSA 1FVSA 1FNXH 3SQOP 2F65A 1EHWA 4S0MA 3F0NA 4ZVQB 5FIIA 2NZ4A 4R8UA 4PZVA 2YBVA 3QFHA 3GIKA 4J9OA 2HHUA 1S6QB 2MGZA 4K4ZA 1HMVA 4ANDA 2UUAJ 3EPGA 4Q2LA 2IHR1 4CLYA 2WBMA 1QDUB 1XR5A 1Z4UA 4FVCA 4CO1A 2IRYA 4ZJQA 2CNOB 2GS8A 5L8RC 4DFKA 3ZFVA 2LU1A 4DQRA 3AJ2A 2AJFE 3D3BJ 1FCAA 1KQGB 2W7AA 3JAMY 3D68A 1VIOA 4HH0A 1RSCA 3CXCR 4X66J 2CZ4A 3US5A 2FZKB 2PMWA 5GMDA 1FRXA 2BQRA 1VQLS 1MG7A 5B0AA 1X4DA 2J76E 1RK8A 3MOZA 1KHVA 4DL4A 3D67A 2GQ2A 3DRXA 4LRCA 1VGYA 2HZCA 3PRBA 2BVZA 3I55S 3MM5A 2HWTA 1S9EA 2E5HA 1X4FA 2XY6A 3G6YA 2HGNA 1FTRA 2BM1A 2QEXS 3M8SA 1KTVA 3ILOA 4ZIWA 1SJFA 3RAQA 1F9FA 3QZ8A 2R8IA 2LYVA 4ZP9A 1O6XA 2XWXA 1U2RA 1GMVA 2IA0A 3W2WB 5GAHU 2ZJRQ 1WACA 2BOAA 2NYIA 4QCLA 1CJUA 2WB1D 2JJ4D 2NXUA 4Z7YA 1N32F 2AZ1A 1JLGB 4YY3F 4JI7J 4WTYA 4M94A 4EYHB 1P9QC 3MEGA 1V5VA 5J2MB 1RHUB 3IS9A 5JMNA 1T03B 5KFDA 5HVFA 2JEJA 2C2KB 2GW8A 3ENQA 2XS5A 2WOMB 1JWWA 4KHMA 4UQGA 2Z2MA 1SIWB 1S1XB 3PJWA 3L3CA 3ISNC 4ZJOA 1VQ6S 1HFEL 4JI3F 3DI6B 3K5MA 2PMHA 3C16B 2J8AA 1FHTA 2W25A 2AYMA 2ZZNA 2E7VA 4A8KA 4WP9A 4EK2A 1ZA1B 3M30A 5GVQA 4Y0FA 4WF9Q 2QO3A 4NLOA 1B7YB 1URNA 4V19J 2V8VA 3MEEA 2KRRA 4DX6A 2VC1A 2XLJA 4A47A 2MZ1A 2HVIA 3CD7A 4LRFA 3DN9A 4YS2A 4UOHA 2EFVA 3C19A 1BD6A 4ILMA 1WG5A 2YTCA 3UDVA 2O1PA 4F67A 1N5QA 2Y8YA 1HNVB 4CM0A 1DURA 3VAMA 2OEKA 1L3UA 3MPYA 4ELTA 2YQ3A 1RT1B 3KHGA 3RAXA 2CQCA 4ZVOB 3OVSA 2BW7A 2VHGA 5HROA 1NJWA 1J5EF 3C15B 1TUWA 2AGOA 4H4KA 3BQ2A 4DV0F 2CPJA 2AJQA 5HMXA 1VOMA 4ZHRA 3W9IA 3TZXA 2L48A 1HBNA 2CPXA 4C4WA 3NWGA 3M8PA 4DOZA 1P1TA 2CADA 3MD3A 4NX9A 4R25A 2FHJD 1XR7A 3FBBA 4OYBA 1S1VA 2VIHA 4C11A 3VAIA 2MYFA 1N0VC 2DHSA 3NCPA 4NXNJ 4LSNA 1TK8A 5LT5A 4FKXA 2OLWA 1FE0A 2R2UA 2K7JA 3M2RA 3BO3A 3Q86A 2AJ1A 3AY0A 3W2VB 4NLRA 5IC6B 3FJ2A 3TUIC 4P72A 2Z58B 1FDAA 3QGIA 4Q44A 4UY85 5HAOA 2BACA 2GVDB 1YZ7A 2EW9A 2YKQA 1S0MA 2LU2A 3V5RA 2FGOA 1GEHA 2F9JA 5AE1A 4ELUA 1LK5A 2O67A 3N4WA 4ZPDA 1VRUB 4PWUA 4KSEB 1TL5A 4QIVA 3FNNA 5AXKA 2HK3A 2VJVA 3OXLA 1J5EJ 2UV8G 4QU6A 1TL1B 4QJVA 4CT9A 1X4BA 1ZBTA 5KFTA 3RBEA 3CJQA 4ECXA 3N0VA 1Q16B 4C3LA 1Y3KA 1R31A 1G4CA 2F1FA 2CJXB 1I1GA 3HHDA 3T3FA 3Q8UA 4KY3A 1R0CB 4NI2A 2GMHA 2LEAA 4J9PA 3K2YA 2AGPA 1DRZA 4B9VA 1SXLA 2DT9A 2XCAA 1MWZA 2PD1A 4J7CA 4R5PA 2DKOB 2DNNA 1UA1A 2B3TB 3FDSA 3OVBA 3WC2A 3IMQJ 1HIYA 2CQ3A 3IAM9 4JI6F 5A8KB 5A2QY 2PO4A 5C7PA 3RB0A 1SI9A 3CC4S 1T11A 1U1NA 2H65B 3NNHA 2GIFA 4NLSA 1J2VA 1X5PA 5GADU 2VUGA 3EXYA 2JEGA 5BYQA 1XNQF 4OMFG 4USJC 2KKHA 4IG0B 4JYAF 3MHYA 4ETXA 3RUBL 1FDBA 2MB0B 2KT3A 1OY8A 2KXNB 1IWGA 3HHKA 2RJZA 3MUVP 2LECA 3OL8A 2V69A 1IR2A 1CJVA 2R3VA 2ZFHA 1HHTP 4WK1A 2Z0GA 1YJRA 1X9WA 1EB0A 2HGMA 3OTBA 1NHUA 5EHHA 1PGZA 4USMA 2CVIA 2E1CA 3KG4A 4YOEA 4O3NA 4U67Q 1SJRA 3DXSX 4MJKA 3RAMA 1V6HA 3LP2B 3B8HA 4MYUA 2E5LF 2E1AA 3VALA 5KG5A 3BBFA 3QGGA 1GFWB 2R2TA 4USTA 4OI1A 1S12A 1FI4A 4HTIA 3I5BA 1HBOB 3SCIE 1RA6A 2GJ2A 2CZVC 2NSCA 2Z2YB 3QT7A 4CO5A 4WK3A 3WBZA 2DK2A 2RAQA 1S6QA 2YH1A 2OD4A 3IR6B 2C3PA 3OSNA 1WNEA 4JI8F 4KB7A 3RRKA 3GG1A 2PA3A 2ZVIA 4USIA 3J81Y 1L3VA 5AE3A 1RT4B 2C42A 2FLPA 4C7QA 4WU2A 4CO3A 1JB0C 1SIZA 5LMUF 1EX8A 3DXBA 1VC5A 3CJTA 2NPFA 5CAAA 2DR9A 1P6TA 2ASDA 4GVLA 2OFGX 2F8HA 5JVGQ 1Q8KA 4AYBD 4IOCQ 2Y1IA 4P7VA 3MM9A 1KQFB 2RDJA 2K1RB 3TAQA 1KVIA 4LBHA 1FEEA 1VISA 2VG6B 4ED3A 3R1LA 2GV1A 2J7WA 5KG6A 2HHQA 4GKJF 2LQBA 3BREA 2ZITA 3BQ1A 2IC3A 3VZHA 5JUMA 4ILRA 1NSPA 1OSDA 1S72S 4X65F 3NGRA 3CSKA 4KH0B 2WSCC 2BKPA 2VC0A 4F50A 4B3RJ 1H0HB 3MM6A 4WFZA 4I6WA 3A3NB 1TTHB 1RU1A 3NXZA 1Q79A 4PQAA 1VK8A 5HP1B 3W2WA 1R8PA 5AXNA 2FB0A 1KRPA 2HFVA 4BWJA 5T7LA 3C6TA 3NBPB 1JLGA 1UKUA 4OL8A 4IG3A 3BGUA 1V3SA 4LBPA 2QSWA 1VC6A 2HFZA 4CH0S 3D7SB 3QT5A 4ZLNA 1RAAB 2EFQA 4B3SJ 1HHSA 4WU3A 3DRRA 3TA1A 1HI1A 2ERRA 2DO4A 1D9FA 1U6BA 2UUWA 1K47A 1C1BA 2FLOA 2DIUA 1S1XA 3NMAA 3X1LB 3AOCA 3QAUA 1R8AA 1HD1A 2MLXA 2VFRA 2R8GA 1JJ2R 3DI6A 3C16A 2J9CA 3H5XA 2OPSA 3CT9A 3Q2TC 3A12A 1YRTA 2ZBQA 5DQGA 4DHVA 2BJ8A 4DV5J 5J1NA 4OZ3A 2CPZA 3HKZD 3VTIA 5KG0A 2Q43A 2IVFB 2FDNA 4HLBA 4LF2A 2CQ2A 5GAGU 2YPYA 1OQ6A 2QJ3A 2F4FA 2XMVA 4ZMMA 1CQNA 4TVAB 1SKSA 3ZTQA 2W9AA 2LFVA 4KYZA 3RTVA 2W8KA 2FHOB 1BQXA 1KVKA 3HVWA 1HNVA 4OJ1A 2OPRA 2FTRA 2HSEB 4DEZA 2MQNA 4DR4F 2LVWA 4OZ0A 1EETA 2AYGA 4UZBA 3BR8A 3PVXA 2G9OA 2OUGA 1L3SA 3EZ5A 5LL6d 2RILA 2OPQA 1YJTA 1PC4A 2BBEA 1HWKA 1SC6A 5B0DA 1R43A 4NZ0A 3RJMB 3G2XA 4M5MA 1MW7A 2VONA 3VAGA 4TU7A 5B0BA 4RNOA 1NSAA 1MMDA 3AD9C 3AT1B 2XSJB 3ITHA 4K5RA 1Q82T 3FQKA 4OX9F 4ZK7M 2W01A 2PC6A 1SUQB 1WI6A 3EZOA 3MEDB 1LWCA 1UFWA 1ZM2A 3OL7A 4EZ6A 2YWKA 1VYAA 1NK5A 2BX6A 3RB4A 1P9YA 2PEBA 1NSQA 1TMJA 4HACB 1NAQA 5CABA 1M1GA 2L3MA 1SKUB 2ZKTA 1TQLA 1RYRA 3B4DA 4CO4A 3LP1B 3Q0AA 1O51A 1BQMB 2DNGA 4A8XA 1D09B 1SBRA 1WSVA 1IJEB 3MDFA 2P6SA 5C25A 2J9DE 1TVRB 2XO6A 4B9SA 4X4PA 4MAKA 4DXLA 2AJ4A 5D3GB 4DV1F 4JP8A 3M6UA 5IC4B 2JLGA 1CC7A 1AZSA 1SL0A 1U1QA 2QYGA 5BR8F 4Q0BB 1Q5YA 4EBDA 3AOBA 1ROFA 3P96A 4KO0B 2MHNA 1IQTA 4LF9F 3SYZA 5F41A 1UJ6A 1I5OB 3EE3A 4K59A 1T9YA 4FBUA 4Z7CA 1X9MA 3BKTA 3CJSA 3SCLE 3JB9k 3MAQA 4GC7A 4FYDA 1O0PA 3H42A 4LR8A 4WFAQ 4B3OB 4DU8A 2XMKA 2LCWA 1B0TA 1UVMA 1GK8A 3AA9A 3B54A 2KYXA 3MWBA 3U27A 3MECB 2HS4A 1XMOF 1QLNA 3OLAA 2HNZB 1WWHA 4BWMA 4C3KA 1S49A 1N54B 3RB6A 1YKWA 2MKCA 2M0GB 1CSJA 3P5BP 3OJUA 4AQYF 1WKJA 4LSLB 1H2VZ 4O23A 4I64A 2YH0A 3L95X 3UDEA 4A8YA 1GNKA 1ZPVA 5ETQA 1GMWA 2IY5B 2D3ZA 5LOQA 2F8MA 4FZVA 3KK1B 3C2PA 5D4LA 3UDLA 4L3NA 1U6ZA 3M9MB 3QMQA 1X0FA 4ZJLA 1RTJA 2R7XA 4YB5A 1U48A 3BQ0A 1ZYQA 4D3HA 4U7UK 3C46A 1X4CA 4IFVB 3UNYA 4QBUA 2ZUAA 1JQGA 4YB6A 1LXNA 4NLPA 1FWKA 5LJ5Y 2HVZA 3TWZA 1G3OA 2ROPA 4PAAA 2XYHB 4KFBB 2IJFA 4KRWA 1HWJA 3M32B 3KYLA 4C3MA 2LA6A 3DM2A 4I67A 1A0OB 4QIFA 2VQFF 2HQ3A 4IDKB 3MCNA 2D9PA 2M52A 1V3ZA 2M3DA 2FD2A 1P27B 1U45A 5E5NA 1BWEA 4ED6A 1TAQA 3TZYA 3DHWC 5CXTA 3PEJA 5J2PA 5BYSA 2KO1A 1HQEB 2I38A 5L1IA 3S7RA 1RAGB 2KZZA 4XK8C 3C3LA 3T9ZA 2EPIA 3LTOA 3AJ1A 4RW9A 4WBFA 3D54A 3V81B 4M5NA 4K4XA 3R5JB 1HPZA 1RWXB 4PYAA 3L7UA 4ZITA 4F4WA 1JLBA 2RVJA 1HI8A 2CWKA 1NKCA 2OEMA 4MTPA 4P7TA 2M5YA 3U7JA 4CTAA 4HDHA 1JXLA 1BHNA 1IBMF 4DR6F 1F0XA 1V3RA 1JJ4A 1DLOA 4OX6A 3CDWA 4CLWA 2ROEA 2K1RA 3SCKE 1RYSA 5A8WB 4ATNA 1N5TA 1AYEA 4DL5A 1FRHA 5HJXA 3TR5A 4M5GA 4DR1F 5SZTA 1W7WA 2MPUA 5K20B 5DS7A 3TAMB 4KGVB 2KXHA 3GTYX 4EZ9A 4M5KA 3KG1A 4UUWA 2VQFJ 1WC1A 1RP5A 1Q53A 3KNAA 1FE4A 3VV2B 3MZIA 2JC0A 1C4AA 2DHXA 4EO8A 3NBPA 2HQGA 3W61A 5KOWA 5JVHQ 3CCWA 3LGHA 1T3NA 2RT3A 3CDEA 2BW2A 3PO4A 2ZVSA 3DGVA 2MLZA 2ZBPA 4ECRA 3AQOA 3HPOA 3RGIA 2GQQA 3GIIA 3ICLA 2JFKA 2DNOA 2W9CB 1N52B 4DR6J 2M70A 1I94F 2HFSA 3BZQA 3A3PB 3PNIA 1X4AA 3MURP 1HBMA 2XWYA 3DMJA 3EMTA 2B4OA 3P45B 1FJCA 5F0UA 2OKQA 2VB6A 3FZBA 3M6WA 4I68A 3VGTA 3OLBA 3L4BC 2DXFA 2R4FA 1FVQA 1IVZA 2EBEA 2GO8A 4J9RA 4RBVA 2MSSA 3JSMA 1N34F 1PYOB 2FGCA 4FPIA 2WONA 3T5JA 3ZZYA 2VOOA 1PO6A 4X4NA 2KI2A 3HZGA 2W8LA 4ID8A 1FTCA 4CLFA 4X64F 4ZCLA 3VQSA 3H5SA 4NZ6A 1NKEA 2GCFA 5F9LA 2VQEF 3U1NA 4QWEA 3M8RA 4L73A 3LPYA 3T1YF 3GJSB 4XPCA 2HHSA 1WSRA 4GO5X 5KFHA 3HHLB 3IGNA 4K0KF 4EEYA 5HANA 3IN5A 4F04B 2YX7A 3Q8VA 1UWAA 1HNZJ 3AA8A 3QT8A 3TVYA 2OTLS 2QA4S 2XGQA 5FD1A 3BSCA 4YFUA 2BANB 3BSOA 3FFIB 3N5FA 3MEDA 3M9NB 6FD1A 5HATA 4QWAA 3R6LB 2QGFB 2ZOGA 3VZIA 1N5VA 4G6VB 5D78A 4B02A 4DV2J 2O66A 4HACA 2R7SA 4I6YA 1RJJA 2CAJA 4JI0F 4K4VA 1WOSA 2AX1A 4RBTA 1BQMA 4LT6A 4H4KC 2Z8QA 1TVRA 3K8VA 1G6BA 4NCGB 2BMBA 4HT5A 2C2EA 3M2UA 5A0YB 3IG1A 3H40A 4QR2A 3CB4A 4X64J 2B7CB 4KT0C 3CIMA 2VOPA 5E7OB 1QAJA 4ILLA 4Q0BA 1JLFA 5FJ4A 1B4SA 1FRIA 3UN2A 2XTJP 2LQ9A 2CJ9A 3BYPA 4OZJA 2OMLA 3JSYA 5HQMA 2KH9A 4X4UA 2Z2LA 3UFCX 3P3DA 1B3TA 4WE1B 5IOLA 2D9OA 4DR7F 2V8DA 2J6UA 1NCLA 3TJ9A 4CNZA 2CQGA 1OO0B 4UUXA 3BGRA 3W65A 2VFTA 4ZPVR 2LLZA 2HWHA 1AFJA 4NMLA 3TANA 2FLLA 4BDPA 1KOOA 2FLNA 4A46A 4B3OA 1HR0F 3CCMS 3R8YA 1KFSA 2QIFA 2WRMA 5E3QA 1S97A 5KFPA 3CJKB 1VQ4S 3F44A 5HBMA 1SJ3P 1HD0A 4UTGA 1OY6A 3PDNA 2AV5A 1KLMA 3LF0A 4LMZA 5HMWA 2BRLA 3HHEA 3WIVA 2NSBA 1RAJA 2VFUA 1KS2A 1YI2S 2YKAA 1GX6A 3MCSA 2B7BB 4DUZF 1OWXA 1S9GB 1T8EA 4Q8FA 3CCZA 4QYRA 3DLHA 3Q8RB 4LSLA 3DDNA 4LRAA 3FSYA 4JBCA 1KNZA 1RTDA 3DOMA 3HD1A 1RGVA 4PYDA 4F4KA 3UPFA 3JXOA 2YKNA 3ENWA 3KK1A 2LKZA 1UEKA 2C2OB 4M5JA 3CVKA 1YBTA 7AT1B 5M2UA 2A6MA 1LXJA 1YJ7A 4BLGA 1SVDA 2R8HA 4WCEQ 3SSRA 3OUYA 2J7UA 2KHDA 4DR7J 1VBZA 2DNQA 3O1LA 3M2VA 2HURA 5KG3A 2EG1A 4Y00A 3E01B 3JS9A 4KFBA 1GMWD 3QRPA 1HR0J 4JI5J 5D6GA 5I42B 3M32A 5J2NA 1VBKA 4ZPBA 2H54B 5DZ6A 3BDEA 2V2VA 3NL0A 4IDKA 4E98A 2N3OA 3RRHA 3W5ZA 3TVKA 3GILA 2WVFA 3HFVA 4B9TA 2OJ3A 3K58A 1SKWA 1WJ9A 4ANEA 4E8UA 4CLZA 1R89A 3FMBA 1X4HA 2ZM6J 2MQLA 2HBYB 4ECVA 3RBZA 4KQZA 1D8YA 1DTTB 1WORA 4OYIA 2F7VA 1DQAA 4CYUA 1T9TA 2B6AB 4TLRA 3SDEB 3MMJA 1NJXA 4ED2A 1S7HA 1RABB 2HPUA 3S1TA 4IRKA 4DMZA 3MPWA 2L08A 4KHPJ 4ZLJA 2HWIA 2FJAB 1U2FA 4TYBA 3NGSA 1JK9B 1YDLA 4FS2A 3HO1A 4ED0A 1M1KT 3LAMA 2H51B 5KFLA 1VQNS 3V6JA 3DOKB 2MZSA 1QSYA 3GYGA 2WBRA 3MM7B 2B4VA 3R2CJ 3SFGA 2BE2A 4TY8A 3MAAA 2B51A 4K2XA 5F8JA 1FERA 4NLTA 3QSYB 5I3QA 4O3OA 2L9NA 4KGZB 3VAFA 3DRSB 3LUYA 2POKA 2RQCA 3KNGA 3GR0A 2PGCA 2QYCA 4I4BA 4OQJA 3DLGB 3BBCA 1SH2A 3KHHA 2VPXB 2ABYA 4FXVA 1Q81T 1HNWJ 3NNCA 3HSGA 4P74A 3T6BA 2MZTA 5C24B 1RCXB 2UUCJ 1BXNA 1M5KC 3POTB 3UI3A 4B3TJ 4PQUB 3NGKA 2RHSB 2V8GA 4LVNP 1YBAA 2PI4A 4M95A 4RW7B 2VPWB 3H2VE 1FESA 4B08A 3TW0A 4C48A 2CPHA 2DIVA 3EGZA 2XY7A 5IT9Y 2OI2A 2LMIA 4B3MJ 3CW2C 3K59A 3EVOA 2W9CA 5KFSA 4GVBB 1YSJA 4DR2F 1MROB 4IH5A 1FK9A 4ID5B 3RU0A 3IR5B 2DH9A 2ZH8A 2R2SA 4X4SA 1S77D 2IRXA 2W2PP 4M5IA 4P2XA 1VR6A 2I9SA 1M5VC 3A8JA 1FXRA 1HNXF 5A8RB 2CPEA 2IMOA 2CNLB 2VBXA 1PBUA 4G1QA 3GE9A 3MXHP 2P9CA 1XMQJ 1J27A 4LF8F 1PJ7A 3R6GB 3WHIA 3I6PA 3PCOB 1NDPA 4QWCA 4DV4J 1WEYA 1BC6A 4K2JA 3PEHA 4TU9A 2DR7A 2Q6BA 5J1PA 3KLFA 1NPPA 1YRXA 2P9EA 2NYHA 3CMAS 2XHWA 1FJGF 3D28A 1GXLA 1CG2A 2Y1RI 1JLEB 5G4DA 1BGXT 1QTMA 2BA9A 4DPTA 1H72C 1K1QA 4O3PA 5KT4A 1Q7YT 3KHLA 1S10A 2D7SA 5EWEA 1OYDA 4NLXA 4O44B 3LO3A 2F63A 1XWLA 4PEOA 3IWNC 3MM8A 2N4DA 4DFJA 2JRSA 3H2LA 3Q2SC 1YX2A 1RA7A 4UZCA 3P6YC 4EFAC 2BANA 2D3OR 3FFIA 2NXJA 2YQ1A 3NS5A 4DQPA 2EKYA 3JTNA 1D0EA 2HS3A 2ADBA 1VQ7S 4ZPCA 4DPYA 1S1UA 1WOOA 2IRUA 2CA9A 2XY5A 3BH6B 5A6WA 2AF6A 2RB7A 3DU5A 4YMEA 2WK4A 3N01A 2FJDB 2HVDA 1FT8A 3B78A 1VJWA 2BE7D 3BYRA 2XMTA 1LW0B 5IS2A 1KWMA 5A2QU 2MGZB 2Z30B 2U1AA 1HMVB 2MSTA 4OLOA 2RH3A 4KKOA 3OSPA 5KFEA 4DR3J 4NCGA 1WHWA 4WKYA 2CZ9A 2AMCB 1YVFA 5J1EA 3CJ0A 3D2WA 2F4VF 4KIAA 5A0YA 4LF8J 3JTOA 3BPDA 1Q1KA 1HA1A 3CD0A 2EFOA 3EZUA 4LIRA 2VKZG 1AFIA 4A8FA 2PMZD 4DL6A 3RW7A 3NCQA 4PR6A 4RUCA 4WE1A 4HEA9 2PN6A 4OYXA 2FVPA 1FXLA 2J8SA 4ZN1A 3PYDA 2XGPA 2IPOB 2Y1JA 4ZVRB 1K73T 1V9OA 2CPYA 3WC0A 5HQLA 3DGPA 1RACB 4PWWA 1JMTA 3MM5B 3MCOA 2KFNA 1S9EB 1BY9A 1N4LA 2DGSA 3CJKA 1MN9A 3ENAA 4RWXA 4ZKAA 2GHVC 2FJBB 4K4SA 4LRBA 3GYNA 1NK6A 2FZGB 2HHHF 5EWGA 4KHRA 4P2FA 3UD5A 3SFUA 1H2UX 5HVGA 2D74B 5J2QA 3U02A 2MKSA 4IH7A 3K57A 3E51A 4I2QB 1QSLA 4DSFA 3T1HJ 1XQIA 1UETA 4KTQA 1K8AT 2HZAA 4ZN3A 1CJUB 1S9GA 5D15A 5DG9A 2ZBCA 5ETRA 3KJFB 1KQKA 3Q8YA 2GO9A 4JI2F 2QT7A 5GAEI 2UU9F 3IS9B 3AXKA 4AFFA 4BC9A 2YX4A 3TP2A 2MJNA 3GONA 2UXCF 2IBKA 5D4PA 4YR0A 4LF7F 2BXJA 1BUXA 4OI3A 5E3RA 4CZCA 1D1UA 3W63A 2R7RA 4FVMA 3LGMA 1VDHA 1IXKA 2C2NA 3WIUA 4USVA 3NCRA 3PKMA 2H1YA 4K4WA 1FFSB 2GIRA 2J9DA 2LEPA 4FF3A 2X1FA 1PJ5A 3E01A 5IQ6A 3T5HA 4MK8A 1HQUA 3O3LA 3MEEB 3FCHA 4HHHA 5I42A 2HHWA 3FUYA 4O4RA 3MR6A 4ED7A 5C5JA 4K4UA 2P5VA 4LREA 2D69A 4PXEA 5DM6Q 4OI2A 3IBCB 2ZE2A 2HNYA 3TJ8A 3UWTA 1Z1ZA 1VQMS 3MMAA 1YK9A 4ZCIA 3Q8QB 5HROB 4LJMA 2RRAA 5ETMA 5L46A 4DS5A 2JFDA 2CRLA 3RYLA 2L9DA 4F02A 4MIAA 1IM4A 2B6AA 2BM0A 3SDEA 4LFCJ 4RKUC 2V68A 1VI7A 4PG6A 3MTKA 2RQ4A 3M8PB 3WZ0A 4LFAF 4Y28C 2DGXA 2C28A 2BR0A 5EWFA 3BN7A 1S1VB 4LF4J 3TARA 5CH7B 1MU2B 3M8QA 2RRBA 4C11B 2FJXA 1N33F 4UW2A 4EBEA 1RBOB 4LF6J 1FRMA 3UW1A 1QUPA 2UVRA 2KL8A 3D1QA 3HULA 1HYSA 1FD2A 1M5PC 5LSLA 3AXMA 1VCTA 3R5DA 2HHXA 4DX8H 1HKAA 1FKPA 4I69A 4CO0A 3CDUA 3MM7A 5KFMA 4DCPB 4J9SA 2XLKA 1PYTA 2YVSA 4LSZB 2HVEA 6AT1B 4NPOA 1RBLA 2KB2A 4J91A 2ZBIA 4KJIA 2LQJA 1GTEA 3NMRA 1REVB 3P49B 1NRKA 1Q8BA 3CCTA 1M90T 4IKAA 1FEHA 2IAJB 1R8HA 3DRSA 2YNHA 1U26A 1NJZA 1U49A 3HF5A 4NLYA 2P9GA 2OPPB 5I3UA 3DLGA 3U1LA 4C8LA 2J0QD 2YNGB 2GAHC 1MMLA 2N4CA 2Y3YA 5C24A 3I32A 4OX7A 3OHBA 4O3RA 4WXWA 5KFQA 3M05A 2LP4A 4YHHJ 1TUGB 4RW7A 1C2PA 4YUDA 5LXYA 1KTQA 2RRNA 1QY7A 3SCJE 4GVBA 4BBYA 4R5PB 4DV7J 3PTWA 3CJ2A 1IKWA 4C9DA 3V4IB 3NS7B 5CYQB 1N0UA 4FXWA 2ZZMA 2V94A 3WX8A 3GJQB 3TEHB 2Y9HA 1VQSA 2JSXA 2AIRB 1HHQA 2UXBJ 1SCJB 1B99A 2UUAF 3ELHA 1R0AB 3CJ8A 2KT2A 5KFFA 4DL2A 3T5KA 3HX9A 2ZJPQ 3A3OB 2GHWA 2YKMA 2BUNA 2GJFA 5B0FA 2Z4PA 1IKXA 1TUVA 1X60A 3GSDA 3DYAA 1YWXA 1X9SA 4F4AA 5KFNA 2ZH7A 2JLEA 4ZPWR 2MJUA 2BV3A 3R27A 3G6VA 4FPRA 4C0BA 4DV6J 5IXUA 2QN6B 4X66F 1RT3A 3I0RB 5JXSA 1FDDA 1HW9A 3ZZUA 3BSNA 3K89A 1CJVB 4ZLLA 1AA1B 3CIZA 1GX5A 1XC9A 5IWAJ 1LOUA 1TP7A 3LWMA 3ZZRA 1EQMA 2XZWA 2V4JA 3V2UC 4KPCA 3S01A 4Q45A 2B9EA 3RBXA 2PT0A 2B5JB 2CXEA 4M5HA 4CT8A 3OR1B 4FXDA 5JJBA 5K8PA 2MMYA 1N56A 5G0RA 1CULA 2ZH2A 3OFFA 4DSLA 1FO1A 2YWFA 2W4CA 2DGOA 2BEFA 4O3SA 5AJ3J 3IRWP 1Y5LB 3BGOP 1JLCA 2CJYB 3HSZA 5C42B 2EXUA 4MH8A 1LW0A 1FD8A 2HLTA 4YEAA 3MFIA 3TNVA 3BBBA 1GH8A 5M2RA 1NJYA 2ACMA 3FEZA 4JI7F 2VICA 5LSOA 4DJBA 3OXFA 2RE1A 2R7UA 3ADAC 3GQCA 3CUNA 2W2MP 1R3NA 4CP5A 4AL6A 5D8HB 3M4XA 1JXEA 3KDOA 2IYGA 5RUBA 3KLGA 2DO0A 2BJEA 4NLDA 1NKBA 2C3OA 3WX4A 5HLFA 1RWMB 1IBLJ 2XC9A 3MM9B 2RQMA 2V2ZA 1D8ZA 2AEFA 2YKOA 4J9LA 3SQGB 2HQCA 3G4SS 4MKBA 4F0HA 1NPKA 3PO5A 3LQVA 2HZVA 3H59A 4X62J 2CPIA 4HTJA 1H7WA 2IC3B 2LEBA 1RADB 4ZOSA 4PG4A 2DHAA 5C2GA 2CWXA 3MPUB 3N79A 2CNNB 2MTLA 1TV6A 1G2EA 3MM6B 3SSQA 3D66A 3VR1A 3MMCB 3N6LA 4I2QA 2DITA 2XZTB 4N56A 5T7LB 2K3IA 4I6AA 3JQKA 1UEUA 3C6TB 3PY8A 4OZ5A 3TAPA 4EBCA 1WEZA 4H54A 2HRTA 3PW4A 4IG3B 4RWWA 2G13A 1Q0NA 2EI5A 2OAUA 2RKIA 2MQQA 2A6OA 3OT9A 4USKA 2R9LA 2MLYA 4IUFA 1X8DA 2Z2ZA 5DRKA 3AODA 2EC2A 3DRRB 4YDXA 4Y34A 1K1SA 1UZDA 2DNYA 1C1BB 3VVTA 4ZLPA 4NXNF 3R5BA 3NAIA 2LQ8A 1YGYA 3EDQB 2RS2A 1X5SA 1SC3B 2OPSB 1T9XA 3CJ5A 4CQ1A 5EDWA 5I3PA 3NRBA 4ED5A 2E44A 3HSDA 2ZEJA 1U6FA 4EO6A 3M6XA 4Y2IA 4LFBF 3JYTA 2XBPA 1AW0A 2GA7A 2ADCA 5LM7E 3SIPB 2E66A 1K0TA 4C8KA 4DFMA 4P2SA 3OFGA 3MF5A 3VHQA 4OHWA 1E6VA 4A8OA 4OHZA 2OPRB 3PHEA 2HNDB 2E9TA 4ZP6A 1WF2A 2H5JB 3UD3P 2E1PA 1EETB 2A18A 3TQ1A 3PACA 2RIJA 3CCJS 1EJ7L 2H4WB 2MKJA 3CO9A 3W9JA 1WC3A 2OPQB 4DF4A 2I5JB 3QLHA 3H90A 1Q95G 2DNLA 2Q79A 3FGVA 4M5LA 4P52A 1IJFB 2DNZA 2XSFA 3GJRB 3VCDA 1FRKA 4FKYA 3ITHB 3S6EA 3M8WA 1IKVB 1MU2A 1VMBA 2E9ZA 2IVYA 2YX1A 3LWLA 4K4YA 1VLOA 1LWCB 3PJXA 1VLYA 2F5GA 5KFOA 1UVKA 4NZ7A 2XB2D 1JLQB 3LW5C 1S1WB 2OO4A 4B9LA 1VHFA 2HFOA 2FUG9 1HI0P 3GSIA 1Y0HA 2HAIA 4MYTA 4YN3B 3UR3C 2MQPA 2UXDJ 1FWLA 4NASA 2KT5A 4JUZA 2P2CB 4LFBJ 2CQDA 4C8OA 4RLEA 5C25B 1IBKJ 1REVA 4ZVGA 1ZAVA 2XMWA 1RAFB 3BH7B 1ZZFA 3GV7B 2JH3A 4RW6A 3ZZ0A 2H5IB 2KFZA 4A48A 4OIXA 2IAJA 2WVCA 2K7KA 1AZSB 1S4EA 2DEIA 3O5TB 3DDIA 4N8NA 1BQNB 2RHQB 3PR5B 2OPPA 4TKTA 4NLVA 2OEJA 5LXRA 3MUMP 2YNGA 2W4PA 1TFYA 4NOHA 5K8OA 2O01C 2HQFA 1CBKA 1EQ0A 3THVA 4QW8A 3KLHB 1IKYA 3W62A 2PI5A 5E3CA 5DDPC 1RAHB 3L9ZA 1ELOA 4YR2A 4P9SA 1OJ4A 4GKKJ 3MR5A 8RUCA 4ED4A 3D9BA 4H4OB 1UPMB 1MN7A 2UUBJ 2F40A 2B43A 3V4IA 5CYQA 2XI3A 5HI7A 5GAHI 3RB3A 2XZDB 3KUEA 3QO9A 3D3CJ 4RUBA 2A1BA 3KK2A 2W24A 4TQRA 1IR0A 1R0AA 5KTQA 4G3IA 2FVRA 2COLA 1RWPB 1RLDA 1WHVA 2DRAA 5KAKA 4WFXA 3IRXA 4C6AA 2LDIA 3TJAA 3PHTA 5DQIA 4WFNQ 1Y11A 4QPTA 1RHQB 3GIJA 1T94A 5E41A 3IR7B 3I0RA 3IA0A 3ISZA 1PJ6A 3TZWA 3C8YA 3TO8A 4EUVA 4J9KA 5L1JA 3N28A 1RTJB 1D9DA 1U1LA 3RRGA 2ZBRA 1M5OC 1RTIB 2JVOA 1A6LA 1LV5A 3PW2A 1FKOA 2C2MB 1XNRJ 1NK8A 4DU7A 2VD3A 1FX4A 2EFNA 2E7WA 5B0GA 3KJNB 2B5JA 3OTEA 3H4DA 2A10A 2HBQB 5KFXA 2UP1A 1VQ9S 2QV6A 3OR1A 3W1YC 4YB1P 5ITHA 3M8ZA 3MAHA 1FJEB 3DM2B 1QD1A 3DOLA 1U2CA 1NDCA 5CQGA 4B3RF 4ES2A 1QVFR 3QZ7A 3GJTB 4FNIA 3HJVA 3IGVA 1HL6A 1SC1B 2RD5C 3D6TB 1D3WA 5C42A 4H4MA 5J2PB 4QIEA 4O0NA 1QVGR 4QW9A 2B56A 1RT5B 4ZVPB 4NCBA 3C14B 4MKYA 3K8WA 2W9BA 3V6DA 2AYEA 4QR0A 1QJHA 3OVAA 4RW9B 1K9MT 3HZEA 3AD8C 1S6PB 5DG7A 3ILJA 2MKKA 1S0OA 4F7VA 1SV5B 4OYOA 1HPZB 3AB2B 3HHNB 3K5NA 5CHCB 1QM9A 3DFEA 2ACYA 4ERDA 1JLBB 1NLKL 3LPEA 4B3SF 3H0PA 3HFKA 4PWDB 3M6VA 3EGVA 3BPSP 4GC6A 5E33A 4LR9A 4CI0B 1OMSA 4AXJA 4CTAB 4M5DA 3EDRB 1WC4A 2F8EX 2HFUA 5F8GA 3MTJA 2ZH9A 1UVNA 1DLOB 3J7AN 3AHPA 2QLFB 1EAYC 5DDRC 3FKBA 4DV5F 2QTWA 1NK4A 3IO1A 1FRJA 4W4MA 3DKDA 1UP1A 4WZQA 2R7TA 1WDTA 3SQGA 4FDFA 4ZCKA 4N47A 3CCLS 2DGUA 4LF5J 4ZVHA 5KOXA 1KQSR 5KFJA 4DSIA 2HIYA 3VAJA 2VV5A 4J9MA 3N6NA 3UE2A 4NA1A 3EXCX 1IN0A 1HBUB 2E5GA 4ZS6A 2ZOMA 2BRKA 3F56A 3ZZOA 1YJVA 3RZAA 3H98A 4RW8B 1DAXA 3FRYA 5H9FJ 2CUYA 3MMCA 5CD4A 3DRPA 4LQ9A 3D5MA 2HS0A 2M8HA 2XI2A 4IOAQ 2MY8A 3O8WA 3ZXWA 3W8GA 2KTQA 3TOQA 2IBOA 1UVJA 2HMIA 1URRA 2JEIA 3KLEB 2EFPA 2G1HA 2ZKUA 2NUUG 1VK3A 2JOQA 4PCQA 4U8YA 1SQEA 2MY7A 4NLQA 2GNKA 1C0TA 1AXQA 5CYMA 3SV3A 1SJ4P 4DZ6A 2ZHBA 1SC4B 2AX0A 3IM9A 4U95A 1N36F 1HLWA 1VQKS 1HBMB 3DMJB 1UVLA 3K17A 3M1VA 3A8EA 1NJIT 3VVUA 4UOGA 4P2MA 1NH8A 2KRBA 5AE2A 1UWBA 3J80U 2CQ1A 3KOAA 1WG4A 3PXGa 2I0XA 2ALYB 4HI1A 4A8QA 3N6MA 1WD6A 5GADI 3P8BB 3QGPA 3GFYA 1RHRB 4ECTA 2DNHA 3JSMB 4J9UE 1LW2A 5KFCA 5IM0B 3W66A 2WONB 1KKHA 4NLGA 1IBCB 3HVTB 4J90A 5CYJA 1XR6A 2DGQA 2HNDA 3R7NB 5F8IA 4BS2A 1GTHA 3ILLA 3VQTA 1DARA 2FJEB 3G87A 3VF0B 3SSSA 5ETKA 4QU7A 4EI2A 1EP4A 3CDAA 2J5AA 1WDDA 4ER8A 5T41A 2I5JA 2VPZB 3LP0B 1CJKB 3DLKA 3HXMA 1JJCB 5IZHA 2ZD1A 4YDDB 5DG8A 2QSFA 3BB5A 5M2PA 1IKVA 4OZ1A 4HVZA 3T9NA 3FVYA 1S6OA 1JKHB 4OJ3A 3EM1A 4I1TA 1N36J 3JTPA 3OTCA 1WHYA 3D1HA 1JLQA 2CPFA 2L41A 2BOPA 4ZIVA 1S1WA 5T14A 4DX5A 2ZNZA 3F73A 2MEWA 3I0SA 4RBUA 1Y7PA 3VAHA 3MD1A 4KGMA 4IFYA 2BJ1A 2NLWA 1JNRB 3MPVA 3QWUA 3MUTP 3WQPA 1UEVA 4I7FB 2QFIA 3PX6A 2DCLA 1S4FA 3GPAA 5L1LA 1NSKL 2MQOA 1N5YA 1NNDA 3M2UB 1U1PA 4RL1A 3IG1B 1E6YB 2VG5B 1BQNA 3HMJG 1JLFB 3GZ7A 3FRZA 3TI0A 1NZAA 1NZ8A 1DY3A 1S0NA 2E7XA 2OFHX 2H9ZA 3W9HA 1QAYA 4NLUA 4R0EA 1R7IA 3KLHA 2KG0A 3CJ3A 4PG8A 3UVJA 1ZZNA 1JJHA 5BXIA 3BGRB 2RSQA 3I87A 3CWJA 4Y2MA 3Q23A 1RWKB 3MR7A 1L3KA 5DLFA 1VQPS 2OP5A 2E29A 3TVZA 4YQWA 4H4OA 1WF1A 2I6WA 2CJQA 2BKOA 1M5HA 4XIUA 4DWIA 1T95A 4AL7A 2V2KA 4PG5A 3ZZTA 4ECQA 3UCGA 4NYPA 1TELA 3AAWB 1T9WA 2WAQD 5HBMB 3GYXB 5KFGA 4RU9A 1LK7A 3LAKA 3PJ9A 2N3LA 4C8NA 1VS3A 3AFGA 3OD2A 2XMJA 1KLMB 4B9MA 3HHLD 2FJWA 2C2DA 4IH6A 2MQMA 1D9AA 1UPPA 2QL9B 1YTYA 2V5HG 4HHJA 5DDQC 2QMXA 2CNKB 1RTDB 3DOMB 1I51B 4LVOP 3K5PA 3PYEA 2EKNA 4QPXA 2YKNB 4ECZA 2IJNA 2YPZA 3ZNJ1 2Q1LA 4RNHA 2AZ3A 1RTHA 3GCXP 3CNQP 3J7A1 1WHXA 3M8YA 4OZLA 3OL6A 1R8BA 1J5OA 5L9NA 3OUYB 2AQ4A 3CEDA 1RTIA 1O5JA 5GAGI 4N41A 3KJVB 3M2VB 4DR5J 3DLBA 3F41A 4JI1J 3C6UA 2ROGA 2B9WA 2FVQA 5J2NB 2V6AA 3Q8SB 2ATLA 2A0FB 3BEGB 3VGUA 1HNIA 4CLLA 4HDGA 4FBTA 2VU5A 5K9FA 1VQOS 4JV0A 3H5YA 2YNIA 5KFRA 1PBAA 2HQDA 5KFVA 1SJQA 1W2IA 1LQ9A 5MLCV 2Y0SD 1RT5A 1K44A 3C14A 3HCXA 3QIPB 4OV1A 4DFPA 4WP3A 2LQ5A 3FQLA 3EJMA 4L6V3 1KVJA 2R7VA 5DETA 1S6PA 5KT5A 2DXDA 4U96A 1SV5A 3R7SB 2DNMA 1KC8T 4CYUB 2ZJQQ 2Q6CA 4TN2A 3M9OB 1JIHA 2RMLA 4PWDA 1RI7A 2RUGA 5KG7A 1LFPA 4J37A 4WIIA 3BJYA 3PW7A 3PX0A 2GMJA 3DNCA 1F5AA 1R0BG 2QX0A 4CWBA 4TLQA 2LXUA 1F3FA 1X7VA 2MZRA 1LWEA 1PG5B 4DZDA 4AE5A 2APOA 5E3AA 4IO9Q 5ETLA 3HSJA 4NA3A 3HD2A 3JSBA 3K7RA 3PG9A 3RR8A 2YKPA 2DVIA 3OHAA 3J81j 4OI0A 1U09A 3GMGA 2J0XA 2G4BA 1U47A 1B0VA 3UNGC 5THWA 4QIGA 2AYBA 2NS1B 4USWA 2W7OA 3GG0A 1HBUA 2ZC4A 3LANA 5DZ7A 2BE2B 2FVSA 4TY8B 3MAAB 3DRYA 3UCZP 4PG7A 4WIQA 2GJIA 4XPEA 3DLJA 5IT0A 3FK4A 4RW8A 4CDIA 4AUKA 5H9FK 4USUA 3QYYA 2QL5B 3ONQA 2AKWB 2QZ8A 4URGA 4NMXA 4CRJA 3T1AA 1OYEA 2P6TA 2Y1LB 5DGAA 2M88A 1H74A 1NDLA 4X4VA 4DN9A 3J7YU 2CQIA 3KLEA 1YHQS 3THTA 1QE1B 4LRDA 3KFWX 1EKSA 4ZPTR 1N32J 4YY3J 1R27B 2WW4A 3IWLA 4ZDNA 2BJ3A 2GVZA 3CC7S 1XIQA 1HNZF 5KFAA 1MLAA 1RISA 1OQ3A 4OHVA 2GMLA 3O44A 2VG7B 1N5SA 2SXLA 3J7ZT 1LEOA 4CLUA 2WHOA 3EYZA 3OTDA 4ZPAA 3BN4A 3CCRS 3H8YA 1RXOB 3MI7X 2BJ7A 4P75A 3KKFA 2DR8A 2BKNA 1FK9B 1UAWA 4DV2F 1XEZA 3CD6S 4JI3J 2VASA 3M7VA 1U1RA 3PW5A 1H38A 4F4XA 2DNRA 1IM6A 3GLJA 3G6ES 2CG8A 1FNOA 3ENVA 2DY1A 4X4QA 4F4ZA 1SKRA 5IM0A 4G1QB 1JXVA 2HGLA 3R3TA 2QE5A 4KE5A 4UOCA 5CZXA 3HVTA 3KK3B 2C2RA 2OGUA 4ED1A 1RHMB 1B7FA 1NO8A 3HVRA 4Y2KA 5I4MA 1UFKA 3KLFB 1ZETA 2HBRB 1ULRA 2LA4A 4N76A 1ZOTA 4OYAA 4HH1A 2VJUA 4LF1A 1NK9A 2IVMA 4DPUA 3KJQB 4RO0A 2ZHOA 1VRTA 3BGFA 2DGWA 3A4TA 1RKJA 2D1CA 3LP0A 1CJKA 1H98A 1LFWA 1M1HA 2V4RA 3SXLA 5H1SV 4DV0J 2DXEA 3OJSA 2XYGB 1NM2A 1NPRA 3CD5A 1M0SA 4N8OA 3MM8B 3ETMA 3CTRA 2QLWA 5HMYA 1NMEB 1FFGB 3JQJA 4ZP8A 1FF2A 4QOTA 4XDCA 2A2CA 2NREA 1JKHA 1Q7LB 3BS9A 3EICA 3QSIA 4OYZA 1NBEB 1DTQA 1X5OA 1S1UB 1YBUA 4F0MA 4OI6A 2ZDOA 3H20A 3GU0A 4DV3F 5E2QA 4RX6A 3T41A 2EWHA 3ZZPA 5KFIA 3BO2A 4I7FA 4ZVFA 3ET6A 1JLAA 4QR1A 4KKOB 1C1CB 5J1EB 1H3DA 3CULA 3IP0A 3MEKA 1E6YA 2AHOB 2VG5A 4XDDA 5KT6A 1OSCA 1YLXA 1EKRA 1RCOB 4JI4F 2IDEA 1CS4A 3QAEA 1T7PA 1DBDA 1RQ0A 2JNJA 2WCXA 1TL4A 4NEZA 3RBDA 3G8SA 4I2PA 2UZAA 1ICEB 2CFXA 3CPWR 1NDKA 3W3SA 1ZPWX 5L39A 4FYWB 1NU4A 3OR2A 1ACMB 1Y9OA 3QWPA 4ZA1A 5DQHA 2PFFB 3TEGA 1ZAXA 2XHCA 2B4UA 5L1KA 1Y10A 5KFZA 3DGPB 4FS1A 4DL7A 5FLXU 4JI5F 2OH2A 4DX7A 2KVQE 5IQQA 1TKZA 2WTFA 1SQFA 3MOJB 2G0IA 4QYZJ 5KG1A 1KOHA 1CEZA 4QZVB 4KBIA 3J7YI 4DV3J 1RT7B 5J2QB 3W60A 2FY8A 4DI6A 2MKIA 2ZM6F 3MGJA 1R6YA 2EBGA 2DPIA 3KUHA 4JI6J 2HVHA 2HW3A 4JV2A 2JLFA 3H7HB 4KPYA 3IC1A 4GMKA 2D3UA 1YJ9S 3HHLC 2N82B 2FJVA 4WXOA 2KN4A
chains in the Genus database with same CATH topology
1VQYA 2J9EA 4IOBA 5DJBA 2XC9A 2X1GA 3MM9B 1HWJA 4KRWA 3SMZA 2RQMA 4J9QA 3SEOA 1PC5A 3M32B 4G1IA 3KYLA 1D8ZA 4C3MA 1TKDA 2LA6A 3DM2A 4I67A 2PE8A 4QIFA 1T3OA 2VQFF 4DPOA 1OPIA 2ZOFA 1TK5A 2HQ3A 2YKOA 1K0VA 3O2IA 4J9LA 4IDKB 3SQGB 4KHPF 3G4SS 2D9PA 2DHGA 2M52A 2UV8A 1V3ZA 2M3DA 4JOUA 2FD2A 1KFDA 1P27B 4MKBA 3VWSA 1FXDA 1U45A 5E5NA 4QIWD 3PO5A 2HHTA 2BQ3A 1UJ5A 3OQ2A 3G71S 4ED6A 1TAQA 3K0JA 1BWEA 3LQVA 1WTBA 3MEGB 2WW8A 3DHWC 3H59A 5CXTA 3PEJA 5J2PA 5BYSA 2KO1A 2CPIA 2CKWA 2ZH4A 1HQEB 2I38A 4HTJA 4ICLA 1H7WA 2IC3B 2LEBA 5LMNF 3S7RA 5L1IA 3DCAA 4ZOSA 4B9UA 3ISND 3W7BA 3KJVA 2KZZA 3CDBA 4PG4A 4XK8C 7FD1A 1Z2ZA 3AQPA 4X4RA 4IQXA 2RU9A 3E2EA 1NH7A 2DHAA 3C3LA 2HRYA 2EPIA 3T9ZA 3PFEA 1Q8IA 3N79A 4M63A 1G7CB 3AJ1A 1TV6A 4RW9A 2F3JA 3D54A 3V81B 1G2EA 1T05B 2KJWA 3MM6B 1TL3B 1HQUB 2CJKA 4RNNA 4K4XA 3SSQA 1HPZA 1LWEB 3MMCB 3N6LA 2D41A 3VR1A 2M2BA 2M7SA 1YJWS 4I2QA 5EX0A 4C0HA 1DQ8A 2DITA 3DLLQ 4M1KA 4N56A 4F4WA 1JLBA 2RVJA 1HI8A 3E8OA 5T7LB 2K3IA 5B0EA 1NKCA 2VFVA 4I6AA 1OS5A 4MTPA 4P7TA 2M5YA 3NP5A 3PW0A 3U7JA 1UEUA 3C6TB 3PY8A 4OZ5A 2DR5A 1FNMA 4CTAA 3TAPA 4HDHA 4EBCA 1WEZA 4H54A 4C0OC 1JXLA 1ZH5A 3M30B 1XERA 1IBMF 4GO7X 4DR6F 1O8BA 1F0XA 1V3RA 1C0UB 1RT6A 2ZE2B 2HNYB 2NPIA 4IG3B 4MKAA 4RWWA 2G13A 5DGBA 1JJ4A 1JNZB 4PPDA 1CVJA 1X5TA 2RF2B 2EI5A 3QJJA 2KHCA 1DLOA 2OAUA 4C8ZA 2RKIA 2XNRA 1U7LA 4OX6A 4PXBA 2MQQA 3MMAB 3QIPA 2R9LA 3KMSA 4WYWA 3CDWA 2O5DA 4IUFA 3PM9A 1X8DA 2ROEA 2CPDA 2K1RA 1HNWF 5DRKA 3DRRB 3SCKE 3TYTA 1AROP 2DNKA 3FSXA 3NGDA 1RYSA 4ELVA 4YDXA 3O6QA 2E5JA 2XCPA 4Y34A 4NCAA 1K1SA 5F8MA 3HLUA 2VZ9A 2UUCF 5A8WB 4ATNA 3UR0A 2DNYA 1C1BB 4ZLPA 4B3TF 4HKQA 4TXSA 4NXNF 1NHVA 3R5BA 3NAIA 1N5TA 4R0JA 5J2MA 1CC8A 2FHJA 4Y6IA 4DL5A 4K50A 3T6JA 5DO2A 1LWFB 1YGYA 1FRHA 3TR5A 2ALZA 4DR1F 5AXLA 2RS2A 5SZTA 4IQMA 1X5SA 2MPUA 2R7OA 5DS7A 3TAMB 1T03A 1WEXA 1GAOA 1UJ4A 2KXHA 2OPSB 4EZ9A 4DFKA 3NAHA 3KG1A 2DNPA 1QUVA 2ZH6A 1S9FA 3CJ5A 1TFWA 4UUWA 3LGNA 4DQQA 4CQ1A 5EDWA 5I3PA 2HYIB 3NRBA 7FDRA 4B3MF 1XN9A 2NQPA 4U9RA 4ED5A 4ITSA 2E44A 3HK2A 4MMOA 1U6FA 1RP5A 4WFYA 2GHPA 1Q53A 3CGIA 1DTTA 3KNAA 3G8QA 2WOMA 3ULHA 4KR0B 3M6XA 4EO6A 3OBIA 3M8QB 3UCUP 4JV5F 1FE4A 3MZIA 4Y2IA 4LFBF 3PX4A 3JYTA 2GQCA 2IYIA 2XBPA 4DLEA 1AW0A 2GA7A 2JC0A 2ADCA 1C4AA 2R8JA 3L7PA 3UQSA 3V6KA 4ZHRB 3NNAA 4PXCA 3CCSS 4IR1A 4ES1A 1HBNB 2E66A 1K0TA 2AWZA 2DHXA 4C8KA 4DSJA 2B4PA 1VFJA 3KHRA 2J7KA 2IM1A 3PIPQ 4CO2A 4EO8A 3NBPA 4P2SA 1Q78A 4DFMA 1HYSB 1W2BR 3OFGA 3IAS9 2KG1A 1IQZA 3MF5A 1WTFA 4OHWA 5KOWA 4IO1A 3CCWA 5JVHQ 1E6VA 1T3NA 2VA3A 4A8OA 4OHZA 2OPRB 2DBBA 3PHEA 1FKPB 2HNDB 2RT3A 3CDEA 4TY9A 2JVRA 2E9TA 1DZ5A 2BW2A 3PO4A 2ZVSA 4ZP6A 2V9WA 2X3GA 1WF2A 2CVEA 1XMQF 4AL5A 4NYOA 4N77A 4ECRA 3AQOA 3FZ2A 3UD3P 3HPOA 4LSNB 1L3TA 1EETB 2A18A 3EGWB 3GIMA 3BR9A 2B9XA 3TQ1A 1RDRA 3PACA 2RIJA 3CCJS 4DV4F 2VL1A 2GQQA 3GIIA 2FHMA 2MKJA 2CYYA 2JFKA 3ICLA 4HL9A 5KFBA 3CO9A 2FY1A 2DD8S 5B7WA 3M2RB 4OLPA 4B9NA 2R2RA 2OPQB 1ZM9A 3CE8A 4DF4A 2DNOA 4RW4B 4G1PA 3WDOA 1KSPA 3DOKA 2I5JB 2YNHB 2M4MA 3QLHA 2W9CB 3SV4A 1FJ7A 1N52B 3BM7A 2M70A 1I94F 3BZQA 2DNLA 3PNIA 1X4AA 1RT1A 2Q79A 3FGVA 3MURP 1HBMA 2XWYA 3DMJA 5B08A 4A8WA 5I3UB 2CJAA 2B4OA 1FJCA 1IJFB 5F0UA 1S0VA 2OKQA 3GV8B 2DNZA 2VB6A 2XSFA 3FZBA 4OX8A 1F60B 2QLXA 4QWBA 1N88A 3M6WA 3QIDA 4MFBB 4PKDB 3VCDA 4I68A 1FRKA 3V4MA 2PIIA 5D4NA 3OLBA 3ITHB 1N6QB 4F3OA 4OHYA 3S6EA 1QE1A 3AH6A 1U8SA 3ETOA 2R4FA 2HG4A 1FVQA 4CNYA 1IKVB 1MU2A 1VMBA 1OPZA 2E9ZA 2IVYA 4K4TA 2YX1A 3LWLA 4K4YA 1LWCB 2QMWA 2EBEA 2GO8A 3PJXA 3Q22A 4J9RA 1VLYA 4RBVA 2MSSA 3I5CA 5KFOA 3JSMA 3KMQA 1UVKA 1N34F 2FGCA 4NZ7A 2OD6A 1JLQB 2IM0A 2XB2D 2PA8D 3LW5C 5KFWA 1S1WB 5DLGA 2OO4A 4X4TA 2WONA 3X3UA 3MFHA 3T5JA 4I0WA 4B9LA 1VHFA 1Q86T 2HFOA 2DTJA 2FUG9 3ZZYA 1ZAWA 2VG7A 1F5BA 2VFSA 5K14B 2E1MC 1TK0A 2KI2A 1PO6A 2X1BA 3HZGA 4X4NA 3DDKA 4X4OA 2W8LA 4ID8A 1FTCA 2KM8C 2DRBA 1VRTB 1G1XA 2W7PA 4X64F 1Y0HA 4HI2A 2HAIA 2XLIA 3EUNA 2DGVA 4MYTA 1S76D 4WZMA 4ZCLA 3VQSA 3H5SA 2HFNA 5B09A 1YIJS 2A2DA 1IKWB 3UR3C 2CQPA 2MQPA 3POTA 4NRTA 1F2GA 4PQUA 1VC0A 2KT5A 4NZ6A 4JUZA 3EPIA 2CQDA 1NKEA 4C97A 4C8OA 1U1OA 5DM7Q 4RLEA 5F0WA 5C25B 1YJNS 2JEFA 2GCFA 1REVA 1H7XA 3TA0A 5F9LA 4ZVGA 1ZAVA 2XMWA 2VQEF 1R8CA 1ZZFA 3Q8PB 3GV7B 3U1NA 4KV8A 2JH3A 4RW6A 2ASJA 4QWEA 3M8RA 3LPYA 3I9V9 1UVIA 3T1YF 4FF1A 3W2VA 3ZZ0A 4XPCA 2KFZA 4IYQA 2HHVA 4A48A 3FEXB 4OIXA 2HHSA 2IAJA 2W4DA 2K7KA 3HI9A 4GO5X 1IUJA 5KFHA 1WI8A 3CJ4A 3HHLB 3O5TB 2KU7A 4N8NA 5KFKA 4DR3F 1BQNB 3IGNA 1DTQB 3PR5B 4K0KF 2OPPA 4TKTA 4NLVA 2EFGA 5ADZA 4EEYA 4F2SA 1MROA 3IN5A 2BZ2A 2O3DA 2VPYB 4ID5A 2YX7A 3KK3A 2MZQA 2AD9A 4MIWA 5F8NA 2F9DA 2YKMB 1ZM3A 2ZHAA 5KT3A 1HARA 3AA8A 2QRRA 5LXRA 4N5SA 3MUMP 3TVYA 2YNGA 2W4PA 1TFYA 1P8GA 3ZC4A 4NOHA 2AU0A 4MK9A 2OTLS 2QA4S 3EGNA 3OXGA 4ES3A 1IKXB 2XGQA 5FD1A 3DYAB 5K8OA 3BSCA 4ECYA 2O01C 4YFUA 2BANB 3BSOA 3FFIB 3N5FA 4AXIA 3MEDA 2IMWP 3B4MA 1M5SA 3M9NB 6FD1A 3RR7A 1JLAB 4QW8A 4BCAA 1IKYA 3KLHB 4QWAA 1Y5IB 4B17A 3THVA 5A8RA 2PI5A 5E3CA 1P1LA 3R1HA 2PSZA 1S79A 2ZOGA 3SZ2A 5HN0A 1RT3B 4PUOB 1VRUA 5DDPC 3KG0A 3VZIA 1N5VA 4G6VB 2OSQA 2XS2A 2RDIA 2OIHA 5D78A 1ELOA 4B02A 3OV7A 2O66A 3G96A 1NK0A 2OSRA 4I6YA 4YR2A 2R7SA 1RJJA 3HVAA 2J6SA 1PILA 3MR5A 5E3PA 2YWHA 3TRGA 1TL1A 2I1RA 4H4OB 4JI0F 1UA0A 4NXMF 4K4VA 1JX4A 2AX1A 4RBTA 2F40A 4QWDA 1TZ0A 2B43A 1BQMA 3OFEA 4LT6A 3V6HA 3I56S 3V4IA 5CYQA 2H5EA 3I31A 4H4KC 2XI3A 5CD4H 5HI7A 2V4QA 2V4JB 1YJUA 5GAHI 3I5AA 2Z8QA 5K8NA 1GQEA 4ZCMA 3RB3A 1TVRA 3R5CA 3K8VA 1G6BA 4NCGB 4TNOA 3DU6A 1UW4A 3P5TL 4HT5A 2C2EA 3HJFA 4RNMA 4Q43A 1JLEA 3S8SA 3QO9A 3TUJC 1Y4ZB 3M2UA 4NRUA 4I2PB 5HO4A 4JV1A 5A0YB 4X2BA 2A1BA 4RU2A 3IG1A 3KK2A 3H40A 1U24A 1S48A 2W24A 3CB4A 3G86A 3KWMA 4QR2A 2B7CB 5G0RB 4TQRA 1KLNA 1IR0A 4DR5F 4KT0C 3CIMA 1R0AA 3OR2B 2VOPA 5KTQA 4PXDA 5E7OB 1QAJA 5BYRA 4ILLA 1FKAF 4Q0BA 4O4GA 1JLFA 2R8KA 5FJ4A 4G3IA 1FRIA 4RUAA 4O44A 2FVRA 5K8MA 2EVZA 2JL9A 2XG8A 1I6JA 4JI1F 2LQ9A 3IXQA 2COLA 2CJ9A 3L7OA 1WHVA 2DRAA 4OZJA 5LJ3Y 5KAKA 4WFXA 2XEXA 5FLXY 1GXUA 3IRXA 2LDIA 2RU3A 2MXYA 2OMLA 1JLCB 3JSYA 2HRUA 2KH9A 3T1HF 5DQIA 1TAUA 4X4UA 1SB6A 2Z2LA 3P3DA 3UFCX 4WFNQ 2C3YA 2RQKA 1QAIA 2XNQA 4WE1B 5K5MA 2DH8A 1TKZB 2VH7A 4QPTA 5A8KA 4DDFA 5L38A 5B0CA 3N9UC 2D9OA 2WSEC 4DR7F 2V8DA 5F9NA 4DBQA 2J6UA 1CQMA 1VQ8S 2JZ5A 4CNZA 3GIJA 1MNEA 1TKXB 1T94A 2CQGA 1C1CA 1OO0B 2HQIA 4URSA 1KD1T 5E41A 4IRCA 1FVSA 4UUXA 3BGRA 4U7CA 1FNXH 3IR7B 3I0RA 4Q8EA 2VFTA 3IA0A 4ZPVR 4CCHA 3ISZA 2L9WA 3PKYA 4EUVA 2MDAA 3C8YA 3TO8A 4J9KA 2LLZA 5L1JA 2NR0A 2HWHA 1AFJA 3N28A 4NMLA 3TANA 2FLLA 4BDPA 5F8LA 1KOOA 2FLNA 1RTJB 4A46A 1D9DA 4B3OA 4NL5A 1HR0F 3CCMS 1U1LA 5FIIA 2NZ4A 3RRGA 1KFSA 2QIFA 2WRMA 1Y5NB 4R8UA 4C8YA 3GIKA 4J9OA 5E3QA 2HHUA 4NYZA 1S97A 4F3QA 4IG0A 1M5OC 2GIQA 5KFPA 1S6QB 3CJKB 1RTIB 2MGZA 4K4ZA 2JVOA 4FN5A 1HMVA 1VQ4S 1A6LA 3F44A 4A8MP 1LV5A 5HBMA 3EPGA 1SJ3P 1WG1A 4O3QA 1FKOA 4Q2LA 3PW2A 3KLGB 1NK8A 1HD0A 2IHR1 3AB4B 2VD3A 2E1RA 2EFNA 2E7WA 5B0GA 3DLEB 2WBMA 2B5JA 3OTEA 3PDNA 2AV5A 3H4DA 5HLFB 2A10A 1SH0A 2MKHA 5KFXA 2UP1A 3LOUA 1VQ9S<