1YJWS

Crystal structure of quinupristin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 19
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2005-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1yjwS00
1WHWA 1AUDA 2VONA 1RKJA 1WHYA 3G96A 1VC0A 3EGNA 1X5SA 2DNHA 2RT3A 2M8HA 1U1LA 2E5GA 2M9KA 2SXLA 4CH0S 1VQ7S 4FXVA 5FJ4A 2DIUA 3CCMS 1VQPS 2NZ4A 1SJ4P 2I2YA 2HYIB 5IQQA 3S6EA 3UD4P 2CPZA 2RS8A 3Q2SC 2N7CA 2JVOA 1DZ5A 2MQMA 1FHTA 2AYMA 5GMKa 5DDOC 2MKIA 1UP1A 2MZSA 2LQ5A 4WKRA 2CQ3A 2ZJQQ 3NNHA 2DNQA 1U6BA 3CMAS 2KM8C 2FC8A 2MKJA 1H6KX 2DNOA 2LYVA 3BO3A 1VBZA 1D8ZA 4WFBQ 1OPIA 3P6YC 2XS2A 2DGWA 1CVJA 3EX7B 3D2WA 2MJUA 2BOPA 2MKSA 2D3OR 5LSOA 4UY8T 4QU7A 3G71S 1ZZFA 2CPXA 2XNRA 2CPDA 3CCRS 2M2BA 4P6QA 4U67Q 3CC7S 3MD3A 1HA1A 4YB1P 1QVGR 5LXYA 1WEYA 3R27A 2DNNA 2MZJA 1HD0A 1ZH5A 1X4FA 5LJ5Y 3LQVA 2MKHA 1VBXA 4IUFA 2RQCA 2KXFA 1U1NA 2MZRA 1YIJS 1WG5A 1FNXH 1VC5A 1OO0B 1D9AA 1B7FA 1H2TZ 5IFMA 3P49B 2D9OA 2A3JA 3MI7X 1ZZNA 1YTYA 3S8SA 2KXHA 4Z2XA 1OWXA 3BEGB 2KFYA 2CQHA 2LA4A 5GVQA 1H2UX 2CQBA 2DGOA 1U1QA 1K9MT 2XNQA 2CQ1A 3MDFA 2QA4S 5CYJA 2MKKA 2KRRA 1WG1A 2PEHA 5DETA 2KVIA 3Q2TC 3FEXB 3CPWR 2U1AA 4WIIA 3CCUS 5ITHA 1FXLA 2YH0A 2E5HA 1VQ8S 2NLWA 3RW6A 2DGXA 1X4BA 1M90T 1VQ6S 2DIVA 1XN9A 5DDQC 3TO8A 2G0CA 4CQ1A 3NS6A 2F9JA 3S01A 2YTCA 1X5TA 4IO9Q 2EK6A 1U1KA 1URNA 3VAHA 2X1GA 4OZ1A 3PIPQ 1JJ4A 2DO4A 5GAGU 4BS2A 3CC4S 1VQLS 2DHAA 4QU6A 2KRBA 3CTRA 1JMTA 2MZTA 3UCZP 4A8XA 2MY7A 3THTA 2DNKA 5BJRA 2RRAA 1X4GA 4WCEQ 1WG4A 2LKZA 4EGLA 2K8GA 4PKDB 4ZKAA 5DDRC 2X1BA 1U1PA 1DBDA 4C4WA 4WF9Q 1Q7YT 3MD1A 2DGVA 1OIAA 3ZZYA 5LXRA 2EVZA 2V94A 1RK8A 2HGNA 2ZJPQ 2RVJA 3CCJS 2OJ3A 3K0JA 2MYFA 2MY8A 2DNMA 3VAMA 2WBRA 3LPYA 4C0OC 3VAGA 3UD3P 2KI2A 2MQQA 3MOJB 2MB0B 3IWNC 1S72S 2MQLA 3CCES 3DLLQ 1NU4A 2VOOA 4ED5A 3I56S 3BO4A 3B4DA 2XB2D 4M5DB 3P5TL 2G4BA 3UCGA 2YWKA 3CCLS 2MSTA 4LMZA 1R8PA 1M5OC 3J7YU 1BY9A 2DNYA 2DNLA 1X4CA 2DGQA 3I55S 2AYGA 3R1LA 2OSQA 2DGUA 5CA5A 4PR6A 1VQ4S 2U2FA 2J0QD 2LXIA 5IM0A 1YJ9S 2F3JA 2CPJA 2YH1A 3G6ES 4TU9A 2RUGA 3VALA 2MPUA 2MKCA 1VQNS 2M8DB 1FJ7A 3G8TA 2KU7A 2KN4A 2MQOA 3G8SA 1X5OA 2XS5A 2G1DA 3SMZA 2MZ1A 5DM7Q 1DRZA 1SJRA 3H2VE 2M70A 2N82B 5LSLA 2B0GA 1U1RA 3N9UC 2LCWA 2DNPA 1YITS 1A9NB 5IM0B 2RQ4A 2M7SA 1S79A 3NS5A 3MXHP 2OTJS 1WEZA 1WWHA 3S7RA 1SXLA 2CQCA 1Q86T 2MJNA 1WI8A 3CULA 4YUDA 1M5KC 1VQMS 1K8AT 1P27B 3HHNB 1PO6A 1KOHA 3R1HA 2QEXS 2HGLA 1YJWS 3NMRA 3RW7A 2OIHA 2M4MA 1UW4A 3L3CA 1YWXA 2HGMA 3MUTP 1G2EA 1W2BR 5GAHU 3CUNA 3FEYB 2KHCA 3CCQS 4IOCQ 2DH9A 1SJ3P 4TLQA 3H2UB 2E5JA 2CQ0A 2J0SD 3G9CA 3U1MA 1L3KA 2L41A 1WEXA 2PE8A 1HL6A 2LA6A 2O3DA 2RU3A 3G4SS 1X0FA 2DHXA 1WF0A 1Q82T 1WHVA 1M1KT 2L9WA 2N3OA 2OTLS 2E5IA 1Q81T 2XS7A 1N8RT 2EK1A 1YHQS 2UP1A 4V19X 1FJEB 3UCUP 1N54B 2CQ2A 2DK2A 2MQPA 2YKAA 1X4AA 1SJQA 1FJCA 1YJNS 2RS2A 3BS9A 5DDPC 1FO1A 2MQNA 2J76E 3P3DA 3IRWP 2DITA 1PGZA 2GO9A 2DHSA 1F9FA 3HI9A 5JVHQ 3ULHA 2MXYA 1VBYA 2AYEA 4F25A 3VAFA 5GADU 3MUMP 2K3KA 2FHOB 3SDEA 4TU8A 4QPTA 1HD1A 4Y00A 3ZZZA 3U1LA 2KXNB 2KH9A 1WF1A 4IOAQ 2KG1A 2M52A 2JX2A 4RU2A 1K73T 1VQ5S 3CC2S 1JJ2R 2DNZA 4WFAQ 3UWTA 2DGSA 5DM6Q 3CD6S 2MMYA 4CIOA 2X1AA 5CXTA 2I38A 1VQ9S 3MUVP 1FT8A 1SJFA 5HO4A 1IQTA 3UE2A 1X4HA 2DH7A 2M0GB 1WTBA 4UQTA 5H1SV 3BO2A 1QM9A 1VQKS 3V4MA 1YI2S 3SDEB 3NNAA 4LJMA 2ADCA 1KD1T 1H2VZ 3SXLA 2E44A 2DNGA 1U1MA 1X5PA 5LJ3Y 4Y0FA 3CMES 3VAJA 4ERDA 2LXUA 2DNRA 2CPYA 2ZJRQ 3DXBA 2BZ2A 2CPIA 1WI6A 1WF2A 2LECA 2DO0A 2MHNA 1P1TA 1M5VC 2Q79A 4C7QA 4W90B 1KOOA 2DH8A 2VODA 1NO8A 5GAEU 3B4MA 4J5OA 2MSSA 4WFNQ 3NNCA 4F02A 1UAWA 2LMIA 3THPA 5MLCV 2DISA 2MGZA 2HVZA 2KT5A 3US5A 4F26A 2CQIA 3J7ZT 2ERRA 3VAKA 2CQ4A 3MURP 1X4DA 2KG0A 2XSFA 2JRSA 3TYTA 1KQSR 2X1FA 5HL7Q 3PIOQ 2F9DA 5JVGQ 2CPFA 2KM8B 2L08A 4TU7A 1NJIT 1KC8T 2JVRA 2RNEA 3CF5Q 5EN1A 1M5PC 2HZCA 2JWNA 2FPHX 2MGZB 2GHPA 2KYXA 4OZ0A 2N3LA 2CJKA 1R8HA 3VAIA 1UFWA 1VC6A 5D78A 4FXWA 1VQOS 2RRBA 1U1OA 4CH1A 3VF0B 2MZQA 4PRFA 3CXCR 2AYBA 2J8AA 2FC9A 1QVFR 2CPHA 4YOEA 2M88A 2DB1A 2AD9A 1JJHA 2LEAA 2CQPA 1U6FA 2VOPA 2ADBA 2CQDA 3JB9k 5D77A 1N88A 1WELA 3CCVS 2QFJA 2DGTA 4LIRA 2FY1A 2LEBA 4W92B 2OSRA 3CCSS 3OW2R 1X4EA 1U2FA 1DHMA 4QQBA 2CPEA 1WHXA 1A7GE 2D9PA 2CQGA 3EGZA 1O0PA 2DHGA 3TP2A 1N52B
chains in the Genus database with same CATH superfamily
1S48A 3BV8A 1BD6A 1U0SA 3G96A 1UA0A 4LBPA 5C25B 3JTOA 3BGRB 1RXOB 2ZKTA 3LO3A 1SQEA 2A0FB 4X66F 1F2GA 4ANDA 3D28A 4EO8A 3W60A 2MZSA 2KO1A 3LOUA 1D9DA 4BWMA 5FD1A 2HVHA 2FC8A 1NPRA 1JLGA 1RABB 5AXMA 3IA0A 1XMOF 3KUGA 2D3OR 2XLIA 4V19J 1JQGA 4RPFA 4ZOSA 1OMSA 1JNRB 2ZHAA 2QSWA 4O3OA 1S9GA 3CD5A 1XMOJ 2HNYA 1U1NA 4PG5A 3CD0A 2YVSA 1FRJA 1GXLA 4CLWA 1UW9A 4M5GA 2BJEA 4DV1J 1OY6A 2BABA 5ETSA 3W9IA 2WHOA 1YJRA 2A2DA 5DETA 3NCPA 2V4QA 4KYZA 4FPIA 1KFSA 2E5HA 4NLDA 2J6SA 2B4OA 2DIVA 4ECXA 4QW9A 5KFCA 1RTHB 3OQ2A 2EK6A 2IRXA 2IVYA 4JI8F 3V2UC 2W9BB 4IRKA 1OQ6A 3UFCX 4HYKA 5D4OA 3VGTA 2EG2A 3UCZP 2NREA 1G1XA 2RRAA 1GMUA 2ZH8A 5M2UA 4EGLA 2AJ1A 3DRYA 4CRJA 5J2MB 2RVJA 4OV6A 5H9FK 3PW5A 5F9LA 2YNHA 3LPYA 5F8LA 3CCES 1NU4A 4DSLA 1RWNB 3BYPA 4N47A 1CULB 2DNLA 3R1LA 2RE1A 1V3SA 3U7JA 2NQPA 2IBKA 3RB4A 1IBMF 2F3JA 1REGX 3D1OA 3SSRA 1S9FA 4KKOA 5ETNA 2ZZNA 4IH6A 1HBMB 3Q0AA 4PABA 2GHVC 2ASJA 4PWWA 3LANA 1OYDA 4DV5F 1LWEA 4X84A 2MHEA 3UVJA 2ALYB 3QFWA 3C66A 2HHQA 3SCLE 4C3LA 2MJNA 3UW1A 5IT4A 5F8MA 4DV5J 1LFPA 1RBLA 4AL7A 3NMRA 3FVYA 2M4MA 2NR0A 1D09B 2DH9A 3SV4A 3UPFA 3I96A 3BN7A 1J5OB 5K8OA 3G4SS 2WW4A 4Z7CA 3HSZA 3KLEB 1M1KT 2N3OA 1HNIA 1VI7A 3DHWC 3HHKA 4Y2MA 3TX8A 4OFZA 1RSCA 1FJEB 1MROA 1KTQA 1SJQA 3GG1A 3DM2B 5CYQA 3VAFA 4X4OA 3W8GA 1IQZA 2B43A 2KXNB 2QMWA 3FQLA 3UWTA 2DGSA 4JV2A 1FRHA 1XIQA 4EK2A 2IVFB 2X51A 3FC9A 4OQJA 4D3GA 4HTIA 3QJJA 2M3DA 4QWBA 3GIKA 2AEMA 2W01A 3NNAA 3SXLA 3C3LA 1EJ7L 5LJ3Y 3VHQA 2VFSA 4ZVUB 2B51A 4ZCLA 3SQOP 3DKDA 2CZ4A 1GTHA 1KQFB 4OZ3A 2K3IA 2GO8A 4WBFA 3CB4A 4I6AA 3CJTA 1Q5YA 1F0XA 2K06A 2UXDJ 4UTGA 1NAQA 2IAJA 1M5SA 4IG0B 3TA2A 5AE2A 2FZCB 5HL7Q 2IBOA 4DQIA 2RNEA 3NAHA 3JSMA 4OV1A 3PR5B 4DU7A 1UEKA 1TKTA 4KT0C 4DUZJ 3QWPA 1GX6A 3SFGA 2WZ1A 3TUJC 5DQGA 2GAHC 4IO1A 5B0DA 1P9QC 2ZH5A 2AD9A 2LEAA 3OL7A 2OELA 4DN0A 2VOPA 4MTPA 4TY8A 4FF1A 2FJDB 4BWJA 2LEBA 3CMQA 2LQ9A 3W5XA 4LR9A 2CQGA 3ISNC 2I5JA 1SKSA 1VR6A 2BR0A 1WHYA 1EZZB 2CG8A 3EGNA 2O1PA 3D66A 2M9KA 3J7Z5 4ETZA 3RG6A 2Y1RI 2I6WA 2R8HA 3KHRA 1B4SA 2V67A 5KFIA 3QAEA 4QIEA 4QPXA 2HNDB 3NNHA 4WWSA 5THWA 1OPIA 1FKOB 3ELHA 4YR0A 3OSNA 2UU9F 4OHVA 3C16A 3MMAB 3R5BA 3EX7B 2MKSA 2XYPB 3G71S 4EO6A 3KHGA 2J7UA 3OSPA 1JLQB 1Z2ZA 2XEXA 3OT9A 3R7NB 1RTJB 4DCJB 3GIIA 4FXDA 3FJ2A 4OYXA 5KFPA 4KV8B 2XHWA 4Y2IA 4LSNB 2FYXA 4OYWA 5KG5A 1VC5A 1UTAA 5KFKA 4CLYA 1WKJA 4J37A 1HWLA 4B3OA 3AXMA 4PWDA 4LSLA 1U1QA 1PIEA 4JBCA 1JIHA 1PAUB 4OX7A 4DL6A 2Y9HA 2LU1A 3VV2B 4K4TA 2J9CA 3C14B 2ZWPA 1RAEB 5CYMB 4HACA 1JLBB 4YHHJ 3FGVA 3TVKA 5KG6A 2BV3A 2IFXA 2BDPA 2DHAA 1NDPA 3CTRA 3K17A 1HQ2A 3KNAA 1VFJA 2QC3A 4KPCA 1U1PA 1DBDA 2D1CA 1Q7YT 3MD1A 2P6SA 2NSCA 2ZH1A 1NLKL 2DD8S 2AEJA 1OSDA 1REVA 1FWLA 3NXZA 4ZVEA 5HVFA 2HHVA 4N8OA 3CJSA 5HJXA 3CCZA 2VG6A 1Y5IB 2XGPA 1IKVA 4M5DB 1R89A 1IBLF 3MM8B 5F41A 2DNYA 2GCFA 1DTQB 2JLEA 2WVCA 1B99A 8ATCB 4C2MA 1S5ZA 2I0XA 3HT3A 2ZWOA 1I1GA 2DRBA 1T11A 2MZ1A 5DM7Q 3HFVA 2GA7A 2UV8A 2BW2A 1Y3JA 3KHLA 3GJRB 4PQUA 3C15A 4J90A 2B8PA 4J9SA 4K4ZA 4ZVGA 4ECSA 2PMZD 1SXLA 3U27A 1UWBB 3I5BA 1T95A 5CABA 3E51A 4YMEA 4ZCMA 2OIHA 5I4MA 3GCXP 2ZC3A 2A6OA 1TFYA 4YR2A 4DPWA 3H2UB 1YZ7A 2V2KA 3NKYA 4JV0A 4X62F 4OYPA 2QTWA 1LEOA 2VD3A 2W9CA 3V81B 4X62J 2B8QA 2VUGA 2XMMA 4C11A 1HNWF 4ZJOA 4KHPF 1I51B 2Q6CA 1S0OA 1RU1A 2CIMA 4ED3A 2XBPA 4NCGA 4QPTA 3MEDB 2VKZG 4N77A 3A4TA 5EX3A 3PR4A 3AH6A 2V4JA 4KHPJ 5DM6Q 1ZAVA 1VQ9S 4RW9A 1FWPA 5IS2A 1IWAA 1HNZF 3JYTB 2QLXA 1R6YA 3SDEB 1XK8A 5DZ6A 3DLKA 1VLOA 3AOAA 1KONA 2DNRA 1MWYA 5ETKA 5E3AA 1Q8LA 4F36A 2VC1A 2DO0A 4URSA 2MHNA 3PRVA 2VODA 5GAEU 2HSEB 4CLZA 2RILA 4CZCA 2KG0A 1X9MA 4USWA 1RT7A 3KMSA 3W5YA 5FDLB 5KFOA 1YK9A 4P2XA 2OD4A 2P9EA 5CH7B 1RT2B 1F3VA 4I6WA 3PJXA 1AZSA 3CJ4A 3Q8QB 2PMWA 1DLOB 2V4RA 4ZP7A 2CPHA 3SCKE 5D4PA 2X3DA 2AJQA 1N88A 5HP1B 2GJIA 5EUHA 1QE1A 2IDEA 4U96A 3K59A 4GKKJ 1JK9B 5KFFA 3GYXB 3A8IA 2D41A 1S1WA 1HNVA 3F44A 2BE7D 4CH0S 4CCHA 4CT9A 2NZ4A 2BKNA 2Y0BB 2CPZA 1TR0A 4DOZA 1UP1A 4GC6A 2GV1A 5C5JA 3D54A 2ZE2A 2VFUA 2VPWB 2BJ3A 4USJC 2W7PA 1KN6A 4PXDA 4UY8T 2BRLA 4NI2B 2OPSB 1O5JA 4C98A 4U8YA 1IBKJ 5HQLA 1WEYA 1HD0A 2V2ZA 3P5BP 1HR0J 3LQVA 5SZTA 3QATA 3IRXA 3GJSB 3TZZA 5CZVA 3C8YA 4UW2A 3A12A 4CYUA 4F4WA 1OWXA 3BEGB 1TP7A 2R7VA 4LRCA 3PACA 1H2UX 1WC6A 4DG1A 4WFXA 3BJYA 4DFJA 4CLFA 3MPDA 8AT1B 3MTKA 1D0EA 3EGWB 3TO8A 4F3OA 4M5MA 1X5TA 2EWHA 2C2DA 3J81U 3VAHA 4O3SA 2ZD1B 1ICEB 3RU0A 3IS9B 4J9PA 4LF5F 1WACA 2DO4A 5A8WA 2Z4PA 2K8GA 4ID8A 4KH0B 1R3NA 1J2VA 4MIAA 2F40A 5J2PA 4YEAA 3GV5B 1P6TA 2NXUA 4ZHRA 5IZHA 2C3MA 3V4IA 3P5TL 3NWGA 1IM6A 1BY9A 2YBVA 4BC9A 4HI1A 5I3QA 4KGMA 4KAIA 4TXSA 5DQIA 1H7WA 4HKQA 1M1GA 1VRUB 2ZHBA 4LF2A 4DU8A 1I3OB 1FFGB 4NE9C 2EFQA 3T9NA 1CG2A 2KN4A 3UN5A 2F8EX 3KLIA 5LSLA 2B6AA 3IO1A 2HQFA 4W98A 4Z7YA 2M7SA 4QYZJ 2MDAA 5K9FA 5DGBA 4J9NA 4LIWA 4PPDA 1S0VA 1DY3A 2HIYA 5E3PA 3M4XA 1UW4A 1TL7B 3ILJA 4C8OA 4HVZA 2N4DA 2E5JA 3KG0A 5KTQA 2RKIB 1X7VA 2HLTA 3A3NB 4ECTA 1T05A 3WIVA 2BACA 3I31A 3PW4A 4ES1A 3UCUP 3DMJA 1XMBA 2ZM6F 4P52A 1C1CA 3K5LA 1T9TA 3Q83A 4TN2A 2GO9A 5JXSA 3A1YG 5E2QA 3O1LA 3ZZZA 2XZTB 3IWXA 2M52A 1NPKA 4NEZA 1JJ2R 3OFEA 4RUBA 2MEWA 4A8OA 5A6PA 4FKYA 1FK9B 3M30A 1QM9A 2V34A 1X8DA 3PZPA 3LP1B 3SIPB 4MKBA 1R0CB 3KLGB 2QYGA 1U09A 4KE5A 4DJBA 1SKRA 3DRPA 4IG3A 4YN3B 2GHWA 7FDRA 4ZCIA 1EETB 2HHHF 1NJXA 3H7HB 4AL5A 5EX0A 1UAWA 2HVZA 1RT1B 3FFIB 2HHHJ 4F26A 2X3GA 2VG7A 4Q2LA 4QCLA 3MURP 3O5TB 3Q8SB 4DR1F 4TY9A 2JVRA 5KT7A 2ATCB 4OHZA 4DR6F 5EHHA 2MGZB 5CD4A 3PRBA 4DX6A 1ZM3A 4FF4A 2XMAA 4DR6J 2XY5A 3JSRA 5A0YB 2DB1A 1DARA 4GRSA 2ADBA 2XC9A 1MMLA 5L9XA 1S1TB 2QFJA 1BMQB 1EQ0A 1K1QA 4C8YA 1Z2LA 1A7GE 1RKJA 4H4KC 2HMIA 5B0CA 1NMEB 1TKZA 3DLBA 4J91A 7FD1A 1WDTA 4ID5A 5DLFA 4DQSA 3HHLB 2UUAF 4X4PA 4YDXA 2BQUA 1S1VB 2AMCB 4GVBB 4FBUA 2DNOA 2JJ4D 1QLNA 4WFBQ 5I42B 2OH2A 1YJVA 3QO9A 4TQSA 2GQ2A 2CPDA 4P6QA 3HX9A 4WIQA 5DG8A 3IBCB 1V3RA 4LRDA 2VPXB 1TQLA 4WU2A 1KHWA 4X65J 4PUOB 3W2WA 2BA9A 2V2QA 2AX1A 4Q8FA 4RW6B 2HNZB 3POTA 2I9SA 3KJVA 1G3OA 3Q8VA 4QR1A 1A0OB 4TVAB 2PN6A 1GTEA 3RBXA 4CNYA 3PRDA 1UEUA 1FX4A 1TL3B 1MNEA 1X4BA 2YQ3A 4NA1A 1TKXA 2J7WA 3OTEA 5HLFA 3M1VB 1YRXA 1HQUA 1RWPB 3S01A 4NZ0A 2ZH7A 2G13A 4OHXA 1IM4A 1VQLS 2HIQA 2YX4A 3W7BA 3ZZ0A 1FRMA 1R0AB 5F8JA 4HH1A 1NM2A 2Y0SD 3BGOP 4PKDB 2B3TB 2UUBF 2IMOA 1VOMA 1LWCA 3PO4A 4P2MA 1SPBP 5T41A 1NPPA 2W4CA 2WBRA 4IFVA 3P4UB 3RJMB 1CJUA 4JI4J 2EBGA 4ZP6A 2MB0B 2FGCA 1EKRA 3KJNB 3LALA 2NXEA 3HD1A 1LW2A 4LMZA 1L3TA 5H9FJ 1FXRA 2B9XA 2W25A 3UDVA 5I3UA 4TU9A 2MKCA 1VQNS 3C19A 2M8DB 3HP6A 2NS1B 4NLRA 3MM9B 4DR4J 3OXFA 3M2RB 4URQU 1APSA 3VTIA 2CDQA 5KFVA 2MTLA 1QD1A 2BX6A 4AYBD 3G82A 4F67A 2V69A 4CP5A 1O8BA 5K8MA 3NS5A 1UVKA 2NUUG 3PYEA 5KAKA 2VFRA 5L8RC 2CFXA 1SC6A 2QEXS 2QJ3A 3EYZA 5C2GA 1CS4B 3D9BA 3GYGA 3FEYB 3BQ1A 2A6MA 1N4LA 2BE2B 1L3KA 2WVFA 2YNIA 3R3TA 1H74A 1WF0A 2L9WA 4ES3A 4I6YA 4AUKA 3DRSA 3QGHA 2UP1A 3OR1B 1S97A 1EP4A 3K8VA 2NXNA 2J76E 1FKPA 2VBZA 4ANEA 1BQMB 2BM1A 1WF1A 1GXTA 2UUCF 1PC5A 4B9MA 3CD6S 2MMYA 1U48A 2YWWA 4H54A 4FN5A 3FCHA 2YNFB 1X9WA 5LMNJ 2WONA 1YI2S 5KT5A 4ZCKA 2UUCJ 4K4YA 4IH5A 1DTTA 5HSPA 3PVXA 4P75A 4F4XA 4QIWD 3QBCA 5SUHA 4GVLA 4P7VA 1J27A 3MPVA 2XLKA 1RCOB 2V9WA 3M2VA 4F4KA 3HO1A 2NXCA 2VPZB 2X7IA 2R7UA 2JLGA 2A2CA 3VAKA 1X4DA 3AOCA 4GMKA 1NCLA 3QGPA 5GMEA 1NJIT 4P10A 1RAJA 5DLGA 1XNRF 3ISND 3DCAA 2W2NP 4OZ0A 1FJGF 3ZC4A 3K5PA 3GFYA 4LFBJ 4LT6A 5RUBA 5KFUA 1FJGJ 2M88A 3FCWA 4RKUC 1AT1B 2L48A 5KT2A 2DGTA 3FSIA 3DOKA 2B9YA 3GTYX 4CWBA 1PILA 2Y3YA 4C8LA 4FYVB 3M8SA 4CDIA 5AJ3J 2YX1A 3MM5B 3EGZA 2XI3A 4Y65A 2DHGA 5C42A 3TP2A 4YDDB 1BQXA 1NK8A 4A47A 2IC3A 3KLHB 1X5SA 1XMQJ 3BH6B 2MLYA 1FKAF 2C2RA 1MN7A 1YJTA 1NZ8A 3NG8A 3M6XA 3R5GA 4HEA9 4N7TA 5IQQA 4TYBA 1H3DA 2MKYA 2ZVIA 2IHR1 1DZ5A 3NBPA 1LW0A 3M6VA 1VBZA 3D6TB 2PFFB 5D4NA 3U1NA 1HWJA 2J9DE 2FZGB 4OMFG 1N5YA 3KTQA 1ZPVA 4HTJA 1S1UA 5HROA 2EKNA 3OJSA 1PKUA 1YG0A 1DQ9A 1JLGB 4GO5X 1U0HA 3D6HB 3MTJA 3HHLD 4IUFA 1WJ9A 3BSCA 5IFMA 3KDNA 4ZK7M 1O6XA 2L3MA 4Z2XA 1HMVA 1PBAA 2HVEA 1TELA 1S9GB 4I4BA 1OYEA 4ZJQA 3C6UA 4KJIA 2QA4G 1MWQA 2HNYB 3HFKA 2CQ1A 1CJTB 5LSRA 1T9XA 5IWAJ 2HFZA 4LFCF 3UNGC 5F3ZA 3SYZA 3OXGA 2HHPA 4IOBA 3DLJA 2BW7A 4LFCJ 2OPPA 1WORA 1HIYA 3TUZC 2QZ8A 2AJFE 1KRPA 1G4CA 4B9VA 3UDCA 6AT1B 1ZM2A 5A8KA 1WG4A 2DR6A 5GAEI 3NCRA 2BEFA 4BBYA 3FMBA 2DNMA 3VAMA 3VAGA 3JSYA 2MQLA 3PYGA 4ED5A 1OY9A 3VVTA 3W63A 2OUGA 2HURA 3NOGA 1YBAA 2AKWB 2DGQA 9RUBA 2IJRA 2YNHB 2H5EA 2V8VA 3O44A 3CJ2A 2H4YB 3EM1A 4HI2A 3OV7A 2BJ8A 4X4NA 3DHXA 4ED8A 1IJEB 4WP8A 3M8PA 3MEGA 1JWWA 2BRKA 4KKOB 1Q53A 2RUSA 3IFEA 2BJ9A 3S7RA 1Q86T 3ITHB 4A8MP 3PFEA 5A6WA 1B0TA 1LWEB 3J7A1 5J1EA 3CUNA 2KHCA 1FD2A 3LPEA 2IDLA 2APOA 2CQ0A 1UCNA 1CEZA 2ROGA 1NH8A 1Q82T 4J9MA 2XS7A 4V19X 2IY5B 5KOXA 3HF5A 4EEYA 2ZC4A 2OMOA 1IN0A 1RWMB 3BR8A 1RT3A 2PMHA 4NLTA 3PJ9A 3ET6A 3HI9A 1SIWB 2MXYA 4ILRA 1E6VA 1JX4A 5BYSA 1VQ5S 4DR2F 4R0JA 3UE2A 5CYQB 1SUQB 2JEJA 2HAFA 3H4DA 4DR2J 4L73A 2YWGA 2ZUGA 2E44A 2CVIA 2J5AA 3GFZA 2RF2B 2LFVA 3AB2B 2VG5A 3SCIE 4C7QA 3CO9A 2R8KA 2MSSA 2LMIA 1BUXA 5MLCV 2DISA 3TJ8A 3LGHA 1SH2A 3I0SB 2C2MB 4OX6A 2ERRA 2LQ8A 1RJJA 3L7UA 3TA1A 2W8LA 3BPDA 2O01C 4CLSA 4ICLA 2NUHA 3VQTA 1YJ7A 1BQNB 2JWNA 4LFAF 1Y4ZB 4MJKA 5IC4B 2IAJB 1RLCL 2CJ9A 3QFHA 5D78A 4FXWA 1VQOS 1U1OA 2CUYA 1H73A 3FEZA 4B17A 2J9EA 2IA6A 3HVTA 4R25A 3AD7C 3ILLA 3CJKA 2AWZA 4WU3A 2R7SA 4OYZA 1YRTA 4N41A 4MK8A 1RT4A 5E0OA 2CWXA 1F5AA 2D9PA 4NA3A 1HQEA 2E1CA 3ADAC 2DPJA 1FNMA 1EHWA 2W2PP 4TY8B 1NDKA 4WTYA 2M8HA 3PJWA 2XHCA 1VQPS 4OLOA 4WFYA 5B08A 5G0RA 2I5JB 1FHTA 3FBEA 3DOMA 4O4GB 3OD2A 3CMAS 1RTDA 4I2QA 1IR1A 2BJ1A 1NSQA 3DI6A 3R7BB 3H5UA 2M2BA 5HAOA 1GQEA 5A8RA 4F04B 2V8HA 4YS2A 5IT9U 5D4LA 5A2QY 2NPFA 2QMUB 1S1XA 2KXFA 2MZRA 4FYWB 2UXCF 2R4FA 1DAXA 4G1QA 4ZIWA 4RU9A 3CGIA 3LWMA 2JDJA 3ENAA 2VF3A 5KG7A 4JI5J 2CNKB 1EQMA 5CYJA 4QIVA 4YY3F 1KWMA 2RDIA 4UF4A 2RU9A 5ETQA 3CPWR 2VA3A 5KFWA 2VBYA 3L95X 4JI0F 1AXQA 4LSLB 2K1RA 3HM9A 1SKUB 3BGRA 4IO9Q 1N32F 1WC4A 4H4MB 4DR7F 4U7CA 2C2OB 4JI0J 5GAGU 3FRZA 1ZA1B 2C42A 1N32J 2LEPA 3C46A 4DR7J 1C0UA 4NZ6A 4FVMA 2HFNA 1QAJA 1U6ZA 1IR2A 4ALZA 1T9WA 5ETRA 4CLLA 3Q8RB 1IBCB 5ETTA 2Y8YA 4FZVA 1ZM4A 2XMJA 1VIOA 3GZ7A 1DFDA 4X4SA 4F4ZA 2B5JA 3J7YU 2GIFA 1MW7A 3B82A 3NEKA 3G6ES 1FESA 1IKVB 1UVMA 3M6UA 4USTA 4DV4J 2XS5A 1DRZA 1CQMA 2DR7A 4NCBA 3M8QA 1GMVA 4QR2A 3FQKA 1Q8KA 4AXIA 4OI1A 2RQMA 2KJVA 1U4BA 3R5CA 2OPRA 4K2XA 1FDDA 3E01A 4IKAA 3C15B 4PQUB 3MR3A 3NWRA 3KK3B 2BANA 2RU3A 4MFBB 4L3KA 1TK8A 1VRQC 4ATNA 4I2PB 3TZYA 1FFSB 3PEJA 1Q81T 1TAQA 3H20A 2C22A 2EK1A 2WSEC 3EVWA 4YB6A 2Y1LB 4CO0A 4OL8A 3TR5A 4RNHA 4ES2A 1V9OA 4B3MF 1B7YB 4P72A 5F9NA 4LF7J 5JVHQ 3TARA 1NB2A 3GWCA 4XAKA 3MUMP 4A8FA 5K20B 4Y00A 2KH9A 4C11B 4RNNA 2DNZA 4OI3A 2DCLA 3CIMA 2WB4A 3EICA 5HO4A 1X4HA 2DH7A 5IQ6A 2DKOB 3V4MA 2XMTA 1XJWB 2NYHA 1KD1T 4CTAA 1UPPA 4L72B 4UOGA 3EDQB 2V4JB 2W2OP 4DS5A 4RW9B 3Q23A 4K0KJ 2RAQA 3O8WA 1WC0A 1N6QA 3ILOA 1U02A 2H51B 2Q79A 4W90B 4Y2CA 3BSOA 3NNCA 4WFNQ 2VFVA 1HFEL 4Y2AA 2ACMA 2AX0A 2A18A 2KT5A 4EU0A 3J7ZT 3V6JA 4OLPA 4XK8C 3UNYA 1YBTA 3KFWX 5HANA 4CM2A 2D69A 2EFNA 3KLEA 2ROPA 2FPHX 4USHA 3I4HX 4BLGA 1K0TA 3KK2B 3D0HE 1GMWA 1SBRA 5GADI 1UL3A 4ZLLA 4Y3CA 1S6QB 5HMYA 3DM2A 2YQ0A 3CJQA 4O3QA 5JMNA 4M1KA 2LQJA 4BC7A 4U95A 4DR5F 3CEDA 3OW2R 4DEZA 1AZSB 2V6AA 4QJVA 2B9WA 1H0HB 2LDIA 1R8CA 3GPAA 4FYXB 3IWLA 4OZJA 3RB0A 3MEKA 4DR5J 3MPUB 5KFRA 4KGKA 1U1LA 4MKVA 4ZVSB 2Z2YB 2DIUA 1QE1B 3UDEA 3PO5A 3S6EA 2F8MA 1I5OB 2XSJA 2AYMA 4IYQA 5DG7A 2VICA 3FSYA 1HNVB 2F7VA 2GAGC 1N5VA 1RA7A 4K4VA 2KB2A 2F63A 1HWIA 1S12A 3OPKA 4URGA 4Q43A 3B6BA 2PT0A 4O3NA 4MYUA 1F9HA 4IG0A 4IRCA 1B64A 4O3PA 4ED7A 4ZVOB 2H65B 4YB1P 3LTOA 4R0EA 3N6NA 2ZE2B 3R27A 1D8YA 4DFKA 2HVIA 3K5MA 4C8NA 2FVCA 2YWHA 2EFPA 3I32A 4X64F 4NEYA 1YIJS 3P49B 2D9OA 5LT5A 2IVMA 3LAMA 3V6HA 4U9RA 2E1MC 4ZA1A 2CQBA 3BQ2A 2JEGA 2DGOA 2XNQA 3SFUA 3UN3A 2ZDOA 5C24B 4MT1A 2YY3A 2FLOA 2HBZB 3RW6A 2ALZA 1VQ6S 4B9TA 4HHJA 4QW8A 1RE1B 3PDNA 4NCAA 1U1KA 3DRRB 1KHVA 2ASLA 3CC4S 4KY3A 1NSAA 4QU6A 1JMTA 3KYLA 3ZZUA 4A8XA 2PGCA 1VLYA 3OHBA 4KQZA 1H38A 3ZFVA 5KFMA 4LBHA 1GAOA 4M94A 4WF9Q 4K50A 3ZZYA 1HBNA 5CAAA 3IAM9 3UI3A 5A8WB 3RZAA 4JYAF 1SJ1A 1JLQA 3MAAB 3RAXA 4C0OC 2JLFA 3DN9A 3HPOA 3NOCA 4RUAA 2ZBRA 4JYAJ 4OYBA 1RCXB 5J2PB 1SH3A 3QT6A 1JXEA 5HQMA 2J0QD 5J2QA 2RUGA 3VALA 4ZPVR 2FHKA 1E6YA 4ZVQB 2MQOA 1X5OA 3QZ8A 4DPYA 4NXMJ 1KNZA 2ATLA 1ZBTA 4Y2KA 3PYFA 3PM9A 2XZWA 2DXDA 5CYMA 2C3UA 1KKHA 1VQMS 1K8AT 3HHNB 3KLIB 5G4DA 3TUPA 2NZCA 3MUTP 2JOQA 3KHHA 3SV3A 4RNMA 2BQ3A 3VVUA 4HHHA 4U7UK 2J0SD 3RRHA 4C9DA 1YLXA 2PIIA 3QJPA 1GNKA 3M9MB 2VFTA 3MM6A 2FVSA 2AGOA 2HS4A 4ZLPA 1ROFA 4H4OA 3W64A 1YHQS 4USUA 3T1HF 1C0TB 1QTNB 3KOAA 4PZVA 2RS2A 3UR3C 1FO1A 2GC8A 5E3RA 3GONA 1T05B 4MK9A 3T1HJ 2HBYB 2CNOB 3DMJB 5HMZA 4NYPA 1EKSA 1Q4RA 1IQTA 1XNQJ 1T0TV 4Q7AA 1WTBA 2YQ1A 1T9YA 2OO4A 4KH1B 2DNGA 1JLFB 2GGPA 4F0MA 3R9LA 1KEKA 2ZEJA 1UWBA 3M30B 4DV6J 4RUCA 4RW8A 1K1SA 4IH7A 3MMJA 3C6TA 4F02A 4YQWA 3TZWA 2HFUA 1N36J 4ETXA 3CO0P 4IG3B 2HRTA 1NDLA 1IXKA 1S6PB 4ZP9A 1S10A 3KKFA 3SBMA 4DV1F 1PJ5A 4AQYF 2F9DA 1KC8T 4NMXA 5EN1A 1Y9OA 1NUEA 2DR9A 3V81A 2UVWA 2N3LA 4CT8A 1SL0A 2VG7B 1AFIA 1UFWA 5CCLA 4AQYJ 2RRBA 2IM0A 3EVMA 3N5FA 2AYBA 1OPZA 2VZ9A 2J8AA 4B9SA 4ZP8A 4YOEA 3K5OA 2G2OA 3BGLA 3MEDA 2FB0A 2OSRA 3R6GB 4FBTA 3EDRB 2BKPA 2CPEA 3JYTA 1S7HA 4RO0A 5EWEA 3I0RB 2DNHA 1U26A 5F8HA 3PW2A 3IXQA 2QT7A 3UD4P 2BE9B 2YPYA 5KOWA 3RBDA 3N01A 2HMIB 4DLGA 4G1IA 3EUNA 1PJ6A 1RU2A 2WVDA 2R7RA 1HYSB 3KJQB 1TTHB 2YNGB 1U49A 3WX4A 2KKHA 2C3OA 1BHNA 3OUYA 1NHVA 1ZZFA 4U67Q 1Y10A 4DX5A 3MD3A 4I69A 3QZ7A 2VJUA 1LWFB 1HARA 4FVCA 3PG9A 5KFXA 4CLUA 1N5TA 2XCPA 1VK8A 2XMVA 1VBXA 4BCAA 1URRA 1LK5A 1YTYA 3PHTA 3CWJA 2XGQA 1VRTA 1S0NA 3QLHB 3W65A 1HHTP 4HL9A 4KHRA 5BYQA 2VQEJ 1RT6A 4RZRA 4A8KA 3Q2TC 5ITHA 2YH0A 2DR5A 2WAQD 1PAEX 3KDOA 4CQ1A 1SB6A 3H2LA 4RNFA 4X4TA 4A4JA 3AAWB 2CG4A 3W8PA 1TKXB 2UUTA 3RGIA 3WHIA 1M1HA 2B4PA 4GC7A 5HLFB 2WCXA 1HQUB 1QUVA 2HRYA 3Q8UA 2E5LF 5LXRA 1SKWA 4K4UA 5HQ8A 1U2CA 5HK4A 4XDCA 2OJ3A 2MYFA 2MY8A 2OPSA 4CLKA 1L3UA 2EG1A 2QX0A 4NLQA 4J9RA 2F8HA 3JAMY 3TOQA 3AODA 1AYEA 2E5LJ 2BBEA 5HVGA 1UWAA 3I56S 2YWKA 3M8WA 3UDLA 3I55S 3LGNA 4IFVB 1PYOB 2FD2A 3KLVA 4JV5J 5IM0A 3CJRA 1RI7A 4I7FA 3RR7A 2KVQE 5LM7E 2XY6A 2UXBJ 1U25A 3MMCA 4NOHA 4RUHA 2UXDF 1LW2B 4WPAA 1UFLA 3LUYA 2N82B 3M05A 5I3UB 1A9NB 2V9KA 3DDNA 1R7IA 1VK3A 4TQRA 4DUZF 4NA2A 3R1HA 2ZOFA 2ZD1A 1JKHA 5KFBA 1XQIA 1YWXA 3HDSA 1X60A 4TLQA 4NL5A 1WSRA 3CIZA 2CZVC 3BREA 3TUIC 5K14A 1NK0A 1CJVA 2W7OA 1LV5A 3MM7A 2HQCA 3LW5C 4QIFA 3QT8A 2YNIB 1X4AA 4FYDA 2BUNA 1YJNS 3SCJE 2G2ZA 4OIXA 3KK1A 3LA0A 4UOFA 1S0MA 1LXNA 1FVSA 3DRSB 1LWXA 5E3CA 4TU8A 4OX8A 1HI1A 3MR2A 1UPMB 4MK7A 3CC2S 4DZ6A 4TLRA 4M95A 3J80Y 2HHTA 3FZBA 4L3NA 5BXIA 2QYCA 1J5EJ 3IC1A 1U1MA 1D9FA 4Y0FA 4ERDA 2UV8G 2YKMA 1FF2A 5GAHI 3NY0A 1UJ4A 3QJLA 1HLWA 4B02A 5KFZA 4LF4J 1DTTB 1RTIA 3M32A 1WDDA 1HBOA 1GFWB 4RR5A 4MKAA 4F0HA 4RWWA 4DPUA 4O23A 3MHYA 5JVGQ 2CPFA 4EUVA 4TU7A 1PSDA 2RB7A 3M2VB 2HZCA 3HKWA 3ISZA 1L3SA 3BBFA 4M5KA 3D6FB 1R8HA 3T1YF 3H5YA 1VC6A 3OVAA 2WSFC 2QA1A 3HHLC 2XWXA 4YHHF 1WSVA 1QY7A 3T1YJ 4Y6IA 2DTJA 1TVRA 4LIRA 3W3SA 2ZNYA 1ZPWX 3ZTSA 3CCSS 3JTPA 3SSSA 2I8EA 3J80U 4DWIA 3PY8A 2P8IA 5BR8F 3VWSA 5FJ4A 3LP0A 4RBUA 3NGRA 2FLLA 1SL1A 1MSWD 4PG4A 3FBCA 3Q2SC 4KPYA 3PKMA 5C42B 5BR8J 1FFWB 4LF6F 1FDNA 4OI6A 2IC3B 2ZJQQ 1U6BA 1WC5A 5KT3A 2JH3A 3VR1A 2DEJA 1WOOA 4LF6J 4ZLNA 1RT1A 1Q0NA 2UUWA 2R7TA 3TAQA 1RWUA 1AW0A 3GJQB 3DOLA 2WOMA 2MJUA 3NBPB 5IXUA 1GH8A 3CC7S 1UFKA 1HA1A 2FJBB 1VMBA 1LW0B 5EGYA 3JQMA 4W4MA 3GV7B 1ZH5A 2COLA 2RIJA 4NLXA 3CDBA 4KC5A 3DLEA 5DGAA 1MMDA 3KWMA 4IDKB 1WG5A 2ZBQA 3JS9A 1N5YB 1S1UB 4M5IA 5HROB 1MU2A 3A8KA 3KG4A 3OFHA 2ZH3A 4DR3J 1DQAA 3TZXA 1YJUA 3L09A 4KFBA 2L9NA 4ZPWR 3MDFA 3OR2A 1N5SA 2U1AA 1KLMA 2XZDB 3CCUS 1FXLA 4FF3A 3C6UB 1XN9A 1ZM9A 4J9UE 2R2RA 1FRXA 4XTTA 1URNA 1VIXA 4OZ1A 3MMBA 1S1VA 4LVNP 4YB7A 3MFHA 2GNKA 4J7CA 2E7VA 4WCEQ 2ACYA 3GP9A 3OJUA 2OPPB 2X1BA 3AXKA 4QWDA 3CSKA 4WTOB 3EGVA 4X4RA 2AJ4A 1EAYC 2OMLA 2OD6A 1Q16B 5A8KB 1T02A 2VASA 1KP6A 3IWNC 1GT8A 3BO4A 3GMGA 1HPZA 1FRKA 2E9TA 2UVVA 1PC4A 1T3OA 1S77D 4OJGA 5KFGA 1NSKL 3NGDA 2CPJA 1T9UA 3OLAA 5D0GA 4FNHA 1RAOA 1RAIB 2P2CB 1UKUA 2WSCC 2DXEA 3W61A 2B56A 2DNPA 3N6LA 4HT7A 3GE9A 2FJWA 3AJ1A 4OHYA 1TV6A 5D3GA 1WKLA 1KOHA 3FCVA 2VC0A 3RW7A 1U7LA 5FLXY 2EFOA 3M8PB 3MEGB 1RHRB 3U02A 2PC6A 3ZXWA 2XMUA 3KNGA 3P96A 5HVHA 3U1MA 3PEHA 1WEXA 1HL6A 3N28A 1X0FA 4RBTA 3MECB 1WHVA 1ACMB 2OTLS 4GKKF 3WC2A 3MFIA 4OJ3A 2POKA 3IGNA 5DZ7A 2H9ZA 1QAXA 4QOTA 2DK2A 4IFYA 4B08A 1XR5A 4NLYA 3CD7A 1S99A 2FDNA 1FJCA 4ITSA 1HKAA 5DDPC 3P3DA 1F9FA 1VBYA 2D74B 4F25A 4E8UA 4LF8F 3ZTPA 4M5LA 7AT1B 2G0JA 1K73T 3D1QA 4QZVB 3PW0A 4WK3A 1RT3B 1SJFA 4LF8J 1WNEA 3HSDA 3KMQA 4O0IA 2HFVA 1Z1ZA 5H1SV 1Y00A 1E6VB 2ADCA 4C0BA 1NKCA 3H25A 1IBKF 2EI5A 3HXMA 3OL9A 2DVIA 2KFZA 4PPZA 1HR0F 3GG0A 4ZITA 1P1TA 1NHKL 4QR0A 2ZOMA 1Y11A 1RT5B 5FLXU 1BGXT 4J5OA 4ZS6A 3THPA 1CS4A 4CLTA 6FDRA 3EZOA 2B4UA 4N5SA 1C1BA 2FGOA 3MCMA 2VG5B 2JEIA 1Q78A 2ZFHA 4RW4B 1JLCB 4R8UB 2VV5A 3CF5Q 3BZQA 3AJ2A 5DG9A 3DGPA 4WXOA 2JEFA 4QWAA 1PJ7A 3N4WA 3RB6A 3QIPA 5F0WA 3LP2A 4P73A 1RAHB 5DJBA 2QL5B 4ICLB 2RJZA 1NK7A 3TAMA 2MQ8A 2CWKA 5B0GA 2JNJA 4OYMA 1QSSA 2J6UA 4J9QA 4TNOA 5GMDA 3IAS9 2HQIA 3HVTB 4C6AA 2J0WA 4DZDA 1VQSA 1OY8A 4RWXA 3RUBL 4DV3J 2R8GA 3PNIA 1RT4B 5B7WA 1XWLA 4EI2A 1HQEB 2XO6A 1X0PA 2MKIA 3D4JA 2LQ5A 3LAKA 3BBCA 5HN0A 1TL5A 2K7KA 2KM8C 1T9VA 2LYVA 3W2VA 2CNLB 1D8ZA 1C2PA 4NRTA 3P6YC 1N0UA 5G0RB 2XI2A 1JLAA 3DOMB 5LSOA 3SEOA 2OHDA 3TWZA 4KB7A 3MCSA 4I2QB 1TAUA 1SQFA 4TYAA 3H8YA 3OVSA 3OTOJ 1X4FA 1NDCA 3THVA 3QT7A 1XERA 1RZMA 2QLJB 3S8SA 3HSJA 2QV6A 5DRKA 2LA4A 2HRUA 1S1XB 5AXLA 1B3TA 2WBMA 4EZ9A 1U2RA 1WG1A 1EIYB 3DC2A 3VZIA 1YGYA 3MM5A 4B3RF 1Y7PA 4L75A 3BKFA 1VHIA 2DGXA 1IKWB 2EC0A 3KLHA 3LH2S 4L6V3 2IJNA 5AXKA 5H9EJ 1ZAXA 4B3RJ 3HJFA 2BQRA 2BKOA 3K58A 2B7CB 3IMQJ 1IKYA 4F0KA 3TJ9A 2BMBA 4BS2A 3DFEA 1BLUA 5J2NB 2G0IA 4Q44A 2K1RB 5DDRC 2H1YA 3TANA 2JZ5A 2HQDA 2RDDA 3KG1A 1RK8A 4P7TA 2KZZA 3TJAA 4JI7F 3W9HA 2VH7A 4X66J 3FBFA 1C0UB 3IBWA 1NJWA 3TI0A 2ZBCA 1NJZA 4LF9F 1XEZA 4JI7J 3MAQA 3PKYA 1X4CA 2Z2MA 4BHQA 3NP5A 3M8YA 4LF9J 3G2XA 3MCNA 1ZTWA 1CJTA 3DDIA 2B5JB 1KQKA 3H2VE 2BJDA 1GEHA 2UVRA 5JUMA 1IR0A 1TL1A 1IKXA 3TVYA 4DL0C 1YITS 1NXIA 3MXHP 1LNQA 5EWFA 2ILZA 5IC6B 3O3LA 1P27B 2Q66A 4NLUA 2VL1A 3TEHB 4RBVA 2R8IA 3M8QB 3SQGA 2FVPA 3M2UA 2PA3A 2VB6A 5CZXA 2Y8WA 3FRYA 1NBEB 3OL8A 2F65A 4TKTA 2DHXA 2OPRB 3GB0A 3HVWA 4WXWA 3E01B 4B9NA 3IG1A 2EPIA 2HAIA 3LF0A 1T03A 5E7OB 5D6GA 2HBQB 3D5MA 3G6YA 2QO3A 4HR2A 4NYZA 4JI8J 3I9V9 3DDKA 4CH7A 1NKBA 1JLEA 2BANB 2GQQA 2EC2A 3IP0A 4B3TF 2D7SA 2V8PA 3Q22A 2FHOB 2OLWA 2JX2A 4RU2A 2G1HA 1S76D 4IRDA 4KBIA 4B3TJ 1MWZA 5IV4A 2X1AA 4ZDNA 4B3SF 1FT8A 1GXUA 4GKJF 3L4BC 4ZPTR 1UETA 3BQ0A 3G6VA 1IUJA 1NHUA 3EPIA 3R5AA 4Q8EA 3WX8A 1YX2A 1R6VA 4B3SJ 2IPOB 1X5PA 3CMES 4GKJJ 1LKZA 1WC3A 5M2PA 2LXUA 2RMLA 3OL6A 4RJVA 1BWEA 2IJFA 3X3UA 2IM3A 3L7PA 3ITHA 5AE3A 4QWEA 4X65F 1IBMJ 2DH8A 3A3PB 4LRBA 4CTAB 4NLWA 3NMAA 2CQIA 4ZVRB 2PDAA 3QIDA 1N6QB 5HI7A 4NLOA 3PTWA 3HD2A 1SH0A 3O2IA 3RB3A 3L9ZA 4DL2A 4OI4A 2CA9A 4OYIA 4OJHA 1NEEA 4ANCA 3HT0A 1FRLA 1I94F 4X4UA 5E5NA 4ELUA 1ZETA 2DR8A 1RP5A 2M5YA 2MZQA 2FUG9 4EYIB 2DXFA 2JHEA 2R9LA 3RAQA 1I94J 3R8YA 1NJYA 2CAJA 2FY1A 4ED6A 1FEHA 2ZBPA 4DL5A 1N5QA 5CQGA 4RNOA 2DPIA 1N52B 4RW7B 2VONA 1FI4A 1SUQA 3FSXA 4FXVA 4NZ7A 4KO0A 4DSIA 1SJ4P 3OBIA 4JI4F 2HYIB 2RS8A 2RF2A 3BN4A 2QFIA 2Y1JA 2LVWA 4DL7A 2IMWP 2OPQB 4H4KA 3X1LB 3AD9C 3CJ8A 4PYAA 2O66A 3BO3A 4DHVA 4PAAA 4AXJA 1ELOA 1HBUB 1CVJA 2HLUA 2XSJB 3I0SA 1V5VA 4CO5A 4XPCA 4DR4F 2W7AA 3PX4A 4ZPBA 1BE4A 1BQNA 4LVOP 5E41A 2E1AA 4C8ZA 4XPEA 2CNNB 3M6WA 1W25A 2Z30B 1D9AA 1H2TZ 2A3JA 2KXHA 2CRLA 4I64A 1RAAB 5F0UA 1DQ8A 2DRDA 3KUHA 1NZAA 2YWEA 3HZGA 3OHAA 1K0VA 3H4BA 5D0RA 3MZIA 1NH7A 2B9EA 4C0HA 5D15A 4ECUA 3DLGA 4KGXB 2R8JA 4WKYA 2E7XA 1PCAA 3ICLA 4EBEA 3EXCX 1VQ8S 2NLWA 5ETOA 2EKYA 4DX8H 1M90T 1YVFA 3V6DA 5DDQC 2G0CA 2KZMA 3ETMA 4Q45A 3R6LB 2VHGA 5EWGA 4MKYA 4P71A 1ZS6A 3PX0A 1Y3KA 3VGUA 3DYAA 1Y5LB 4O4GA 3T5HA 2VBXA 4ED0A 1X4GA 2QLWA 1TFWA 3HFZB 1S9EB 4U8VA 4J9KA 1QJHA 4DL4A 4WE1B 2V94A 1QAYA 3K0JA 2IYGA 2FJVA 4F3MA 5LMNF 4MIWA 2FHMA 2QMXA 2W8KA 2EEYA 2XB2D 1HBNB 2QIFA 1FDAA 3EZUA 5ETPA 2DEIA 1RUSA 2B7BB 4PR6A 4MIBA 2LXIA 2UU9J 3GSDA 4ZN3A 3JQKA 1KFDA 2MPUA 2IM2A 3GIJA 2C2EA 2YPZA 1AFJA 3DU5A 1VQYA 4O44A 4XIUA 2B0GA 2EW9A 5J2QB 1QSYA 1E6YB 2KDOA 2LDYA 2BXJA 2OTJS 1WEZA 2HS3A 4PXCA 4O0NA 4DMZA 2AF6A 2QG9B 2YKNA 4LFBF 1CJKA 1FCAA 4H4MA 4F4AA 3L3CA 3BF4A 4IOCQ 4NLSA 4FS1A 4ZPAA 1P1LA 5AJ3F 2ZUAA 4DFMA 3QNWB 4WP3A 2KTQA 4WJBA 3TEGA 2MQPA 1XMQF 3Q89A 4DPOA 3IRWP 2DITA 1QTMA 3MM6B 3ULHA 4CLPA 1D1UA 4KR0B 4GO7X 5AXNA 4H4OB 2OFGX 1S49A 2AQ4A 5T7LA 2PEBA 1VCTA 3PYDA 1TMMA 5CXTA 5T14A 1C4CA 5F8GA 5KFLA 4P2SA 3MPYA 2QRRA 2WB1D 1EARA 3TX0A 4ZVPB 4FDFA 3HHEA 4USMA 3CDEA 2CJAA 2ZJRQ 1IBLJ 2GVZA 3GFHA 1M5VC 4HT5A 5ETMA 3TAPA 1UA1A 4DQPA 3HVRA 2GGPB 1XC9A 3US5A 4EZ6A 1SV5A 2CQ4A 1RISA 3KK3A 3CE8A 4RW8B 3PIOQ 1VYAA 1VISA 2KM8B 5IWAF 4MFBA 3C6TB 4ZLJA 5E33A 4I2PA 2AGPA 1ZA2B 1U8SA 5LMUF 5EDWA 4EBCA 2GQCA 2G2YA 2AV5A 1UVNA 1JXVA 3CXCR 1DURA 2W1BA 3HMJG 2D3O1 3FK4A 4UQGA 4K2JA 5LMUJ 2CQDA 2C2ZB 5D77A 1WELA 1YDLA 1U2FA 2DY1A 2J9DA 4NX9A 4DN9A 3DU6A 3BBBA 4A48A 2VBWA 5HBMA 2RT3A 3G87A 2SXLA 4ECZA 1HNWJ 3TW0A 3WZ0A 2I2YA 2KFNA 2AZ3A 2JVOA 4EMDA 2MQMA 5DDOC 3ONQA 3KXDA 2HK2A 3QQCD 3QAUA 1GMWD 2V0NA 3M7VA 3BH7B 3RRGA 3R97A 4J9VA 1HNZJ 3JXOA 3AD8C 3HSGA 1FE0A 2XS2A 1VDHA 2J7KA 5L9NA 2W4DA 3CCRS 1IVZA 1SC1B 5E3QA 2VJVA 1MN9A 2ROEA 3K57A 2ZOGA 5LJ5Y 2R2UA 5KG0A 3KK2A 3OUYB 2RQCA 1R8AA 3E8OA 1FNXH 1R8BA 3GJTB 3MI7X 1S6QA 4LR7A 4KSEB 1TUGB 5L46A 1RAFB 3KLFA 4DSFA 3PV8A 1N0VC 4E98A 4DI6A 3GILA 4FYYB 2KVIA 2HWIA 2AIRB 3R2DJ 4F4YA 2HK3A 2KHDA 3T5JA 1VRTB 3UVJB 4PEOA 3CDAA 2NPIA 2R42A 2E9ZA 4X4QA 1RT6B 3FMWA 2H5JB 1JJ4A 3I5CA 2PFDA 4UOCA 3VGSA 2DNKA 2EFGA 2GVDA 4Q2MA 1B70B 1PBUA 4QIGA 2FZKB 3J81Y 1HNIB 3QRRA 4PCQA 2OP5A 1Q8IA 2WW8A 3NL0A 2AT1B 2FHJD 1MROB 3IR7B 1LK7A 4Q0BA 3A13A 4OZ2A 2ZH6A 3GIMA 2G4BA 3CCLS 2MSTA 1TU0B 4JI2F 1NB7A 1YJ9S 4AL6A 3AFGA 1G6BA 3G8SA 1C4AA 3A8JA 3DXSX 4JI2J 5B0EA 5C24A 2M70A 5LL6d 4P9SA 3N9UC 3TA0A 5IM0B 2RQ4A 4KRWA 2OFHX 3AT1B 4I7FB 2V2VA 2ZH4A 1RA6A 4LSZB 3WQPA 3R7SB 3MMCB 3TQ1A 5KFNA 3VZHA 3DRRA 3H0PA 3L7OA 2RRNA 3MEEA 2HGMA 3R5JB 3Q8PB 4I68A 4DV2F 1A6LA 3G9CA 2VDHA 5KFAA 5B09A 2LA6A 2DJWA 5IT0A 2ZH2A 1JKHB 2JSXA 4G1PA 2V8DA 3JSMB 3F73A 5B0AA 3T6BA 4DV2J 1UMJA 1LQ9A 2CADA 1TKTB 2DBBA 3MAAA 2D3ZA 2IYIA 4LF5J 3BS9A 1RADB 5K14B 1PGZA 1CJVB 1QAIA 3MM7B 4USIA 4M5HA 1WC1A 4A8WA 2CJXB 4IOAQ 4DPTA 1FVQA 2HG4A 2I38A 3MUVP 5F3TA 4R5PA 2VU5A 3KK1B 3R2CJ 3IR5B 3BO2A 2EXUA 4CO4A 3IM9A 3NGUA 1XBWA 5HJYA 1JB0C 3F41A 2AHOB 2CPIA 1WI6A 3GU0A 3GV8B 3NGTA 3B78A 5D0EA 2CJBA 1MLAA 2WRMA 3C16B 1RDRA 2YKMB 2QLBB 5KFDA 4JI5F 3TYTA 3PXGa 4N56A 4L76A 1U24A 1M5PC 1RTIB 2XWYA 3M32B 1HBOB 4KHMA 1HNXF 3ENQA 3DGVA 1C0TA 3E2EA 1SC3B 4I67A 4A8SA 1VBKA 1RHUB 1QVFR 2KT2A 2ZNZA 2R2SA 4NYOA 3UQSA 1JJHA 2CQPA 4B3OB 1RGVA 1HNXJ 4PWDB 3JB9k 4HDGA 3RYLA 1NK4A 3G6XA 4AE5A 5C25A 2C1EB 1TK5A 2CJYB 2K7JA 2OEJA 3RBZA 4K4XA 4QQBA 1RBOB 2QLFB 1O0PA 1CSJA 2HHUA 2GFFA 4LF1A 3I4PA 1TVRB 2R3VA 4IR9A 4HDHA 4AFFA 1ULRA 2E5GA 1RB0A 2ZM6J 1VQ7S 3QRPA 4HACB 3GSIA 1JLFA 2JC0A 4G3IA 2Q43A 1S4FA 3K2YA 4A8YA 4JUZA 4WKRA 2DNQA 5IV3A 5K5MA 2RHQB 3LP0B 3BPSP 5A2QU 3ZZPA 2DHHA 5AT1B 4M8LA 3NGSA 3OLBA 3D2WA 1REVB 2XCAA 1S6PA 4DV4F 2FJEB 4XDDA 1UVIA 2VG6B 2DNNA 5ETVA 2MZJA 1CBKA 1QDUB 1W2IA 3DOLB 4IQXA 2WOMB 3W5ZA 4ZMMA 4WYLA 1KDNA 3OTBA 1F3FA 4CNZA 3ZNJ1 2GW8A 3WBZA 2CQHA 2GMLA 3DLEB 2GIQA 2XMWA 3IGVA 2Z2LA 4HHUA 4DR1J 1RTHA 2XMKA 3FEXB 1MU2B 4CI0B 2W9BA 1M0SA 1Q79A 4WIIA 4UZCA 1UEVA 3OVBA 3CVKA 1T7PA 4MMOA 3I0RA 4KFBB 1TUWA 3NS6A 4DLEA 4ECWA 1RLDA 2PSZA 5U47A 3OR2B 2YTCA 3N79A 1TZ0A 3DNCA 1FXDA 2X1GA 3PIPQ 4RL1A 1KLMB 5J2MA 3FBBA 4LF7F 5ADZA 1S6OA 1FE4A 1HYSA 2YX7A 4AT1B 2E1RA 4ZKAA 3UD5A 2XULA 2YNGA 2BOAA 2EVZA 2IRUA 2QL7B 2W9CB 2ZJPQ 3MMBB 3VGVA 1CULA 5IOLA 4JP8A 3CCJS 2KJWA 3MF5A 1CQNA 4A8QA 1LWFA 2KI2A 2UUAJ 1HW8A 2DYAA 2HZVA 4B9UA 2BYCA 4DUYF 3B4DA 1W7WA 3OTDA 4NCGB 1PG5B 1HBMA 4K0KF 3FDSA 1NKEA 2AYGA 4UT4A 2AZ1A 3D3BJ 4DUYJ 2ZZMA 1HPZB 1S57A 2QA2A 4LQ9A 3K8WA 3QLHA 2YWFA 3DLKB 1IJFB 4ED2A 1QUPA 3RTVA 3O6QA 4ER8A 5KFHA 3DRXA 3N6MA 2RHSB 4RLEA 2FQQB 2HPUA 1XR6A 3CULA 4YUDA 4AD6A 4OYAA 3MGJA 3D6MB 4C3MA 4OZNA 1J5OA 4DCPB 2HGLA 1HW9A 4JI1F 1CLFA 1TUVA 1M5HA 1G2EA 3DLHA 1HWKA 1UVLA 1L3VA 1TV6B 4JI1J 1KVKA 2L41A 5D3GB 1RT7B 2O3DA 4DL3A 4D3HA 2KL8A 2QE5A 2E5IA 4DS4A 3P8BB 4FNIA 9ATCB 1XR7A 2GZOA 2ZKUA 4CO1A 4WK1A 3GYNA 1TKDA 3FNNA 1BWVA 2Z57B 2DHSA 2AYEA 1ZTTA 5GADU 1WOPA 1HD1A 2C2NA 2C2KB 3U1LA 2KG1A 2UUBJ 4IFYB 5KG3A 1GK8A 3MR7A 5CHCB 5L1JA 3GR0A 3OTCA 3ZZRA 4UQTA 4UUWA 4MYTA 2J0XA 1S1WB 2AW0A 4LJMA 3EVOA 3T1AA 4A46A 4ENOA 4DQRA 5DS7A 4ILMA 4F2RA 2W2QP 3A3OB 3I87A 4ECYA 4ECVA 3RRKA 4DSJA 4DV7F 3BB5A 3EMTA 2HFSA 3B4MA 1T3NA 1RHQB 2Q3PA 2GMHA 1Q1KA 4DV7J 4P74A 3FUYA 4OYOA 2RSQA 2JRSA 1PYSB 4EWTA 2HQGA 4K7QA 2GHPA 1C1BB 4N8NA 4NLGA 5H9EK 2HWHA 3IRXB 1N34F 3CCWA 3VF0B 3EZ5A 4CYUB 2OAUA 2V8GA 3JQJA 1N34J 3DGPB 4DG1B 3QSIA 4M63A 3QIPB 3LP2B 4YFUA 3ZO7A 1WHXA 3J81j 4NWBA 3GLJA 3TAMB 3JSBA 1F6TA 1S7IA 1EB0A 2HNDA 2L9DA 4ZPCA 5KG2A 1VC0A 3GCWP 4DBQA 2Z8QA 4V1Ak 1YSJA 1K47A 4KGVB 4PQAA 2WVBA 1FKOA 3HULA 3MMAA 3H5SA 5GMKa 3CNQP 2R7WA 2CQ3A 2K2PA 2BM0A 4OJ1A 4NPOA 1RTJA 2QSFA 4KV8A 1NNDA 4LSNA 2E1PA 2ASYA 3CJ3A 4YB5A 4Y28C 4X2BA 4DDFA 2CPXA 1KS2A 1Y0HA 3QYYA 3NS7B 2LQBA 1QVGR 4NXMF 3W2VB 3BKTA 4DX7A 2VPYB 1HWUA 4ZHRB 3V4IB 2GMJA 2Z58B 3K7RA 2MKHA 1JLAB 5DO2A 2A1BA 1BC6A 1ZZNA 2FIUA 2I1RA 2G9OA 4Z37A 1AA1B 3C14A 3J7AN 2KFYA 1TMJA 1R0BG 1SC4B 2HHXA 5GVQA 4PYDA 2J6TA 4OHWA 2QA4S 5ETLA 1JLBA 5J1PA 2PO4A 3PFOA 2B6AB 3BDEA 1XNRJ 4XO0A 2VDIA 1TL4A 2ZVSA 1RHKB 2BVZA 2V63A 1QSLA 2HWTA 4UY85 1H7XA 1ZAWA 3PW7A 4E0DA 3MWBA 1FERA 2LU2A 3T5LA 1S4EA 1HI0P 2MY7A 2N4CA 2FY8A 2LKZA 3AY0A 4C4WA 4CM0A 1P9YA 3WC0A 3EE3A 2R7XA 2FJAB 5CCMA 1RHJB 1RACB 2H54B 1IKYB 3N5BA 4M5DA 3T6JA 1RTZA 3MM8A 1XNQF 2P9CA 1DTQA 8RUCA 1RYRA 1Q95G 1RAGB 5D8HB 3ETOA 1C1CB 1S72S 4C8MA 1RWVB 2LP4A 1B0VA 3IN5A 3UCGA 3OFGA 4IDKA 2LLZA 3D3CJ 2DGUA 3CJ0A 4DV6F 3T9ZA 4NMLA 1GX5A 4C48A 4F3QA 1FJ7A 4J9OA 1V6HA 1N36F 4ZJLA 1U47A 2JFKA 4S0MA 3TVZA 2IRYA 3ZTQA 4ZVHA 4ZVTB 4N76A 1UVJA 1X9SA 1KVIA 1S79A 2V68A 2ZITA 3DRPB 2YKOA 1CC7A 1H98A 2E9RX 1WI8A 2PA8D 2JC1A 4DF4A 3LGMA 1TL1B 1IKXB 4USKA 3WIUA 4O3RA 1XTZA 1UJ6A 4C97A 4NLVA 2FVRA 2C3PA 1KLNA 2XYGB 3RAMA 1RBAA 2GJ2A 1P8GA 1WD6A 3SQGB 1WUUA 4CO3A 3M2UB 1YQHA 4ZIVA 1ZYQA 2GJFA 1N54B 2C28A 4LQ3A 1JJCB 4I1TA 3TQEA 1RWXB 3IG1B 3D1HA 5F8NA 5K8NA 1F1BB 2K3KA 2J8SA 2MLZA 1T03B 3SDEA 4DFPA 3P45B 4QBUA 3W62A 4CIOA 1JLEB 2YXLA 4LUBA 3IR6B 1AROP 4DQQA 3ILIA 4LRAA 2WVEA 1VQKS 3SI8A 2V5HG 2JL9A 1VS3A 5M2RA 1H2VZ 5B0FA 4P2FA 1TKZB 1H72C 3VAJA 2CPYA 4ID5B 2BZ2A 2LECA 4LRFA 3OFFA 4K4SA 5B0BA 4EFAC 4B9LA 1D3WA 3CT9A 2OEKA 1KOOA 3FKBA 4JOUA 4OZLA 5FDLA 1FTRA 4C3KA 1S6UA 3D7SB 4DV0F 1RT2A 3QO9B 2XSFA 1KQSR 2OGUA 1DLOA 1OJ4A 2HBRB 4DV0J 3MECA 4KGZB 1U45A 2VQEF 2O5DA 4KTQA 3KUEA 2FLPA 3ZNUA 5HP1A 3A8EA 3W2WB 4EBDA 4CH1A 2HFOA 2HW3A 2VA2A 2FLNA 4M5JA 5D0HA 1OS5A 2KYZA 1W26A 3ENVA 4PG7A 3POTB 3MAHA 3KJVB 3G86A 2Q6BA 3UN2A 3QPIA 1NK6A 1B0PA 4J9LA 1X4EA 1DHMA 2LXFA 4K5SA 3TRGA 1WHWA 1AUDA 2D3UA 1FX2A 1VGYA 4ELTA 3GR1A 1OSCA 5L1KA 4RX6A 2N7CA 4EYHB 5L1IA 2OKQA 1CC8A 4NI2A 1RT5A 1R43A 4DSEA 2MKJA 1H6KX 3WDOA 4PG6A 4OX9F 4KO0B 3RR8A 4ECQA 4JV5F 4ZPDA 2OEMA 5DQHA 1HHQA 2DGWA 2WK4A 3HJVA 1LWCB 5FIIA 1F9EB 3NCQA 1FDBA 4QU7A 4WZMA 2UXBF 4I56A 4RW4A 4OX9J 3Q8YA 1JLCA 4R8UA 1L5UA 1CJUB 1JNZB 2HVDA 4UUXA 4F50A 3BSNA 2UVUA 1S59A 3AB4B 2MLXA 3QGGA 1TK0A 2H3EB 1OO0B 1B7FA 2CZ9A 1VJQA 4PXEA 5C7PA 1RWKB 1O51A 2H4WB 5IT9Y 2C3YA 1Z4UA 2W4PA 2F1FA 2Q1LA 4JV1A 2MKKA 2KRRA 2XQCA 4LFAJ 3IS9A 2CXEA 2ILYA 3G82B 4NXNF 4WP9A 3R5DA 3EXYA 3F0NA 1T8EA 4G65A 1KQGB 3DLGB 4NXNJ 3S1TA 4F7VA 2AEFA 2MZTA 2RD5C 3JAMU 3V6DB 3THTA 3B8HA 5BJRA 2P5VA 3QWUA 2DGVA 3T3FA 3DYAB 2HGNA 1UZHA 2IA0A 3M8RA 3VCDA 2HQ3A 2YKQA 2GX8A 5BYRA 1RQ0A 3UD3P 2XLJA 3MOJB 1EP4B 1VRUA 2DY9A 1F5CA 1Y5NB 4DXLA 1J5EF 3DLLQ 2HS0A 1FKPB 3HLUA 1AB8A 5CA5A 2U2FA 4HH0A 4QYRA 2YH1A 4LF4F 3G8TA 2KU7A 3BGUA 1NK5A 4FPRA 2CKWA 1RWWB 1FD8A 3SMZA 3ZTRA 3PHEA 2QN6B 2WONB 1N33F 1U1RA 4K8RA 2LCWA 1WKKA 4LBIA 1K44A 5L38A 1TL7A 1RKIA 1IKWA 2UXCJ 5GAGI 2O67A 4ECRA 1N33J 5JJBA 2GS8A 1KVJA 1M5KC 1PO6A 2EBEA 4O44B 2RKIA 1AUSL 1YJWS 1MG7A 3E3XA 1R27B 5L1LA 5GAHU 4Y34A 5J2NA 1SJ3P 3EJMA 4YY3J 4ILLA 1LOUA 2QGFB 3V5RA 2Z0GA 3HVAA 2PE8A 2YKNB 1CJKB 4QWCA 2ZDPA 4MH8A 3D0IE 3MCOA 2P6TA 4I0WA 2KT3A 3EWGA 1V3ZA 3H5XA 3J7YI 2CQ2A 3RBEA 3W66A 2YKAA 3I6PA 4UZBA 2W2MP 3MPWA 4WYWA 2XO7A 3SSQA 1FK9A 1UZDA 3NRBA 3LP1A 1YBUA 3DOKB 3MR5A 1X31C 3QT5A 2XYHB 4WFAQ 3KLGA 3Q24A 2ABYA 3Q86A 2QL9B 5A76A 1EETA 3HZEA 2YKPA 5KT4A 3PX6A 2VIHA 4ED1A 3AHPA 1UJ5A 1DJ0A 2BJ7A 5T7LB 5KG4A 5KG1A 1KSPA 1N48A 1PYTA 1Q5VA 4FP9A 4U7UD 3FFIA 5C2CA 3DXBA 1FTCA 1WF2A 1G7CB 3PCOB 1RYSA 4F2SA 3FZ2A 4YR3A 4KIAA 1NO8A 3F56A 5KT6A 2MGZA 4CO2A 3K5NA 4NLPA 4DR3F 4DUTA 1WOSA 2GVZB 3I5AA 4K5RA 1V5IB 1OQ3A 1WTFA 3IBFB 2X1FA 2L08A 3SZ2A 4OZ5A 5A0YA 4F8RA 1U0HB 2R2TA 2ASDA 1I6JA 1R31A 1S1TA 3K89A 4LREA 2CYYA 1SV5B 1EX8A 1NSPA 2Z56B 3D0GE 3CJ5A 4PRFA 2FJXA 1HMVB 1NRKA 2FC9A 3N0VA 1U6FA 4O4RA 2XM3A 3MOZA 4HLBA 2FVQA 2E66A 4K4WA 4JB8B 4W92B 2NYIA 1LXJA 5AE1A 2AGQA 3H59A 2H48B 5K8PA 2N7YA 3HHLA 3AJDA 1VQ4S 2ZHOA 4L74A 4GVBA 1NK9A 1SIZA 3CCMS 2CJQA 4B3MJ 5I42A 2ZBIA 1KBRA 3CDUA 4NRUA 5HATA 3AQPA 2NXJA 3C2PA 4USVA 5HBMB 3HK2A 1U8WA 2P9GA 2NSBA 4DSKA 3OXLA 2VQFF 3ZTOA 3TNVA 3T41A 3BR9A 2BOPA 5KFJA 4PUOA 2OI2A 4PWUA 3BKUA 2XNRA 2VQFJ 5L39A 4RW6A 5LXYA 2HNZA 3AQOA 3QMQA 5MAOA 2E29A 2AJ2A 2F4FA 3GIRA 1FWKA 5I3PA 4U6PA 1TL3A 1FA0A 4DPXA 2HKEA 3GQCA 1K9MT 2CVEA 4M5NA 3M1VA 2PEHA 3EPGA 4JI6F 3LWLA 3T19A 3KLFB 4RW7A 1HHSA 3H42A 3HKZD 5LOQA 2F4VF 4ELVA 1R0AA 2PD1A 2R7QA 3W1YC 4ED4A 3CW2C 3D68A 1F2HA 2F9JA 2ZZTA 4JI6J 3B54A 6FD1A 5KFEA 3QRQA 4UOHA 1YKWA 2EFVA 2F4VJ 1SL2A 2FTRA 2OPQA 5J1EB 4FS2A 2KRBA 2AU0A 4E2FB 3V6KA 1KTVA 1IWGA 1VHFA 2W24A 2NCKL 2HHWA 1OIAA 1HBUA 4YP3A 2GVDB 1RHMB 1T94A 5CD4H 2MQQA 4FF2A 4X4VA 2VOOA 4IR1A 4LR8A 3MM9A 3ET6B 3M2RA 1CPZA 4ZN1A 1R8PA 3H90A 1M5OC 2JFDA 4K59A 2WTFA 2Y1IA 1SI9A 2OSQA 2VKRA 2HZAA 2Z2ZA 3BGFA 4Q0BB 4QYZK 1VJWA 2DCUB 1RWOB 3G8QA 1MMNA 3M8ZA 2G1DA 3AA8A 1SJRA 1N56A 2R7OA 3M9NB 3HCXA 1ZOTA 4OI2A 2XG8A 4X64J 2DT9A 1YRUA 3CCTA 3HHDA 3ZZTA 4OI0A 1WWHA 2CQCA 1FEEA 4FKXA 2BE2A 2FHJA 3W9JA 1SVDA 3QGIA 2DRAA 1W2BR 4PXBA 3CCQS 3BSAA 3I9ZA 2XTJP 3VQSA 3OR1A 5J1NA 2XY7A 1S9EA 2RQKA 3NGKA 4WE1A 3GFXA 1BQMA 3MEEB 3BYRA 2H5IB 1N8RT 3NLCA 2F5GA 3CDWA 3NAIA 4DV3F 2MQNA 3D67A 2AJ0A 3CJKB 3I82A 2W9AA 2YNFA 4JI3F 1YZ6A 2IM1A 5F8IA 2GIRA 1F5BA 2UZAA 3BDPA 4NASA 2M0GB 4WZQA 4JI3J 2IIHA 4PG8A 2ZH9A 4Q5VA 4DF8A 4MAKA 1Q8BA 4ZVFA 3UR0A 5HMWA 4R5PB 5HMXA 4WFZA 2HEKA 3OTOF 1KR4A 3JTNA 2RDJA 1RTDB 3H98A 2A10A 5KFQA 1JXLA 1FNOA 3DI6B 2V50A 5KFTA 1SQGA 3MR6A 2PI5A 3AA9A 3M9OB 2RH3A 5A8RB 2PI4A 3T5KA 4IQMA 2KYXA 2CJKA 2HHSA 4G6VB 1Q7LB 3VAIA 5KFSA 3QSYB 1LFWA 2AP6A 4C8KA 4G1QB 2CDRB 2B4VA 3BM7A 3KJFB 5KFYA 1FRIA 3H40A 3IM8A 1ITPA 3UO0A 3ENWA 1BXNA 1SCJB 3CCVS 4DCOB 1F60B 3ZZOA 4BDPA 3AOBA 1HI8A 2E7WA
chains in the Genus database with same CATH topology
4YDDB 1S48A 2GFFA 1BQXA 4DWIA 1BD6A 3G96A 4A47A 1NK8A 3I4PA 2IC3A 1TVRB 1UA0A 3PY8A 3KLHB 1X5SA 5BR8F 4IR9A 4HDHA 4AFFA 1ULRA 2E5GA 3VWSA 5FJ4A 1VQ7S 3LP0A 1FKAF 2C2RA 5C25B 4RBUA 3JTOA 1YJTA 1JLFA 3NG8A 2FLLA 3BGRB 3M6XA 2JC0A 2ZKTA 4HEA9 1SL1A 1MSWD 5IQQA 4TYBA 4G3IA 1H3DA 3LO3A 2Q43A 4PG4A 1SQEA 4X66F 3Q2SC 1F2GA 2IHR1 1DZ5A 4KPYA 3PKMA 5C42B 1S4FA 3NBPA 3D28A 4EO8A 4LF6F 3K2YA 4A8YA 4JUZA 2MZSA 1FDNA 4OI6A 4WKRA 2KO1A 2IC3B 2ZJQQ 3LOUA 2DNQA 1U6BA 1D9DA 4BWMA 5FD1A 1LW0A 2HVHA 2FC8A 3M6VA 5K5MA 3LP0B 1VBZA 1JLGA 2PFFB 3ZZPA 5D4NA 3U1NA 4M8LA 5KT3A 2JH3A 5AXMA 3VR1A 3IA0A 3OLBA 1HWJA 1RT1A 2UUWA 2R7TA 3TAQA 1RWUA 1AW0A 2J9DE 3DOLA 2WOMA 2MJUA 3NBPB 5IXUA 3D2WA 1XMOF 2D3OR 1REVB 4OMFG 2XLIA 2XCAA 1S6PA 4V19J 1GH8A 4DV4F 1N5YA 3KTQA 1ZPVA 4HTJA 1S1UA 3CC7S 2FJEB 1HA1A 4XDDA 4ZOSA 2FJBB 5HROA 1VMBA 1LW0B 5EGYA 1JNRB 2ZHAA 3OJSA 2QSWA 1YG0A 1DQ9A 1UVIA 2VG6B 1JLGB 2DNNA 4O3OA 3GV7B 1S9GA 2MZJA 4GO5X 1ZH5A 2COLA 3CD5A 2RIJA 3MTJA 4NLXA 3CDBA 3HHLD 4KC5A 3DLEA 5DGAA 1W2IA 4IUFA 2HNYA 1MMDA 3BSCA 3DOLB 4IQXA 2WOMB 1U1NA 3KWMA 4ZMMA 4IDKB 1WG5A 4WYLA 4PG5A 1N5YB 5IFMA 1S1UB 3CD0A 5HROB 3OTBA 4ZK7M 2L3MA 2YVSA 1MU2A 4CNZA 4Z2XA 1HMVA 2GW8A 3WBZA 3KG4A 1FRJA 1GXLA 3OFHA 1S9GB 4I4BA 2ZH3A 2CQHA 1DQAA 3C6UA 2GMLA 4KJIA 1YJUA 3DLEB 2BJEA 3L09A 4KFBA 2GIQA 2QA4G 2XMWA 2L9NA 2HNYB 2BABA 3HFKA 3IGVA 2WHOA 1YJRA 4ZPWR 2CQ1A 3MDFA 5LSRA 2Z2LA 1RTHA 2A2DA 3OR2A 2XMKA 5DETA 3NCPA 2V4QA 3FEXB 1MU2B 1N5SA 4CI0B 2HFZA 4LFCF 3UNGC 5F3ZA 2W9BA 3SYZA 1M0SA 3OXGA 1Q79A 2U1AA 1KLMA 4WIIA 3CCUS 1KFSA 1FXLA 1UEVA 2E5HA 2HHPA 4FF3A 3OVBA 3CVKA 1T7PA 4NLDA 3C6UB 4MMOA 3I0RA 2J6SA 2B4OA 4KFBB 4IOBA 2DIVA 1XN9A 1ZM9A 4ECXA 3NS6A 4DLEA 4ECWA 3DLJA 2R2RA 2PSZA 4QW9A 5KFCA 1RTHB 5U47A 2OPPA 3OR2B 1FRXA 2YTCA 3OQ2A 1URNA 2EK6A 3N79A 1VIXA 1TZ0A 2IRXA 2IVYA 3DNCA 4JI8F 3TUZC 1FXDA 2QZ8A 3V2UC 2X1GA 4OZ1A 3PIPQ 2W9BB 2AJFE 1KRPA 1KLMB 4IRKA 1OQ6A 3MMBA 3UFCX 5J2MA 1S1VA 4B9VA 4HYKA 5D4OA 4LVNP 2EG2A 4YB7A 3UDCA 5ADZA 3UCZP 3MFHA 2NREA 4LF7F 1S6OA 1G1XA 2GNKA 1ZM2A 1FE4A 2RRAA 5A8KA 1HYSA 4WCEQ 2ZH8A 2ACYA 2YX7A 5M2UA 1WG4A 4EGLA 3OJUA 2E1RA 4ZKAA 2OPPB 2XULA 2X1BA 5GAEI 2YNGA 3NCRA 4QWDA 3CSKA 4X4RA 2EVZA 2AJ4A 2AJ1A 2IRUA 3DRYA 4BBYA 2W9CB 3FMBA 2ZJPQ 3MMBB 5J2MB 2RVJA 3CCJS 3PW5A 5F9LA 2OMLA 2KJWA 3MF5A 2DNMA 3VAMA 1CQNA 2OD6A 1Q16B 2YNHA 3LPYA 5A8KB 4A8QA 1LWFA 3VAGA 5F8LA 2KI2A 3JSYA 1T02A 2VASA 3IWNC 1HW8A 2MQLA 1GT8A 3CCES 4B9UA 1NU4A 2BYCA 4ED5A 3BO4A 3B4DA 3GMGA 4DUYF 1HPZA 3OTDA 4DSLA 4NCGB 4N47A 1HBMA 4K0KF 1YBAA 1FRKA 2E9TA 3FDSA 2DNLA 1NKEA 2DGQA 2AYGA 2UVVA 3R1LA 1PC4A 1T3OA 2RE1A 1V3SA 2YNHB 1S77D 4OJGA 5KFGA 3U7JA 2NQPA 3NGDA 2IBKA 2H5EA 3RB4A 1IBMF 2F3JA 2ZZMA 2CPJA 2V8VA 3OLAA 3D1OA 3SSRA 1S9FA 4KKOA 1HPZB 3O44A 3CJ2A 2ZZNA 4LQ9A 2QA2A 4FNHA 4HI2A 3OV7A 3K8WA 4IH6A 3QLHA 1UKUA 3DHXA 2WSCC 1HBMB 4X4NA 3Q0AA 2YWFA 2GHVC 2ASJA 3DLKB 1IJFB 2B56A 4ED8A 4ED2A 3LANA 2DNPA 1QUPA 3RTVA 3O6QA 1IJEB 4DV5F 1LWEA 3M8PA 3MEGA 3N6LA 5KFHA 4HT7A 3GE9A 2BRKA 2MHEA 4X84A 3DRXA 1JWWA 2FJWA 3N6MA 3C66A 4KKOB 1Q53A 4RLEA 3AJ1A 2HHQA 3IFEA 3S7RA 2HPUA 4OHYA 3SCLE 4C3LA 2MJNA 3UW1A 1Q86T 5IT4A 1XR6A 1TV6A 3ITHB 4YUDA 3CULA 5D3GA 3MGJA 5F8MA 4C3MA 4A8MP 4OZNA 1KOHA 1LFPA 1J5OA 2HGLA 1HW9A 4AL7A 2VC0A 3PFEA 4JI1F 3NMRA 1CLFA 3FVYA 5A6WA 3RW7A 1U7LA 2M4MA 5FLXY 1B0TA 1LWEB 1TUVA 2EFOA 1M5HA 2NR0A 3J7A1 3M8PB 3DLHA 3MEGB 1G2EA 5J1EA 3CUNA 3U02A 2KHCA 2PC6A 1FD2A 2DH9A 2XMUA 1HWKA 3KNGA 1UVLA 2APOA 3P96A 3SV4A 2CQ0A 1L3VA 3UPFA 3U1MA 1TV6B 3PEHA 2L41A 5D3GB 1WEXA 1HL6A 3N28A 1RT7B 3I96A 3BN7A 1CEZA 1J5OB 2ROGA 2O3DA 1NH8A 5K8OA 4RBTA 3G4SS 1X0FA 3MECB 4DL3A 3KLEB 4D3HA 1WHVA 1Q82T 1M1KT 2N3OA 1HNIA 2QE5A 2OTLS 3WC2A 4GKKF 1VI7A 2E5IA 3DHWC 4J9MA 4DS4A 2XS7A 3HHKA 4Y2MA 3TX8A 3MFIA 4FNIA 4OJ3A 2POKA 3IGNA 4V19X 2H9ZA 1QAXA 4OFZA 5KOXA 3HF5A 1MROA 1FJEB 4QOTA 2DK2A 4IFYA 4B08A 4EEYA 1XR5A 2ZC4A 1KTQA 4NLYA 3CD7A 1S99A 2OMOA 1SJQA 2FDNA 1IN0A 1XR7A 2ZKUA 4CO1A 1FJCA 4ITSA 4WK1A 3BR8A 3GYNA 1RT3A 1TKDA 5DDPC 2PMHA 3GG1A 3P3DA 3FNNA 4NLTA 2DHSA 1F9FA 3DM2B 3HI9A 1SIWB 2MXYA 4ILRA 2AYEA 5CYQA 2D74B 4F25A 1VBYA 1ZTTA 3VAFA 4E8UA 4X4OA 5GADU 4LF8F 1E6VA 1IQZA 2B43A 1HD1A 3U1LA 2KXNB 1JX4A 2KG1A 2QMWA 5BYSA 3FQLA 4IFYB 1K73T 1VQ5S 5KG3A 4DR2F 3D1QA 3UWTA 2DGSA 4QZVB 4JV2A 3PW0A 1FRHA 4WK3A 1RT3B 2IVFB 1SJFA 4R0JA 3UE2A 1WNEA 5CHCB 3KMQA 5L1JA 4O0IA 3GR0A 2X51A 3OTCA 4OQJA 5CYQB 3ZZRA 4UQTA 4UUWA 4MYTA 4D3GA 4HTIA 1SUQB 1Z1ZA 5H1SV 2JEJA 3QJJA 2J0XA 1Y00A 2M3DA 1E6VB 1S1WB 4QWBA 3GIKA 3H4DA 2AW0A 2YWGA 3NNAA 4LJMA 2ADCA 3SXLA 2ZUGA 4C0BA 2E44A 1NKCA 3C3LA 3T1AA 2CVIA 4A46A 4DQRA 5DS7A 5LJ3Y 3H25A 4ILMA 2VFSA 4F2RA 2B51A 1IBKF 4ZCLA 3I87A 2EI5A