1YJWS

Crystal structure of quinupristin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 19
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2005-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1yjwS00
2M8HA 1HD1A 2KU7A 1M5PC 3J7ZT 3VAIA 3MOJB 3Q2SC 1X0FA 3CTRA 1U6BA 3MD3A 2CQHA 2RRAA 2SXLA 1U1OA 4M5DB 2OJ3A 4BS2A 3TP2A 3S6EA 3B4MA 3US5A 3G6ES 2G1DA 2N82B 1YITS 1UAWA 5JVGQ 1BY9A 1X5SA 5FJ4A 2XSFA 2ADBA 2E5GA 5CYJA 3ZZYA 2DGXA 2UP1A 1YIJS 1SXLA 5GVQA 1WF1A 3VALA 4ED5A 1QM9A 3BS9A 3MDFA 5DDQC 1SJRA 1JJHA 2EK6A 2KN4A 2LXIA 1JJ4A 2DNNA 1YJNS 3CD6S 5DDOC 2EK1A 5MLCV 5DDPC 2MJNA 2CQ3A 4YB1P 5IQQA 5ITHA 5D77A 2MQLA 1VQ6S 3CMAS 4IOCQ 2DISA 2WBRA 1PGZA 2DB1A 2GHPA 3MD1A 1U6FA 5BJRA 5GMKa 3G4SS 5CXTA 4F02A 2N3OA 1VC6A 2LECA 3UWTA 4CH0S 3G8SA 2HYIB 3S7RA 1D9AA 2RUGA 3DXBA 3CC7S 2J0SD 2M2BA 1WELA 2J0QD 3D2WA 1P27B 2CPHA 3CULA 5LJ5Y 2MJUA 1VQMS 1RK8A 1N54B 2AYEA 2GO9A 1VQ4S 3CC4S 1U2FA 1FJEB 3BEGB 1UP1A 4U67Q 3SXLA 3MUTP 4OZ1A 1W2BR 2J8AA 1WEYA 1KOOA 3SDEA 1X4GA 1KC8T 1KQSR 2M9KA 2MZQA 5EN1A 2KRRA 2L9WA 1WHWA 3CF5Q 1AUDA 1WI8A 2FC8A 2M7SA 5HO4A 1VBXA 4PRFA 1WF2A 2LQ5A 3ZZZA 5GADU 2G0CA 3FEXB 2ZJPQ 1VQ9S 5DDRC 2MB0B 3S01A 1X4FA 2KXHA 1FT8A 3UCUP 2VOPA 4W92B 4A8XA 2F9DA 2JX2A 1FJ7A 2PEHA 3B4DA 3I55S 3I56S 2DIVA 4Z2XA 3U1LA 3CCRS 2AD9A 2MPUA 2LMIA 3CCMS 2NZ4A 1YJWS 2DNKA 2DGUA 2MSSA 5LJ3Y 2MKIA 4QQBA 3NMRA 2RS2A 2DGQA 2YH1A 1RKJA 2XS2A 3NNHA 5JVHQ 1HL6A 1WHYA 2CQ2A 2DGWA 5DETA 3IWNC 1X5PA 1X4AA 3NNCA 3H2UB 4IOAQ 2DHGA 3RW6A 1OIAA 2XB2D 2CPYA 5LXRA 4ERDA 2X1AA 4RU2A 2RQ4A 4TU8A 4QPTA 3P3DA 2YWKA 3MURP 1O0PA 1ZZFA 1U1MA 2MQNA 2RVJA 3SDEB 2D3OR 1N88A 1U1LA 2JWNA 2CPZA 3OW2R 1WG5A 1X4BA 4TU7A 2U2FA 2DNZA 2K3KA 3P6YC 4C0OC 1M5VC 1JMTA 2FPHX 1FNXH 2CQ0A 1YTYA 4PKDB 2OSQA 2J76E 2KM8C 2ERRA 2CQDA 1SJ4P 1Q82T 3G9CA 2DH7A 2DNYA 1IQTA 2A3JA 1SJQA 2MMYA 2YTCA 1U1KA 2DHSA 1ZZNA 2G4BA 2F3JA 4C7QA 2LYVA 5GAEU 2U1AA 1QVFR 2RS8A 4WFNQ 3L3CA 2YH0A 2CQCA 2RRBA 3S8SA 3CXCR 3G71S 2D9OA 3NNAA 4WKRA 1Q86T 2EVZA 2FY1A 3G96A 3VAHA 2MQPA 1S72S 2I38A 1R8PA 2HVZA 2DIUA 2DNQA 1VQ5S 2CJKA 3CMES 4WF9Q 4OZ0A 2DK2A 3NS5A 2MHNA 3N9UC 1H2VZ 2LA4A 2DNOA 2N7CA 1SJFA 1X5OA 1WG1A 2DHXA 2RT3A 3BO4A 1WEXA 1YWXA 2LXUA 1VQOS 3K0JA 2JVRA 2DO4A 2ADCA 1U1NA 4Y00A 4W90B 1P1TA 2MKHA 4WIIA 3CCLS 4YUDA 2O3DA 2CQGA 3EGNA 4IUFA 3U1MA 1N52B 1G2EA 1URNA 2DO0A 1OWXA 2DGTA 2X1FA 2CPDA 2LEBA 1XN9A 2BOPA 3P49B 2HGNA 2KRBA 3Q2TC 1K8AT 2MQOA 4FXWA 1X4HA 2MYFA 2CPIA 2PE8A 4V19X 3IRWP 3CPWR 3CCVS 4EGLA 3VAFA 3VAGA 2DNHA 1FJCA 1WHVA 2MSTA 2ZJQQ 3MI7X 2KVIA 2OIHA 2DNMA 2Q79A 1VQNS 5CA5A 1D8ZA 2MZ1A 2CQ4A 1U1QA 4TLQA 1X4EA 2MKCA 2YKAA 2E5IA 2CQ1A 3UD3P 2XNRA 4UY8T 1OPIA 3LPYA 3CCQS 2MZTA 4C4WA 3UCGA 2AYGA 2MGZB 1KOHA 1VC0A 1CVJA 1F9FA 2CPXA 1S79A 2E5JA 4YOEA 3PIPQ 2DNLA 4TU9A 3HHNB 2CPFA 2KH9A 1K73T 2CQBA 4PR6A 2KFYA 3MUVP 5IM0B 3BO2A 2CPJA 2M70A 2M0GB 3BO3A 3CUNA 2DH8A 2I2YA 2DITA 2LKZA 3THTA 1FHTA 3EGZA 1HA1A 3LQVA 2LCWA 2VONA 1WF0A 3CCES 2CPEA 2V94A 2MQQA 2MKKA 4IO9Q 2K8GA 4QU7A 2MZSA 2OTLS 2KI2A 2QFJA 2VODA 1QVGR 2L41A 1DZ5A 3P5TL 3ULHA 4CIOA 3V4MA 2DNPA 1OO0B 2HZCA 2MY8A 3FEYB 2RQCA 5LSOA 5LXYA 2VOOA 3EX7B 3NS6A 4WFAQ 2B0GA 3R1LA 4LMZA 1ZH5A 2N3LA 1X5TA 5GAGU 1JJ2R 5H1SV 1WWHA 2BZ2A 3H2VE 2OSRA 3CCJS 2L08A 1R8HA 1NU4A 3VAJA 1DBDA 2RNEA 1VQ8S 4F26A 1DRZA 3R27A 1VQKS 4UQTA 2LA6A 1UFWA 3TO8A 1H2TZ 1VC5A 2MGZA 4P6QA 2KM8B 1PO6A 1A7GE 2F9JA 2RU3A 2MXYA 3THPA 4ZKAA 4LJMA 1U1RA 4J5OA 2DGSA 3RW7A 1K9MT 3PIOQ 1DHMA 2MZJA 1WEZA 2KG0A 2D9PA 1X4DA 2DNRA 1WI6A 2FC9A 1H6KX 2HGLA 5D78A 2NLWA 4LIRA 5DM6Q 3JB9k 1YHQS 5IM0A 1KD1T 4CQ1A 5IFMA 2KXNB 2MKJA 5LSLA 2AYBA 1SJ3P 1B7FA 2CQPA 1M1KT 2MZRA 2OTJS 2MY7A 1FXLA 1Q7YT 2QEXS 2XS7A 4F25A 2MQMA 3VAKA 2FHOB 3G8TA 1M5OC 4FXVA 2KHCA 3SMZA 3HI9A 2CQIA 2AYMA 1VQ7S 1YI2S 2KXFA 3UCZP 1NO8A 1FO1A 2DGVA 2QA4S 1M5KC 1NJIT 2KT5A 3UD4P 3R1HA 4QU6A 2HGMA 2DHAA 1A9NB 3CCSS 5HL7Q 3VAMA 2KG1A 1YJ9S 2KYXA 3TYTA 1Q81T 5GAHU 4WFBQ 1HD0A 1UW4A 1L3KA 2M52A 2XNQA 4Y0FA 1X4CA 2DH9A 2E5HA 4CH1A 3MUMP 1VQLS 4WCEQ 2JRSA 3DLLQ 2X1GA 1WTBA 2ZJRQ 1VQPS 2JVOA 2DNGA 1WHXA 2LEAA 1VBYA 2MKSA 1H2UX 2E44A 2X1BA 2M88A 3UE2A 2M8DB 2XS5A 3VF0B 1M90T 1N8RT 1U1PA 2M4MA 3J7YU 3CC2S 1VBZA 3CCUS 5DM7Q 3MXHP 1WG4A 2DGOA
chains in the Genus database with same CATH superfamily
4WK3A 2XI3A 1E6YA 2E7VA 1AFIA 4Q8FA 1UWAA 3K57A 4JI3F 1GFWB 1XC9A 1RSCA 1ZS6A 2UVVA 2C2KB 3PTWA 1U45A 3IBCB 2HURA 2QFIA 4UF4A 5CYJA 4G3IA 4OX8A 4ZPAA 1GX5A 5EX3A 4GC6A 4ECZA 2IAJA 3KJFB 4ZJLA 1JJHA 2HRTA 2GJFA 1FXRA 4OFZA 2MTLA 4EMDA 1CQMA 2EC2A 5DDPC 2CQ3A 3W9JA 1HBMB 3DRPA 3DM2A 3EZOA 1BQNB 2PD1A 1S4EA 4LT6A 1RBLA 2AT1B 3ILIA 4ZPWR 1KLMA 1HNIB 4QPXA 1RBAA 2AYEA 3RBZA 5DLFA 4U67Q 4EBEA 1JXEA 1KOOA 3D54A 1YZ6A 2LDYA 4LRBA 5M2RA 1AUDA 3EJMA 3OXGA 3JSYA 1RJJA 4ID8A 3N5FA 1XERA 4AUKA 5KFTA 2G2YA 1H3DA 4Z2XA 3CJ0A 5HLFA 4U95A 5J1EB 2DGUA 4C9DA 2LEPA 2PIIA 2OGUA 5C42B 3M8QA 2UUBF 2EBGA 3L95X 1TK0A 2UXCF 1U0HA 4PXEA 4ERDA 5GAEI 3H42A 2HHHF 3R7NB 4LF1A 3SEOA 3CO0P 3M05A 3KLHA 3DRYA 2IA0A 2XEXA 4PKDB 1QLNA 4CTAB 4NI2A 4WBFA 4UTGA 1N5SA 1RWOB 2IC3A 3S8SA 3MMBA 2EVZA 1RAHB 4ECWA 1VK8A 2EBEA 3K59A 3CNQP 4PPZA 2DK2A 1Q8KA 2V34A 1JLFB 4WFYA 3PV8A 1GTEA 1WEXA 4W90B 3TEHB 2MKHA 2C2OB 2VQEF 4OI2A 2BABA 1LK7A 4OQJA 3W62A 3LP0A 5IZHA 1YJTA 2LEBA 3DLHA 1XN9A 3CJKB 5HI7A 2OPSB 3Q2TC 4WXOA 2HFOA 3DU5A 3OUYA 3EGWB 1RTJA 4IG3A 2CG4A 3R7SB 3AFGA 4MIBA 3Q24A 1C1CB 4AL7A 1ZM4A 3VGTA 1NKCA 3OHAA 4B3OB 3FMBA 3GIKA 3MEDB 3I0SB 4Q44A 2Q3PA 3TA2A 5A76A 1LW0A 2OFHX 1HBNA 4PG8A 3DLKB 4NASA 2J7KA 5AE2A 2VJVA 1LXJA 1K73T 4CLWA 5IM0B 3BO2A 4DN0A 2WONA 3OL7A 4WZMA 4LSLB 1REVB 5CHCB 2WBMA 4L3NA 3JAMY 1P1LA 4KV8B 5F0UA 1LNQA 2YX1A 2QFJA 5C2CA 2NYHA 1CJVB 2EC0A 4KGKA 1DZ5A 3A3NB 1H72C 1HLWA 4ELTA 1ICEB 3M6VA 3IGVA 2HG4A 5C24B 4OI4A 1ZH5A 1OQ6A 4RUHA 3GTYX 4B3RJ 4JI4F 3GV8B 4I4BA 3Q8SB 4U6PA 8AT1B 3M2RA 1DBDA 3QO9B 4XAKA 5SZTA 1OY8A 1UETA 2VDIA 4WTOB 3DXSX 4NXNJ 3J81Y 5E3QA 4C11B 2JLEA 1XMBA 2F63A 5K20B 1VMBA 4C6AA 1ZM3A 5A8RB 3PYDA 3K5PA 2IMOA 1VYAA 1WI6A 5DM6Q 2NLWA 1YHQS 4GKJJ 2W9CA 4GRSA 4K5RA 1E6YB 3AHPA 3ZTOA 2IIHA 3I5BA 4J9KA 5KT3A 1TFYA 2V8VA 2R4FA 2DRBA 2KHCA 3SMZA 3PW4A 3GJQB 1FO1A 2B3TB 1YJRA 5F8HA 2JNJA 3AD9C 2L9NA 3R1HA 3LO3A 4DV6F 2Z4PA 2IAJB 1EKRA 4X4OA 4P72A 4O44A 1X4CA 1VGYA 5LMUF 1S59A 3PW0A 1G4CA 3F41A 2ZD1B 3DRPB 4Z37A 4B3MJ 1BC6A 3FGVA 1N5VA 3QWUA 2BE7D 3MMCA 3MZIA 4UOCA 4BCAA 1CG2A 1UMJA 4PUOB 1KLMB 1EZZB 1TVRA 5F8GA 2R7XA 4TY8B 3NCRA 2OJ3A 5J2NA 2WCXA 2DEIA 4NLSA 1BY9A 1J5EF 5F3TA 5FJ4A 4MTPA 3OSPA 3DMJA 2CJAA 2VPZB 1LWEA 4YHHJ 2P8IA 3ZNUA 1SL1A 4OHXA 1WF1A 3UW1A 4ED0A 4JBCA 1LKZA 5ETVA 5KG7A 5HLFB 1OS5A 2DNNA 1RCXB 4ZITA 3M8QB 3QIPB 1JIHA 3QGGA 3TANA 4FNIA 3B82A 3OV7A 1U0HB 3Q0AA 3M9MB 3KJVB 1RYRA 2CPHA 1VQ4S 3TOQA 3BH6B 1FJEB 3CJTA 2O66A 1S1UA 2RUSA 4WYLA 4DCJB 4M5IA 4NI2B 4K4WA 2W01A 4CO5A 2W2NP 2IC3B 3KUEA 3J7YI 2ZH9A 2FC8A 2M7SA 1MG7A 3O1LA 4BWJA 2UVRA 2RD5C 2ZOGA 1X4FA 1S6PA 1QD1A 1F2GA 2VBWA 2IM3A 2ILZA 4PWUA 1BGXT 5H9FJ 2BJ1A 4GC7A 3MOZA 4WWSA 2YPYA 3KDOA 2E5LF 4WYWA 4O3QA 5HP1A 3LP0B 2ROEA 2ZWPA 1N88A 3DYAB 1X4BA 1IR1A 4TU7A 1L3VA 3WIVA 4RBVA 4IG3B 2CQDA 2DH7A 1TV6B 4EYIB 4Y6IA 1RLCL 3TJ9A 2F3JA 5GAEU 1PYOB 1S1XA 5J2MB 2YH0A 1PJ6A 4F3MA 1NDLA 4NYZA 3TRGA 3GCXP 1TL3B 4LIWA 4ZP6A 2DIUA 4MH8A 1UL3A 1LW0B 1HBNB 2RAQA 3UR0A 2A18A 2MHNA 2QV6A 4ECSA 1SJFA 4ATNA 2WONB 4CO2A 2FVCA 2GHVC 3VQSA 1OPZA 2IHR1 1PBUA 2VG5A 2ZNYA 1N36J 3PW5A 1RT6A 5B09A 2MYFA 4P73A 4DL7A 3IRWP 1X0PA 3HM9A 4EGLA 1HR0J 1FJCA 1WHVA 2ZEJA 5KFCA 4OZNA 3G82A 3NP5A 3QSIA 4F0HA 4F0MA 3M2RB 4QIVA 2DEJA 2R2RA 3UD3P 4N8NA 1FFGB 4ZA1A 3LPYA 3CCQS 1IQZA 4C4WA 3C14A 2VH7A 4TVAB 4CZCA 3EYZA 4J9RA 2BR0A 4DFKA 4PR6A 2W9CB 1DURA 2E1RA 1SPBP 3LWLA 4YR2A 4DR5F 2HRYA 1PJ5A 3PFOA 4DFPA 3M2VA 4DR1J 1YJUA 2V9WA 2VODA 4CLSA 4CIOA 2HZCA 2MY8A 2B8PA 3MMAA 5LXYA 3TUZC 4RU9A 2N3LA 2HHQA 2R7UA 3IC1A 2XQCA 2OHDA 4JI7J 1TR0A 4WFXA 3UO0A 1NB7A 2MLXA 2O67A 2Z0GA 4F3OA 1SI9A 2BRKA 2RNEA 7AT1B 3BN7A 2E7WA 4F26A 1SKRA 2AQ4A 1ZA2B 4USKA 1YZ7A 3OTCA 4MYTA 4ZKAA 2DGSA 4JV0A 4H4MB 4B3SJ 2HGLA 4DQPA 3BH7B 4C48A 2E9ZA 1S1WA 3L7UA 3KKFA 2GHWA 2CQPA 2HS0A 3D6FB 3V4IA 1FEHA 5J2NB 4D3GA 3EWGA 4UUWA 3G8TA 1V9OA 1AXQA 1M0SA 2CQIA 1ZPVA 2WSCC 5CH7B 3THVA 2B9YA 3VTIA 2R2TA 3DMJB 1AROP 1HW9A 1PC5A 3CCSS 5HL7Q 2N7YA 2OH2A 2KZZA 2CRLA 4Y2CA 2BANA 4CH1A 3MUMP 2VL1A 4HEA9 1GXTA 4LUBA 4AXJA 2NYIA 2UUCF 3UE2A 2XS5A 1M90T 2F4FA 1N8RT 1DJ0A 1VK3A 3GV5B 2AGPA 4IRCA 1WG4A 2XMUA 2HQGA 4AL6A 4G1PA 1NRKA 4KT0C 3AOAA 2C2ZB 4LR8A 3MOJB 1S1UB 3H5UA 2CDRB 2SXLA 3ELHA 4FBUA 3TP2A 5F8JA 1RABB 1TKDA 3VGUA 2BJ9A 2DGXA 4B9TA 1UCNA 2PMWA 3VALA 1S6PB 4N8OA 4DU8A 3RR8A 2XCPA 1FNMA 2NCKL 2FZGB 2EK1A 1U25A 2ROGA 4YB1P 2MQLA 3CMAS 3D28A 3H5YA 2GHPA 2CJXB 1QTNB 4TKTA 4YEAA 3NOCA 3BGUA 3G4SS 1JLEA 4CH0S 3CC7S 4C3KA 1D9AA 1Y3JA 3R5AA 2A6OA 3PR5B 3G86A 3BYRA 2AGOA 1OMSA 2BJ8A 2RQKA 1TL1A 3HD2A 3QYYA 3D0IE 2K1RA 3MPWA 1R0BG 2KRRA 4FPIA 3WBZA 2D41A 3RZAA 5DQIA 5AE3A 2W24A 4C0BA 4ZMMA 5KFWA 3C19A 2PSZA 3QQCD 2DCLA 4A8XA 4NLGA 4K4TA 3OXFA 4DS4A 2NZ4A 4OYXA 3TZYA 5LJ3Y 2RS2A 5KG4A 1RKJA 1CSJA 3K2YA 2QL5B 1NK7A 3D7SB 1GMUA 3RRGA 4LRFA 1ZAXA 3MURP 5E3RA 1KTVA 2RVJA 1VRUB 2DKOB 2YNGA 4PWDA 2H1YA 4UOGA 1YTYA 2XG8A 2ZZMA 4FKXA 3G82B 3PW7A 4C8OA 3ENWA 4DL5A 2LYVA 2PFFB 2RS8A 2YKPA 3AH6A 5J2PB 2E1CA 2UUTA 3IA0A 5MAOA 2YKOA 3SCLE 3C14B 3OD2A 1KNZA 3QFWA 3UDEA 1SC6A 2HK2A 3W5XA 4Y2AA 2MLZA 2LP4A 4QIGA 4DV4J 1WTFA 1YWXA 3AA8A 5I3UA 4JI5F 1TKTA 3E3XA 4IDKA 5IV3A 3M2VB 2DO0A 5FDLA 4UUXA 4AQYJ 1H74A 2AF6A 3D0HE 2HBRB 1JLAB 2DNHA 3M32A 4BC7A 2DNMA 3M8RA 4Q0BB 1Q95G 4GVLA 5ADZA 4IFVA 5KTQA 3KOAA 4CNYA 3D3CJ 3JSMA 4UY8T 3TEGA 3GSIA 2EFQA 4RUBA 1T9TA 4WP3A 3BBBA 1SKWA 4LSZB 3TAMB 2F7VA 4OHVA 1S79A 1N33F 4C0HA 1EB0A 5EGYA 2Z30B 2CVIA 1S1WB 3JS9A 4ZPVR 1FX2A 5IWAJ 3HZGA 3V4IB 3SIPB 4A8KA 1WF0A 3PY8A 2XMJA 5F41A 3QATA 2MKKA 3GG0A 3D1QA 1LOUA 2HWTA 2ZHOA 3PJ9A 1RTZA 3SBMA 1EARA 4K0KJ 3FEYB 5IQ6A 3RRHA 1WORA 2J9DA 3EUNA 4BDPA 2EFNA 4HVZA 5F9NA 1WC4A 2QL9B 4F36A 2BANB 1YVFA 3UN5A 3QBCA 3NGRA 2L48A 4UQTA 2LA6A 2C28A 4NLRA 4I67A 2CG8A 2RKIB 1OY6A 2NSCA 4KKOB 3JB9k 2NXUA 2QYGA 2ZM6F 3VV2B 3FRYA 1KQGB 4DV3J 1RADB 1BQXA 1M1KT 3W66A 3HX9A 2C3PA 1U8WA 4F25A 3D67A 1M5OC 3QGPA 2WRMA 3I5AA 3N79A 4F04B 4QU6A 3VAMA 2KG1A 1WC5A 1WC3A 1SUQA 3QSYB 1CULB 5GMEA 2ZBQA 1L3UA 3FDSA 3GIIA 1AFJA 2DH9A 4ZVFA 2JVOA 2N4CA 1H98A 1B3TA 1S48A 4NCGA 1RU2A 2GFFA 1W26A 1JLEB 3IM9A 3JXOA 4ZN1A 3GG1A 1XNQJ 3HFKA 4PABA 2YWWA 1TL1B 4ZVSB 1XWLA 2W7AA 3C6TB 3US5A 2ZZNA 2BQRA 1UAWA 5HVFA 3DCAA 3NGDA 2F40A 4GMKA 1JXLA 4JOUA 3SCIE 2AKWB 2HWHA 4ZDNA 2VC0A 3FFIB 3O5TB 4JI0F 1QM9A 2Y8WA 2NXEA 4WFZA 4G1QA 2QZ8A 4NEYA 3IBFB 2CJYB 1PKUA 1H38A 1MROB 5L1KA 3H25A 3MAQA 4HI2A 2WBRA 1R89A 5BJRA 1HKAA 2EEYA 3BSCA 1VCTA 5GAHI 1R8CA 3S7RA 4ZP9A 2AX0A 4ZVOB 2J0SD 1X9SA 2YNGB 3VWSA 3CC4S 3O3LA 3EICA 2YWFA 2G1HA 1WEYA 2DR6A 4H4OB 1X4GA 4OI6A 1KQSR 3ZC4A 4JB8B 1XMOF 2ZHBA 4I2QA 4ELVA 4AFFA 5D0RA 4O3SA 3GPAA 4CNZA 3POTA 3RYLA 4I68A 2PEHA 3KDNA 1M5HA 4YY3J 4GO5X 3OJUA 4USWA 1DLOA 3ZFVA 2XS2A 3R2CJ 2DGWA 5I3UB 2EW9A 5JJBA 4IOAQ 4ED4A 3RW6A 1OIAA 1TKTB 4IDKB 3QLHA 3D9BA 1U1MA 2MDAA 3SDEB 9RUBA 4RPFA 2NREA 5ETLA 2J76E 4JV5J 3M32B 2BQUA 2DNYA 2VKRA 1U1KA 4IQMA 5DLGA 4QIEA 3I31A 4KBIA 1PILA 2BKOA 4IFVB 3H2LA 1Y5NB 1FE0A 3CSKA 4TN2A 3CIMA 4Y2IA 1CJKA 5BXIA 2ZH8A 2AJ2A 4R25A 1VQ5S 4FF2A 3RUBL 1RWKB 3U02A 4ZJQA 5JUMA 3KTQA 3A3PB 2HNYA 1WG1A 5E3CA 4RLEA 1FE4A 1Y4ZB 2XZTB 3H5XA 5C2GA 1TKXB 3LH2S 1VS3A 3HD1A 5HK4A 1OWXA 4ENOA 5DQGA 4IG0B 2CDQA 4AT1B 2ZH3A 3EVWA 2GNKA 4DS5A 3PJWA 3D1HA 3G6YA 3CPWR 4FF3A 3VAGA 5M2PA 3MAAB 2B43A 2HIYA 4RUCA 4URSA 2QMXA 1RHUB 3FUYA 3ETOA 2XNRA 1M5SA 3PKYA 4U8YA 2FJWA 4B3MF 4NLXA 4KHPJ 2MZTA 1RKIA 2VG7B 4U96A 1KOHA 1VC0A 1WKKA 2FLLA 4O4GB 2I8EA 4O0IA 1NZ8A 4J90A 5HMYA 3TARA 1DTTA 2KFYA 2XY7A 4IH6A 3ITHB 4I6YA 5LOQA 3F56A 3CVKA 2V8PA 1HA1A 2LCWA 4FKYA 4PXBA 2OTLS 2HWIA 4GVBB 1TAQA 2YNIA 3ZZ0A 1WDTA 1SUQB 3EPGA 4FYWB 2E9RX 3DLEA 2BZ2A 1N5TA 3PVXA 1SKSA 4RNHA 1ZAVA 3J7Z5 4M5KA 3TWZA 2ZZTA 4L6V3 4I1TA 4NCGB 5K9FA 3VHQA 3OL6A 3R2DJ 4LJMA 4N5SA 1QSYA 3CWJA 3PIOQ 4EK2A 4GKKJ 1WEZA 3TZWA 2KG0A 2XLJA 2DNRA 1DQAA 1KD1T 3NGKA 4OJGA 5LSLA 2HIQA 1RWXB 2W9AA 4K2JA 4R0EA 2EFOA 3N4WA 1NJIT 3FSXA 2HGMA 2WVBA 4FDFA 3KUGA 1G6BA 2WVFA 3CJ8A 2E66A 3KLGB 3HO1A 3C15A 1SQEA 2M52A 1WACA 5KG3A 2X7IA 1JLQA 4I2PB 4RW9A 4OJHA 1NSKL 4F7VA 3EGVA 2PMHA 2FY8A 1H2UX 1PBAA 1XEZA 4LF4J 2M4MA 3KK2A 4C8LA 1M5PC 1OY9A 2XLIA 1TL5A 1U6BA 3MD3A 3PKMA 3SSSA 4UZBA 5KAKA 2N82B 1YITS 3E01A 3RBDA 4IFYA 2XSFA 5KFKA 3OTDA 1C4CA 3BQ0A 5KFYA 2K06A 5B0FA 4IH7A 4LRDA 2KT2A 2H51B 2V4JA 1S6QA 2VG6A 2KN4A 4DN9A 1DLOB 3JSBA 2FJDB 1ZTWA 3T1HF 3SQOP 5DQHA 2JDJA 2ZKUA 1X9MA 1YQHA 1W7WA 1UJ4A 2RIJA 3IM8A 3W63A 3AODA 3NKYA 2JC1A 4AE5A 3HF5A 2VFRA 5EHHA 1RK8A 1HR0F 1U2FA 4U7CA 3SXLA 2ABYA 1HNVA 3MUTP 1HNXF 2PI5A 2FUG9 7FDRA 1KEKA 2FD2A 3C66A 1RI7A 2M9KA 4PZVA 5EN1A 4KR0B 3K58A 4PRFA 5DGAA 3KLVA 4G1IA 1CJKB 1HNZJ 3S01A 2Q43A 3UCUP 4LRAA 1U48A 2VBXA 4LFCF 2HNYB 2VV5A 4ZVRB 2FVSA 1AUSL 2ROPA 2X1AA 2RQ4A 4TU8A 4B02A 1ZZFA 4Y34A 1R43A 2IRUA 1MU2A 3HPOA 4B17A 2V4QA 1GNKA 4J9SA 1B4SA 4HTIA 1KSPA 2IFXA 3V6HA 2DRDA 2HKEA 1URRA 3O44A 1T9VA 3DLBA 3CD0A 3C16B 1I94F 1DTQB 4U7UK 2LDIA 3VAHA 2POKA 2R8KA 3HULA 4OV6A 2I6WA 3I4PA 5ETPA 2B5JB 3PHTA 4CP5A 4P2SA 3AXKA 1U1NA 2HSEB 3NS7B 4DCOB 4ECTA 5U47A 2HBYB 5K8NA 1T03A 3M30B 4KSEB 2YNIB 3CCVS 4LFBF 3VAFA 2GVZA 3CIZA 3BGFA 3HJVA 1HHTP 3DLEB 2MKCA 3QPIA 4LSNA 3AJ2A 4QZVB 1Y5IB 3V6DA 2HHUA 5K8PA 2W7OA 4RUAA 4ED8A 4RW8B 3NBPA 4JI8F 4L75A 2H65B 2VHGA 4OX9F 4J9NA 5A6WA 2BDPA 4LF6F 1TKZB 4FVMA 4JUZA 2CZ9A 3T9ZA 3CJ2A 4HHJA 4IOBA 2VONA 1K0TA 4DR6F 2ZKTA 1NK8A 3D66A 2XO6A 1Y5LB 1XQIA 5DG9A 3P5TL 4N56A 3TA1A 2Q6BA 1R6YA 3R1LA 1RU1A 4DG1B 5KFUA 2CZ4A 2LQJA 2ZVSA 3C15B 3R5BA 5B0DA 4IR9A 4DFJA 1JLQB 2QGFB 4P52A 5CYMA 4OI1A 3OQ2A 4OYPA 1A7GE 8ATCB 1OJ4A 1H73A 1IM6A 4JYAF 3BPDA 1LWXA 5E3PA 1U24A 2NXJA 4CQ1A 4USJC 3NMAA 4ED3A 3H7HB 3CE8A 2MY7A 5HATA 4NRTA 3Q86A 4QWBA 2X3GA 5K14A 1NO8A 3BDPA 4IFYB 4LFAF 3EM1A 3IS9A 2EFPA 5KFNA 3I82A 5AJ3J 2NXNA 3GP9A 1YJ9S 5EWEA 3WX8A 2V4JB 1S6QB 2VG6B 5AT1B 2XNQA 3VZIA 1VJQA 4DX7A 3WZ0A 1TAUA 2X1GA 2CZVC 2DNGA 1WHXA 2MKSA 1YKWA 1UVNA 4LVNP 2E44A 3MEEA 3VF0B 2COLA 4M5HA 2RQMA 3OFGA 3KLEA 4MKBA 5K5MA 2VQFJ 3BDEA 2FJBB 3QAEA 1HNVB 2NZCA 3OFHA 4X64J 1UVLA 5D6GA 3HP6A 2V2ZA 3MFIA 5FLXY 1D9DA 3U27A 1KR4A 4O3OA 3DOKA 2AEFA 2QJ3A 2W8LA 1X5SA 3E8OA 5A8KA 1HHQA 3HZEA 2RJZA 5B0AA 1IKVA 5I3PA 1NHKL 4M5MA 1ZOTA 4DV4F 5CZXA 3BSOA 3AD7C 4IOCQ 2ZOFA 1YJ7A 4NRUA 2FJXA 4NLTA 3ZTSA 3QJLA 2HYIB 1ZA1B 2IVYA 2HQDA 2R8HA 5GADI 4NMLA 4KPCA 4Q45A 4DV5J 1W2BR 2VPYB 1N56A 4PEOA 4JI6F 1X31C 2OAUA 1RHRB 4C3MA 3CDUA 3PACA 3UDCA 4A8OA 2HZAA 1S97A 2QN6B 2F9DA 4BHQA 1HQ2A 5E0OA 3W1YC 2F8MA 2J0XA 2KKHA 2HHSA 3HSZA 3KJQB 3GFHA 2XI2A 3M8WA 4K4SA 2V2QA 4A4JA 3AA9A 3FBBA 1FRLA 2OPPB 4NL5A 3OTOJ 2C3YA 1T03B 1RYSA 2JOQA 4K0KF 2KJWA 2DXDA 1M5VC 3FEZA 4PG4A 5E3AA 2GVZB 2GZOA 4DX6A 3ISNC 3FNNA 2YTCA 4YB5A 1M1HA 1MMNA 4LSNB 2HK3A 2C2NA 1RT5A 3V6DB 2E29A 2HQ3A 2D9OA 3G96A 2V2KA 3NBPB 4QR1A 5E5NA 2DR8A 3MM5A 4OI3A 4IRDA 4DV3F 2GS8A 2VA2A 7FD1A 1AZSB 1X8DA 4LBHA 2ZUGA 3EGNA 4USTA 1HYSB 2R8IA 2X1FA 4N47A 1L3TA 5A0YB 2KRBA 2MQOA 2HNDB 2J8SA 3N01A 3T5KA 2Z2ZA 3HK2A 5L9NA 4UZCA 1Z1ZA 1WUUA 1X4EA 2YKAA 4NA2A 1FDDA 4RZRA 1TP7A 3FBEA 5CYMB 3UCGA 3W7BA 1D3WA 3GFZA 3OVSA 4LF2A 4DEZA 1F5CA 1N5YB 3DNCA 2FLNA 2CYYA 4RWWA 2EI5A 2QA1A 3CDBA 4KO0A 4WU3A 2ASLA 2BM0A 4ZCMA 2XY6A 4WP8A 5IS2A 3BR9A 3CJRA 2IPOB 2DVIA 5K14B 3FC9A 4RWXA 4DWIA 3N6MA 3BV8A 4F2SA 1YK9A 1IWGA 5E41A 3MM9B 2E1AA 3HMJG 3I9ZA 1UFKA 4OI0A 3QJJA 3UQSA 1F2HA 2OSRA 1U49A 4FYDA 2RU9A 5HMZA 5J2QA 2HHXA 1VQ8S 2HHVA 5K8MA 2BJ7A 3VVUA 2FVRA 1VC5A 4ZLJA 4Q2LA 5LT5A 3MEEB 4YMEA 4J5OA 3KLEB 3D6MB 1Y00A 1S1VA 2N4DA 3LW5C 1SJ3P 1VJWA 3QNWB 3DC2A 1SCJB 4W98A 5KFIA 1RAJA 2B4OA 1FRHA 1JJCB 1WOSA 1RAAB 2EKYA 3VAKA 2IM2A 2ZBRA 4LR9A 3DOKB 3QMQA 1HMVB 5A8KB 1NPPA 4P75A 1JLGA 5D0GA 1S99A 1IKVB 1J27A 4DR2J 3PX6A 3W9HA 3MM7A 4J9VA 3BGOP 2E5HA 1NK5A 1VQLS 3M1VB 4CRJA 2HNZA 1GXUA 4MYUA 2DY9A 4DV0J 5L46A 4DV2F 3HHLD 2AIRB 2CJQA 1XIQA 1GK8A 2VZ9A 3FK4A 1U09A 3WDOA 1A0OB 4P2XA 3HVTB 1HNIA 2R7OA 3S6EA 2G1DA 4BLGA 4JI2J 3HT0A 2FB0A 2H5EA 2V63A 5T14A 4ITSA 3QGIA 3MDFA 1Y7PA 1PJ7A 1W25A 2YNFB 5CQGA 2JEFA 5IQQA 3PM9A 1UVMA 2HVDA 3D68A 1KVKA 4QIWD 1S12A 4ICLA 2NS1B 4DLEA 5ETTA 2IBOA 4N77A 3AQOA 2J8AA 4JI1J 4DOZA 5DZ7A 1KC8T 3RB6A 4PG5A 2MZQA 2C2RA 3MFHA 1RT5B 5BR8J 4Q5VA 4KHPF 4RL1A 1RZMA 5GADU 3D5MA 4M8LA 4B9MA 3SV3A 4CLZA 3B4DA 4USHA 3U1LA 3CCRS 5KFXA 2A2DA 5H9FK 2JC0A 2CQ2A 3HHLC 1X5PA 5HAOA 5ETQA 1LEOA 2RH3A 3MEGB 2CA9A 4GO7X 4LF7J 1Q0NA 2PMZD 3BSNA 4RU2A 2CIMA 3JTOA 3PHEA 2YWKA 3NOGA 4K8RA 3DN9A 4FF4A 1NSQA 3GMGA 1S9EA 2U2FA 3T5HA 3P6YC 1CQNA 1CC7A 1FNXH 3R5GA 5LMNF 1HWUA 2OSQA 1QSLA 1NUEA 2XMVA 1SJQA 4DU7A 2DHSA 4F4ZA 4WZQA 3OHBA 1S49A 2APOA 1J2VA 2QLBB 4QW9A 1C1CA 1Q86T 2UU9J 1S72S 1U6ZA 2R8JA 3VZHA 2KFZA 3MEDA 3I0SA 4X62J 1TL7A 1AT1B 2CKWA 2F8EX 1Q53A 2LXUA 3NGUA 3GB0A 4NLDA 3M2UA 1S0VA 1QY7A 3RAMA 3QZ7A 1RUSA 1N52B 2VDHA 5GMDA 2YKMA 1JNZB 4LSLA 1REVA 1MMDA 3A8KA 3ZZUA 4QYZK 4KV8A 3FCVA 1GQEA 2MKYA 1CJVA 3D3BJ 1BQMB 1U1QA 4K4VA 4ZLPA 5J2QB 5C24A 4BC9A 5HMWA 4X4SA 3NCQA 3C6UA 4CLTA 1P9YA 1GTHA 4X66F 1F9FA 3QO9A 1KLNA 3K5MA 3H4BA 1S1VB 3MECA 4C11A 1B99A 4NZ0A 2M0GB 1F5AA 5HQ8A 3PRDA 3NEKA 4ZCLA 3CCES 2ASJA 4DUYF 4ETZA 2MZSA 4QWAA 2B9XA 2HAFA 3R6LB 1T11A 2NPFA 1JLGB 3IFEA 1YG0A 2MQ8A 5CZVA 4C2MA 1RAOA 4DI6A 3GQCA 4NYPA 3PCOB 3MM7B 4L76A 3H2VE 1UEKA 1RTIA 1NMEB 5L38A 2HNZB 4YR0A 4CO3A 3D6HB 1VQKS 1GMWD 4XK8C 1UFWA 4G6VB 2HVIA 3KLIB 4P6QA 3M9OB 3RB0A 2GJ2A 3FZBA 1M1GA 3THPA 1T0TV 2CJ9A 3RW7A 2OD4A 4C98A 2ZD1A 2B9WA 5DRKA 3AXMA 4DQRA 4ZPTR 3PJXA 4O3PA 2QEXS 2XS7A 4TYBA 4PUOA 4K50A 4NX9A 3L7PA 3UCZP 1T02A 2X3DA 1SQGA 2DGVA 4TY8A 2FLPA 1VRTB 2KT5A 3P4UB 3M6UA 2DHAA 3Q8VA 1FFSB 4RW6B 4N76A 1TQLA 2H54B 5D0HA 2NPIA 4X65F 4WCEQ 1VISA 3IR5B 4ZLNA 3K8WA 1KBRA 2IA6A 2M8DB 2UUBJ 8RUCA 2PT0A 3QIPA 1V3RA 3CCUS 3GONA 3DKDA 4YDXA 1T05B 2UXCJ 4BWMA 4ICLB 3R9LA 2AZ1A 1Q1KA 1I6JA 2HHHJ 3KJVA 2HMIA 1JB0C 5KT5A 4OJ3A 4USMA 3UN2A 5JVGQ 2JFKA 4QWEA 3U7JA 2V69A 2C2MB 5ETNA 3SQGA 3LWMA 2VKZG 5L9XA 1UFLA 5EDWA 3ENAA 4QYRA 4NCAA 2QC3A 2V8GA 4OYWA 4C97A 1SB6A 1IN0A 2J9CA 4YB7A 5ITHA 5CABA 1D9FA 2NUHA 3QRQA 5H9EK 3CJ4A 4F02A 3FRZA 5CYQA 3GV7B 2LECA 1NSAA 4NPOA 3UWTA 4DV1F 3DXBA 3D2WA 1S9EB 2AMCB 1AYEA 9ATCB 5LJ5Y 2UUAJ 2AEJA 1QAIA 4M5DA 3DYAA 2IBKA 4MFBA 3ZTPA 4PAAA 4P7TA 2WB1D 1S76D 3DFEA 3SFUA 3ZZZA 1TV6A 5KG6A 4HT7A 3UI3A 4Q43A 5HJXA 1C4AA 2HS3A 5J2MA 4PQAA 1TL7B 2IM1A 2B8QA 1TL3A 3CJSA 1MLAA 1EJ7L 3KMSA 3M2UB 2P6SA 3HJFA 4QPTA 5KFGA 2MQNA 4P7VA 2YKMB 4QJVA 1RWPB 2K3KA 5HVHA 4O3NA 2XC9A 3B8HA 2FPHX 3G9CA 1SJ4P 2ERRA 1GX6A 5KFHA 1IQTA 2BEFA 3LP2A 4LF9J 2G4BA 4U7UD 4FYYB 4K2XA 1S10A 2AJ4A 3L3CA 3RBEA 4E8UA 5C7PA 3GCWP 3LGMA 3C6UB 3GZ7A 5LM7E 4OLOA 2HBQB 3B78A 4QWCA 2BMBA 3CDWA 4CLKA 4LQ9A 1HQUA 3ZNJ1 3MECB 1U2CA 2HQIA 3NY0A 2O3DA 4WPAA 4KJIA 3G6VA 1EIYB 2FHKA 1LWFA 2CPDA 3B54A 3KK1B 3EMTA 1B64A 2VB6A 4UOHA 3MM8A 3TAQA 1IR2A 3JTNA 2Q79A 2ATCB 1WDDA 2H3EB 3M6WA 4X4PA 3Q8PB 1RTIB 1FNOA 1SIZA 2NQPA 1BXNA 2BW2A 3DI6B 2AJ1A 2V6AA 2GGPA 4MKYA 3TJ8A 5LMUJ 1CVJA 2AJFE 4P71A 2E5JA 5KFFA 1XNRF 3C3LA 2BUNA 2VQFF 2LXFA 2DXFA 1P6TA 3CUNA 4WP9A 2AJ0A 1RCOB 1YGYA 4H4MA 3GR1A 2K8GA 1CPZA 2L41A 4WXWA 4ZLLA 2FGCA 4RNOA 1FTRA 2ZDOA 2P5VA 2D3UA 2OMLA 1NM2A 1YBTA 1J5EJ 2XWYA 5C25A 3J81j 3HVWA 3T6JA 3I32A 1L3SA 1ELOA 1CS4A 1ITPA 1VLYA 3PRBA 3M6XA 2HFUA 2OO4A 4KGVB 4XDDA 1RHQB 1VQYA 2FC9A 1IJFB 1I5OB 2J7WA 2Q1LA 2P9GA 3Q22A 4O23A 1IJEB 2HMIB 1V6HA 2OTJS 1JNRB 3M9NB 2JL9A 2PN6A 4K5SA 2VF3A 3ZTRA 1D8YA 2F65A 2FLOA 3T3FA 1APSA 2CVEA 4QW8A 1Z2LA 5KFZA 4OMFG 5FD1A 1RT1A 3SQGB 3UD4P 4XPEA 4F8RA 2J6SA 1JLBB 1PAUB 5AXNA 1L3KA 1VLOA 3FSIA 4NEZA 1Q8IA 2XMTA 4ZCIA 1S0NA 2A2CA 5I42A 2B4UA 3QAUA 3OTOF 2W8KA 1CBKA 4NWBA 5B0BA 5CYQB 4Y3CA 4EWTA 4O0NA 2UXDJ 3SSRA 2M8HA 2GAGC 3GJSB 5D4OA 3WIUA 3HKZD 2E5LJ 4X4NA 5I4MA 3RRKA 2XSJA 3CMQA 3MPDA 1U1OA 4M5DB 4BS2A 3K5LA 1FVQA 1V3ZA 3RB3A 4MFBB 1MWQA 1VBKA 1K44A 2AJQA 4CM2A 1ULRA 4ID5B 4CO4A 1RDRA 3PR4A 3KUHA 1WSVA 3AY0A 1VRQC 3KHGA 2KDOA 4RNNA 2EK6A 3HHEA 3NWGA 2J9DE 5ETOA 2JSXA 3NWRA 2I0XA 2GQCA 5DDOC 3SCJE 2MJNA 1UEUA 3HDSA 4C8NA 2DISA 3CJ3A 1FJGF 5KT6A 1UZDA 2BKNA 3TQ1A 1SJ1A 1FF2A 5B0GA 1B7YB 5IC4B 1RHKB 3KG0A 2GO9A 4LF5J 5L1JA 2FJVA 3DLGB 4ER8A 1UVJA 2GC8A 3LP2B 1VRUA 4DSIA 4FS1A 3N0VA 4DZDA 1WI8A 1BWEA 1WF2A 1V5VA 2G0CA 4URGA 3UN3A 5DDRC 4ZPDA 1FDNA 2KXHA 3K8VA 2VOPA 5KFAA 4W92B 4NLQA 5J2PA 2QE5A 2DIVA 1KFSA 5E33A 3GYGA 1HQUB 1YSJA 2ZNZA 4NA1A 1WHYA 4I6WA 2ZC4A 2OPRB 1D1UA 1JLCA 2OEJA 1S6UA 1Q8BA 1F3VA 3PYEA 3H5SA 2Z2LA 1LWFB 1L5UA 3GJRB 2R7QA 2D3OR 4DR5J 4UY85 1HFEL 3K5OA 1UPPA 1Y10A 5AXKA 3DOMA 5KFRA 1O5JA 2CFXA 4RKUC 4DR7J 2W1BA 1KONA 2CQ0A 3KK3B 3MM8B 1NH7A 2BBEA 3W60A 3MCNA 1T94A 4B3TJ 1FCAA 4M94A 3DHWC 4CCHA 4WFNQ 1JLAA 2AV5A 5KOWA 4DR3F 2DTJA 1IXKA 4IKAA 4Q0BA 2GGPB 4XDCA 4ECYA 1TMJA 1RTHB 1IBKF 3V6KA 3MCOA 3F73A 3MF5A 4DQIA 3PFEA 2DR7A 6AT1B 2ALZA 1ZM9A 2RHQB 2VU5A 3TAMA 2UUWA 4X2BA 2JVRA 3JAMU 1R3NA 2FHJD 4R5PB 1S0OA 3N28A 1O51A 1FERA 1MNEA 2OUGA 2RF2A 4OX7A 1WKJA 3K7RA 4RW7A 3BJYA 2ZH6A 3BGRA 4P2MA 5CAAA 4B08A 4LF8F 2MSTA 1RE1B 5C25B 4DPOA 2WB4A 5KT7A 3TR5A 3GWCA 4LBIA 3J81U 1S4FA 1CS4B 3CEDA 2BRLA 3A8IA 1ZPWX 4OV1A 1LWCA 3BF4A 4WE1A 3RTVA 5ETMA 3BKUA 3MR2A 2CPFA 1MSWD 4KGXB 1VOMA 2UVUA 2I9SA 4DCPB 1ROFA 1S57A 2W2OP 3QFHA 2RKIA 4KKOA 1TUWA 2L9DA 2GMJA 4JI2F 4K4XA 2KI2A 3TZXA 1RT1B 2W25A 4LMZA 2YX7A 4N41A 1MW7A 3LOUA 2D3O1 4ZS6A 1WWHA 5KG2A 2Z2MA 1SH3A 2J0WA 1UJ5A 4CT9A 1HIYA 2D7SA 4ILMA 5I42B 1CULA 4DV7J 4ZN3A 2UXBJ 1DFDA 1KHVA 4Z7CA 4X4RA 4HT5A 2P2CB 4DDFA 2W9BA 2FQQB 1UPMB 1NSPA 4KGZB 4J9LA 4OZ3A 3KYLA 1S9FA 3HVAA 2XSJB 1RHJB 3W61A 4ZHRB 2HAIA 1Y9OA 5HANA 3HKWA 1YI2S 1Q5YA 2R7TA 3IGNA 2OMOA 2VD3A 3J80U 2JZ5A 3KHRA 3C6TA 4QCLA 2KYXA 2YBVA 1SVDA 3FSYA 3JTPA 2R2UA 4ZOSA 3BSAA 4DJBA 2KZMA 1IKWA 2ZUAA 3FFIA 1RXOB 2BVZA 4ES3A 4ZVPB 2KYZA 2B7CB 1XMQF 2XHCA 3GYNA 2FGOA 2PFDA 1MROA 4AXIA 3J7YU 3CC2S 1N48A 2FVQA 1PC4A 3EVMA 4BBYA 2A10A 4HR2A 2HLUA 1HI0P 1HD1A 1EAYC 3V5RA 2K3IA 5KT2A 2ALYB 1R31A 1HI1A 3MCSA 3MR5A 2VICA 2RB7A 3A8EA 4MMOA 3HSJA 4USUA 3W2VA 4ECVA 2YWHA 4H4OA 2DJWA 1T3NA 2UP1A 3OJSA 4DPYA 3IAS9 1LXNA 2PDAA 3CCWA 4OHWA 1RA7A 1HQEB 2G0IA 2H5JB 4USVA 1B0VA 4EZ6A 2VBZA 4F4WA 1JLCB 3HSDA 2G0JA 3OFEA 3PNIA 2CWXA 2OKQA 1KP6A 1IBMJ 4JI5J 3LP1B 3DOMB 5B7WA 2GJIA 2EFVA 3SDEA 4FS2A 1HW8A 3J7AN 1VBXA 1FKPA 1KVJA 4K59A 3ENQA 3QT6A 1VQ9S 2BJEA 3D4JA 2BX6A 1G3OA 1FJ7A 3ZO7A 1TL4A 4NLVA 4DR4J 4UT4A 5DZ6A 1N33J 3IWNC 1NAQA 4B9NA 5HBMA 2Z2YB 2VBYA 2QTWA 3L7OA 3W5YA 3TUJC 4DSLA 3SI8A 4ZP7A 3ILLA 3MPVA 1C2PA 2RF2B 1TKXA 1IKYA 3AB2B 4RW7B 3BGRB 4C0OC 2ZE2B 5L8RC 1YRXA 2EFGA 4IG0A 3I4HX 1GMWA 1ZZNA 1OSDA 5KG5A 3HHLB 2KHDA 3MAAA 2A1BA 3G71S 2CNKB 4KFBA 3L9ZA 2LLZA 1QE1A 4OZLA 2GQ2A 4KYZA 1OSCA 2HVZA 1LWCB 3MTKA 3M8ZA 2V0NA 3CMES 4WE1B 4OZ0A 2H4YB 2QIFA 1RTDA 4H54A 2Y0BB 2GVDA 1X5OA 2RT3A 2VG7A 4YFUA 1TELA 4XIUA 4O4GA 1J5OB 1KN6A 2E9TA 3ITHA 2ZM6J 3PX4A 2LU2A 5EWFA 1NEEA 2ATLA 1DY3A 2C42A 4ALZA 1UKUA 3DRRA 1I1GA 2BJDA 2ZJQQ 3MI7X 3CDAA 1I3OB 4GVBA 4TLQA 1VHIA 2CQ1A 3ZXWA 2J9EA 4DPXA 3A13A 2QMUB 3UVJB 2B56A 3JQJA 3M8SA 4D3HA 1U26A 5T7LB 2W9BB 4O4RA 4I56A 4NE9C 3TVZA 2F4VJ 1RWWB 4EO6A 4ZVQB 3THTA 1FHTA 3W8GA 2ZH7A 2KT3A 2MQQA 5F8MA 1JQGA 3I9V9 3ULHA 4ZVTB 4Y2MA 4OIXA 4C3LA 2BOAA 4WFAQ 2B0GA 1KFDA 1X5TA 3DDIA 1EKSA 3O6QA 3T1YJ 2LQBA 3O2IA 5KFLA 4CYUB 4YP3A 1IKWB 4JI0J 2HFVA 2B6AA 4NLOA 3R27A 2DD8S 3ENVA 3KLGA 2KM8B 3MAHA 1GH8A 2B51A 2YWGA 3GJTB 2WW8A 2G13A 4I2PA 1A6LA 2BACA 2UUAF 2ZH2A 5G0RB 2QX0A 3FMWA 5IXUA 3H20A 1IM4A 1FXLA 4UOFA 1Q7YT 3SCKE 3ISZA 1Q4RA 3HI9A 4MIWA 3W2VB 1FX4A 4CM0A 4F67A 2W4PA 3OTEA 1X7VA 4LBPA 4JV1A 1C1BB 1XMOJ 3PO4A 2GO8A 1T95A 1GXLA 1GEHA 2R3VA 3JQKA 3DLLQ 2JRSA 4DLGA 4KB7A 2UV8A 1IKXB 2M3DA 2ZVIA 3OPKA 2YPZA 4AYBD 4OZ5A 3EZ5A 2QLFB 4DL2A 1E6VB 2ILYA 1NJYA 2KU7A 2Q66A 4ZPBA 3V6JA 1NPKA 2UVWA 5J1NA 4LF9F 1QSSA 4I64A 3Q8RB 2E1PA 3AJDA 3PRVA 1RT7B 1LK5A 1WJ9A 4B3RF 5DJBA 1FKPB 5KG1A 2CNLB 4CH7A 2I1RA 2AGQA 2XO7A 2GQQA 4TYAA 4J9PA 3BQ1A 4NXNF 1YJNS 1JWWA 2W4DA 5D77A 2EPIA 2XBPA 2VFTA 5HBMB 2FHMA 5DGBA 2QLXA 4GKJF 3HCXA 4LVOP 1NJZA 1QAXA 1FA0A 1IKYB 3LPEA 3TZZA 1P27B 5KFQA 4DMZA 2XGPA 4NOHA 2JH3A 2Z8QA 1JKHA 4ZVEA 2E7XA 1SBRA 5ETKA 1VI7A 4OX6A 4DSFA 1R6VA 3F0NA 5HO4A 3FCHA 3L4BC 2MLYA 1R0CB 4KFBB 1QE1B 2AHOB 2MB0B 3RGIA 4FNHA 1HPZA 3DM2B 1CJUA 1R0AA 2LMIA 1RTDB 3C16A 4TXSA 2HW3A 1DTQA 4QQBA 2GVDB 3EPIA 2DHHA 1RAIB 4AL5A 3C2PA 2XCAA 1WOOA 3NNCA 3H2UB 1AB8A 2B5JA 4NZ6A 3CO9A 5AE1A 3T5JA 2CNNB 1HBUA 3P3DA 2W2MP 2JWNA 2F5GA 4Q8EA 4F4XA 4HTJA 3SV4A 4Y2KA 5A6PA 4KH0B 3DRRB 2C3OA 2GMHA 1NHUA 2EWHA 2MMYA 4YHHF 1IR0A 3M30A 4RNMA 2KTQA 4F4YA 3J80Y 2CQCA 3IRXA 2RRBA 1YJVA 4WKRA 2Z56B 2WVEA 2MQPA 3LUYA 3R5CA 3QZ8A 3KG4A 3QT8A 1RT2A 3V81A 4IRKA 4RW8A 5HN0A 1S77D 3LTOA 4IYQA 4KRWA 3CGIA 2YWEA 3K0JA 3OVAA 3KLHB 2ZHAA 4YUDA 2CQGA 3VQTA 2YQ3A 1URNA 3WX4A 5HVGA 3E2EA 1TKZA 3I96A 3UD5A 4H4KC 3QT7A 4PXCA 1G7CB 4TY9A 3FBCA 3MMBB 4MKAA 4OZJA 4FP9A 3CB4A 1D8ZA 3A1YG 4CI0B 2QLJB 4HL9A 5HMXA 1FRKA 4RNFA 4DG1A 2B6AB 3NRBA 3WHIA 2XY5A 4MK9A 4ZVUB 2UXDF 3MMJA 2DNLA 4F3QA 5ETRA 1S1TA 2WSEC 5FIIA 4QIFA 4CT8A 1RWMB 4UQGA 4TNOA 1JXVA 1EETA 2X51A 2M70A 3CJQA 1H0HB 1RGVA 2I2YA 2V8DA 5JMNA 3FKBA 3EGZA 3LQVA 1U4BA 2IMWP 2CPEA 3OUYB 1LV5A 1ZYQA 1RTJB 4KIAA 3V4MA 4DF8A 4NCBA 1BWVA 3B6BA 3BB5A 1N32J 1AW0A 3EX7B 4MK8A 3IWLA 2AEMA 2KJVA 3W65A 5D4PA 1FD8A 2R7RA 3AQPA 1R8HA 4ANDA 2XM3A 5B08A 3TJAA 3Q83A 4ZIWA 2JHEA 1YLXA 3UNYA 5I3QA 2MGZA 2OPQA 2BYCA 3PX0A 1U1RA 3T1HJ 1K9MT 3NLCA 5KFVA 4LF5F 1N36F 4J9UE 5L1LA 2J7UA 1V5IB 1XR7A 2MZRA 5A2QU 2AP6A 2FVPA 4QYZJ 3OL9A 4M95A 1NJXA 1BD6A 5F8LA 5E7OB 1HNXJ 1NK4A 2YX4A 1M5KC 2ZITA 1IBLJ 1DQ8A 1A9NB 2OLWA 2XMWA 1NKEA 3NGTA 1F5BA 3TYTA 2BE2A 5GAHU 1HD0A 2XZDB 3MCMA 4C8YA 4B9UA 1Q16B 2VFVA 5M2UA 4B9LA 4LFCJ 1KWMA 1VBZA 4B9VA 1QTMA 4WKYA 4DR7F 4DR1F 3PXGa 3W64A 3OR1A 1JKHB 3CTRA 2XZWA 1X0FA 5RUBA 2CAJA 2XWXA 4B3TF 3BPSP 3B4MA 1LFPA 1AA1B 4PYAA 1QUPA 2HBZB 4JI7F 1F1BB 4O44B 4DL3A 2QG9B 1WC0A 4B9SA 1HPZB 3S1TA 1CJUB 1R0AB 2FHJA 3PYGA 1I94J 2Y0SD 3MMCB 2FJEB 4ILRA 4C8KA 2QSWA 3KHLA 4M63A 4C8MA 1Q5VA 4B3SF 1B70B 4YQWA 1TVRB 1QAJA 5CXTA 3OTBA 2N3OA 1JX4A 1HBUB 5LSRA 3W3SA 2FTRA 2RUGA 1MWZA 2HFSA 3CCZA 2J0QD 4ZJOA 1FRIA 1Q79A 2HRUA 4UW2A 2GAHC 2OPPA 1NNDA 5AXLA 4OHZA 2ZH4A 1LWEB 2D74B 2WHOA 3NAHA 3BBFA 3IBWA 4RX6A 3N6LA 3I0RA 1NKBA 5IT9U 4LFBJ 1O8BA 2DR9A 3R97A 1BE4A 3IRXB 3VR1A 1SL2A 5D3GA 1NLKL 4X4TA 1RT2B 3P45B 2ZC3A 2MKIA 3V81B 1NPRA 2DRAA 4NLUA 3BQ2A 4JI8J 4F4AA 5DETA 1CLFA 2FZKB 1NDCA 2DHGA 4HI1A 1K0VA 4XPCA 2XB2D 5LXRA 4OX9J 3KFWX 1SC1B 3MGJA 2RILA 4LF6J 1XBWA 1AZSA 4NXMJ 3HXMA 2FYXA 3P8BB 1HYSA 3ZZTA 4MIAA 4DR6J 1JMTA 4IR1A 4RR5A 1Q82T 3R6GB 5A0YA 3NG8A 3NAIA 4YR3A 2HNDA 3JYTA 4DXLA 1YDLA 2IYIA 3LALA 2FJAB 1HWIA 4DV7F 2HQFA 2UXBF 2FY1A 3EDRB 3OT9A 2GIFA 1GMVA 1XTZA 2PC6A 5H9EJ 1S1TB 5HP1B 5JXSA 1EETB 2YNHA 3L09A 4PG6A 4JYAJ 1N5YA 1NJWA 1KDNA 2IVFB 4DUZJ 1R8BA 1QAYA 3DDKA 1S1XB 2V4RA 1FD2A 2XLKA 2OIHA 3RU0A 2XYPB 4LFAJ 3ZZRA 2D69A 3MM9A 2HHPA 4FVCA 3QRRA 2AW0A 3NGSA 4DQSA 3MR7A 2MGZB 2OPQB 1NHVA 4PG7A 2GMLA 4KGMA 4P9SA 3AOBA 3DLJA 3HHNB 1Z4UA 3IR6B 2VG5B 4P74A 1CC8A 3FQLA 4ZCKA 3PW2A 1U7LA 3BO3A 2DITA 1GAOA 4CLFA 3OL8A 3BREA 3X1LB 1RT6B 2H9ZA 4QU7A 1NH8A 2O01C 2YKNA 1QVGR 1OYEA 1S7IA 5K8OA 2RDJA 1TFWA 5LSOA 3PYFA 2BE2B 1HMVA 4HDHA 1NU4A 1FWLA 1PYTA 4ZK7M 1TK8A 2R2SA 5KFBA 2EG1A 3M1VA 3WC0A 1IBMF 2D9PA 1X4DA 4Z7YA 1C0UA 1H6KX 3SYZA 2DYAA 2WOMA 5IFMA 1BUXA 1MN7A 2NUUG 3OR1B 1K1QA 4AQYF 1B7FA 2KL8A 3KG1A 4HH1A 1PAEX 3MMAB 5KFPA 4HH0A 4EEYA 4OYZA 3EDQB 5F0WA 6FDRA 4DL4A 4A8YA 1VR6A 4ES2A 4CLYA 4DBQA 4JI6J 2GW8A 3HVTA 3VGVA 5L39A 4KH1B 4A47A 5EUHA 4Y0FA 4DR4F 2WK4A 1YRTA 1FDBA 1MWYA 2ZJRQ 2DT9A 3RAXA 2O5DA 3PEHA 4Y65A 2YNFA 3IMQJ 1OQ3A 2X1BA 4HHUA 1T8EA 1WC6A 3MXHP 5IWAF 1TK5A 2WAQD 1NK6A 2QYCA 1UWBA 1LFWA 4XTTA 1TUGB 5KFSA 2B4VA 2RRAA 2BKPA 2EKNA 3I0RB 1FDAA 1Q78A 4JV2A 4F4KA 5BYQA 2M5YA 3ZTQA 2ACMA 1YIJS 5GVQA 1S7HA 4ED5A 3BS9A 5D3GB 2DR5A 2IRYA 2J6UA 4QOTA 4URQU 2F1FA 4KY3A 4EBDA 4NLWA 2LQ8A 1U6FA 5GMKa 1VHFA 2M2BA 3VCDA 3TA0A 1WOPA 4MAKA 3MEGA 4X4QA 4PPDA 2R7WA 3KNAA 3LF0A 1UJ6A 4OLPA 4CLPA 1UVIA 2FDNA 1MN9A 2JEGA 3LA0A 4KAIA 3JYTB 2VC1A 1HNWJ 2L9WA 3IXQA 4ZIVA 4FYVB 1SKUB 1DQ9A 1FK9A 4A46A 3GU0A 5DG7A 1RT4A 3M4XA 3KNGA 1PYSB 2RDDA 2HHTA 3K17A 3I56S 2RSQA 2MPUA 3CCMS 2DNKA 2F4VF 4KC5A 3O8WA 3NMRA 3AAWB 2DGQA 4F50A 2KB2A 2YNHB 1HL6A 4WK1A 4XO0A 1X4AA 1XK8A 1XNQF 6FD1A 1O0PA 3BBCA 4ECRA 3ZZPA 3TQEA 3K89A 5B0CA 2K1RB 1WG5A 3DHXA 4K7QA 5A2QY 3R5JB 2IDEA 1IWAA 3T1YF 3IAM9 4ED6A 1TTHB 4C7QA 1FKOA 1RWVB 4A8QA 4MKVA 4P10A 3NNAA 1RA6A 1PCAA 3AD8C 3QWPA 2Z57B 4W4MA 1BHNA 1BQMA 2W4CA 4AD6A 2WVDA 2JEJA 3I87A 4A8WA 2CJKA 1B0PA 1EP4A 1S9GA 4OYOA 4PYDA 3K5NA 3HLUA 1H2VZ 2LA4A 3AT1B 4NLPA 2OELA 2ADCA 2C1EB 1S5ZA 4DSJA 3UDVA 4PWDB 3GFXA 5KFOA 2G2ZA 2YKNB 3P49B 4LRCA 3E51A 2Y3YA 1GT8A 2YXLA 4ES1A 1KKHA 2KVIA 3TVKA 5CA5A 2CQ4A 1QDUB 3TUIC 4YY3F 1NK0A 2BJ3A 1IBCB 5DG8A 3TNVA 4LQ3A 3M7VA 4E98A 5J1PA 4L73A 3R8YA 5CCLA 3A3OB 2KH9A 4DV2J 5SUHA 1C0UB 3KLIA 5FDLB 2WOMB 5GAGI 2AZ3A 3NCPA 2V94A 3G87A 5BYRA 4QBUA 4JV5F 4ECQA 1ZM2A 1RHMB 2HS4A 2HPUA 3AJ1A 3BR8A 1SV5A 1NB2A 3BGLA 2R7SA 3TX8A 2HQCA 3NS6A 3JSMB 3AOCA 1JJ2R 5IT9Y 4TQSA 3D6TB 1VIXA 1YX2A 4FPRA 3LAKA 1VRTA 3VAJA 4ED2A 1WNEA 2V67A 3KLFA 2DPIA 4RW6A 4N7TA 3ZZOA 1H2TZ 4OYMA 3DDNA 3LGNA 1FTCA 3KJNB 2RU3A 4X4UA 4Q2MA 4H4KA 2HEKA 5F8NA 3LAMA 2AX1A 1HWLA 4M1KA 1UWBB 4DZ6A 5FLXU 2MKJA 1Z2ZA 2E1MC 3PDNA 1H7WA 1T05A 2MQMA 1RBOB 2Z58B 4HACA 2C22A 2KXFA 3CT9A 1U8SA 2GV1A 1CJTA 3W9IA 1CEZA 1FWKA 1FRXA 3P96A 4LREA 1Q81T 2P6TA 4S0MA 3ICLA 2Y8YA 1ACMB 1IUJA 3FVYA 1WTBA 1REGX 5D0EA 1VQPS 2WW4A 4EUVA 2JFDA 3GYXB 3C8YA 4RW4A 5THWA 1T3OA 2M88A 1N34J 3P5BP 5DM7Q 1F9HA 3OSNA 3VAIA 3KMQA 3GR0A 3Q2SC 3KHHA 2CQHA 3QIDA 3WC2A 1SIWB 4DL6A 2FIUA 4A8SA 5LMNJ 3RG6A 1VIOA 2ADBA 1EX8A 2GIRA 1FK9B 3GIRA 2XGQA 1RT4B 4EBCA 2GA7A 3Q23A 1NDKA 2YKQA 2LXIA 2ZWOA 1ZTTA 3FBFA 3CD6S 5B0EA 1Q7LB 1TZ0A 2IJNA 2XMKA 2QRRA 4GKKF 3BM7A 1PGZA 2DB1A 2LQ9A 4OHYA 1S6OA 1ZBTA 3N5BA 1R8AA 2JLGA 4IQXA 5AXMA 1U02A 1UA0A 2QSFA 1T7PA 2MJUA 1VQMS 3D0GE 1N54B 1KTQA 3BEGB 1UP1A 4RBUA 1Y0HA 4J9OA 1X9WA 1RT3A 3IG1A 1FKOB 2DPJA 5HQMA 1WHWA 3H4DA 3CJ5A 2VPWB 4DPWA 4G1QB 2LQ5A 1KS2A 1BMQB 2EXUA 3FEXB 1XJWB 1TU0B 3D1OA 1B0TA 2CXEA 2JX2A 1EP4B 4NZ7A 3I55S 1S9GB 1VFJA 4X4VA 1R7IA 2MSSA 5KFEA 2WZ1A 3H59A 4X66J 4X84A 4DPTA 4LF4F 4QWDA 2ZOMA 1V3SA 3OBIA 1SL0A 3IR7B 2IJRA 4F0KA 1SH2A 2B9EA 4M5GA 4DPUA 4EU0A 4KTQA 2VJUA 2QA4G 4U8VA 4KHMA 1N32F 2DNZA 3NL0A 4DUYJ 4I2QB 4L74A 2KM8C 2IY5B 3KK1A 3Q8YA 2A3JA 4DHVA 1QUVA 4JI3J 2K7JA 3POTB 2MHEA 4J37A 2C2DA 3EZUA 3GLJA 2VASA 3CXCR 3A4TA 2ZH1A 4OYBA 1F0XA 1KQKA 1SH0A 2ZH5A 1D0EA 4K4UA 2I38A 4OZ2A 2DNQA 2VFSA 3NS5A 2NSBA 3RJMB 3DI6A 2I5JA 3QLHB 4DX8H 4YS2A 3BO4A 4NMXA 1VQOS 1Y3KA 1T9YA 2ZBPA 3UPFA 4CO1A 3R7BB 3A12A 4IUFA 2A0FB 3U1MA 1N0VC 5CD4A 3OLBA 2V5HG 1IBLF 1SV5B 4FXWA 1LW2A 2V2VA 2CPIA 2UV8G 4V19X 1VQNS 2NXCA 1HNZF 4DX5A 3I5CA 3KLFB 1WSRA 3WQPA 3PZPA 3T5LA 4DFMA 3X3UA 4X65J 2CPXA 3ET6A 1VQSA 3PIPQ 2YY3A 4K4ZA 4OYIA 4KHRA 3MUVP 2IDLA 2CPJA 1X60A 4MK7A 2DH8A 2LKZA 2RHSB 2J5AA 3ETMA 4PXDA 1EQMA 1HWKA 4HACB 3MR3A 2ZDPA 2H48B 4J91A 1CJTB 5GAGU 2GCFA 5H1SV 5IT0A 4R8UA 4HDGA 3NXZA 2BM1A 2L08A 4DSEA 2CUYA 1JLBA 3KWMA 4MJKA 2VA3A 1DRZA 1VDHA 1F9EB 4ELUA 1HBOA 1DTTB 3TO8A 4KPYA 4RW4B 4CLUA 4ECXA 3RR7A 2BQ3A 1DARA 3DOLA 1K47A 3HSGA 2MZJA 1U0SA 4DF4A 3QT5A 1NK9A 5D78A 5IT4A 1NZAA 1O6XA 4DV1J 2AYBA 1S0MA 3M8PA 2VQEJ 1ZAWA 1FI4A 4ANEA 4FXVA 1WD6A 1N5QA 2V9KA 2V50A 3R5DA 2K7KA 1RAEB 2KVQE 4ID5A 3UFCX 2HHWA 2Y1JA 4EZ9A 3W2WA 4FBTA 4U9RA 2OEKA 2YQ0A 4HKQA 5DO2A 4NXMF 3MWBA 1XR5A 1UTAA 1KRPA 5C5JA 2ACYA 4K4YA 3J7ZT 4WJBA 3OXLA 1RT3B 3G6ES 3IG1B 2DBBA 1MMLA 3CD5A 5IOLA 3DLGA 3RB4A 3EVOA 3I6PA 3ZZYA 1SXLA 4RW9B 1T9WA 1SJRA 4ZPCA 4RO0A 2MEWA 1JJ4A 4JI4J 2KO1A 3KK2B 1VQ6S 1U47A 1KVIA 4ILLA 4ZVHA 4MT1A 3MD1A 4DUZF 2IVMA 3OLAA 2XULA 3ONQA 4QR0A 4J7CA 5D4NA 3G8SA 2HFZA 4L72B 2OPRA 3CULA 3GFYA 3E01B 1D09B 1RP5A 5D8HB 1IVZA 4P2FA 3SFGA 4JP8A 5AJ3F 2YQ1A 2C2EA 5A8WA 1FWPA 3KK3A 5D15A 2ZBIA 2Q6CA 2ZJPQ 2PEBA 3DRXA 4DSKA 3R3TA 2KFNA 3H40A 4DV6J 3TX0A 3LANA 1SC3B 2YVSA 1RAGB 3MPUB 1N0UA 2I5JB 2YH1A 3MM6A 3NNHA 1RTHA 1XNRJ 1SQFA 3QGHA 5HROA 4X64F 5EWGA 3GILA 3GE9A 4USIA 2ZFHA 1U1LA 2CPZA 3OW2R 5F8IA 4R5PA 3V2UC 1UA1A 2Y1LB 1LW2B 4ANCA 3ISND 3BZQA 4FYXB 4RBTA 4ECUA 3H98A 5IC6B 1OYDA 4M5JA 4CWBA 2DCUB 1QVFR 1HHSA 2R8GA 3QJPA 2XMMA 5KOXA 1DAXA 1FRMA 3T6BA 2OP5A 3GSDA 2PA8D 1C0TA 3ET6B 1NXIA 1P8GA 2XYHB 3N9UC 4PQUA 3DU6A 3FQKA 1FESA 4WIQA 1KQFB 3H90A 1T9UA 4I7FA 4WIIA 1MU2B 1K1SA 4FXDA 4DV5F 4E0DA 2HGNA 2V8HA 1K8AT 2VIHA 2Y9HA 2LFVA 1U2RA 2XMAA 1N4LA 3SZ2A 4R8UB 1XR6A 3HHDA 4OJ1A 3TI0A 2E5IA 2BE9B 3W8PA 2WSFC 3N6NA 2WVCA 1HBOB 1N6QA 1NCLA 4C8ZA 2VPXB 4EO8A 3C46A 1UVKA 1LQ9A 1JK9B 4DUTA 2O1PA 3DOLB 1NBEB 1SC4B 2CQBA 4HHHA 4ED7A 5E2QA 3PO5A 3HVRA 4ETXA 2LU1A 3G2XA 1T9XA 2C3UA 4V19J 2JJ4D 1H7XA 4EFAC 3M8PB 5DS7A 4EYHB 2JEIA 4OYAA 5T41A 2F8HA 1Y11A 2OI2A 2NR0A 2DNPA 1OO0B 4ZHRA 3PEJA 2RQCA 1PIEA 1UZHA 2RDIA 3CW2C 3G6XA 4HYKA 3HHKA 2R42A 3CCJS 4Y28C 3F44A 3ADAC 3DGPA 3AB4B 2ZBCA 2CWKA 2K2PA 3W2WB 3GIJA 2ASYA 3LGHA 1FRJA 1NDPA 4QR2A 1PO6A 3J7A1 2F9JA 2MXYA 2ASDA 4LIRA 3MTJA 5KFMA 1FJGJ 3TW0A 4O3RA 2KXNB 2L3MA 4TQRA 3U1NA 1HI8A 2LVWA 1HNWF 2AU0A 2OFGX 3BN4A 3CDEA 4M5NA 3IP0A 2QLWA 4RJVA 2QA2A 3BKFA 3MHYA 1UEVA 4IH5A 1TMMA 2RE1A 2FZCB 1WKLA 3FZ2A 3EXYA 4WFBQ 3DRSA 1UW4A 5F3ZA 4A8MP 5G4DA 3OR2A 4F2RA 2Y1RI 2QO3A 1F6TA 2RRNA 2LEAA 1VBYA 1HQEA 3IWXA 4NLYA 2OEMA 3T1AA 3PG9A 2B4PA 2A6MA 2BA9A 4I6AA 1EHWA 3OVBA 4V1Ak 1YBUA 2B7BB 4DQQA 3IS9B 5KFJA 3Q8UA 4OL8A 5HSPA 4A8FA 3LP1A 2H4WB 5A8WB 3GIMA 2W2PP 2E5GA 2EG2A 2PGCA 5CCMA 2OD6A 3Q89A 3VVTA 5DDQC 2AWZA 4DR3J 1RACB 4ZVGA 3FJ2A 5MLCV 2VUGA 3MM6B 1IBKJ 4FN5A 1EQ0A 4HLBA 3JQMA 3MR6A 5F9LA 2D3ZA 3EXCX 1VC6A 5HROB 1WELA 5KG0A 3KXDA 4A48A 3RAQA 4EI2A 1RB0A 5LL6d 4OZ1A 5CD4H 4NA3A 1FFWB 3IN5A 1PG5B 2J6TA 4DR2F 2D1CA 3CF5Q 1F60B 4LF8J 2ZE2A 4FZVA 4IO1A 2DY1A 5HJYA 1I51B 1FT8A 1C0TB 5L1IA 3HHLA 1P9QC 4DV0F 2AD9A 1UW9A 1QJHA 4YDDB 1YJWS 1RISA 3DGVA 4PQUB 3HFZB 5JVHQ 1HBMA 1ZETA 2BV3A 2QL7B 4I7FB 2WTFA 3H0PA 1BQNA 4NYOA 3BKTA 3MEKA 2CPYA 3HT3A 4TLRA 2UUCJ 2HZVA 2IJFA 5IV4A 1R27B 1J5OA 5D4LA 5KT4A 2R7VA 2G9OA 2H5IB 2P9EA 3UDLA 3VGSA 2U1AA 4E2FB 3T19A 1YBAA 4WTYA 3TUPA 4LR7A 1N6QB 4CDIA 1HARA 5ETSA 1YRUA 1R8PA 2HVHA 3H8YA 3RBXA 4WF9Q 4YN3B 5J1EA 5KFDA 2CNOB 3Q8QB 2DNOA 2N7CA 3JSRA 2V68A 5C42A 2DXEA 2DHXA 3UVJA 2BXJA 1Q8LA 3BYPA 3G8QA 2DO4A 2GX8A 4Y00A 1P1TA 3CCLS 5T7LA 2W7PA 2PO4A 1TUVA 1RWNB 1G2EA 1F3FA 2UZAA 2DGTA 1BLUA 2BOPA 4JI1F 1G1XA 1RQ0A 4I69A 1X4HA 2PE8A 3TAPA 1RLDA 5BR8F 2Y1IA 4CTAA 2MZ1A 3SSQA 1WC1A 2QT7A 3DGPB 4G65A 2QMWA 2VFUA 1OPIA 3CCTA 1N34F 3MM5B 1RWUA 4KE5A 2AYGA 4CYUA 3MPYA 1HWJA 5EX0A 2JLFA 4YOEA 2IRXA 4TU9A 4LF7F 1PSDA 3UR3C 1JLFA 2PI4A 1XMQJ 3A8JA 2IM0A 1FKAF 1RAFB 3TVYA 5G0RA 2XTJP 4IO9Q 3M8YA 3T9NA 1FXDA 3CJKA 2OPSA 1FVSA 4M5LA 4I0WA 1FEEA 3EE3A 2VOOA 3IO1A 4FF1A 3FCWA 2GIQA 2RMLA 3DRSB 4WU2A 2W2QP 3ILOA 2HLTA 3T41A 2UU9F 3W5ZA 4R0JA 4ED1A 4L3KA 3OR2B 2G2OA 3ILJA 2R9LA 4J9MA 4B3OA 1C1BA 4X62F 3UNGC 4KQZA 2XHWA 3DLKA 2XYGB 4KO0B 1DHMA 2C3MA 2IYGA 5IM0A 1IKXA 2P9CA 4J9QA 3QRPA 1E6VA 2BW7A 2CADA 2FHOB 4DL0C 2CJBA 2AYMA 1VQ7S 2QA4S 4PCQA 4CLLA 4CO0A 1KHWA 4Q7AA 1RT7A 5BYSA 4YB6A 3HFVA 2PA3A 3OFFA 4PWWA 5HQLA 2HFNA 4ZP8A 3CD7A 1U1PA 1W2IA 2HVEA 5A8RA 2DGOA
chains in the Genus database with same CATH topology
1NK6A 2M8HA 4WK3A 4C8LA 2XI3A 5D4OA 3HKZD 2QYCA 1UWBA 1M5PC 1LFWA 2XLIA 1TL5A 4X4NA 5I4MA 1E6YA 3RRKA 2XSJA 1AFIA 1U6BA 5KFSA 3MD3A 2B4VA 2RRAA 4Q8FA 1U1OA 3PKMA 4M5DB 3SSSA 3K57A 4BS2A 4JI3F 3K5LA 1FVQA 5KAKA 1V3ZA 3RB3A 4MFBB 3I0RB 2N82B 1FDAA 1Q78A 1YITS 3E01A 1XC9A 4JV2A 3RBDA 2UVVA 4F4KA 2AJQA 1ULRA 5BYQA 1U45A 4ID5B 4IFYA 2M5YA 2XSFA 4CO4A 1RDRA 5KFKA 5CYJA 4G3IA 3OTDA 1C4CA 3PR4A 3BQ0A 4OX8A 4ZPAA 1GX5A 5EX3A 4GC6A 1YIJS 5GVQA 5KFYA 1S7HA 4ECZA 2IAJA 5B0FA 3AY0A 4ED5A 4IH7A 3KHGA 2KDOA 2KT2A 4RNNA 3BS9A 2V4JA 1S6QA 2VG6A 1JJHA 2EK6A 2KN4A 3HHEA 5D3GB 3NWGA 4DN9A 2J9DE 1FXRA 4OFZA 2JSXA 2DR5A 1CQMA 1DLOB 2I0XA 2GQCA 2IRYA 5DDOC 5DDPC 3SCJE 2MJNA 3JSBA 2FJDB 1ZTWA 2J6UA 2CQ3A 1HBMB 1UEUA 3T1HF 4QOTA 4URQU 3HDSA 3DRPA 4C8NA 2DISA 2F1FA 3DM2A 4EBDA 4NLWA 1BQNB 3CJ3A 5DQHA 2JDJA 1U6FA 2ZKUA 1X9MA 5GMKa 5KT6A 1FJGF 1YQHA 2PD1A 1UJ4A 4LT6A 2RIJA 1VHFA 2M2BA 3TQ1A 3NKYA 3VCDA 2JC1A 1SJ1A 3TA0A 1FF2A 5B0GA 4AE5A 4ZPWR 4MAKA 3MEGA 1KLMA 1HNIB 3HF5A 4QPXA 4X4QA 3KG0A 4PPDA 2VFRA 5EHHA 1RK8A 2AYEA 2GO9A 2R7WA 1HR0F 5DLFA 1U2FA 4U7CA 3KNAA 3LF0A 4U67Q 3SXLA 2ABYA 1HNVA 1UJ6A 3MUTP 4OLPA 5L1JA 1HNXF 2FJVA 3DLGB 4EBEA 2FDNA 1JXEA 1UVIA 1KOOA 2GC8A 2JEGA 1UVJA 2PI5A 3D54A 3LP2B 2FUG9 7FDRA 1VRUA 4KAIA 1KEKA 2FD2A 3C66A 3JYTB 1RI7A 2LDYA 2M9KA 2VC1A 5EN1A 4KR0B 2L9WA 3IXQA 5M2RA 3K58A 4FS1A 3N0VA 1AUDA 4DSIA 1WI8A 4PRFA 5DGAA 1BWEA 3OXGA 1DQ9A 3KLVA 1WF2A 3JSYA 1FK9A 4A46A 1RJJA 2G0CA 4ID8A 4URGA 5DG7A 3N5FA 4G1IA 5DDRC 1XERA 3S01A 4ZPDA 1RT4A 2Q43A 1FDNA 2KXHA 3M4XA 3K8VA 3KNGA 4AUKA 5KFAA 3UCUP 4W92B 2VOPA 2HHTA 4NLQA 5KFTA 3I56S 5J2PA 2QE5A 1H3DA 2DIVA 2RSQA 2VBXA 4Z2XA 1U48A 2MPUA 3CJ0A 5E33A 3CCMS 5HLFA 1KFSA 5J1EB 2DNKA 2DGUA 2F4VF 4LFCF 4C9DA 2LEPA 4KC5A 1HQUB 2PIIA 3O8WA 3NMRA 3AAWB 1YSJA 2HNYB 2VV5A 5C42B 2DGQA 4F50A 3M8QA 2ZNZA 4NA1A 2UUBF 2KB2A 2YNHB 1HL6A 2EBGA 1WHYA 2FVSA 3L95X 4WK1A 4I6WA 4XO0A 2ZC4A 2OPRB 1X4AA 1TK0A 2UXCF 1D1UA 1JLCA 2ROPA 4PXEA 1XK8A 1S6UA 1Q8BA 1XNQF 4ERDA 5GAEI 2X1AA 2RQ4A 4TU8A 3H5SA 4B02A 2Z2LA 2HHHF 6FD1A 1LWFB 1O0PA 1ZZFA 4Y34A 4ECRA 1L5UA 3ZZPA 2R7QA 1R43A 2D3OR 3SEOA 5B0CA 3M05A 3KLHA 2K1RB 3DRYA 1WG5A 2IA0A 2IRUA 3DHXA 4UY85 1HFEL 3K5OA 1MU2A 5AXKA 3HPOA 4B17A 5A2QY 3DOMA 5KFRA 1O5JA 2CFXA 2V4QA 1GNKA 4RKUC 1KONA 2XEXA 2CQ0A 4J9SA 4PKDB 4HTIA 3T1YF 3KK3B 3IAM9 3MM8B 1QLNA 4CTAB 1NH7A 4ED6A 2BBEA 1KSPA 2IFXA 1T94A 1FCAA 4C7QA 3V6HA 4M94A 1FKOA 1N5SA 2IC3A 3DHWC 4CCHA 4WFNQ 4A8QA 1URRA 3O44A 1JLAA 2AV5A 3S8SA 3DLBA 3CD0A 3MMBA 5KOWA 4DR3F 3NNAA 1I94F 1RA6A 2DTJA 2EVZA 1DTQB 1IXKA 3QWPA 4IKAA 4Q0BA 4U7UK 1BQMA 2LDIA 2GGPB 4XDCA 3VAHA 2W4CA 4ECYA 2POKA 4ECWA 2R8KA 1RTHB 1VK8A 2EBEA 1IBKF 3K59A 4PPZA 2JEJA 3I87A 4A8WA 2CJKA 1B0PA 1EP4A 2DK2A 1S9GA 3I4PA 3V6KA 3K5NA 3F73A 3HLUA 3MF5A 2B5JB 4DQIA 3PFEA 2DR7A 1H2VZ 1JLFB 2ALZA 2LA4A 4P2SA 4WFYA 1ZM9A 4NLPA 3PV8A 1GTEA 1WEXA 2UUWA 3TAMA 4X2BA 2JVRA 2ADCA 1U1NA 4W90B 2MKHA 1R3NA 2FHJD 4R5PB 2VQEF 3N28A 1S0OA 1O51A 4DSJA 4ECTA 1FERA 4OI2A 4PWDB 2BABA 1LK7A 4OQJA 5U47A 3GFXA 3LP0A 5KFOA 5K8NA 5IZHA 1MNEA 1YJTA 2LEBA 3DLHA 1XN9A 2YKNB 3P49B 1T03A 2RF2A 4OX7A 3CJKB 5HI7A 2OPSB 3Q2TC 3E51A 3K7RA 4RW7A 4WXOA 3BJYA 3M30B 2HFOA 3BGRA 4KSEB 2ZH6A 1GT8A 3DU5A 2YNIB 4ES1A 3OUYA 3CCVS 4LFBF 3EGWB 1RTJA 4B08A 3VAFA 4IG3A 4LF8F 2MSTA 2CG4A 3CIZA 2KVIA 3BGFA 4MIBA 3Q24A 1C1CB 4AL7A 1HHTP 3TVKA 5C25B 5CA5A 1ZM4A 2CQ4A 3DLEB 4DPOA 2MKCA 2WB4A 3QPIA 4LSNA 5KT7A 3TR5A 1NKCA 3AJ2A 3TUIC 4QZVB 3OHAA 1Y5IB 3GWCA 4B3OB 3V6DA 3FMBA 3GIKA 1S4FA 3MEDB 3CEDA 3I0SB 4YY3F 2HHUA 2BRLA 1NK0A 5K8PA 2W7OA 4RUAA 4ED8A 4Q44A 2Q3PA 5DG8A 3TNVA 4LQ3A 4RW8B 4E98A 1ZPWX 5J1PA 4OV1A 3TA2A 3NBPA 5CCLA 1LWCA 4JI8F 1LW0A 2OFHX 1HBNA 4PG8A 3DLKB 3BF4A 4WE1A 3RTVA 2J7KA 5AE2A 3MR2A 2CPFA 2KH9A 1K73T 1LXJA 1MSWD 5SUHA 4OX9F 1C0UB 4J9NA 3KLIA 5IM0B 5A6WA 1VOMA 5FDLB 3BO2A 4DN0A 2WONA 2WOMB 2BDPA 2UVUA 2I9SA 5GAGI 3OL7A 4LF6F 1TKZB 4FVMA 4JUZA 4WZMA 1ROFA 3NCPA 4LSLB 3T9ZA 1REVB 5CHCB 3W3SA 2WBMA 3CJ2A 4HHJA 4IOBA 2VONA 4L3NA 2RKIA 3JAMY 4KKOA 1P1LA 4KV8B 2V94A 1K0TA 4DR6F 2L9DA 2GMJA 2ZKTA 4JI2F 1NK8A 4K4XA 5F0UA 2KI2A 2YX1A 2QFJA 5BYRA 4QBUA 4JV5F 1Y5LB 1ZM2A 4ECQA 2EC0A 2HS4A 4KGKA 5DG9A 3P5TL 1DZ5A 4N56A 2HPUA 3AJ1A 3BR8A 4ELTA 1SV5A 3BGLA 2R7SA 3TA1A 1RT1B 3TX8A 3M6VA 2W25A 2Q6BA 1R6YA 3IGVA 2HG4A 3NS6A 5C24B 3R1LA 2YX7A 4OI4A 3JSMB 4DG1B 1ZH5A 4N41A 1MW7A 1OQ6A 3LOUA 4RUHA 4ZS6A 5KFUA 1JJ2R 5IT9Y 4TQSA 2CZ4A 1VIXA 2LQJA 2ZVSA 4JI4F 1WWHA 3GV8B 5KG2A 4I4BA 3R5BA 4FPRA 3Q8SB 3LAKA 1VRTA 4U6PA 5B0DA 2Z2MA 4IR9A 4DFJA 3VAJA 4ED2A 1WNEA 3M2RA 1DBDA 1JLQB 3QO9B 1SH3A 4XAKA 3KLFA 2DPIA 2J0WA 4RW6A 1UJ5A 5SZTA 4CT9A 2D7SA 4ILMA 5I42B 5CYMA 3ZZOA 1UETA 4OI1A 1H2TZ