1YJWS

Crystal structure of quinupristin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 23S RIBOSOMAL RNA
total genus 19
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2005-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1yjwS00
1DHMA 3CPWR 2M4MA 2KHCA 3FEYB 1U6FA 2DNQA 2YH0A 2KVIA 1VBYA 3MUVP 5GMKa 3CF5Q 2MZJA 1VQ7S 1VC5A 3CCMS 2LQ5A 4F26A 3D2WA 1JJ2R 1HA1A 1SJ4P 1VQ8S 2MY8A 2BZ2A 4WIIA 4QU7A 3CCVS 2KXHA 3CCSS 2LA4A 1FJ7A 1H2UX 2L08A 5GVQA 2KRRA 1UP1A 2CPJA 1UFWA 1NJIT 2DNOA 3MUTP 2QFJA 1U2FA 4IO9Q 3P5TL 3G8TA 4TU7A 2OTJS 2RUGA 2MYFA 3NNAA 3VAFA 2MKKA 3MOJB 3J7YU 2MMYA 1DZ5A 2CPFA 3UCUP 3CTRA 3HHNB 2CQ1A 2MY7A 1M5OC 3CC2S 1DBDA 2DHXA 2CQHA 1Q7YT 1R8HA 2CQCA 2JWNA 2YH1A 2L41A 1YJNS 1UAWA 5BJRA 1ZZNA 2MZ1A 2N3LA 2M88A 4F25A 4W92B 5GAEU 1RKJA 1JJ4A 3TP2A 4PR6A 2N7CA 4IOCQ 1N88A 1N54B 3MUMP 2OIHA 3DLLQ 4YOEA 2AYMA 2KI2A 2MKSA 2DNGA 1M1KT 3BO4A 1VQ5S 5HO4A 2ADBA 4UY8T 2D9OA 3CD6S 1S79A 2AD9A 1FXLA 1U1NA 4V19X 3BEGB 1WI6A 2MHNA 5LSOA 3ZZZA 2LEBA 3CULA 1M5PC 2KG1A 1OIAA 1U1MA 1FJEB 2OTLS 1U6BA 3K0JA 3CXCR 2QEXS 2YTCA 1H2TZ 2LA6A 1L3KA 2MKJA 1WTBA 1X4GA 1X5OA 3H2UB 1A9NB 1SXLA 1FJCA 2HGNA 2CPDA 2DGSA 1VC0A 1WELA 3U1MA 1X4HA 3SMZA 2M52A 1SJRA 3SDEA 2MZRA 3OW2R 3S6EA 2LMIA 3CC7S 2MZTA 3MD1A 3NNHA 5IFMA 1VQ6S 1WEYA 2DNHA 4M5DB 2O3DA 2KN4A 1FT8A 3NS6A 3N9UC 4BS2A 2XSFA 2DHGA 1Q82T 2DH7A 5HL7Q 2CQIA 1WEXA 5IQQA 2DNRA 3UWTA 2RRBA 1K9MT 3UD3P 2X1GA 2VOPA 2I38A 2DH8A 1WF2A 3CUNA 1S72S 5ITHA 2DNZA 5GAGU 3MURP 4C0OC 3UCZP 1M5VC 1YIJS 1X4AA 3TO8A 3FEXB 1BY9A 2AYEA 2BOPA 2HZCA 1RK8A 1X4FA 2KT5A 1YJWS 2DGWA 1FHTA 2CQ2A 2MXYA 2FPHX 2RVJA 2OSRA 3EGZA 2DB1A 3VAMA 1WEZA 3LPYA 2JX2A 2LXIA 4QQBA 3VAGA 2DIUA 3PIPQ 5DETA 1AUDA 2M9KA 3S8SA 3IRWP 2XS2A 2XNRA 2CPZA 1SJ3P 2XB2D 2MKIA 2U2FA 3VAJA 3UD4P 2J0SD 4A8XA 2EK6A 2Q79A 1VQ4S 4LMZA 3V4MA 2ZJQQ 3JB9k 1YTYA 1U1RA 2MB0B 1O0PA 1P1TA 2KU7A 5DDRC 4U67Q 1QVGR 3CCES 3L3CA 2HGLA 1U1OA 1WG1A 5GADU 1VBZA 2MKHA 3PIOQ 2N3OA 2DHAA 1WHYA 3ULHA 1X4BA 5DM7Q 3CCQS 1VQLS 1FO1A 2CQ0A 2XNQA 5FJ4A 1X5PA 1YITS 1P27B 3IWNC 1N52B 2KRBA 2FC9A 1R8PA 2EVZA 1X4EA 4FXVA 2DGOA 2DGUA 2I2YA 3BO2A 4WCEQ 2OSQA 2FC8A 2RT3A 3R1HA 1VQPS 3THTA 1W2BR 2DO4A 2X1FA 1WI8A 2CQBA 2EK1A 1KOOA 3TYTA 3U1LA 2OJ3A 3ZZYA 2RNEA 1N8RT 2MZSA 1H2VZ 2KG0A 1X0FA 2FY1A 3DXBA 5DDQC 2XS7A 5DDOC 3G4SS 2CQPA 4WKRA 2VODA 1D8ZA 2CQGA 3UE2A 4QPTA 2DIVA 2LYVA 3P49B 2KYXA 1M90T 2E5GA 1X5SA 2JVOA 1SJFA 1PGZA 1NU4A 2E44A 1B7FA 2K3KA 2UP1A 4TU9A 1WF1A 4UQTA 2LXUA 2L9WA 5JVGQ 2F3JA 2PE8A 3G8SA 3G6ES 3MD3A 2RRAA 2FHOB 2LCWA 2XS5A 1VQ9S 2V94A 2DGQA 3EGNA 2F9JA 1KOHA 4OZ1A 4WFBQ 2KM8C 1WHVA 3EX7B 3VAHA 2DGXA 2CQDA 2E5IA 2B0GA 2M8DB 2PEHA 5LXRA 2CPIA 2E5JA 3S7RA 2MSSA 3J7ZT 1XN9A 2RS2A 2GHPA 3LQVA 2VOOA 1K73T 4ED5A 1YWXA 4RU2A 1YI2S 1VQKS 3NS5A 3CCRS 2M70A 1K8AT 1URNA 1A7GE 2DHSA 1KC8T 5LSLA 2QA4S 3I55S 3MXHP 2JVRA 3MI7X 5JVHQ 2N82B 1ZH5A 1WHWA 2NLWA 3NMRA 2J8AA 1U1KA 1OPIA 2M8HA 3H2VE 2F9DA 4C4WA 2DGTA 2M7SA 2KXFA 1WF0A 3MDFA 2DNKA 2MQNA 3BO3A 3VAKA 1FNXH 2ZJRQ 5GAHU 4WFAQ 3RW7A 5LJ5Y 3NNCA 1D9AA 1U1LA 3Q2TC 1VQMS 2MZQA 3CC4S 4YUDA 2DNYA 1OO0B 3Q2SC 1Q86T 1G2EA 5EN1A 2DO0A 2CJKA 1X5TA 2G1DA 5MLCV 3G96A 2X1AA 5DM6Q 2RQ4A 1JMTA 5CXTA 1WWHA 2JRSA 2X1BA 1DRZA 2CPYA 1VQOS 1UW4A 2ERRA 2MGZA 2D9PA 1JJHA 2U1AA 3US5A 1F9FA 2MJNA 4F02A 2MQQA 2AYBA 3THPA 2CQ4A 1U1PA 1VBXA 2E5HA 2M2BA 2MKCA 4LIRA 4PRFA 2DGVA 3CCJS 2D3OR 4OZ0A 2CPEA 1HD1A 1QM9A 5IM0B 1WG4A 3CCUS 1YJ9S 2MQPA 4WFNQ 1KQSR 2CPXA 4TLQA 2HGMA 1HL6A 2LEAA 2SXLA 2CPHA 2MJUA 2KXNB 4W90B 2DK2A 4IUFA 2ZJPQ 2MPUA 4Y00A 3SXLA 1U1QA 1HD0A 2DNNA 1Q81T 4Z2XA 4EGLA 1CVJA 2MGZB 1QVFR 2HVZA 1IQTA 2DH9A 2GO9A 2MQLA 3G71S 3CMAS 2DISA 2MQMA 1WHXA 2WBRA 4LJMA 4QU6A 4CQ1A 3CMES 2HYIB 5D77A 4CH0S 2J76E 3I56S 4C7QA 3VF0B 3RW6A 5IM0A 1X4DA 5CA5A 4P6QA 3UCGA 3R1LA 4ERDA 2LKZA 3S01A 2RS8A 2CQ3A 1PO6A 1ZZFA 4YB1P 2YKAA 2RU3A 2A3JA 2G4BA 2KH9A 3CCLS 3VALA 2LECA 2M0GB 2G0CA 5DDPC 4IOAQ 1NO8A 1VQNS 2NZ4A 4PKDB 2DNMA 2ADCA 2KFYA 4TU8A 1KD1T 2DITA 2YWKA 1WG5A 3VAIA 2AYGA 4CH1A 3BS9A 3G9CA 3HI9A 2DNLA 3B4DA 1M5KC 5D78A 5LJ3Y 3P3DA 2J0QD 4J5OA 4WF9Q 3SDEB 3R27A 2RQCA 4CIOA 2DNPA 5CYJA 2MSTA 1YHQS 2KM8B 1SJQA 1VC6A 3B4MA 4Y0FA 2MQOA 4ZKAA 1H6KX 5H1SV 3P6YC 1OWXA 2VONA 5LXYA 1X4CA 2K8GA 4FXWA
chains in the Genus database with same CATH superfamily
3U7JA 5KFHA 3IBWA 1N34F 3CPWR 3I87A 5F0UA 2DNQA 2UUAJ 4ED0A 3D68A 1FRLA 1VBYA 1BQNB 4GVBB 2XYPB 3SCJE 3B8HA 1UWBB 2EPIA 3TWZA 3TUJC 3DLBA 4CNYA 4F3OA 1MSWD 3FBCA 2KFZA 3AD9C 3NOGA 3C16A 1VC5A 4OYIA 3U02A 3HSDA 1VCTA 5KG6A 1TL3B 1VISA 3D2WA 2R9LA 1SKWA 3Q8SB 3X1LB 2C2DA 4OI0A 1UKUA 2E9RX 1SJ4P 4C9DA 1IBMJ 2UVRA 2V34A 5HQ8A 1G3OA 2FGCA 2X3GA 3Q22A 1HW8A 3NWRA 1XMOJ 3I4PA 4NLUA 1TL5A 2VB6A 1WACA 2LA4A 1N56A 1IWGA 1SH3A 3HVTA 3J7AN 3MEDA 3FC9A 3UNYA 1JXEA 4G6VB 3FK4A 4CDIA 4LR9A 1L3UA 4I2PB 1YBTA 3RR7A 1Q1KA 5KFDA 2UVUA 3I5CA 3CMQA 4LFBF 2YNFA 2ZD1B 2L08A 1TV6A 3KUHA 1PAUB 4F50A 3FBBA 3KJVB 2KRRA 4ZK7M 4HACB 2HMIA 1YRTA 2GHVC 2QFJA 4OJGA 3NL0A 1C1BB 3P5TL 4ZVUB 2ASJA 1URRA 2OTJS 1RTIB 2RUGA 1Z4UA 3P45B 4NMLA 3CIZA 4KC5A 2QRRA 2OPSA 1DZ5A 2GC8A 1WSRA 5E5NA 3W8GA 3UCUP 4ETXA 3CTRA 3HHNB 2XBPA 2ACMA 2A2CA 3A1YG 4K8RA 3FBEA 2HIYA 3R97A 1KFDA 2AEMA 4DUYF 1TK0A 1JJCB 3PX6A 1DBDA 2YVSA 2NXCA 4C11A 5L1JA 3CCZA 1NK8A 2DHXA 3C66A 3TX8A 4ECSA 4KO0B 4N76A 3DXSX 2L48A 4A47A 4QPXA 3Q23A 5BJRA 1RAGB 3BYPA 2DJWA 1ZZNA 2QE5A 1IUJA 4L75A 2XMKA 2OP5A 3R7NB 2OPPA 4M5HA 2C2RA 1FTCA 2VU5A 4USKA 1DFDA 2MZ1A 2CZ4A 1H74A 4M5NA 5K5MA 2FY8A 1T0TV 2V8PA 3AXKA 4Q7AA 7FD1A 3TZYA 1RKJA 3DGPA 5KT5A 4PR6A 5I3UB 2GIRA 4M5DA 4TY8A 2N7CA 2BW7A 2OIHA 5FIIA 1WC0A 1R0AA 2MKSA 4DCPB 1M1HA 1IKXA 2HFZA 2BJDA 2UV8A 4NOHA 2VG7A 4ED6A 3BBCA 4UY8T 3TRGA 1DTTB 2VG5A 3ENVA 5D3GB 1MWZA 2NPIA 1J2VA 3BH6B 1L3SA 1G7CB 3CD6S 1O6XA 5HAOA 5AE2A 1RACB 1S79A 5M2PA 3Q89A 1FXLA 4YR2A 2EC0A 3BEGB 1CQNA 5LSOA 2QIFA 3AAWB 2RD5C 1FXDA 3ZZZA 2LEBA 3CULA 1OIAA 3MFHA 4B9LA 2GS8A 1EZZB 4C8YA 2ZH3A 2DY1A 2QFIA 3C14A 4F0HA 2KVQE 4OLOA 4ES1A 2AJ1A 2VDIA 3FVYA 4IRKA 4DU7A 4GKKJ 1MN9A 5DS7A 2DR6A 5HSPA 4AYBD 2LA6A 2R2RA 4B9UA 4YEAA 1X5OA 5J2PA 1Q5YA 1QE1A 3H2UB 1NKCA 2F4VJ 4CO3A 4FBTA 3PO5A 3KUEA 5BXIA 2EXUA 2NXNA 2CPDA 2E1MC 5ETTA 1VC0A 5KG5A 1O8BA 1WELA 3FUYA 4ZPDA 1UFLA 4H4MB 4ZLPA 2M52A 4USVA 4M95A 4CLYA 4PABA 2OEMA 3CD5A 1FKAF 2KKHA 4I67A 3CC7S 1PBUA 3QBCA 4JBCA 2HHUA 5KOWA 4MKAA 2IVMA 4TVAB 1WJ9A 5D0EA 1IXKA 5E7OB 2DXEA 4X66J 1VRQC 1ZM2A 2DRBA 2D1CA 1SUQB 2QMUB 3LPEA 4ZVGA 4C3LA 4ZIVA 1EP4B 2CG4A 2DNHA 2Z30B 3NEKA 3R6LB 3NS6A 3N9UC 3L7OA 4FKYA 4L76A 4XDCA 4Y2MA 3KLGB 1KLNA 1Q82T 3SQOP 3CEDA 3W8PA 2GV1A 3POTB 4PG6A 4K4SA 4LFCF 4I2PA 2LLZA 5IQQA 2BYCA 2L9DA 3UFCX 3UWTA 2A6OA 5HMZA 2RRBA 2GZOA 5KFWA 1K9MT 1RHRB 2HQIA 2V8GA 2V0NA 3FFIA 3IP0A 3HXMA 3UD3P 2C3MA 1H7WA 2YQ3A 4ZLNA 3BSOA 3ZO7A 3JAMY 1TUWA 2X1GA 2UXBJ 2AEJA 3NGSA 4AFFA 1T8EA 4KIAA 4HHJA 3T9NA 3CUNA 3S1TA 3EPGA 2CNNB 4F3MA 3BB5A 3QPIA 1M5VC 4E0DA 2Z57B 3RW6A 4P2XA 1RWOB 4D3HA 2JEGA 2V8VA 1BXNA 2DCUB 2W4DA 4QCLA 1FKOA 2WSEC 3J81j 4WU2A 1NK6A 4QR1A 2ROGA 5B0CA 3BGLA 3M9NB 3QRRA 4EYIB 2DGWA 2YY3A 2CQ2A 4MH8A 3NAHA 2IDEA 4CLLA 5A8WA 5ETVA 2FPHX 4A8KA 4ED4A 4DSJA 3EGZA 2WVFA 2DB1A 4JI8F 3VTIA 4PAAA 4HDGA 1WEZA 4ZJOA 1PSDA 3HFZB 3LPYA 4Y2IA 5JUMA 3IBCB 3LP2B 1PBAA 5A8RB 2E1PA 3G82B 4LF8J 4WJBA 2M9KA 1AUDA 1N0VC 2UXCF 1U02A 2CPZA 3KXDA 1OMSA 4LQ9A 4AXIA 3M8SA 1S1WA 4DL3A 2XB2D 1PILA 2C2MB 2E1RA 1CG2A 2BX6A 2Q79A 3DLKB 3PFOA 2PMHA 4X65F 4K0KF 4A8MP 5J1NA 3MMAB 5AJ3F 1U1RA 4R0EA 4FPRA 2MB0B 4NMXA 1DAXA 1GX6A 2AMCB 2RQKA 1B70B 2XWXA 4H4KC 1P1TA 1U6ZA 2XEXA 5L39A 2KU7A 1FJGJ 1NJXA 2VG7B 2EFNA 3BYRA 4I68A 2I6WA 5D4OA 2C22A 2KFNA 2IY5B 4ILMA 2C1EB 1TL4A 2B9YA 2D3ZA 4HT7A 1PC4A 4O3OA 2FJXA 3CCES 4O3NA 5KFLA 1VIXA 2A6MA 3J80U 3K2YA 4M8LA 1FESA 2C42A 3L3CA 4WFXA 1BWEA 1XNQJ 1U1OA 3QNWB 2QLBB 5T7LB 3OLBA 1T9TA 1WORA 3ILIA 4FVCA 1DY3A 1T3OA 2QJ3A 4DV6F 2QSWA 2FVRA 2R3VA 4USHA 3PIOQ 3PRVA 4AD6A 3MMBA 2HFOA 2HBRB 1AB8A 2HHPA 2CQ0A 1VQLS 4JI4F 2GMJA 1F2HA 1NZAA 4FKXA 4ED2A 1X5PA 1JLAB 1ZETA 3IWNC 5HP1B 3GSIA 1S59A 2FC9A 4OI6A 2EVZA 4YHHJ 2LDIA 1X4EA 1VFJA 4CNZA 2FJWA 4B9VA 2RDDA 4IR9A 4O3SA 4DV3F 4WYWA 1UTAA 2YNGA 1RWNB 3TZXA 2I2YA 3OVBA 1HWIA 2OSQA 1GMWD 4USUA 4ZPBA 4WTYA 4IQXA 1B7YB 1I6JA 4NEYA 2HHSA 4F0KA 3ONQA 3GV8B 2AX1A 1VQPS 4OZLA 1W2BR 2JEFA 4NX9A 1PJ7A 2DO4A 1U8SA 5C24B 3G6YA 4LFAF 4N77A 3MR6A 3DOMB 2PMWA 3CO9A 4C8KA 4X4SA 4HVZA 3TOQA 1C4AA 2CQBA 3ZTPA 1D3WA 4O44A 3ENAA 1S6OA 5C7PA 1C0TA 2ZBIA 1IVZA 1RWUA 2G2ZA 2OH2A 3LP0A 3OR1B 4X66F 2KG0A 2FY1A 4U8YA 4RW6B 2CWXA 3MM5A 1K44A 1TAQA 2W2NP 2E5LF 2VODA 3N4WA 2QSFA 2QL7B 4ID5A 1ELOA 4NLOA 5D4NA 2HSEB 3UE2A 3SZ2A 4QPTA 2BVZA 2HZAA 3AJ1A 3A4TA 3D0HE 2LYVA 3UDVA 1YTYA 3P49B 2EI5A 4ECWA 1T9YA 4DL6A 5LT5A 3H20A 4USIA 1M90T 1PGZA 1FEEA 3D28A 2ASDA 5F3TA 1WUUA 8ATCB 2HQFA 3PJWA 2UV8G 5I3PA 4JI5J 1HWJA 1C2PA 1RCXB 4O4RA 3PYDA 1NM2A 2GAHC 4KT0C 3IWXA 3KDNA 5L46A 4UQGA 3SSRA 1H0HB 3G8SA 3G6ES 2CJXB 1NJYA 3KUGA 5CCMA 1VLYA 3MGJA 1QUPA 1IJEB 4DCOB 2RUSA 3EICA 3GYXB 2MLYA 3EWGA 3MR7A 5HP1A 2XS5A 4ZCKA 2B3TB 2J5AA 1KOHA 2ZC3A 4OZ1A 4QYZJ 4IDKA 4QZVB 4AL7A 3EX7B 1B64A 4GVLA 4DFMA 4KRWA 2DGXA 2CQDA 3W9JA 4ZN1A 1S12A 2RKIA 5IV4A 1S6UA 4RWWA 2PEHA 5LXRA 3S7RA 2E5JA 4NLRA 2B4PA 1S57A 1NK7A 1RA7A 2W4CA 1FWKA 2Y1LB 5KT4A 1NJWA 4CLZA 4QJVA 4I2QB 5KFPA 3V6HA 1CC8A 1HNVA 3GZ7A 3LQVA 5KT3A 1K73T 4ED5A 2G0JA 3M32B 3N28A 2V4RA 2QMXA 1VQKS 1QSYA 3KJNB 4I56A 3POTA 3CCRS 2HVIA 3GR0A 3BH7B 1A7GE 4HH1A 2VF3A 1X9WA 3BQ1A 4LFAJ 1KHVA 3RBDA 1RYRA 3I55S 4K50A 4QWBA 2JVRA 3MF5A 3D67A 3TNVA 3FSXA 4X4QA 4TQSA 2NUHA 5KFMA 2I9SA 3M6XA 4EFAC 4KYZA 2QLJB 2GA7A 4HHHA 3NMRA 4K5RA 1Q4RA 1KLMA 2JNJA 2JOQA 3MM9A 3WQPA 1RDRA 2W01A 3H2VE 2VBWA 3HDSA 4KSEB 4YB7A 5E3QA 4EU0A 3BGUA 3IXQA 2M7SA 1WF0A 3MDFA 2HBYB 2HKEA 4F8RA 1OYDA 5LMUF 2VJUA 1FFGB 3LH2S 3LWMA 5J2PB 5LMNF 3T5KA 4B3SJ 2MHEA 5LJ5Y 5AXNA 2C2OB 1XR6A 5HMWA 3BR8A 4NA2A 3Q2TC 1LFWA 2YNIB 1NHVA 1V3RA 4DR2F 2D7SA 5IXUA 1Y10A 2JC0A 2XWYA 3RRGA 3E3XA 3TAMA 3G9CA 2A2DA 3LP1B 3L4BC 4A8OA 1MLAA 1S4FA 5CQGA 2CNOB 2IJNA 3LGMA 3VWSA 1MG7A 1RQ0A 1RT4A 2DO0A 1CJKA 3PNIA 5B7WA 3BZQA 5MLCV 4KHPF 4JI4J 3V4IB 4LBHA 2B4VA 4URGA 3Q8YA 4LREA 2JC1A 3CB4A 3JS9A 4KPCA 4P75A 3V6DB 3RAXA 5CXTA 3IO1A 1HNXF 2X1BA 4OMFG 3Q8PB 3BDEA 3DDNA 3K5PA 5A0YA 4F4AA 3CDBA 2COLA 4OI2A 4WIQA 2FZGB 2V2VA 4L3NA 4R8UA 1VQOS 2PI4A 2ERRA 1RWMB 4M5LA 4X4NA 2IM0A 3UO0A 2GQQA 2U1AA 2B7CB 1F9FA 5A8KA 1LWXA 2ZKTA 4C2MA 3HVRA 2HYIB 2F4VF 4X4UA 4MFBA 4EWTA 3GIIA 4F4XA 5HLFB 2AIRB 4DOZA 1LEOA 3IG1B 4C8NA 1X7VA 3FJ2A 5D0RA 2VA3A 4NLQA 4RW8B 5ETMA 1RHKB 5H9FK 1VHFA 2X7IA 4RUAA 3OFEA 2C2ZB 4ITSA 2M2BA 1M5HA 2DGVA 3F56A 4NZ7A 2D3OR 1PYOB 3N6MA 5E3PA 1K0TA 1RAEB 4JI7J 1RBLA 4OZ0A 2IVFB 3TVKA 1N5YA 1QM9A 1WG4A 1CJUA 2I5JA 2LXFA 2XYGB 2ZM6F 3AOAA 6FDRA 4TLQA 2HGMA 4OQJA 2SXLA 1RTDA 2IFXA 1C1CA 2MJUA 2XSJA 2KXNB 3OHBA 4JYAJ 1IKWB 5AT1B 2OAUA 2NSBA 2ZE2A 5E3CA 1EETB 2MPUA 3EGVA 3UD5A 2B4OA 3HKWA 3SXLA 2RILA 3A13A 1VR6A 2HNZA 1HD0A 1WKJA 2FZKB 2HHTA 4QIEA 3SFUA 4IDKB 1LFPA 1TL7B 2MQLA 4IOBA 1NSAA 3MMBB 2FJAB 2LQJA 2I8EA 4IFYB 2EFVA 3HMJG 3K57A 1N33J 1Q78A 1H3DA 2B9WA 4FYYB 3WC0A 4ZHRA 3QSIA 3K5MA 3H5SA 3G8QA 3D0GE 3PYFA 2BM0A 2YNFB 4M5IA 3GB0A 2Z2ZA 1H98A 2APOA 2OPQB 3LO3A 2E7VA 4OHVA 5HI7A 4RUHA 1RUSA 3T41A 2W9CB 4P72A 1T03A 4P6QA 3R1LA 3WIVA 3C3LA 3S01A 4ERDA 4ZVFA 2QLFB 1UW9A 4CT9A 1N6QA 4N41A 2V69A 2O67A 3BGRB 4ID5B 4LVOP 5HBMB 1OPZA 5KG2A 2LU2A 3T1HF 3AOBA 2KH9A 3BBFA 3NG8A 5DO2A 3I4HX 2WZ1A 1N4LA 2ATCB 2JLFA 2MLZA 3AY0A 3PM9A 3V2UC 3KHHA 3UDCA 4DUZF 2IBOA 1ICEB 2IVYA 2M0GB 1HBNA 2LU1A 4A8YA 2UUWA 1NO8A 3FEZA 3UW1A 1VQNS 4QBUA 4KH0B 4TQRA 4TY9A 5GAGI 4NLTA 1RBAA 5ETSA 3DRYA 1N5SA 3TA1A 4TU8A 2DITA 2YWKA 2BE7D 1U45A 5J1PA 3ELHA 2YKNA 3CE8A 3BS9A 3HSZA 2YX4A 4RUCA 3OSNA 2R8HA 1KEKA 4UT4A 4KGXB 2ZH2A 4B9SA 5H9EK 2FLNA 3P3DA 1SKRA 2YKMA 4J9OA 4WF9Q 1PG5B 2AWZA 3R27A 3RUBL 2K1RB 3Q8RB 2BR0A 2DNPA 3AFGA 1V3ZA 3FSYA 3LP1A 2KM8B 3TAPA 1VC6A 2R2SA 3E01B 1Y3JA 4X62F 1YX2A 4LRAA 2O66A 4JV0A 2A0FB 4ZIWA 2POKA 3P6YC 1N5TA 2V2ZA 4NEZA 4OLPA 5LXYA 2HQGA 2XLIA 2LFVA 3I5BA 1HBUB 4CLUA 3TW0A 2BDPA 4JV1A 2M4MA 4L6V3 4CO1A 2HQCA 3FEYB 3M9MB 4A48A 1F60B 2YH0A 1YJUA 4OZNA 4JV5J 4WTOB 2CIMA 1HMVA 1P1LA 3T6BA 2EWHA 2OUGA 4IH5A 1SIWB 2VG6A 4LVNP 5GMKa 5F8LA 2FIUA 5KG1A 1HPZB 4HTIA 5BR8J 1HNIB 2HVEA 4LBIA 3CCMS 3QSYB 1VQ7S 1U49A 4F26A 3TAQA 3TJ8A 1Y5NB 4TKTA 1JJ2R 1F9HA 1GTHA 1MMLA 4H4OB 3GONA 1HA1A 2RIJA 1AFJA 3QT5A 3VHQA 2GVZA 1TUVA 3ENWA 1RAAB 4ZMMA 2R7UA 3J81Y 4O4GB 1RCOB 2BZ2A 2LEPA 2PD1A 4WIIA 1OS5A 2HVDA 5B0FA 4C97A 4CWBA 4Q44A 4PXCA 4HHUA 3AHPA 3CCVS 3BPSP 3V81A 4R0JA 3KTQA 3OT9A 4ELVA 3CCSS 4DMZA 3M32A 3P5BP 4C8LA 5GMEA 3JTNA 2GHWA 1RWWB 4KJIA 2I0XA 1OY9A 4DF8A 2BANA 1YZ7A 2WK4A 1XEZA 2WVEA 4A8WA 3QYYA 5GVQA 2DY9A 2B5JB 3RRKA 1IWAA 4UOCA 4CLPA 4P52A 2VBZA 4DLEA 1BQNA 3NXZA 4QR2A 3SV3A 2YKOA 4OI3A 4NYOA 3ZZPA 2HRYA 1NKBA 2H5JB 3VGTA 2DNOA 4Q8FA 2VIHA 4J9QA 1S49A 1Q53A 1U2FA 3FMBA 4L74A 4EO6A 1RGVA 2ZC4A 4TU7A 1IR0A 3K8VA 2QL5B 3IAM9 3G6XA 2E9ZA 3D0IE 2MYFA 1LWFA 1FKOB 3AOCA 2FLLA 4ZVEA 1HBMA 2QL9B 4NRUA 5KG0A 1TK5A 3J7YU 3BM7A 4PZVA 3GSDA 2CPFA 3KFWX 3UN5A 3K5NA 1SVDA 2H3EB 1Q0NA 4ECYA 3MEEB 1Y5IB 2CQ1A 1M5OC 2YWEA 3MAAA 4MYTA 4JOUA 4RO0A 4ED8A 3QZ7A 1RTHA 2H54B 3LA0A 5IWAF 3W3SA 1N33F 2J8SA 3M8PA 1UWAA 3QWUA 5ETNA 4IFYA 2JHEA 5F0WA 4L3KA 4QYRA 5ETQA 4LF1A 2JWNA 5ADZA 2YNIA 4ZCLA 3ILJA 2L41A 2YH1A 1BGXT 4OL8A 4I4BA 1SB6A 4EK2A 2RHQB 2W8LA 1IBMF 1KWMA 2HNZB 4DFKA 2DEJA 2VUGA 3MMCB 4NLDA 4PWDA 5DG8A 3PYGA 3DRSB 3A3PB 4HACA 4LRCA 4W92B 5F8GA 2HRUA 1LV5A 5JXSA 2IHR1 1OQ6A 3M8QB 1JJ4A 4JYAF 3I82A 5HBMA 2QGFB 4IOCQ 2XI2A 3BGRA 2XZWA 2KI2A 3H98A 3K8WA 4DR3F 1NMEB 3HZGA 3O44A 3CDEA 2HPUA 4ALZA 1TP7A 1ZBTA 3GIMA 2C2EA 1VQ5S 5HO4A 2CRLA 4MK8A 4WFYA 1NSQA 4R5PA 2DXFA 2AGPA 3CJSA 4HYKA 5G0RA 3M6WA 2J9DE 3QO9B 1VMBA 2ILYA 3M2VA 4LSLA 4PXEA 1JXLA 1RT3A 1N34J 3D1OA 3IG1A 1U1NA 2HS4A 4DUTA 1YJRA 2IM1A 4ZN3A 2UUAF 1HNIA 2V9KA 4Q8EA 1Y3KA 2KHDA 3VQTA 3RB0A 2CVEA 3T19A 3ITHB 2GQCA 3I32A 3NP5A 1U1MA 2AJ2A 1M5PC 1FJEB 4OHZA 3EDRB 2P9EA 4UOGA 3K0JA 4L73A 4CO4A 3OV7A 2HNYB 5A8WB 1GFWB 2XLJA 2Y1RI 1XK8A 4XDDA 2QEXS 3IR7B 3W60A 3H5YA 3T6JA 2ALYB 2WHOA 4F4YA 2IMWP 4NXMJ 5IT9U 1E6VA 1X4GA 2YBVA 2KT3A 2ZE2B 1BLUA 4C3KA 2BJ3A 1IKWA 1SXLA 4WU3A 4DL4A 2C3PA 4O0NA 3PJXA 2DXDA 1KBRA 4NXNF 2HQDA 3M2RB 1Y11A 3D4JA 2L3MA 5D4LA 1CS4B 2RH3A 2UU9J 3R5JB 4DUZJ 3U1MA 1X4HA 2B9XA 1CC7A 3PHTA 5D15A 1P9YA 2PO4A 3SMZA 4AUKA 5CHCB 5BYSA 4QWCA 3OW2R 4B3OB 1NNDA 2VG5B 2HW3A 2LMIA 2ZM6J 4RNHA 2MZTA 4ZVRB 4UUXA 3IC1A 4WWSA 3V6KA 3NNHA 1UEVA 1U4BA 1GXTA 2XZDB 1U8WA 3RJMB 1R0AB 1NKEA 2KL8A 1HKAA 5F9LA 2XCAA 1VRUB 2A10A 1WC4A 2G2OA 2KN4A 1KQFB 1C4CA 2GAGC 4WZQA 4MMOA 2UZAA 2BANB 1K1SA 2IYIA 1X31C 1RAIB 1NK0A 1XMBA 5ETOA 4F67A 1JLGB 3G82A 2F40A 3IA0A 2Y8YA 1PAEX 2J6TA 4GKJJ 2DBBA 2M5YA 3DGVA 5L9XA 3KYLA 2W7OA 2UUTA 4UOFA 4HKQA 2F4FA 1IKVA 1I94J 1V9OA 1FVSA 2AX0A 4ZCMA 3AQPA 1IQZA 5KAKA 3PKYA 2OFHX 3M30A 2I38A 1U2CA 1Q8BA 2OPRA 3GCWP 3V5RA 1IM6A 3ZC4A 2HS3A 4N56A 5GAEI 1WF2A 4G1PA 5C24A 2IA6A 3L7UA 4TLRA 3UCZP 4V1Ak 2VQFF 3W2VA 3RU0A 2O1PA 1I5OB 5J1EB 4HL9A 5SZTA 4DWIA 2OPQA 4Y2AA 5KG7A 3PW2A 4FBUA 3FQLA 1HQUB 3PW4A 1VLOA 2AYEA 4NI2A 3H8YA 3IFEA 2BOPA 2R7TA 2HZCA 1TKXA 3OL8A 2J0WA 4ECTA 1WC5A 2OD6A 1JLEB 1UVIA 4I0WA 2MKYA 1YJWS 3EGWB 3IR6B 3ET6B 5B0DA 1QAXA 1VIOA 2WAQD 2H4YB 4JI3J 1SH0A 2N4CA 2YKMB 3RG6A 4E2FB 3A3NB 4NYPA 1R27B 2ZBQA 2F8MA 3C6TB 5IT4A 3KJVA 3GQCA 3T1YF 2B7BB 2JX2A 3OLAA 3VAGA 2DIUA 4OYWA 1NSKL 3PIPQ 1S76D 4FYWB 3MWBA 2BEFA 4KKOA 5AJ3J 1S0NA 4NLYA 3S8SA 2XS2A 3THVA 3A8KA 1REGX 2RMLA 3VAJA 3UD4P 1B0PA 3IS9A 4CLTA 4NA3A 2R7XA 2B6AB 2DRDA 3T9ZA 3QAUA 1ROFA 3Q83A 3V4MA 5J2QA 2Y1JA 3TZZA 3PVXA 2UXDJ 1QD1A 2B4UA 1IKYB 3GIKA 3H0PA 5T14A 1RHQB 4N8NA 4U67Q 3IWLA 4BDPA 5EX0A 3DOLA 4OYMA 3M8QA 2V50A 4I2QA 1EQMA 3K89A 1WG1A 1ZM3A 1UVNA 3W66A 1Q95G 3J7A1 1HNXJ 2RHSB 3OJSA 5DQIA 5E3RA 3BV8A 2OGUA 1NHKL 4OI1A 5KFGA 2W2OP 1A0OB 4WE1B 1R3NA 3M2UB 2PIIA 2V4JB 4DJBA 4IKAA 5KFYA 1LQ9A 1HI8A 1GAOA 5HVHA 1WHYA 2VV5A 5A8RA 1D1UA 2UVVA 4OYOA 1CJVA 1RE1B 3CCQS 1NPPA 5I42A 5LL6d 4XTTA 4YY3J 1FO1A 4PG8A 5A2QY 2DR9A 1KVIA 2V5HG 2GX8A 3FNNA 2JFKA 4ZPWR 4MKBA 3KJFB 3M8RA 3KK2B 1JLQA 2VICA 2XY6A 1KP6A 1TR0A 2XULA 2ZKUA 3NLCA 3FSIA 3IGVA 1DLOB 3V6DA 2W9BB 4LF7F 3MTJA 2AW0A 1FXRA 3NCQA 1MWYA 1BQMB 2W25A 1HW9A 2BUNA 2BJ8A 3ITHA 3MM7B 4FYXB 4AE5A 2DVIA 4HEA9 2DGUA 5LMUJ 4PG7A 4DR7J 4CLFA 1AA1B 4J9VA 4QIWD 4Y28C 1YJVA 2VL1A 2DCLA 1YDLA 2R7QA 3FDSA 3O1LA 3LWLA 1HR0J 3DOLB 4MTPA 1NAQA 3H42A 1CJVB 3O5TB 4ZDNA 3R1HA 4LF5F 2ZBPA 4DS5A 2J9CA 3QQCD 4AQYJ 4K59A 3R9LA 4F0MA 1WI8A 2PSZA 5HVGA 1B3TA 4IRDA 3BF4A 4RW4A 2LQBA 1XERA 2FHJD 1KOOA 2E5LJ 1C0TB 4J91A 3PG9A 1ZPVA 3U1LA 2GJFA 3ZZYA 1G4CA 3B78A 1CEZA 2EW9A 1L3VA 2XHWA 4ZP7A 2ASLA 3EMTA 4FYDA 1X0FA 1AZSA 3MZIA 1VYAA 3DRSA 4YB5A 4DPWA 3MR3A 2XS7A 3HJFA 1NDLA 4ECRA 4MYUA 4RNFA 3ZZUA 3MEDB 2WTFA 3BREA 2XC9A 3RB3A 2P5VA 5E3AA 5L8RC 2V2KA 3I31A 2DIVA 3ISNC 3UQSA 1EIYB 2KYXA 1RT7B 4B3MF 1HWUA 4MIWA 1LWEB 5JJBA 4DSIA 2JVOA 1NU4A 2E44A 2HZVA 2R8JA 1B7FA 4UQTA 2Z0GA 3CDUA 1Q16B 3MAAB 3ZZRA 3UR0A 2Q1LA 3TEGA 1FRKA 1RU1A 2FDNA 4LF4J 1SC4B 3GJRB 3UN2A 3QJJA 1TELA 2LCWA 2CG8A 3VQSA 2HVHA 1IBKJ 1FX2A 4P9SA 3DYAB 3C6UB 3D6MB 2DGQA 2F9JA 4PG5A 3TAMB 1Y0HA 4NLSA 3SSSA 4DPXA 2KM8C 1T94A 1TUGB 1B0TA 2W2QP 3VAHA 4QWEA 3NKYA 2E5IA 1FX4A 3QZ8A 3JQMA 2EBGA 3D3CJ 4CO5A 2M8DB 2KT2A 2ZFHA 2AHOB 3QRPA 4DPTA 2VPWB 2ZBRA 1NXIA 2NR0A 1IKVB 4K4XA 2RS2A 4DR7F 4LR7A 5IC4B 4EEYA 4YR0A 3GE9A 3HFKA 3IMQJ 4BWJA 3SYZA 1WNEA 1HBOB 3HT3A 3NS5A 3TUPA 4QR0A 1G1XA 1LXJA 3SFGA 5HANA 1URNA 2DHSA 3UVJA 2OEKA 3GV7B 3HCXA 3M9OB 2EKYA 3MXHP 5B0GA 4K4YA 1TTHB 5CYQB 3MI7X 1WOOA 3TVZA 3EXYA 1UETA 2NLWA 1NZ8A 1UEUA 2WOMB 2B6AA 2OKQA 4USJC 4WK3A 4MK7A 3PRDA 3K5LA 1HYSB 3FZ2A 3BSNA 3QT8A 4ATNA 4DEZA 4FN5A 5EWGA 3BKTA 2C2KB 2HHHJ 1H73A 3DNCA 4FF4A 2M3DA 4ZVQB 2KXFA 4E8UA 2QG9B 4JV5F 1APSA 1IR1A 3DLGB 2MQNA 5IT0A 1UA1A 4Q0BA 4DR6J 2YKPA 3RW7A 4FF3A 2Q6BA 4KH1B 3U27A 1VQMS 3CC4S 1BUXA 1SPBP 1XJWB 1OO0B 2DNYA 2H51B 4YR3A 1CS4A 3Q2SC 3TJ9A 3J7Z5 2JEJA 1FKPB 1HWKA 1Q86T 4J7CA 1N32J 1BQXA 3J81U 3QWPA 1S9GA 3V6JA 4OX8A 2HWHA 2RQMA 4LQ3A 2DR7A 5F8JA 4X2BA 3DLEA 2X1AA 5DM6Q 2XO7A 1JMTA 2RQ4A 4HR2A 4KFBB 3QMQA 3MM8A 4PYDA 3PV8A 2HNDB 3QT6A 4NZ0A 4B3RF 5ETRA 3I0RA 1JLAA 2XMJA 3R5DA 3TVYA 1DRZA 4AXJA 2G9OA 1DLOA 1W7WA 2AKWB 2AV5A 3FBFA 2CPYA 2BMBA 4B08A 1V5VA 2CJ9A 3MEKA 4GMKA 3TUIC 3NWGA 1ZA1B 1FI4A 4IR1A 1U48A 4IG0A 3HVAA 3BBBA 2UUBF 3DU6A 3JSBA 1T9UA 1HHSA 3FQKA 4RBVA 2GCFA 1JLCA 5DG9A 2MQQA 4F02A 3GFHA 5G0RB 2AYBA 4DXLA 4U7UD 4GC7A 4XK8C 2FLPA 4LF5J 1TAUA 2N7YA 3VGVA 1U25A 1JB0C 4IFVA 1U1PA 1VBXA 2Y3YA 3E51A 3HVTB 4A4JA 2MKCA 3QGPA 5IZHA 3CCJS 4ECXA 4JI8J 2NZCA 3UDLA 1FFSB 1Y5LB 1TMJA 1FDAA 1ZS6A 2CPEA 2HIQA 3IM9A 2FD2A 4HI2A 3HSJA 4KY3A 4WPAA 4DV4J 3BJYA 1SQEA 5K8OA 3KOAA 4LF8F 2CPXA 2R8KA 2LEAA 4PXDA 1LW0A 3VZIA 1SCJB 2AP6A 3DDKA 2HHHF 2R8GA 4DN0A 1JWWA 2UUBJ 4IUFA 3NOCA 4FXDA 2ZJPQ 2Q3PA 2VQEJ 1VGYA 2VC0A 2YQ0A 3IGNA 4B9TA 4WP8A 2CADA 1PJ5A 1NUEA 4ID8A 2VFSA 4NRTA 1Q81T 2YX1A 1BD6A 3GV5B 2ZDOA 4XO0A 2ALZA 3C14B 4ZVPB 3ZZTA 2DH9A 3IBFB 3D6FB 2JSXA 2Z56B 2B51A 2BE2A 5DQGA 1WHXA 4OZ5A 2LQ8A 2AJ4A 2WBRA 3GPAA 3KLHA 4MK9A 4DQQA 1F6TA 5K8NA 2BABA 1QUVA 2VFVA 3CT9A 3EZUA 5D77A 3IM8A 3ISZA 2ZUAA 4RX6A 3I56S 2CAJA 3RB4A 1TKTB 3OPKA 2FHKA 2P6SA 3BKFA 2OPSB 2VD3A 1Q79A 3TANA 1OJ4A 1X4DA 3DN9A 1HQUA 1SC1B 1VK3A 1GNKA 2ZEJA 2CDQA 1RJJA 1SH2A 2RS8A 4UUWA 1CJUB 4WFZA 2BQUA 2HAFA 2HHQA 1NPKA 1T9VA 2Z2LA 1RT5A 1PYTA 1WDDA 4N47A 1X0PA 2RU3A 2CA9A 3GJTB 4HDHA 3DGPB 1AW0A 2FJVA 1OY6A 3FRYA 2OPRB 2GVZB 1JLFB 2FJDB 3MTKA 4RNOA 2ZOFA 4ED1A 3CCTA 4G3IA 4RW7B 4OYPA 3TUZC 1RAOA 1TVRB 1HNWJ 3ETOA 4F36A 2WSCC 5IT9Y 4Y34A 2K3IA 4AT1B 4IOAQ 3NBPB 5AXMA 1V3SA 3FCHA 2W9AA 1ZOTA 4WYLA 5L38A 1S1TB 2XMUA 4RZRA 2IYGA 1J5EF 1S6PB 4DCJB 2AYGA 1CBKA 1U0SA 4P2MA 5AE3A 1Q5VA 1M5KC 4ZVOB 3DMJB 5D78A 5LJ3Y 1LNQA 3R7SB 1XMQF 1HI0P 5CAAA 3M4XA 3LOUA 1FRJA 2J0QD 5HN0A 1PKUA 4DV2J 1WTFA 4CIOA 2ZWPA 2NXJA 2WB1D 3WHIA 2RSQA 3EVMA 2HURA 2MSTA 2ROEA 2BKNA 3KG4A 3B4MA 5AE1A 3NAIA 1S9FA 1H6KX 2Q6CA 2RRNA 5H1SV 4DV1J 3Q8UA 4JP8A 3TQ1A 1RP5A 1R8AA 1OWXA 4I1TA 2P6TA 4P2SA 3M2RA 2UUCF 3I0SB 4MIAA 1R6VA 3BQ0A 1KSPA 1PYSB 2OHDA 2XO6A 8AT1B 3OUYB 2VHGA 5F9NA 1O5JA 1DHMA 4DR2J 1N32F 2H5IB 2ZHAA 4XIUA 3JSRA 4NWBA 3TI0A 1S99A 2KVIA 3WDOA 3MUVP 1RYSA 2AJFE 1TL1B 1RT2B 4B3SF 2UXBF 1PCAA 3CF5Q 1R31A 4ES2A 4GRSA 2C3UA 1P9QC 4TXSA 4LFBJ 5DGAA 1SL1A 4RNMA 1NB7A 1YGYA 2P9CA 2BQ3A 4KPYA 3C46A 3MCMA 3CD0A 4OX9F 3X3UA 3B54A 4CCHA 4YHHF 1C0UB 2Q66A 1NEEA 3HHLC 4OX7A 4DN9A 3DFEA 2R7RA 4DSLA 1VQ8S 1E6YA 2MY8A 2XMMA 3OXFA 2WVDA 3EM1A 3HLUA 2VKRA 3W5ZA 3OL6A 4YB6A 4JUZA 1RT6B 4ZVHA 4ZA1A 4OV6A 4RW6A 3ICLA 3NGKA 1FWLA 1UJ4A 1L3TA 5DQHA 3VCDA 3TARA 1FJ7A 2W2MP 4ER8A 2B9EA 2YXLA 2HQ3A 2HAIA 4CLSA 3KLGA 1MNEA 5ETKA 1RTZA 2CWKA 4RW7A 5AXKA 3CJKA 1GX5A 2B8PA 4PG4A 1FCAA 1KQKA 4ZJQA 2W2PP 2KJVA 5CZXA 5FLXY 1X9MA 3PJ9A 4DV4F 2H65B 2DPIA 1NJIT 3JYTB 3GU0A 3MUTP 4X4OA 1PIEA 1S9EA 1N36F 4JV2A 4KR0B 4KO0A 1REVB 4B02A 4EUVA 3IAS9 3AA8A 4DX8H 1TKXB 1FJGF 2BBEA 5M2RA 1AT1B 2XG8A 1IN0A 3LTOA 1SBRA 2OMLA 5A76A 2MKKA 1VQSA 3MOJB 3I96A 2MMYA 3W2WA 4F4WA 5CH7B 5GAHI 4QWAA 4OJ1A 5LM7E 1VK8A 2QV6A 3W5YA 1XTZA 4OX6A 4TN2A 2Z8QA 4BLGA 3R5GA 2VH7A 2J6SA 3PXGa 2HG4A 2A1BA 2B56A 1R8HA 1S6PA 3M30B 4P73A 4YP3A 1RLDA 2CQCA 4OHWA 2QTWA 3MAHA 1S9EB 1QAJA 3AXMA 4ECQA 7AT1B 2GJ2A 2CXEA 2CZVC 3LAKA 2RF2B 5C2GA 3DDIA 2OEJA 2AT1B 3EDQB 3DRPA 3MM6A 1GXLA 1RABB 2V9WA 1Z2ZA 4CH7A 3EUNA 2N3LA 2AGOA 2M88A 2Y0BB 1W25A 3DC2A 4UOHA 5ETLA 5GAEU 1BC6A 4KAIA 2L9NA 2DR8A 4ZLLA 1N88A 1N54B 5THWA 3MUMP 1Q7LB 3DLLQ 2AYMA 3HHKA 1XNQF 2KJWA 5CCLA 2VBXA 2DNGA 2BJ7A 2VA2A 3BSAA 3KHRA 5C5JA 5BYRA 2IJRA 4R8UB 3QRQA 1UFKA 4O3RA 4XPEA 1CULA 1E6YB 3CIMA 3NCRA 1TKTA 4RWXA 4KQZA 5DG7A 5HROA 1EAYC 2YPYA 3JAMU 4MAKA 4WK1A 1RTHB 1Y4ZB 1R43A 4MFBB 3CWJA 3H7HB 1KHWA 9ATCB 5GADI 2YKQA 1EJ7L 3OSPA 5HLFA 1SV5A 3SQGB 2AD9A 4C0HA 3V4IA 4V19X 3KWMA 3EYZA 3IS9B 2XGPA 3QGGA 1CJTA 3BQ2A 1UVLA 2WONB 2E1AA 3ILOA 2KG1A 3CJ5A 1GK8A 3MFIA 5C25B 3KK3B 1D09B 3OFFA 5KFNA 1ZAVA 3H4DA 1HMVB 3HX9A 2MKJA 4WXOA 5KFIA 6AT1B 1NDCA 4I6WA 1K47A 3SBMA 3KLIB 5F8HA 4XPCA 3PW0A 2JEIA 2IAJA 1FJCA 3ET6A 4DFJA 2HGNA 2ZH5A 1S7HA 1YRXA 3AJ2A 3GG0A 4X64J 4DR4J 2QA1A 1HLWA 1NDPA 1TV6B 1TU0B 1R8BA 1U0HA 4DPYA 1FRMA 3SDEA 4JI6J 1S0OA 5HJYA 3KHLA 2JH3A 3K7RA 4OHYA 2Q43A 1VQ6S 2F8HA 3AODA 3DRXA 5SUHA 3W7BA 3G86A 3VVTA 4CLWA 3ENQA 4QW8A 4ETZA 3KK1B 4LF9J 5C42B 5KFTA 4OHXA 1FT8A 4RW8A 2E9TA 4BS2A 2NSCA 2XSFA 2DHGA 1NK9A 5B09A 3CJRA 2CQIA 4P7VA 3OR2A 3OR2B 4QIVA 2BKPA 5HL7Q 4U7CA 3MR2A 4ILRA 4BC7A 2MLXA 2YWHA 3DOKB 2CUYA 2BRLA 2J7WA 3HHLD 4DX7A 3NGTA 4DR4F 1RT6A 1HWLA 4CM0A 1VDHA 2VFUA 3WX8A 2VOPA 2D69A 2ZZNA 5A0YB 4UZCA 1TKZB 5J2MA 1S72S 5ITHA 4DQRA 3MURP 1U0HB 1F5AA 3OUYA 4J9KA 3R3TA 5IS2A 1X4AA 3TO8A 4G1QB 3C15A 3FEXB 2P8IA 1JQGA 1B4SA 1BY9A 1S1UB 3T5JA 3GIRA 4JI3F 3GWCA 4Y2KA 2PDAA 4RBUA 1MWQA 1RK8A 1HI1A 2JL9A 3KLIA 2VQFJ 4K2XA 1ZTTA 1EHWA 1RTJA 2ZWOA 4CM2A 2Z58B 2PMZD 3PYEA 2EKNA 4ZHRB 2FHJA 3E2EA 3CJTA 4HT5A 1FHTA 3RBZA 2MXYA 1FE4A 2LVWA 2VKZG 2RVJA 1F9EB 4FVMA 4CP5A 3L7PA 5D6GA 5J2MB 3VAMA 4DX5A 4JI0J 1S77D 1N5YB 1CPZA 1S1XA 4QQBA 3M1VB 3MMJA 3TR5A 4L72B 2K2PA 4PWUA 5DETA 1YVFA 2G2YA 3DOKA 2YWGA 1QSLA 3H25A 1SJ3P 3T1HJ 3VR1A 2U2FA 3D1QA 3KMSA 4FS1A 2HHWA 2DRAA 2J0SD 5CYQA 2ZZTA 1LW0B 4LMZA 4U6PA 2YX7A 1O51A 3DI6A 3R8YA 4DV1F 3F44A 3IR5B 4ZP9A 4WKYA 1CQMA 4O4GA 1SQFA 1UL3A 5F8MA 5DDRC 4CTAB 1N48A 3OTCA 3QIPA 2F8EX 1FD2A 1NSPA 1AUSL 3EE3A 3ZTRA 4ZCIA 4CO0A 3SCIE 2X51A 1QVGR 2FVQA 2C2NA 3LP0B 3N6LA 2HGLA 3HKZD 3OR1A 1RA6A 3BGOP 3CSKA 3AH6A 2GGPB 3W5XA 1X60A 5D0GA 4U7UK 5J2NB 4TNOA 5DJBA 3VGSA 3HP6A 5GADU 5K8PA 4YY3F 4B3MJ 4K4TA 4IH7A 4A46A 3ZZOA 2QN6B 4Z7CA 2HHXA 1RU2A 3EPIA 4DV7J 2ROPA 4C98A 2DHAA 2QLWA 3SCKE 4OJHA 4GC6A 1X4BA 5DM7Q 2UU9F 1QE1B 1NH8A 3J80Y 1JK9B 3E8OA 1TL7A 1V6HA 4LR8A 4ZVTB 4ED3A 3WZ0A 5L1LA 2Z4PA 1YQHA 4RW9A 1YITS 1V5IB 4OX9J 3WX4A 3HFVA 1N52B 3O2IA 3MM8B 4JI1F 3IRXA 1R8PA 3NGDA 2ZUGA 4F2SA 2DT9A 1GXUA 2WONA 4J9LA 5EUHA 4FXVA 3D1HA 3G87A 2C3OA 2A18A 1NDKA 4O23A 2ZH9A 4RPFA 3BO2A 2VFRA 4WCEQ 2R7SA 1U47A 2FC8A 4HLBA 2I5JB 1REVA 2D74B 2G13A 2JJ4D 2OD4A 2VC1A 1KTQA 1VJWA 1WC6A 3HHLB 5U47A 1LWFB 3CJ3A 1RAJA 1MU2B 3THTA 3PZPA 4IRCA 4FF1A 3ETMA 2CJYB 3GCXP 1EX8A 3N79A 5F8IA 4YN3B 4ICLA 4LRDA 1JXVA 2EK1A 2ZD1A 4ANDA 3WIUA 2I1RA 3OTDA 2ZH6A 1OSDA 5LOQA 1QDUB 2B5JA 3PY8A 5CYMA 5CYMB 4B3TF 4X62J 2HBQB 2RNEA 3HHEA 4X4TA 4CRJA 2MZSA 1H2VZ 1RZMA 1ZA2B 2VASA 3DXBA 4MJKA 4W98A 5DDQC 3PR5B 2QO3A 1Y00A 3OTEA 2WOMA 3PEHA 3G4SS 1XMOF 2FZCB 4DL2A 3DOMA 5T41A 1VQ4S 1VRUA 2RF2A 1MU2A 3DI6B 3K58A 1FDNA 2DD8S 2E5GA 3CJQA 1X5SA 1SJFA 1C0UA 2QC3A 4GO5X 4X64F 2GO8A 1NRKA 4ZVSB 3RGIA 5L1IA 3D66A 1GMVA 2K3KA 3M7VA 2J9DA 3RYLA 1WF1A 4C11B 3PR4A 2LXUA 5EGYA 5HMYA 2F3JA 4J37A 2PE8A 4P10A 2RRAA 2IC3A 2KZZA 4ZLJA 5IWAJ 2EC2A 4EO8A 1HNVB 3K17A 1UPMB 1VRTB 3EGNA 1Z1ZA 1ZM4A 3QIDA 3MCNA 3W65A 3KJQB 1WHVA 4NL5A 4O3PA 4WFBQ 4OYZA 4DX6A 1ZTWA 3D5MA 4JI1J 2LQ9A 2CPIA 3JTPA 4KFBA 4F04B 3JYTA 1HR0F 5BYQA 3J7ZT 1S1UA 1XN9A 2H48B 4H4KA 4K7QA 3F73A 4LF9F 3R2DJ 1DQ8A 2RDIA 1GMUA 1C1CB 2GHPA 2J6UA 2VOOA 4OZ2A 1FKPA 1NH7A 3HM9A 4RU2A 2IC3B 3PACA 3AD7C 1YI2S 1RHUB 2WCXA 4F7VA 4DSFA 3LGHA 3W2VB 4ZPTR 1QJHA 1IKYA 3M2VB 3T5HA 3OVSA 2IJFA 4IO1A 4FF2A 3OTOJ 2PC6A 2RE1A 2XMTA 2QYCA 3DLGA 4DPUA 4PPZA 3EJMA 3JSYA 2XQCA 4UY85 4GKKF 3RR8A 3BGFA 1W2IA 2XMWA 2N82B 1ZH5A 1WHWA 4FPIA 2NYIA 1F5CA 1SL2A 1PC5A 1OPIA 2IMOA 4FP9A 2AQ4A 1HHTP 2QA4G 1PJ6A 4C4WA 2IM2A 4DSEA 1RB0A 3C6TA 4HI1A 1SL0A 3LANA 4DZDA 1T05A 1IBKF 2AJ0A 2DGTA 4J90A 2V8HA 3RBEA 5KFCA 2DNKA 1LW2B 4NASA 5K9FA 3VAKA 1FNXH 3R6GB 2ZJRQ 1EQ0A 4FS2A 1I1GA 4XAKA 2HFNA 4WFAQ 1JLEA 5E0OA 3Q8VA 3IN5A 4LF4F 3JSMB 3NNCA 3LW5C 2AJQA 4H4MA 1WSVA 2MZQA 4YQWA 2DKOB 3SI8A 1ZYQA 3R7BB 2Y8WA 2EBEA 5E33A 4JI5F 1CLFA 1OQ3A 4USWA 2VFTA 3G2XA 1MROA 1LK7A 3CJ4A 1G2EA 2R2UA 1VHIA 1LK5A 2K1RA 1RHMB 2NREA 2HLUA 5H9FJ 4Z37A 1X5TA 2G1DA 2V67A 5KG3A 2UXCJ 3O6QA 4B9MA 2B8QA 2IBKA 5K20B 4FYVB 1WWHA 1VBZA 4LT6A 1JLQB 2PA3A 1FRXA 2HEKA 4EI2A 4CI0B 4F3QA 5F8NA 2WVBA 1DTTA 4DV5J 2EEYA 1UW4A 4LUBA 1K0VA 3RBXA 2HRTA 3L9ZA 3FFIB 3UN3A 4KGKA 1JJHA 1KDNA 2V2QA 3US5A 1SI9A 2LDYA 4TY8B 5F3ZA 2F65A 3KKFA 2BKOA 4BWMA 2Z2YB 1XC9A 1KLMB 5EDWA 1AZSB 2NXEA 1HIYA 4P74A 1N5QA 3THPA 3PTWA 4ILLA 1GEHA 2ZITA 1DQAA 3EZ5A 1BWVA 1JLFA 1SKSA 1LWEA 2ZOGA 2E5HA 4LIRA 1XR7A 4TYAA 3MEGB 3MOZA 4RW4B 4ENOA 3KG0A 1XBWA 1RISA 2G1HA 2VPXB 3BPDA 4NLVA 6FD1A 2HWTA 1N6QB 1HNWF 4DQIA 3R5AA 3CCUS 1YJ9S 1F3FA 1KONA 3GJSB 3T1AA 2MQPA 4CTAA 1KR4A 4WFNQ 1HL6A 3F0NA 1KQGB 2CPHA 3LGNA 3ZZ0A 4OFZA 1WKLA 4W90B 5KFZA 2OLWA 4M63A 5KFRA 4NPOA 4BC9A 4U95A 2R8IA 5H9EJ 4LRBA 4ELTA 3DLKA 2EG1A 4ZPCA 4Q43A 2Y9HA 4OJ3A 1FVQA 3B82A 2DNNA 4P7TA 1S1VA 4EGLA 4Z2XA 4DV2F 1CVJA 2VQEF 1N0UA 2YQ1A 3LP2A 1IQTA 2GO9A 3OFHA 3B6BA 4OZJA 3KK2A 3G71S 5HMXA 3PW7A 4AL5A 5I4MA 2DISA 4OYXA 1EETA 1FTRA 1IBLF 4P71A 4CQ1A 1GT8A 3AB4B 3W61A 3CMES 1B99A 3W9IA 2J76E 1CSJA 4UZBA 3A3OB 2FLOA 5EWFA 1IM4A 3MCSA 3VF0B 4B3TJ 3NMAA 2UXDF 2V8DA 3N6NA 3MPVA 4Q2LA 3DHWC 2D3O1 3UCGA 4RU9A 4DFPA 4USTA 2O5DA 3ZNUA 2CQ3A 2QT7A 3QIPB 1PO6A 4NXMF 1FRIA 1ZZFA 4PUOB 5GMDA 4YB1P 2XY5A 2YKAA 1MN7A 1F2GA 1OYEA 4DV0F 3C8YA 3FRZA 1IKXB 4DBQA 4DSKA 2A3JA 2G4BA 3KDOA 3M2UA 3O3LA 1WC1A 3MMAA 4CO2A 4DR1J 3Q24A 2Z2MA 3MHYA 1RHJB 3VALA 1S6QA 1LWCB 2BOAA 2G0CA 1JLGA 5DLGA 5L1KA 4PXBA 2QLXA 2ADCA 1VJQA 4G65A 1UWBA 3RZAA 5KFEA 3R5BA 3CJ2A 1KD1T 3VAIA 1WOPA 2HK2A 3M8PB 2HWIA 1AXQA 1WOSA 2W7PA 1WC3A 4KE5A 3HI9A 2DNLA 3B4DA 1MW7A 4NE9C 4NCGB 3OBIA 3QAEA 1VQYA 1XWLA 5J2QB 2CJBA 2R4FA 4OV1A 2YNGB 4J5OA 4N5SA 3OVAA 2R7WA 4DV7F 3O8WA 3T3FA 1EKSA 3SCLE 1YHQS 2V63A 1SJQA 1T03B 4Y0FA 4Q45A 2FVCA 4GVBA 2MQOA 4ZKAA 1I94F 3UI3A 2QX0A 1SIZA 4EMDA 4NLWA 3JSMA 2VONA 2HFVA 3D6HB 4MKYA 1RTIA 3NRBA 2K8GA 4FXWA 2MEWA 5L9NA 2CJQA 2RKIB 3FCWA 3PEJA 2GJIA 2KHCA 2HNYA 1U6FA 4I7FA 1S48A 3BKUA 3UDEA 3BN7A 2D3UA 2BJEA 2HFUA 1D8YA 4GKJF 1I51B 3C19A 4UTGA 3N5BA 2PFFB 4Y3CA 3TQEA 2MZJA 5CZVA 1S0MA 3ADAC 4RNNA 3DRRB 4O0IA 2DEIA 3MR5A 2LQ5A 5KFBA 1H38A 4LFCJ 3CO0P 4S0MA 4X84A 1RLCL 1AFIA 3HF5A 3AA9A 3DMJA 2ZVIA 3NGUA 1GTEA 2NUUG 3ZTSA 3QGHA 2VJVA 3PX4A 1R8CA 1RWPB 3GTYX 1YBUA 1UVJA 1ULRA 1Y7PA 1TFWA 3GYNA 3UNGC 2DPJA 4N8OA 5IC6B 4JI2F 4BCAA 4QU7A 4C8ZA 2XM3A 1YKWA 2WSFC 2WW8A 1YLXA 3A8JA 3LUYA 4IYQA 2KXHA 2V6AA 1Q8KA 2EG2A 2CNKB 1HPZA 1HHQA 4MIBA 1DJ0A 1H2UX 4KTQA 1JKHA 2ZOMA 1FF2A 2BA9A 2BRKA 3FMWA 3TEHB 1M0SA 5E2QA 3MPWA 1UVKA 4EZ6A 4W4MA 3TA2A 3HD2A 2FYXA 5B0EA 5FLXU 1XIQA 4H54A 4ZS6A 1UP1A 4F2RA 1SC3B 2CPJA 4O44B 5A8KB 1IBCB 1UFWA 1UMJA 3QGIA 2BACA 4ECZA 2BE2B 2FTRA 2ZHOA 1ZAWA 2E66A 2FQQB 3D6TB 3GMGA 4IO9Q 1RI7A 2J7UA 3SSQA 2KYZA 3G8TA 2EFPA 3H4BA 4Y6IA 5MAOA 1HARA 1R6YA 5CABA 3MCOA 4TYBA 3NNAA 4DUYJ 3C6UA 3DYAA 2H1YA 3AJDA 1I3OB 4U96A 5DRKA 5RUBA 5KFJA 3KLFA 2W9CA 4G1QA 1N36J 3PKMA 2BQRA 4PQUB 4DG1B 3ZXWA 3VGUA 4DG1A 2VBYA 2IPOB 1CJKB 2YWWA 1SV5B 3SQGA 2MTLA 1R0BG 2BXJA 2MY7A 3QLHA 2XMAA 3CC2S 3L95X 2C28A 2YKNB 2VZ9A 2CQHA 5IV3A 1Q7YT 4F4KA 5HVFA 4YDDB 2F1FA 4DL5A 1KFSA 1YJNS 1UAWA 1RKIA 5DGBA 4DI6A 3D9BA 3NS7B 3W62A 1QAIA 4WE1A 1HBNB 1LWCA 2P2CB 2YWFA 2IRYA 1NK5A 1YJ7A 3HSGA 3NBPA 1JLBA 4F25A 1LKZA 5LSRA 1G6BA 2D41A 4RJVA 3QFWA 3J7YI 1YSJA 2H9ZA 4KV8B 4LSLB 1T9WA 3TP2A 4HH0A 2ZH7A 4DR5F 3KK1A 5KFUA 4ED7A 4DL7A 3ZFVA 4KHPJ 3KHGA 5D4PA 4YOEA 1ITPA 2GGPA 1M1KT 3HPOA 4LBPA 2AGQA 4M5KA 4Y2CA 3BO4A 3AD8C 4Q2MA 1HQ2A 3AQOA 2KB2A 2ADBA 2C3YA 1J5OA 2ZHBA 2D9OA 1KRPA 2RAQA 2CYYA 2UUCJ 2ZBCA 3W1YC 1P6TA 1HQEA 1JLCB 1KN6A 1UCNA 2HNDA 1T02A 3OFGA 1RSCA 4NLXA 3RRHA 2VPZB 4V19J 3PX0A 2WVCA 4NLGA 2GQ2A 3DRRA 1WI6A 2MHNA 4YDXA 2XTJP 3KMQA 3NGRA 3PCOB 4WXWA 4Y65A 2OTLS 1U6BA 3PDNA 3OL9A 2W9BA 1T3NA 2FHMA 4M94A 4PQUA 1UZHA 4I7FB 2CVIA 2LP4A 2AF6A 4QWDA 1IBLJ 3CXCR 1RT2A 1TL1A 2YTCA 2GVDA 4OI4A 1H2TZ 3U1NA 2KDOA 1L3KA 2NCKL 3DLEB 4J9UE 1WTBA 2X3DA 1TQLA 4ZP6A 4Q0BB 1A9NB 4RL1A 1YBAA 3P8BB 4OZ3A 4HTJA 2OFGX 2DGSA 5J2NA 5KFKA 4B17A 5EX3A 1YK9A 2V68A 3DM2A 1MMDA 3N01A 2GIQA 4QIGA 3KLFB 1UA0A 3WC2A 4RLEA 5KFVA 1HNZF 1SJRA 1MROB 4ZPAA 3GFXA 5HROB 1T9XA 2E7WA 2MZRA 1RWVB 3BR9A 4O3QA 1DARA 5HK4A 3NCPA 3S6EA 2FJBB 3M6UA 5IQ6A 3MD1A 2PT0A 1ZM9A 4M1KA 5IFMA 3H2LA 1GMWA 1TKZA 1KVJA 1WEYA 1T11A 4M5DB 2N4DA 2O3DA 1XNRJ 4IFVB 2GIFA 1H7XA 1S1WB 2RJZA 4ANEA 2AEFA 3DLJA 3MPUB 2DH7A 5KFAA 4DZ6A 3MECB 1WEXA 1JKHB 5KTQA 2DNRA 1S5ZA 4IG0B 3GP9A 3GILA 5CD4A 1OY8A 1RT1A 2G0IA 2Y0SD 3CD7A 3GFYA 3L09A 4LSZB 4K4UA 3PFEA 1JX4A 3D7SB 3H59A 5KT6A 1IJFB 2DH8A 4EBDA 1SUQA 3PHEA 2IM3A 3HT0A 4LSNB 2F63A 4I69A 3I0SA 2DNZA 3RAMA 3TJAA 5A6PA 2WW4A 4RR5A 5GAGU 4C0OC 2FVPA 4U8VA 4FNIA 4X4VA 3OXLA 1U7LA 2CNLB 3CNQP 1YIJS 3DHXA 4YS2A 4UF4A 2F5GA 1M5SA 1S9GB 1FDDA 5FDLA 1T95A 2AZ1A 2FB0A 4KHRA 4DU8A 3R2CJ 4LF6F 2ZH8A 2HHVA 3M05A 1X4FA 4JI6F 2NXUA 1D9DA 1TFYA 2KT5A 5KT7A 4ZPVR 4QYZK 1NPRA 4BHQA 2DYAA 2PFDA 3GG1A 1HBUA 4C8MA 2XI3A 3WBZA 2BV3A 2R7VA 4URSA 4K4WA 3HK2A 2MQ8A 4A8QA 2OSRA 4QIFA 1T05B 2PI5A 2KTQA 1S1VB 4Q5VA 2QYGA 4M5JA 2LXIA 2XLKA 1S1TA 2EFOA 3I9V9 1RWKB 3QATA 5G4DA 3RAQA 4K2JA 5M2UA 3OJUA 3KLEA 1SQGA 3IRWP 2DHHA 2W4PA 3BN4A 2XNRA 4ZITA 2ZZMA 2XMVA 4IH6A 4MKVA 2ZDPA 3A8EA 2MKIA 3QJPA 1YRUA 5FD1A 1U2RA 2HLTA 2EK6A 2XSJB 4A8XA 3PW5A 3M6VA 1EKRA 5T7LA 2ZJQQ 2FUG9 3VZHA 2NS1B 1FD8A 4DPOA 2XYHB 3JB9k 4R5PB 1O0PA 1W26A 4NCGA 2GNKA 4JB8B 2JLEA 2KO1A 4DR1F 1J5OB 5F41A 2JFDA 2JZ5A 5B08A 5KFQA 2UVWA 2R42A 1CULB 1S0VA 5D0HA 3UVJB 2HBZB 3VV2B 4C8OA 2ZVSA 1UEKA 3RB6A 4LF7J 4DR5J 2KZMA 1Q8IA 3FGVA 2XCPA 1NJZA 4KV8A 3T1YJ 3ZTOA 1EARA 2J0XA 2NYHA 3M8ZA 1NCLA 4QOTA 4WBFA 2ABYA 2HFSA 1VS3A 2MKHA 1YG0A 1NK4A 1X9SA 3DM2B 4E98A 3CJ8A 1QTNB 3SV4A 4LF6J 4NCBA 2E1CA 2WBMA 1BQMA 3MM7A 2N3OA 1VOMA 3BSCA 3ULHA 3Q8QB 2ZNZA 1S1XB 2BW2A 2EFQA 4M5MA 4C6AA 4C48A 2P9GA 2XNQA 3N5FA 3R5CA 3EXCX 2GVDB 3CGIA 4G1IA 5A6WA 3EZOA 5FJ4A 5KFSA 1P27B 1F5BA 2YNHA 4IG3A 2KRBA 3I0RB 2V4JA 4ECVA 1XR5A 2DGOA 3LALA 2GFFA 2CJAA 3PRBA 1S7IA 4PYAA 5KG4A 3EVWA 1TZ0A 5JMNA 4C0BA 3C15B 5CD4H 3ILLA 2QA2A 2RT3A 4R25A 3H5XA 1U26A 4ES3A 1TMMA 1RTDB 2GW8A 2GMHA 1AYEA 3K59A 2MDAA 1IR2A 4P2FA 3MM5B 1NBEB 1H72C 5EWEA 5ETPA 1NHUA 2QMWA 2X1FA 3P96A 1HNZJ 4AL6A 3TYTA 3W64A 1RAHB 3QJLA 2OJ3A 4OIXA 3CJKB 3C2PA 5HATA 4NLPA 1JNRB 3QT7A 1S97A 3HJVA 1N8RT 3M8YA 1GQEA 1JLBB 1OSCA 5I3QA 4EBEA 5DDOC 2CQPA 3DLHA 2PGCA 4WKRA 3GYGA 1D8ZA 2CQGA 2CZ9A 3HZEA 4QW9A 5DZ6A 1Y9OA 2W1BA 5HJXA 1YZ6A 5C42A 3OTOF 3GFZA 1KS2A 4JI2J 1HFEL 5EHHA 3MAQA 3CDWA 1QY7A 1VI7A 2O01C 2UP1A 3UPFA 4DQPA 4TU9A 3GLJA 1KVKA 4DS4A 2L9WA 5JVGQ 3KLEB 4KGVB 2QZ8A 3F41A 4NI2B 1R89A 2VG6B 4UW2A 1FNOA 1RXOB 2FJEB 3CVKA 3MD3A 5A2QU 3C16B 2FHOB 3OQ2A 3VAFA 1VQ9S 5J1EA 4CT8A 1HBMB 2V94A 1NB2A 1UZDA 3G6VA 2J7KA 3OXGA 4U9RA 2CDRB 2CKWA 3DCAA 4FNHA 4PEOA 2VDHA 3Q0AA 3HD1A 4K0KJ 1KNZA 1RADB 2B0GA 2B43A 3MPDA 4RUBA 2F7VA 2MSSA 2RB7A 2BJ9A 5DLFA 5FDLB 1NLKL 1R0CB 3H40A 1RT1B 2PA8D 3A8IA 4D3GA 3LF0A 4DR3J 5IOLA 1FK9B 1XMQJ 4C3MA 1QTMA 1X8DA 1CJTB 1RBOB 1YWXA 2DTJA 1HYSA 4A8SA 3MECA 2M70A 4CLKA 1WDTA 1A6LA 3ZTQA 4J9RA 1K8AT 4PCQA 1KC8T 1BMQB 4KHMA 2H5EA 2CFXA 2IA0A 2HK3A 3JXOA 4AQYF 3V81B 5LSLA 2QA4S 3T5LA 1LW2A 4PQAA 4RKUC 1YJTA 4NYZA 4F4ZA 2E29A 2W7AA 5KOXA 3GIJA 5JVHQ 3OL7A 2HS0A 1M1GA 3TA0A 1R7IA 2J8AA 1RT7A 4LIWA 1U1KA 3EVOA 4DF4A 2ZH4A 1HBOA 3OTBA 1Z2LA 2M8HA 3LAMA 4H4OA 1S6QB 1FEHA 2YPZA 2F9DA 2XHCA 3CW2C 1S10A 4MT1A 5K14A 1RWXB 3D54A 8RUCA 5LMNJ 1J5EJ 1TVRA 2R2TA 2XGQA 3HO1A 1LXNA 3VVUA 1DQ9A 3FCVA 1VBKA 3BO3A 5GAHU 1ZAXA 2ATLA 4IQMA 1QLNA 2K7KA 1D9AA 4PPDA 2J9EA 1U1LA 1RT5B 4ZOSA 3NY0A 1JNZB 2W24A 3TZWA 4YUDA 3KNAA 4KBIA 1AROP 1TK8A 2XY7A 4WP9A 1MMNA 3KNGA 5E41A 3HULA 2WB4A 5EN1A 1P8GA 3AB2B 1F1BB 1D0EA 2EFGA 2CJKA 4J9NA 1S4EA 3G96A 1E6VB 3W9HA 1UJ5A 3QFHA 4ZJLA 2DR5A 2IAJB 2RDJA 1SKUB 2H4WB 1J27A 3JQJA 1FERA 2BE9B 2E7XA 2JRSA 4LSNA 4ANCA 1F3VA 4K4ZA 1KTVA 2YNHB 4IG3B 4DV6J 1U09A 1SC6A 1VRTA 4KGZB 3K5OA 4RBTA 4X4RA 3I6PA 4J9PA 1FNMA 1LOUA 3AT1B 4B9NA 2ILZA 2MGZA 2D9PA 2W8KA 4J9MA 2HMIB 1FA0A 2IRXA 2PN6A 3HHDA 5I42B 1QSSA 1D9FA 1RT3B 4LF2A 9RUBA 5HQMA 5HQLA 2MJNA 4J9SA 5D8HB 3QO9A 5KFXA 1WKKA 2R7OA 4DQSA 4DDFA 4FZVA 4I6AA 2WRMA 3Q86A 1Q8LA 5AXLA 4EYHB 2K7JA 1KKHA 2OO4A 1K1QA 2CQ4A 4ZP8A 4NCAA 1XNRF 1FWPA 4YFUA 4FDFA 4PRFA 3CJ0A 4KGMA 3MEGA 2OI2A 4I6YA 4CZCA 1UPPA 1TKDA 3OHAA 3GJQB 2OELA 3GR1A 4I64A 5KT2A 4DV0J 4PUOA 4CYUB 5IM0B 1HD1A 4EZ9A 4B3OA 1KQSR 4A8FA 3JTOA 3HHLA 5KFOA 5I3UA 1ACMB 3DU5A 3TX0A 3H90A 2BM1A 2IDLA 1SJ1A 2DK2A 3CDAA 3P4UB 3BDPA 1TL3A 4M5GA 1WD6A 3KLHB 4Y00A 1FRHA 2AZ3A 2PEBA 4ICLB 4BBYA 1U1QA 3M8WA 2OPPB 2ZH1A 4OYAA 3SIPB 3M1VA 1FDBA 3A12A 4WP3A 5C25A 3KK3A 4KKOB 2MGZB 1QVFR 4DR6F 2HVZA 2ZNYA 4YMEA 2JLGA 3I5AA 4DV5F 3QLHB 1JIHA 4RW9B 2IRUA 3CMAS 2MQMA 3D3BJ 1RTJB 2AU0A 2ACYA 4LJMA 4X4PA 4QU6A 4URQU 3N0VA 4CH0S 5KFFA 4KB7A 2FVSA 3IRXB 5D3GA 4C7QA 1BHNA 5C2CA 3W2WB 4B3RJ 1FFWB 1HQEB 4CYUA 5IM0A 5CA5A 4ELUA 4OYBA 1RAFB 3SEOA 2LKZA 5K8MA 2BJ1A 1F0XA 1UJ6A 2IIHA 1C1BA 2VPYB 3I9ZA 4PWWA 3ZNJ1 4X65J 3FZBA 5BR8F 1GH8A 3RTVA 4DHVA 3CCLS 3FKBA 1ZPWX 4LRFA 3JQKA 3H5UA 4K4VA 1U24A 3DKDA 1EB0A 2NPFA 4JI7F 3UR3C 4DL0C 3MM9B 2LECA 2Y1IA 3DRPB 3MM6B 1L5UA 4NA1A 5DDPC 2K06A 1DTQA 1DTQB 5K14B 4WZMA 4PWDB 3MMCA 2NZ4A 4PKDB 4GO7X 1B0VA 2DNMA 4K5SA 3CCWA 3ISND 1QAYA 1WG5A 1XQIA 1EP4A 3PO4A 4CH1A 1FE0A 5DZ7A 4Z7YA 4JI0F 4NXNJ 4EBCA 1N5VA 2JDJA 2OMOA 4NZ6A 3KG1A 5B0AA 3SDEB 3W63A 4USMA 2RQCA 3MEEA 4DLGA 1UVMA 5CYJA 3KLVA 2RU9A 3MPYA 1DURA 3E01A 1RT4B 2FGOA 3HVWA 4N7TA 7FDRA 1FK9A 2GMLA 5B0BA 2KFYA 2ASYA 4ECUA 1T7PA 2NQPA 3OD2A 2V4QA 1X4CA 4DV3J 2XZTB 1BE4A
chains in the Genus database with same CATH topology
3U7JA 5KFHA 3IBWA 1N34F 3CPWR 3I87A 5F0UA 2DNQA 4ED0A 1FRLA 1VBYA 1BQNB 3SCJE 3B8HA 1UWBB 2EPIA 3TUJC 3DLBA 4CNYA 4F3OA 1MSWD 2KFZA 1VC5A 3U02A 5KG6A 1TL3B 3D2WA 2R9LA 1SKWA 3Q8SB 3X1LB 2C2DA 4OI0A 1UKUA 2E9RX 1SJ4P 4C9DA 2UVRA 5HQ8A 1G3OA 2FGCA 2X3GA 3Q22A 1HW8A 3I4PA 4NLUA 1TL5A 2VB6A 1WACA 2LA4A 1N56A 1SH3A 3HVTA 3MEDA 1JXEA 4G6VB 1L3UA 4I2PB 3RR7A 1Q1KA 5KFDA 2UVUA 3I5CA 4LFBF 2YNFA 2ZD1B 2L08A 1TV6A 4F50A 3KJVB 2KRRA 4ZK7M 2HMIA 1YRTA 2GHVC 2QFJA 4OJGA 3NL0A 1C1BB 3P5TL 2ASJA 1URRA 2OTJS 1RTIB 2RUGA 1Z4UA 4NMLA 3CIZA 4KC5A 2QRRA 2OPSA 1DZ5A 2GC8A 5E5NA 3UCUP 4ETXA 3CTRA 3HHNB 2XBPA 2A2CA 3A1YG 1KFDA 4DUYF 1TK0A 3PX6A 1DBDA 2YVSA 4C11A 5L1JA 1NK8A 3CCZA 2DHXA 3C66A 3TX8A 4ECSA 4KO0B 4N76A 3DXSX 2L48A 4A47A 4QPXA 3Q23A 5BJRA 2DJWA 1ZZNA 2QE5A 1IUJA 2XMKA 2OP5A 2OPPA 2C2RA 1FTCA 1DFDA 2MZ1A 2CZ4A 5K5MA 4Q7AA 1RKJA 7FD1A 3DGPA 5KT5A 4PR6A 5I3UB 2GIRA 4M5DA 4TY8A 2N7CA 2OIHA 5FIIA 1R0AA 2MKSA 1IKXA 2HFZA 2BJDA 2UV8A 4NOHA 2VG7A 4ED6A 4UY8T 3TRGA 1DTTB 2VG5A 3ENVA 5D3GB 1MWZA 2NPIA 1J2VA 1L3SA 1G7CB 3CD6S 5AE2A 1S79A 5M2PA 1FXLA 4YR2A 2EC0A 3BEGB 1CQNA 5LSOA 2QIFA 3AAWB 2RD5C 1FXDA 3ZZZA 2LEBA 3CULA 1OIAA 3MFHA 4B9LA 4C8YA 2ZH3A 4OLOA 4ES1A 2AJ1A 3FVYA 4IRKA 5DS7A 4AYBD 2LA6A 2R2RA 4B9UA 4YEAA 1X5OA 5J2PA 1QE1A 3H2UB 1NKCA 4CO3A 4FBTA 3PO5A 1VC0A 2CPDA 2E1MC 5KG5A 1O8BA 1WELA 4ZPDA 1UFLA 4H4MB 4ZLPA 2M52A 4M95A 3CD5A 1FKAF 4I67A 2KKHA 3CC7S 4JBCA 2HHUA 5KOWA 4MKAA 2IVMA 5E7OB 1IXKA 2DRBA 1ZM2A 2D1CA 1SUQB 4ZVGA 4C3LA 1EP4B 2CG4A 2DNHA 4XDCA 3NS6A 3N9UC 3L7OA 4Y2MA 1KLNA 3E2EA 3KLGB 1Q82T 3CEDA 2GV1A 3POTB 4PG6A 4K4SA 4LFCF 4I2PA 2LLZA 5IQQA 2BYCA 2L9DA 3UFCX 3UWTA 5HMZA 2RRBA 5KFWA 1K9MT 2HQIA 2V8GA 3UD3P 2V0NA 3FFIA 3HXMA 1H7WA 2C3MA 2YQ3A 3BSOA 3JAMY 2X1GA 4AFFA 1T8EA 4KIAA 4HHJA 3T9NA 3CUNA 3S1TA 3EPGA 4F3MA 3BB5A 3QPIA 1M5VC 4E0DA 4D3HA 2JEGA 2V8VA 2DCUB 2W4DA 4QCLA 1FKOA 2WSEC 1NK6A 4WU2A 4QR1A 2ROGA 5B0CA 3BGLA 3M9NB 4EYIB 2DGWA 2YY3A 2CQ2A 4MH8A 3NAHA 2FPHX 4A8KA 4DSJA 3EGZA 4JI8F 2DB1A 3VTIA 4HDGA 1WEZA 1PSDA 3LPYA 4Y2IA 5JUMA 3LP2B 5A8RB 4WJBA 2M9KA 1AUDA 1N0VC 2UXCF 2CPZA 3M8SA 4LQ9A 4AXIA 4DL3A 1S1WA 2XB2D 1PILA 2E1RA 2Q79A 1CG2A 3DLKB 4X65F 1VQ4S 3PFOA 2PMHA 4K0KF 4A8MP 5J1NA 3MMAB 5AJ3F 1U1RA 4R0EA 4FPRA 2MB0B 3VWSA 1DAXA 1GX6A 2RQKA 2XWXA 1D0EA 4H4KC 1P1TA 1U6ZA 2XEXA 5L39A 2KU7A 1NJXA 2VG7B 2EFNA 4I68A 2C22A 5D4OA 2KFNA 4ILMA 1TL4A 2B9YA 2D3ZA 4HT7A 1PC4A 4O3OA 2FJXA 3CCES 4O3NA 5KFLA 1VIXA 3L3CA 3K2YA 4M8LA 1FESA 2C42A 4WFXA 1BWEA 1U1OA 5T7LB 3OLBA 4FVCA 1T3OA 4DV6F 2QSWA 4USHA 3PIOQ 3MMBA 2HFOA 2HHPA 2CQ0A 1VQLS 4JI4F 2GMJA 1NZAA 1ZETA 4ED2A 1X5PA 1JLAB 3IWNC 5HP1B 4OI6A 2FC9A 2EVZA 2LDIA 1X4EA 1VFJA 4CNZA 2FJWA 4B9VA 4IR9A 4O3SA 4DV3F 4WYWA 2YNGA 2I2YA 3OVBA 1HWIA 2OSQA 4ZPBA 4WTYA 4IQXA 1I6JA 2HHSA 3GV8B 3ONQA 2AX1A 1VQPS 4OZLA 1W2BR 2JEFA 4NX9A 2DO4A 1U8SA 5C24B 3G6YA 4LFAF 4N77A 3MR6A 4C8KA 3CO9A 4X4SA 4HVZA 3TOQA 1C4AA 2CQBA 1D3WA 4O44A 1S6OA 1C0TA 2ZBIA 1RWUA 2OH2A 3LP0A 3OR1B 4X66F 2KG0A 2FY1A 4RW6B 2E5LF 3MM5A 1TAQA 2VODA 3N4WA 2QSFA 4ID5A 4NLOA 1ELOA 5D4NA 3UE2A 3SZ2A 4QPTA 3D0HE 2BVZA 3AJ1A 2LYVA 3P49B 2EI5A 4ECWA 4DL6A 5LT5A 3H20A 4USIA 1M90T 1PGZA 1FEEA 3D28A 2ASDA 5F3TA 3PJWA 2UV8G 5I3PA 1HWJA 1C2PA 4O4RA 4UQGA 4KT0C 3G8SA 3IWXA 3SSRA 1H0HB 1NJYA 3G6ES 5CCMA 1VLYA 3MGJA 1QUPA 1IJEB 2XS5A 5HP1A 3GYXB 4ZCKA 2B3TB 2J5AA 1KOHA 2ZC3A 4OZ1A 4QYZJ 4IDKA 4QZVB 4AL7A 3EX7B 1B64A 4DFMA 4KRWA 2DGXA 2CQDA 2RKIA 1S6UA 4RWWA 2PEHA 5LXRA 3S7RA 2E5JA 4NLRA 2B4PA 1RA7A 2W4CA 5KT4A 1NJWA 4QJVA 4I2QB 5KFPA 3V6HA 1CC8A 1HNVA 3GZ7A 3LQVA 5KT3A 1K73T 4ED5A 3M32B 3N28A 2V4RA 2QMXA 1VQKS 1QSYA 4I56A 3POTA 3CCRS 2HVIA 3GR0A 1A7GE 4HH1A 1X9WA 3BQ1A 1KHVA 3RBDA 1RYRA 3I55S 4K50A 4QWBA 2JVRA 3MF5A 3TNVA 3FSXA 4X4QA 4TQSA 2NUHA 5KFMA 2I9SA 3M6XA 4EFAC 3NMRA 2GA7A 4K5RA 1Q4RA 1KLMA 2JOQA 3MM9A 1RDRA 3H2VE 2VBWA 3HDSA 4KSEB 4YB7A 5E3QA 4EU0A 3BGUA 3IXQA 2M7SA 1WF0A 3MDFA 4F8RA 5LMUF 3LH2S 3LWMA 5J2PB 5LMNF 3T5KA 2MHEA 5LJ5Y 5AXNA 1XR6A 5HMWA 3BR8A 4NA2A 3Q2TC 1LFWA 2YNIB 1NHVA 1V3RA 4DR2F 2D7SA 5IXUA 2XWYA 2JC0A 3RRGA 3E3XA 3TAMA 2A2DA 3LP1B 4A8OA 1S4FA 5CQGA 2IJNA 3LGMA 5B7WA 1RT4A 1RQ0A 2DO0A 5MLCV 3PNIA 1ZYQA 3BZQA 3V4IB 2B4VA 4URGA 3V6DB 2JC1A 3CB4A 5CXTA 3RAXA 3IO1A 1HNXF 2X1BA 4OMFG 3Q8PB 3BDEA 3DDNA 3K5PA 5A0YA 3CDBA 2COLA 4OI2A 1VQOS 4L3NA 2PI4A 4R8UA 2ERRA 4X4NA 2IM0A 2GQQA 2U1AA 2B7CB 1F9FA 5A8KA 2ZKTA 4C2MA 3HVRA 2F4VF 4X4UA 4MFBA 4EWTA 3GIIA 4F4XA 5HLFB 4DOZA 3IG1B 4C8NA 1X7VA 3FJ2A 2VA3A 4NLQA 4RW8B 1VHFA 4RUAA 3OFEA 4ITSA 2M2BA 1M5HA 2DGVA 3F56A 4NZ7A 2D3OR 3N6MA 5E3PA 1K0TA 4OZ0A 2IVFB 3TVKA 1N5YA 1QM9A 1WG4A 2I5JA 2LXFA 2ZM6F 6FDRA 4TLQA 2HGMA 4OQJA 2SXLA 1RTDA 2IFXA 1C1CA