1YK3A

Crystal structure of rv1347c from mycobacterium tuberculosis
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
198
structure length
198
Chain Sequence
ADDALVRLARERFDLPDQVRRLARPPVPSLEPPYGLRVAQLTDAEMLAEWMNRPHLAAAWEYDWPASRWRQHLNAQLEGTYSLPLIGSWHGTDGGYLELYWAAKDLISHYYDADPYDLGLHAAIADLSKVNRGFGPLLLPRIVASVFANEPRCRRIMFDPDHRNTATRRLCEWAGCKFLGEHDTTNRRMALYALEAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein Rv1347c/MT1389
publication title The crystal structure of Rv1347c, a putative antibiotic resistance protein from Mycobacterium tuberculosis, reveals a GCN5-related fold and suggests an alternative function in siderophore biosynthesis
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 58
structure length 198
sequence length 198
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2005-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13523 Acetyltransf_8 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1yk3A00
2G3AA 1KUVA 1M4DA 4ZBGA 2ZXVA 2JEVA 1M1DA 2J8MA 4EVYA 3EO4A 3TOBA 2ZW5A 1RO5A 4KUAA 3GKRA 3CXQA 4DNCA 3BJ8A 3FXTA 1Z4EA 1IICA 4U9ZA 2FIWA 3C26A 2BSWA 4FD4A 1YGHA 4F0YA 3SHPA 4YGOA 2EVNA 2BUEA 3BLNA 1Q2CA 2Q4YA 4HNYB 4AVCA 2PQ8A 2BEIA 4MY3A 3LODA 2P6EA 4H6UA 2PR1A 1BO4A 4RI1A 4KOXA 2FS5A 4L8AA 3SXNA 1I12A 3VWDA 4OADA 4GS4A 2R8VA 4I49A 1WWZA 1XE4A 4AB7A 2PRBA 3NE7A 2JLMA 1QSOA 4E8OA 3R96A 4MBUA 4UWIA 1IIDA 3P2HA 2EUIA 1QSMA 4U5YA 5KTCA 1CJWA 2D4PA 2H5MA 1XMTA 3K9UA 3S6HA 1N71A 3FIXA 2OB0A 3IWGA 4M3SA 2R98A 3DR8A 1Z4RA 4YFJA 1S7FA 1VKCA 1MJBA 4LX9A 3G3SA 3BJ7A 4YRHA 3SXOA 1U6MA 4E2AA 4H6ZA 4HKFA 4OLLA 2QMLA 3R1KA 1LRZA 5EBVA 3W6XA 2WPXA 3EFAA 5F48A 3CXSA 1S5KA 1ON0A 4X5KA 2GANA 2ARHA 2X7BA 4J3GA 4E0AA 3WR7A 2GE3A 4BMHA 3PGPA 5HH1A 3DNSA 2B4BA 5JQ4A 1K4JA 3PP9A 2OH1A 2B3UA 4NXYA 2P0WA 4QVTA 4QC6A 2AJ6A 1MK4A 1MJAA 3TT2A 2QECA 3R9GA 1IB1E 3V8IA 4CAVA 2B3VA 4FD7A 2F5IA 4B5PA 3DR6A 4B5OA 4AG7A 2B5GB 2ZW6A 2B4DB 4MJ8A 1IYLA 3FNCA 2DXQA 4KVME 2CNSA 4LUAA 5DWMA 1P4NA 3TTHA 4XNHB 3R9FA 5JPHA 2Z11A 5I0CA 3LD2A 1NSLA 2OZUA 2VEZA 4CAWA 2B58A 3QB8A 2C27A 3D2PA 2ATRA 5F49A 1L0CA 4KOVA 2D4OA 2Q7BA 4Y49C 2FL4A 5H84A 4PK3A 4HNWB 4FD6A 3VWEA 3KKWA 1KUXA 2FXFA 4KOTA 1IYKA 3H4QA 1RXTA 3TOAA 5HMNA 1UFHA 2NMTA 1PUAA 2CNTA 2FIAA 2JDDA 4ONUA 3ZZIA 1Q2YA 1Q2DA 4QUSA 2FE7A 3I9SA 5J8FA 2ZW4A 3R95A 3EY5A 3ZJ0A 3P2FA 3G8WA 3JVNA 4CRYB 1MJ9A 4XNHC 4JD6A 4HNXB 5C82A 2JDCA 1QSRA 2OU2A 2QIRA 2REEA 4U9YA 5C88A 1QSNA 1M4GA 4XPDC 4JLYA 1S7LA 1R57A 4XPLA 2AE6A 4R57A 4NSQA 5F47A 1YX0A 2PC1A 2R1IA 3R9EA 4IF5A 2VBQA 5E96A 2J8NA 4PSXA 4L89A 1J4JA 2P6GA 4QBJA 5IV0A 1Z9UA 3TO7A 1M4IA 4II9A 3I3GA 1FY7A 2VZYA 4ORFA 4OAEA 5H86A 2A4NA 4Y49B 3F0AA 1S60A 1YR0A 2Q4VA 2OZHA 4QB9A 1WK4A 5IX3A 5J8CA 3W91A 4CS0B 3MGDA 4PK2A 3D2MA 3FB3A 2FCKA 4CRZB 2VQYA 3FRMA 1I1DA 1B87A 3TFYA 1NE9A 1P0HA 1BOBA 1XF8A 2CY2A 3GY9A 4K30A 4R87A 2WPWA 2RC4A 3W6SA 3DDDA 1SQHA 1TIQA 3D3SA 3F5BA 4R3LA 2O28A 2PSWA 2ZW7A 4H89A 5EC4A 4UBRA 2B5GA 3S6KA 2B4DA 1OZPA 4KOYA 4XPDB 5FVJA 4JJXA 3TO9A 4KUBA 4KLWA 4KOUA 2REFA 2IL4A 4AG9A 3RYOA 4MI4A 5F46A 2HUZA 4UWJA 3JUWA 4JXRA 4KOWA 4R3KA 4AVBA 2HV2A 4NCZA 2G3TA 3TO6A 1GHEA 5GCNA 2Q04A 5KTAA 3T9YA 3EC4A 4PSWA 3GYAA 4MHDA 1YREA 1I21A 3N7ZA 5IB0A 2VZZA 3OWCA 3UY5A 2FSRA 4F6AA 1VHSA 3T90A 4CAXA 4KVOE 2BL1A 3E0KA 3PZJA 5DWNA 3D8PA 3F8KA 1S7NA 1KZFA 2OZGA 2GIVA 4NF1A 4KORA 2Q44A 4KZTA 2HQYA 1S7KA 1YLEA 1QSTA 4KLVA 2P6FA 4PV6A 2ZPAA 2VXKA 1V0CA 4KVXA 2Y0MA 2G0BA 3TE4A 1KUYA 1YVOA 1M44A 2K5TA 4MY0A 5ISVA 1NMTA 4AVAA 1YVKA 2Q0YA 3CXPA 1PU9A 3FYNA 5CNPA 1S3ZA 2I79A 2CNMA 4JWPA 3S6GA 2I00A 4JXQA 4UA3A 4XPKA 3S6FA 1Y9WA 4M85A 2PDOA 1YK3A 3EXNA 3QAHA 2FT0A 4RS2A 3B8GA 5KTDA 3DSBA 3IGRA 2KCWA 3TCVA 4KOSA 2J8RA 1Y7RA 4FD5A 1Y9KA 2R7HA 2PR8A 4R9MA 4NEXA 1XIXA 2Z10A 1CM0A 2VI7A 2Z0ZA 1B6BA 4B5PB 3FBUA 4IUSA 1XEBA
chains in the Genus database with same CATH superfamily
4FBEA 2ODFA 6CPAA 2G3AA 2AFSA 1KUVA 1M4DA 2PJ2A 3MN8A 4ZBGA 2ZXVA 4ZX8A 3PRTA 1XFOA 1NSAA 1VIXA 3RAMA 2JEVA 5IB9A 1M1DA 2J8MA 2DEAA 4EVYA 3EO4A 1Y0YA 3TOBA 1IOIA 4GXHA 2ZW5A 1IOFA 1RO5A 4NGMA 4PXEA 5CBMA 4KUAA 3FX6A 5HVHA 3GKRA 5A27A 2DF5A 2XEIA 2PJAA 3CXQA 4UEFA 3BJ8A 3FXTA 4DNCA 1Z4EA 1IICA 2DPSA 2ZEGA 3GB0A 4MHZA 4U9ZA 3D4UA 2FIWA 3C26A 2BSWA 4FD4A 3FEEA 4P4DA 4UFXA 1YGHA 4X2TA 4F0YA 3WC7A 3SHPA 3KZWA 4YGOA 2AFMA 2EVNA 4Z65A 4OC5A 5DS0A 2BUEA 2ZEOA 1XJOA 5JH9A 2C6PA 3IU2A 1Z8WA 2CTCA 3BLNA 3IWEA 2PCUA 4P4EA 2POKA 5LRKA 1Q2CA 1CG2A 2Q4YA 3K2KA 4HNYB 4LQGA 4A32A 3L2NA 2PQ8A 2PJ9A 4MFLA 4A37A 2BEIA 4AVCA 1JWQA 4MY3A 3FEDA 1LOKA 3RZAA 4B6ZA 2PVWA 4PPZA 3LODA 2P6EA 4F8ZA 4H6UA 3FECA 2NYQA 4C2YA 1DTDA 2PR1A 1BO4A 4RI1A 4KOXA 2XEFA 2ZEDA 3D7GA 4OC4A 2FS5A 2RB7A 5G20A 4L8AA 3SXNA 1YW6A 2Q51A 1I12A 5D8NA 3VWDA 5LYFA 2CTBA 4G1PA 4Q7AA 4P6YA 4RUHA 4OADA 3SI2A 4GS4A 2PIZA 2R8VA 4I49A 1WWZA 3D7HA 4UFWA 2ZENA 3FVLA 1XE4A 4AB7A 2PRBA 1UWYA 4A31A 1GYTA 3NE7A 2JLMA 1QSOA 2AFUA 4E8OA 4M6HA 5D29A 1AUGA 4UCPA 2PJ3A 3R96A 4MBUA 4UWIA 3FF3A 3WC5A 3H8EA 4JZ0A 1IIDA 2EWBA 2IMOA 3P2HA 2ZEHA 3IEHA 4Q36A 4MFPA 4R6TA 2EUIA 5CPAA 1QSMA 2NSMA 4U5YA 2PVVA 1CJWA 2D4PA 2H5MA 5KTCA 2GU2A 1F2PA 1R3NA 1XMTA 1TKJA 2AFZA 3K9UA 3PBBA 3S6HA 4JYWA 1N71A 3KR4A 1ZG7A 3FIXA 3KI9A 2OB0A 3IWGA 4OP4A 4C7HA 3CPAA 1YMEA 3B3VA 4M3SA 2R98A 1QMUA 3DR8A 4CGNA 1Z4RA 2GREA 3SI1A 3SJGA 4YFJA 1S7FA 5HXDA 1VKCA 3CZXA 4P4IA 1MJBA 3BJ7A 3G3SA 4LX9A 2GFQA 4YRHA 2ZOGA 3SXOA 1U6MA 4E2AA 4H6ZA 1BAVA 4HKFA 4ZY0A 4OLLA 2QMLA 2VL1A 3R1KA 4Q38A 1R43A 1LRZA 5EBVA 3W6XA 2WPXA 3EFAA 3RO0A 5F48A 3PB9X 4CYOA 3CXSA 1S5KA 4A94A 3JRUA 3ISZA 4FUUA 3TX8A 1ON0A 1ZG9A 1A2ZA 4X5KA 2GANA 2YGWA 4MMOA 2EO8A 2ZEMA 2OR4A 2ARHA 1Y7EA 3V7ZA 4B14A 2X7BA 4J3GA 4E0AA 3WR7A 2F7VA 3IIBA 2GE3A 3NH8A 1XOVA 4BMHA 3PGPA 2BCOA 3DNSA 5HH1A 2V8VA 2B4BA 5JQ4A 1K4JA 3PP9A 2QJ8A 2OH1A 2B3UA 3B2YA 4NXYA 2P0WA 4QVTA 4QC6A 3WC6A 2AJ6A 1M4LA 1MK4A 3CPXA 3A9LA 5I4MA 1MJAA 3TT2A 4DUKA 2QECA 5G21A 3R9GA 2PJCA 1IB1E 3V8IA 4A39A 4CAVA 2B3VA 4FD7A 2F5IA 4B5PA 3DR6A 2ZELA 4BINA 3RBUA 4F0XA 4A38A 4B5OA 4AG7A 2B5GB 2ZW6A 2B4DB 4MJ8A 2RFHA 1IYLA 3H8GA 4CYPA 4A33A 3FNCA 1CX8A 1VHOA 2DXQA 4KVME 4P4FA 1X10A 3KHZA 4EMEA 2CNSA 5HVGA 4MRIA 4LUAA 2Q43A 1HEEA 2WUUA 4BBHA 4PQAA 1HDUA 5DWMA 3NA6A 1P4NA 3QAYA 3TTHA 3GLJA 2QVPA 4ONWA 1FNOA 4XNHB 2ABZA 3R9FA 2JEWA 3PEIA 5JPHA 1ARLA 1EE3P 2Z11A 3LD2A 4KSIA 4X3RA 1NSLA 4CGLA 5I0CA 5K8OA 2OZUA 2VEZA 2YNCC 3MRUA 4P45A 4CAWA 3IC1A 2QYVA 3DLJA 4PXCA 1CP6A 3IU1A 5AG7A 4MFJA 2B58A 4B12A 3QB8A 2G9DA 4EWTA 2C27A 8CPAA 2WZNA 3D2PA 3T8WA 2ATRA 1Z8TA 3PFEA 5F49A 1L0CA 3B3SA 4KSFA 1H8LA 4KOVA 4OIWA 2D4OA 2Q7BA 1TF8A 3LACA 1X12A 4Y49C 2FL4A 5AG4A 1ZO0A 1Z8LA 4MFKA 5H84A 4PK3A 1XBUA 5LYDA 5J1QA 1TXRA 2ANPA 3N5FA 4CGPA 4HNWB 4FD6A 2EK8A 2V8DA 3B35A 4IHMA 2GLJA 2Z3MA 3VWEA 1KUXA 1LAPA 3KKWA 2FXFA 4KOTA 1IYKA 4FWUA 4F9VA 3H4QA 1RXTA 3TOAA 5HMNA 1UFHA 1XMBA 4ZY2A 2NMTA 4B10A 1PUAA 2EBJA 1TKHA 2CNTA 2FIAA 2JDDA 3VH9A 4MFZA 4ONUA 3B7IA 4A95A 3ZZIA 4WWVA 4MCRA 2OOTA 1Q2YA 1Q2DA 3KASA 4QUSA 5JM6A 5LRJA 2FE7A 1YSJA 3I9SA 5J8FA 1ZLHA 1CPSA 3H5ZA 3LMSA 2ZW4A 4TNUA 2V8HA 3B3CA 3R95A 3EY5A 4OKOA 3S9LA 1ARMA 1CPXA 1TKFA 3ZJ0A 2WYRA 4ZI6A 3P2FA 3G8WA 3JVNA 3PFOA 1AMPA 4CRYB 2BO9A 1MJ9A 4H2KA 4W9YA 4XNHC 2XEJA 4JD6A 4HNXB 5C82A 2JDCA 4MHYA 4M6GA 1PYTB 1QSRA 2OU2A 2QIRA 2REEA 4P10A 4U9YA 2V8GA 3D7DA 3KGQA 4KSAA 4X8IA 5C88A 1QSNA 4CGMA 2Z3LA 4OIDA 1M4GA 4XPDC 3IFEA 4JLYA 5HVFA 5LYIA 4AXVA 1S7LA 2BOAA 1R57A 4XPLA 2AE6A 4R57A 5F09A 3HUVA 4NSQA 4OMEA 5F47A 1YX0A 2PC1A 2R1IA 3R9EA 3SJFA 4IF5A 1YQEA 2VBQA 5E96A 2J8NA 4PSXA 2JBJA 4NGTA 3IJ3A 4L89A 1LCPA 1CP7A 3GUXA 4R8FA 1J4JA 2P6GA 3B3WA 1ELLP 3I1UA 3KQZA 4R7MA 4QBJA 2HC9A 1Z9UA 3TO7A 1M4IA 5IV0A 3I3GA 4II9A 1FY7A 3FJUA 2EK9A 2VZYA 4MCSA 2HB6A 4CAFA 4ORFA 4CYNA 4UF4A 4OAEA 5H86A 2A4NA 2PJ5A 3NH5A 4Y49B 4ZY1A 2O4HA 5AGEA 4OC1A 3F0AA 4MXUA 1S60A 1YR0A 1LANA 1JQGA 4RN7A 2Q4VA 2OZHA 4QB9A 4HPSA 3PB4X 2AFOA 1WK4A 1XRYA 2ZEPA 3D67A 5IX3A 4NGSA 3ISXA 2PIYA 4OC3A 3S9NA 5J8CA 2Z3NA 3BHXA 3W91A 4CS0B 2PRQA 3RNZA 4OC0A 4YU9A 3MGDA 4FAIA 4GM5A 4K3NA 2PJ1A 4PK2A 2PJ4A 3D2MA 4EFDA 3IWWA 4DYOA 3FB3A 1LAMA 2FCKA 4CRZB 2PJ6A 3BI1A 2VQYA 2YNDA 3FRMA 4UEEA 2WSAA 1Z8XA 1I1DA 1B87A 3K9TA 4MCPA 3TFYA 1NE9A 1P0HA 1BOBA 3QNVA 1XF8A 4UIBA 4CPAA 5JGFA 1Z5RA 2CY2A 3GY9A 4K30A 4R87A 2WPWA 2RC4A 3W6SA 2I3CA 3DDDA 1SQHA 1TIQA 3D3SA 3F5BA 4R3LA 2O28A 2PSWA 1QQ9A 3DGVA 4ZX9A 2ZW7A 2C6CA 4H89A 1Q7LA 3KL9A 4NFRA 5BWAB 3FH4A 1BLLE 1YW4A 2B5GA 4UBRA 2B4DA 3PBEA 5EC4A 3S6KA 4ZYQA 2CF4A 5K8PA 4P4BA 1OZPA 4KOYA 4XPDB 3PB8X 4JJXA 2IJZA 5FVJA 3TO9A 2J9AA 4B13A 1YLOA 4CYQA 5K8MA 4KUBA 4KLWA 4KOUA 4DJLA 2IL4A 1AYEA 2REFA 4AG9A 2IQ6A 4NGPA 3RYOA 5EMIA 1LFWA 2PJBA 3KQXA 4MI4A 2F8HA 1DE4C 3CT9A 5F46A 2HUZA 1VGYA 3NFZA 4UWJA 1FT7A 3JUWA 4JXRA 4KOWA 3SJEA 2V77A 3SI0A 4R3KA 4A2ZA 4AVBA 2Q4ZA 4TWEA 2HV2A 4NCZA 2G3TA 4ZGYB 3KHXA 3TC8A 4P4JA 4NJRA 3TO6A 1PCAA 1OBRA 1GHEA 5GCNA 2Q04A 1KWMA 3HLPA 5KTAA 3T9YA 2PE3A 3EC4A 4PSWA 4KS9A 4MCQA 3GYAA 4MHDA 2PJ7A 1YREA 4B11A 3BI0A 4O23A 1I21A 3N7ZA 5AG6A 4C7IA 5IB0A 2VZZA 3GIUA 3OWCA 3UY5A 2FSRA 4F6AA 1VHSA 3T90A 3CDXA 1F57A 4CAXA 2C6GA 3D66A 2ZEFA 4LQ6A 4OC2A 4KVOE 2BL1A 3SJXA 2CIJA 3NH4A 4UCMA 3E0KA 3PZJA 5DWNA 3D8PA 1ELMP 3F8KA 4MHNA 3NE8A 1S7NA 1KZFA 2AFXA 2OZGA 2GIVA 3PB6X 5LRGA 2DPTA 4NF1A 4UEZA 5G22A 4A30A 3IO1A 4MFQA 4KORA 4IAVA 1ZLIA 2Q44A 4PXBA 4KZTA 2HQYA 4UFVA 1S7KA 1YLEA 1QSTA 4KLVA 2P6FA 4PV6A 3VATA 2ZEEA 2C1CA 2ZPAA 3KR5A 2VXKA 4CGOA 4C68A 2GLFA 1V0CA 3PB7X 1Z2LA 4KVXA 1F2OA 2Y0MA 2G0BA 4NGNA 3TE4A 1KUYA 7CPAA 2Z3OA 3BXMA 4CAEA 1IGBA 2YNEA 3H8FA 1YVOA 1M44A 5AG5A 4NGRA 5A28A 2K5TA 4MY0A 5ISVA 3FMCA 4NGQA 3D68A 1HDQA 2FVGA 1NMTA 4AVAA 1CBXA 1YVKA 1IU8A 1BPMA 2JBKA 2Q0YA 1PU9A 3CXPA 1ZG8A 3FYNA 5CNPA 1S3ZA 2I79A 5THWA 2CNMA 1TF9A 4JWPA 3S6GA 2I00A 4JXQA 3WT4A 5K8NA 4UA3A 4XPKA 3S6FA 1Y9WA 3V38A 1IY7A 2AFWA 1Y0RA 2PJ0A 4M6IA 4M85A 2PDOA 1YK3A 3EXNA 3QAHA 1VHEA 4YWYA 2FT0A 2Q7SA 2O53A 4RS2A 3B8GA 4MHPA 4BD9A 5KTDA 2XEGA 2YNCA 3DSBA 3JTKA 4C2ZA 1RTQA 3IGRA 4R76A 4UIAA 3LWUA 2PJ8A 2KCWA 3TCVA 4PXDA 4KOSA 5G1ZA 3B3TA 2J8RA 1Y7RA 3D7FA 4FD5A 4P44A 1Y9KA 2R7HA 2PR8A 4NJQA 4R9MA 4UCNA 2ZOFA 4NEXA 3VARA 3S9MA 1XIXA 4C2XA 5ELYA 2Z10A 5LYLA 1CM0A 1BPNA 2VI7A 2Z0ZA 1B6BA 4B5PB 4IK2A 2Z3KA 4WJBA 3WABA 4F9UA 2CXAA 3FBUA 2Z3PA 4IUSA 1XEBA
chains in the Genus database with same CATH topology
2G3AA 1KUVA 1M4DA 4ZBGA 2ZXVA 2JEVA 1M1DA 2J8MA 4EVYA 3EO4A 3TOBA 2ZW5A 1RO5A 4KUAA 3GKRA 5A27A 3CXQA 4DNCA 3BJ8A 3FXTA 1Z4EA 1IICA 2DPSA 4U9ZA 2FIWA 3C26A 2BSWA 4FD4A 4UFXA 1YGHA 4F0YA 3SHPA 4YGOA 2EVNA 2BUEA 3IU2A 3IWEA 3BLNA 1Q2CA 2Q4YA 4A32A 4HNYB 4AVCA 4MFLA 2PQ8A 2BEIA 4MY3A 3LODA 2P6EA 4H6UA 4C2YA 2PR1A 1BO4A 4RI1A 4KOXA 2FS5A 5G20A 4L8AA 3SXNA 1I12A 3VWDA 4OADA 4GS4A 2R8VA 4I49A 1WWZA 4UFWA 1XE4A 4AB7A 2PRBA 4A31A 3NE7A 2JLMA 1QSOA 4E8OA 4UCPA 3R96A 4MBUA 4UWIA 1IIDA 3P2HA 4Q36A 4MFPA 2EUIA 1QSMA 4U5YA 5KTCA 1CJWA 2D4PA 2H5MA 1XMTA 3K9UA 3S6HA 1N71A 3FIXA 2OB0A 3IWGA 4C7HA 4M3SA 2R98A 3DR8A 4CGNA 1Z4RA 4YFJA 1S7FA 1VKCA 1MJBA 3BJ7A 3G3SA 4LX9A 4YRHA 3SXOA 1U6MA 4E2AA 4H6ZA 4HKFA 4OLLA 2QMLA 3R1KA 4Q38A 1LRZA 5EBVA 3W6XA 2WPXA 3EFAA 5F48A 4CYOA 3CXSA 1S5KA 1ON0A 4X5KA 2GANA 2YGWA 4B14A 2ARHA 2X7BA 4J3GA 4E0AA 3WR7A 2GE3A 4BMHA 3PGPA 5HH1A 3DNSA 2B4BA 5JQ4A 1K4JA 3PP9A 2OH1A 2B3UA 4NXYA 2P0WA 4QVTA 4QC6A 2AJ6A 1MK4A 3A9LA 1MJAA 3TT2A 2QECA 5G21A 3R9GA 1IB1E 3V8IA 4CAVA 2B3VA 4FD7A 2F5IA 4B5PA 3DR6A 4F0XA 4B5OA 4AG7A 2B5GB 2ZW6A 2B4DB 4MJ8A 1IYLA 4CYPA 4A33A 3FNCA 2DXQA 4KVME 2CNSA 4LUAA 2WUUA 4BBHA 5DWMA 1P4NA 3TTHA 4XNHB 3R9FA 5JPHA 2Z11A 5I0CA 3LD2A 1NSLA 4CGLA 2OZUA 2VEZA 2YNCC 4CAWA 5AG7A 3IU1A 4B12A 4MFJA 2B58A 3QB8A 2C27A 3D2PA 2ATRA 5F49A 1L0CA 4KSFA 4KOVA 2D4OA 2Q7BA 4Y49C 2FL4A 5AG4A 1ZO0A 4MFKA 5H84A 4PK3A 4CGPA 4HNWB 4FD6A 3VWEA 2Z3MA 3KKWA 1KUXA 2FXFA 4KOTA 1IYKA 3H4QA 1RXTA 3TOAA 5HMNA 1UFHA 2NMTA 4B10A 1PUAA 2CNTA 2FIAA 2JDDA 4MFZA 4ONUA 4A95A 3ZZIA 1Q2YA 1Q2DA 4QUSA 2FE7A 3I9SA 5J8FA 3H5ZA 2ZW4A 3R95A 3EY5A 3ZJ0A 3P2FA 3G8WA 3JVNA 4CRYB 1MJ9A 4XNHC 4JD6A 4HNXB 5C82A 2JDCA 1QSRA 2OU2A 2QIRA 2REEA 4U9YA 4KSAA 5C88A 1QSNA 4CGMA 2Z3LA 1M4GA 4XPDC 4JLYA 1S7LA 1R57A 4XPLA 2AE6A 4R57A 4NSQA 5F47A 1YX0A 2PC1A 2R1IA 3R9EA 4IF5A 2VBQA 5E96A 2J8NA 4PSXA 4L89A 1J4JA 2P6GA 4QBJA 5IV0A 1Z9UA 3TO7A 1M4IA 4II9A 3I3GA 1FY7A 2VZYA 4CAFA 4ORFA 4CYNA 4OAEA 5H86A 2A4NA 4Y49B 5AGEA 3F0AA 1S60A 1YR0A 2Q4VA 2OZHA 4QB9A 1WK4A 5IX3A 5J8CA 2Z3NA 3W91A 4CS0B 3MGDA 4PK2A 3D2MA 3FB3A 2FCKA 4CRZB 2VQYA 2YNDA 3FRMA 2WSAA 1I1DA 1B87A 3TFYA 1NE9A 1P0HA 1BOBA 1XF8A 2CY2A 3GY9A 4K30A 4R87A 2WPWA 2RC4A 3W6SA 3DDDA 1SQHA 1TIQA 3D3SA 3F5BA 4R3LA 2O28A 2PSWA 5BWAB 2ZW7A 4H89A 5EC4A 4UBRA 2B5GA 3S6KA 2B4DA 1OZPA 4KOYA 4XPDB 5FVJA 4JJXA 3TO9A 4B13A 4CYQA 4KUBA 4KLWA 4KOUA 2REFA 2IL4A 4AG9A 3RYOA 4MI4A 5F46A 2HUZA 4UWJA 3JUWA 4JXRA 4KOWA 4R3KA 4A2ZA 4AVBA 2HV2A 4NCZA 2G3TA 4ZGYB 3TO6A 1GHEA 5GCNA 2Q04A 5KTAA 3T9YA 3EC4A 4PSWA 4KS9A 3GYAA 4MHDA 1YREA 4B11A 5AG6A 4C7IA 1I21A 3N7ZA 5IB0A 2VZZA 3OWCA 3UY5A 2FSRA 4F6AA 1VHSA 3T90A 4CAXA 4KVOE 2BL1A 4UCMA 3E0KA 3PZJA 5DWNA 3D8PA 3F8KA 1S7NA 1KZFA 2OZGA 2GIVA 2DPTA 4NF1A 5G22A 4A30A 4MFQA 4KORA 4UFVA 2Q44A 4KZTA 2HQYA 1S7KA 1YLEA 1QSTA 4KLVA 2P6FA 4PV6A 2ZPAA 2VXKA 4CGOA 4C68A 1V0CA 4KVXA 2Y0MA 2G0BA 3TE4A 1KUYA 2Z3OA 4CAEA 2YNEA 1YVOA 1M44A 5AG5A 5A28A 2K5TA 4MY0A 5ISVA 1NMTA 4AVAA 1YVKA 2Q0YA 3CXPA 1PU9A 3FYNA 5CNPA 1S3ZA 2I79A 2CNMA 4JWPA 3S6GA 2I00A 4JXQA 4UA3A 4XPKA 3S6FA 1Y9WA 4M85A 2PDOA 1YK3A 3EXNA 3QAHA 2FT0A 4RS2A 3B8GA 5KTDA 2YNCA 3DSBA 3JTKA 4C2ZA 3IGRA 2KCWA 3TCVA 4KOSA 5G1ZA 2J8RA 1Y7RA 4FD5A 1Y9KA 2R7HA 2PR8A 4R9MA 4UCNA 4NEXA 1XIXA 4C2XA 2Z10A 1CM0A 2VI7A 2Z0ZA 1B6BA 4B5PB 2Z3KA 2CXAA 3FBUA 2Z3PA 4IUSA 1XEBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G3A A;  1KUV A;  1M4D A;  4ZBG A;  2ZXV A;  2JEV A;  1M1D A;  2J8M A;  4EVY A;  3EO4 A;  3TOB A;  2ZW5 A;  1RO5 A;  4KUA A;  3GKR A;  3CXQ A;  4DNC A;  3BJ8 A;  3FXT A;  1Z4E A;  1IIC A;  4U9Z A;  2FIW A;  3C26 A;  2BSW A;  4FD4 A;  1YGH A;  4F0Y A;  3SHP A;  4YGO A;  2EVN A;  2BUE A;  3BLN A;  1Q2C A;  2Q4Y A;  4HNY B;  4AVC A;  2PQ8 A;  2BEI A;  4MY3 A;  3LOD A;  2P6E A;  4H6U A;  2PR1 A;  1BO4 A;  4RI1 A;  4KOX A;  2FS5 A;  4L8A A;  3SXN A;  1I12 A;  3VWD A;  4OAD A;  4GS4 A;  2R8V A;  4I49 A;  1WWZ A;  1XE4 A;  4AB7 A;  2PRB A;  3NE7 A;  2JLM A;  1QSO A;  4E8O A;  3R96 A;  4MBU A;  4UWI A;  1IID A;  3P2H A;  2EUI A;  1QSM A;  4U5Y A;  5KTC A;  1CJW A;  2D4P A;  2H5M A;  1XMT A;  3K9U A;  3S6H A;  1N71 A;  3FIX A;  2OB0 A;  3IWG A;  4M3S A;  2R98 A;  3DR8 A;  1Z4R A;  4YFJ A;  1S7F A;  1VKC A;  1MJB A;  4LX9 A;  3G3S A;  3BJ7 A;  4YRH A;  3SXO A;  1U6M A;  4E2A A;  4H6Z A;  4HKF A;  4OLL A;  2QML A;  3R1K A;  1LRZ A;  5EBV A;  3W6X A;  2WPX A;  3EFA A;  5F48 A;  3CXS A;  1S5K A;  1ON0 A;  4X5K A;  2GAN A;  2ARH A;  2X7B A;  4J3G A;  4E0A A;  3WR7 A;  2GE3 A;  4BMH A;  3PGP A;  5HH1 A;  3DNS A;  2B4B A;  5JQ4 A;  1K4J A;  3PP9 A;  2OH1 A;  2B3U A;  4NXY A;  2P0W A;  4QVT A;  4QC6 A;  2AJ6 A;  1MK4 A;  1MJA A;  3TT2 A;  2QEC A;  3R9G A;  1IB1 E;  3V8I A;  4CAV A;  2B3V A;  4FD7 A;  2F5I A;  4B5P A;  3DR6 A;  4B5O A;  4AG7 A;  2B5G B;  2ZW6 A;  2B4D B;  4MJ8 A;  1IYL A;  3FNC A;  2DXQ A;  4KVM E;  2CNS A;  4LUA A;  5DWM A;  1P4N A;  3TTH A;  4XNH B;  3R9F A;  5JPH A;  2Z11 A;  5I0C A;  3LD2 A;  1NSL A;  2OZU A;  2VEZ A;  4CAW A;  2B58 A;  3QB8 A;  2C27 A;  3D2P A;  2ATR A;  5F49 A;  1L0C A;  4KOV A;  2D4O A;  2Q7B A;  4Y49 C;  2FL4 A;  5H84 A;  4PK3 A;  4HNW B;  4FD6 A;  3VWE A;  3KKW A;  1KUX A;  2FXF A;  4KOT A;  1IYK A;  3H4Q A;  1RXT A;  3TOA A;  5HMN A;  1UFH A;  2NMT A;  1PUA A;  2CNT A;  2FIA A;  2JDD A;  4ONU A;  3ZZI A;  1Q2Y A;  1Q2D A;  4QUS A;  2FE7 A;  3I9S A;  5J8F A;  2ZW4 A;  3R95 A;  3EY5 A;  3ZJ0 A;  3P2F A;  3G8W A;  3JVN A;  4CRY B;  1MJ9 A;  4XNH C;  4JD6 A;  4HNX B;  5C82 A;  2JDC A;  1QSR A;  2OU2 A;  2QIR A;  2REE A;  4U9Y A;  5C88 A;  1QSN A;  1M4G A;  4XPD C;  4JLY A;  1S7L A;  1R57 A;  4XPL A;  2AE6 A;  4R57 A;  4NSQ A;  5F47 A;  1YX0 A;  2PC1 A;  2R1I A;  3R9E A;  4IF5 A;  2VBQ A;  5E96 A;  2J8N A;  4PSX A;  4L89 A;  1J4J A;  2P6G A;  4QBJ A;  5IV0 A;  1Z9U A;  3TO7 A;  1M4I A;  4II9 A;  3I3G A;  1FY7 A;  2VZY A;  4ORF A;  4OAE A;  5H86 A;  2A4N A;  4Y49 B;  3F0A A;  1S60 A;  1YR0 A;  2Q4V A;  2OZH A;  4QB9 A;  1WK4 A;  5IX3 A;  5J8C A;  3W91 A;  4CS0 B;  3MGD A;  4PK2 A;  3D2M A;  3FB3 A;  2FCK A;  4CRZ B;  2VQY A;  3FRM A;  1I1D A;  1B87 A;  3TFY A;  1NE9 A;  1P0H A;  1BOB A;  1XF8 A;  2CY2 A;  3GY9 A;  4K30 A;  4R87 A;  2WPW A;  2RC4 A;  3W6S A;  3DDD A;  1SQH A;  1TIQ A;  3D3S A;  3F5B A;  4R3L A;  2O28 A;  2PSW A;  2ZW7 A;  4H89 A;  5EC4 A;  4UBR A;  2B5G A;  3S6K A;  2B4D A;  1OZP A;  4KOY A;  4XPD B;  5FVJ A;  4JJX A;  3TO9 A;  4KUB A;  4KLW A;  4KOU A;  2REF A;  2IL4 A;  4AG9 A;  3RYO A;  4MI4 A;  5F46 A;  2HUZ A;  4UWJ A;  3JUW A;  4JXR A;  4KOW A;  4R3K A;  4AVB A;  2HV2 A;  4NCZ A;  2G3T A;  3TO6 A;  1GHE A;  5GCN A;  2Q04 A;  5KTA A;  3T9Y A;  3EC4 A;  4PSW A;  3GYA A;  4MHD A;  1YRE A;  1I21 A;  3N7Z A;  5IB0 A;  2VZZ A;  3OWC A;  3UY5 A;  2FSR A;  4F6A A;  1VHS A;  3T90 A;  4CAX A;  4KVO E;  2BL1 A;  3E0K A;  3PZJ A;  5DWN A;  3D8P A;  3F8K A;  1S7N A;  1KZF A;  2OZG A;  2GIV A;  4NF1 A;  4KOR A;  2Q44 A;  4KZT A;  2HQY A;  1S7K A;  1YLE A;  1QST A;  4KLV A;  2P6F A;  4PV6 A;  2ZPA A;  2VXK A;  1V0C A;  4KVX A;  2Y0M A;  2G0B A;  3TE4 A;  1KUY A;  1YVO A;  1M44 A;  2K5T A;  4MY0 A;  5ISV A;  1NMT A;  4AVA A;  1YVK A;  2Q0Y A;  3CXP A;  1PU9 A;  3FYN A;  5CNP A;  1S3Z A;  2I79 A;  2CNM A;  4JWP A;  3S6G A;  2I00 A;  4JXQ A;  4UA3 A;  4XPK A;  3S6F A;  1Y9W A;  4M85 A;  2PDO A;  1YK3 A;  3EXN A;  3QAH A;  2FT0 A;  4RS2 A;  3B8G A;  5KTD A;  3DSB A;  3IGR A;  2KCW A;  3TCV A;  4KOS A;  2J8R A;  1Y7R A;  4FD5 A;  1Y9K A;  2R7H A;  2PR8 A;  4R9M A;  4NEX A;  1XIX A;  2Z10 A;  1CM0 A;  2VI7 A;  2Z0Z A;  1B6B A;  4B5P B;  3FBU A;  4IUS A;  1XEB A; 
#chains in the Genus database with same CATH topology
 4FBE A;  2ODF A;  6CPA A;  2G3A A;  2AFS A;  1KUV A;  1M4D A;  2PJ2 A;  3MN8 A;  4ZBG A;  2ZXV A;  4ZX8 A;  3PRT A;  1XFO A;  1NSA A;  1VIX A;  3RAM A;  2JEV A;  5IB9 A;  1M1D A;  2J8M A;  2DEA A;  4EVY A;  3EO4 A;  1Y0Y A;  3TOB A;  1IOI A;  4GXH A;  2ZW5 A;  1IOF A;  1RO5 A;  4NGM A;  4PXE A;  5CBM A;  4KUA A;  3FX6 A;  5HVH A;  3GKR A;  5A27 A;  2DF5 A;  2XEI A;  2PJA A;  3CXQ A;  4UEF A;  3BJ8 A;  3FXT A;  4DNC A;  1Z4E A;  1IIC A;  2DPS A;  2ZEG A;  3GB0 A;  4MHZ A;  4U9Z A;  3D4U A;  2FIW A;  3C26 A;  2BSW A;  4FD4 A;  3FEE A;  4P4D A;  4UFX A;  1YGH A;  4X2T A;  4F0Y A;  3WC7 A;  3SHP A;  3KZW A;  4YGO A;  2AFM A;  2EVN A;  4Z65 A;  4OC5 A;  5DS0 A;  2BUE A;  2ZEO A;  1XJO A;  5JH9 A;  2C6P A;  3IU2 A;  1Z8W A;  2CTC A;  3BLN A;  3IWE A;  2PCU A;  4P4E A;  2POK A;  5LRK A;  1Q2C A;  1CG2 A;  2Q4Y A;  3K2K A;  4HNY B;  4LQG A;  4A32 A;  3L2N A;  2PQ8 A;  2PJ9 A;  4MFL A;  4A37 A;  2BEI A;  4AVC A;  1JWQ A;  4MY3 A;  3FED A;  1LOK A;  3RZA A;  4B6Z A;  2PVW A;  4PPZ A;  3LOD A;  2P6E A;  4F8Z A;  4H6U A;  3FEC A;  2NYQ A;  4C2Y A;  1DTD A;  2PR1 A;  1BO4 A;  4RI1 A;  4KOX A;  2XEF A;  2ZED A;  3D7G A;  4OC4 A;  2FS5 A;  2RB7 A;  5G20 A;  4L8A A;  3SXN A;  1YW6 A;  2Q51 A;  1I12 A;  5D8N A;  3VWD A;  5LYF A;  2CTB A;  4G1P A;  4Q7A A;  4P6Y A;  4RUH A;  4OAD A;  3SI2 A;  4GS4 A;  2PIZ A;  2R8V A;  4I49 A;  1WWZ A;  3D7H A;  4UFW A;  2ZEN A;  3FVL A;  1XE4 A;  4AB7 A;  2PRB A;  1UWY A;  4A31 A;  1GYT A;  3NE7 A;  2JLM A;  1QSO A;  2AFU A;  4E8O A;  4M6H A;  5D29 A;  1AUG A;  4UCP A;  2PJ3 A;  3R96 A;  4MBU A;  4UWI A;  3FF3 A;  3WC5 A;  3H8E A;  4JZ0 A;  1IID A;  2EWB A;  2IMO A;  3P2H A;  2ZEH A;  3IEH A;  4Q36 A;  4MFP A;  4R6T A;  2EUI A;  5CPA A;  1QSM A;  2NSM A;  4U5Y A;  2PVV A;  1CJW A;  2D4P A;  2H5M A;  5KTC A;  2GU2 A;  1F2P A;  1R3N A;  1XMT A;  1TKJ A;  2AFZ A;  3K9U A;  3PBB A;  3S6H A;  4JYW A;  1N71 A;  3KR4 A;  1ZG7 A;  3FIX A;  3KI9 A;  2OB0 A;  3IWG A;  4OP4 A;  4C7H A;  3CPA A;  1YME A;  3B3V A;  4M3S A;  2R98 A;  1QMU A;  3DR8 A;  4CGN A;  1Z4R A;  2GRE A;  3SI1 A;  3SJG A;  4YFJ A;  1S7F A;  5HXD A;  1VKC A;  3CZX A;  4P4I A;  1MJB A;  3BJ7 A;  3G3S A;  4LX9 A;  2GFQ A;  4YRH A;  2ZOG A;  3SXO A;  1U6M A;  4E2A A;  4H6Z A;  1BAV A;  4HKF A;  4ZY0 A;  4OLL A;  2QML A;  2VL1 A;  3R1K A;  4Q38 A;  1R43 A;  1LRZ A;  5EBV A;  3W6X A;  2WPX A;  3EFA A;  3RO0 A;  5F48 A;  3PB9 X;  4CYO A;  3CXS A;  1S5K A;  4A94 A;  3JRU A;  3ISZ A;  4FUU A;  3TX8 A;  1ON0 A;  1ZG9 A;  1A2Z A;  4X5K A;  2GAN A;  2YGW A;  4MMO A;  2EO8 A;  2ZEM A;  2OR4 A;  2ARH A;  1Y7E A;  3V7Z A;  4B14 A;  2X7B A;  4J3G A;  4E0A A;  3WR7 A;  2F7V A;  3IIB A;  2GE3 A;  3NH8 A;  1XOV A;  4BMH A;  3PGP A;  2BCO A;  3DNS A;  5HH1 A;  2V8V A;  2B4B A;  5JQ4 A;  1K4J A;  3PP9 A;  2QJ8 A;  2OH1 A;  2B3U A;  3B2Y A;  4NXY A;  2P0W A;  4QVT A;  4QC6 A;  3WC6 A;  2AJ6 A;  1M4L A;  1MK4 A;  3CPX A;  3A9L A;  5I4M A;  1MJA A;  3TT2 A;  4DUK A;  2QEC A;  5G21 A;  3R9G A;  2PJC A;  1IB1 E;  3V8I A;  4A39 A;  4CAV A;  2B3V A;  4FD7 A;  2F5I A;  4B5P A;  3DR6 A;  2ZEL A;  4BIN A;  3RBU A;  4F0X A;  4A38 A;  4B5O A;  4AG7 A;  2B5G B;  2ZW6 A;  2B4D B;  4MJ8 A;  2RFH A;  1IYL A;  3H8G A;  4CYP A;  4A33 A;  3FNC A;  1CX8 A;  1VHO A;  2DXQ A;  4KVM E;  4P4F A;  1X10 A;  3KHZ A;  4EME A;  2CNS A;  5HVG A;  4MRI A;  4LUA A;  2Q43 A;  1HEE A;  2WUU A;  4BBH A;  4PQA A;  1HDU A;  5DWM A;  3NA6 A;  1P4N A;  3QAY A;  3TTH A;  3GLJ A;  2QVP A;  4ONW A;  1FNO A;  4XNH B;  2ABZ A;  3R9F A;  2JEW A;  3PEI A;  5JPH A;  1ARL A;  1EE3 P;  2Z11 A;  3LD2 A;  4KSI A;  4X3R A;  1NSL A;  4CGL A;  5I0C A;  5K8O A;  2OZU A;  2VEZ A;  2YNC C;  3MRU A;  4P45 A;  4CAW A;  3IC1 A;  2QYV A;  3DLJ A;  4PXC A;  1CP6 A;  3IU1 A;  5AG7 A;  4MFJ A;  2B58 A;  4B12 A;  3QB8 A;  2G9D A;  4EWT A;  2C27 A;  8CPA A;  2WZN A;  3D2P A;  3T8W A;  2ATR A;  1Z8T A;  3PFE A;  5F49 A;  1L0C A;  3B3S A;  4KSF A;  1H8L A;  4KOV A;  4OIW A;  2D4O A;  2Q7B A;  1TF8 A;  3LAC A;  1X12 A;  4Y49 C;  2FL4 A;  5AG4 A;  1ZO0 A;  1Z8L A;  4MFK A;  5H84 A;  4PK3 A;  1XBU A;  5LYD A;  5J1Q A;  1TXR A;  2ANP A;  3N5F A;  4CGP A;  4HNW B;  4FD6 A;  2EK8 A;  2V8D A;  3B35 A;  4IHM A;  2GLJ A;  2Z3M A;  3VWE A;  1KUX A;  1LAP A;  3KKW A;  2FXF A;  4KOT A;  1IYK A;  4FWU A;  4F9V A;  3H4Q A;  1RXT A;  3TOA A;  5HMN A;  1UFH A;  1XMB A;  4ZY2 A;  2NMT A;  4B10 A;  1PUA A;  2EBJ A;  1TKH A;  2CNT A;  2FIA A;  2JDD A;  3VH9 A;  4MFZ A;  4ONU A;  3B7I A;  4A95 A;  3ZZI A;  4WWV A;  4MCR A;  2OOT A;  1Q2Y A;  1Q2D A;  3KAS A;  4QUS A;  5JM6 A;  5LRJ A;  2FE7 A;  1YSJ A;  3I9S A;  5J8F A;  1ZLH A;  1CPS A;  3H5Z A;  3LMS A;  2ZW4 A;  4TNU A;  2V8H A;  3B3C A;  3R95 A;  3EY5 A;  4OKO A;  3S9L A;  1ARM A;  1CPX A;  1TKF A;  3ZJ0 A;  2WYR A;  4ZI6 A;  3P2F A;  3G8W A;  3JVN A;  3PFO A;  1AMP A;  4CRY B;  2BO9 A;  1MJ9 A;  4H2K A;  4W9Y A;  4XNH C;  2XEJ A;  4JD6 A;  4HNX B;  5C82 A;  2JDC A;  4MHY A;  4M6G A;  1PYT B;  1QSR A;  2OU2 A;  2QIR A;  2REE A;  4P10 A;  4U9Y A;  2V8G A;  3D7D A;  3KGQ A;  4KSA A;  4X8I A;  5C88 A;  1QSN A;  4CGM A;  2Z3L A;  4OID A;  1M4G A;  4XPD C;  3IFE A;  4JLY A;  5HVF A;  5LYI A;  4AXV A;  1S7L A;  2BOA A;  1R57 A;  4XPL A;  2AE6 A;  4R57 A;  5F09 A;  3HUV A;  4NSQ A;  4OME A;  5F47 A;  1YX0 A;  2PC1 A;  2R1I A;  3R9E A;  3SJF A;  4IF5 A;  1YQE A;  2VBQ A;  5E96 A;  2J8N A;  4PSX A;  2JBJ A;  4NGT A;  3IJ3 A;  4L89 A;  1LCP A;  1CP7 A;  3GUX A;  4R8F A;  1J4J A;  2P6G A;  3B3W A;  1ELL P;  3I1U A;  3KQZ A;  4R7M A;  4QBJ A;  2HC9 A;  1Z9U A;  3TO7 A;  1M4I A;  5IV0 A;  3I3G A;  4II9 A;  1FY7 A;  3FJU A;  2EK9 A;  2VZY A;  4MCS A;  2HB6 A;  4CAF A;  4ORF A;  4CYN A;  4UF4 A;  4OAE A;  5H86 A;  2A4N A;  2PJ5 A;  3NH5 A;  4Y49 B;  4ZY1 A;  2O4H A;  5AGE A;  4OC1 A;  3F0A A;  4MXU A;  1S60 A;  1YR0 A;  1LAN A;  1JQG A;  4RN7 A;  2Q4V A;  2OZH A;  4QB9 A;  4HPS A;  3PB4 X;  2AFO A;  1WK4 A;  1XRY A;  2ZEP A;  3D67 A;  5IX3 A;  4NGS A;  3ISX A;  2PIY A;  4OC3 A;  3S9N A;  5J8C A;  2Z3N A;  3BHX A;  3W91 A;  4CS0 B;  2PRQ A;  3RNZ A;  4OC0 A;  4YU9 A;  3MGD A;  4FAI A;  4GM5 A;  4K3N A;  2PJ1 A;  4PK2 A;  2PJ4 A;  3D2M A;  4EFD A;  3IWW A;  4DYO A;  3FB3 A;  1LAM A;  2FCK A;  4CRZ B;  2PJ6 A;  3BI1 A;  2VQY A;  2YND A;  3FRM A;  4UEE A;  2WSA A;  1Z8X A;  1I1D A;  1B87 A;  3K9T A;  4MCP A;  3TFY A;  1NE9 A;  1P0H A;  1BOB A;  3QNV A;  1XF8 A;  4UIB A;  4CPA A;  5JGF A;  1Z5R A;  2CY2 A;  3GY9 A;  4K30 A;  4R87 A;  2WPW A;  2RC4 A;  3W6S A;  2I3C A;  3DDD A;  1SQH A;  1TIQ A;  3D3S A;  3F5B A;  4R3L A;  2O28 A;  2PSW A;  1QQ9 A;  3DGV A;  4ZX9 A;  2ZW7 A;  2C6C A;  4H89 A;  1Q7L A;  3KL9 A;  4NFR A;  5BWA B;  3FH4 A;  1BLL E;  1YW4 A;  2B5G A;  4UBR A;  2B4D A;  3PBE A;  5EC4 A;  3S6K A;  4ZYQ A;  2CF4 A;  5K8P A;  4P4B A;  1OZP A;  4KOY A;  4XPD B;  3PB8 X;  4JJX A;  2IJZ A;  5FVJ A;  3TO9 A;  2J9A A;  4B13 A;  1YLO A;  4CYQ A;  5K8M A;  4KUB A;  4KLW A;  4KOU A;  4DJL A;  2IL4 A;  1AYE A;  2REF A;  4AG9 A;  2IQ6 A;  4NGP A;  3RYO A;  5EMI A;  1LFW A;  2PJB A;  3KQX A;  4MI4 A;  2F8H A;  1DE4 C;  3CT9 A;  5F46 A;  2HUZ A;  1VGY A;  3NFZ A;  4UWJ A;  1FT7 A;  3JUW A;  4JXR A;  4KOW A;  3SJE A;  2V77 A;  3SI0 A;  4R3K A;  4A2Z A;  4AVB A;  2Q4Z A;  4TWE A;  2HV2 A;  4NCZ A;  2G3T A;  4ZGY B;  3KHX A;  3TC8 A;  4P4J A;  4NJR A;  3TO6 A;  1PCA A;  1OBR A;  1GHE A;  5GCN A;  2Q04 A;  1KWM A;  3HLP A;  5KTA A;  3T9Y A;  2PE3 A;  3EC4 A;  4PSW A;  4KS9 A;  4MCQ A;  3GYA A;  4MHD A;  2PJ7 A;  1YRE A;  4B11 A;  3BI0 A;  4O23 A;  1I21 A;  3N7Z A;  5AG6 A;  4C7I A;  5IB0 A;  2VZZ A;  3GIU A;  3OWC A;  3UY5 A;  2FSR A;  4F6A A;  1VHS A;  3T90 A;  3CDX A;  1F57 A;  4CAX A;  2C6G A;  3D66 A;  2ZEF A;  4LQ6 A;  4OC2 A;  4KVO E;  2BL1 A;  3SJX A;  2CIJ A;  3NH4 A;  4UCM A;  3E0K A;  3PZJ A;  5DWN A;  3D8P A;  1ELM P;  3F8K A;  4MHN A;  3NE8 A;  1S7N A;  1KZF A;  2AFX A;  2OZG A;  2GIV A;  3PB6 X;  5LRG A;  2DPT A;  4NF1 A;  4UEZ A;  5G22 A;  4A30 A;  3IO1 A;  4MFQ A;  4KOR A;  4IAV A;  1ZLI A;  2Q44 A;  4PXB A;  4KZT A;  2HQY A;  4UFV A;  1S7K A;  1YLE A;  1QST A;  4KLV A;  2P6F A;  4PV6 A;  3VAT A;  2ZEE A;  2C1C A;  2ZPA A;  3KR5 A;  2VXK A;  4CGO A;  4C68 A;  2GLF A;  1V0C A;  3PB7 X;  1Z2L A;  4KVX A;  1F2O A;  2Y0M A;  2G0B A;  4NGN A;  3TE4 A;  1KUY A;  7CPA A;  2Z3O A;  3BXM A;  4CAE A;  1IGB A;  2YNE A;  3H8F A;  1YVO A;  1M44 A;  5AG5 A;  4NGR A;  5A28 A;  2K5T A;  4MY0 A;  5ISV A;  3FMC A;  4NGQ A;  3D68 A;  1HDQ A;  2FVG A;  1NMT A;  4AVA A;  1CBX A;  1YVK A;  1IU8 A;  1BPM A;  2JBK A;  2Q0Y A;  1PU9 A;  3CXP A;  1ZG8 A;  3FYN A;  5CNP A;  1S3Z A;  2I79 A;  5THW A;  2CNM A;  1TF9 A;  4JWP A;  3S6G A;  2I00 A;  4JXQ A;  3WT4 A;  5K8N A;  4UA3 A;  4XPK A;  3S6F A;  1Y9W A;  3V38 A;  1IY7 A;  2AFW A;  1Y0R A;  2PJ0 A;  4M6I A;  4M85 A;  2PDO A;  1YK3 A;  3EXN A;  3QAH A;  1VHE A;  4YWY A;  2FT0 A;  2Q7S A;  2O53 A;  4RS2 A;  3B8G A;  4MHP A;  4BD9 A;  5KTD A;  2XEG A;  2YNC A;  3DSB A;  3JTK A;  4C2Z A;  1RTQ A;  3IGR A;  4R76 A;  4UIA A;  3LWU A;  2PJ8 A;  2KCW A;  3TCV A;  4PXD A;  4KOS A;  5G1Z A;  3B3T A;  2J8R A;  1Y7R A;  3D7F A;  4FD5 A;  4P44 A;  1Y9K A;  2R7H A;  2PR8 A;  4NJQ A;  4R9M A;  4UCN A;  2ZOF A;  4NEX A;  3VAR A;  3S9M A;  1XIX A;  4C2X A;  5ELY A;  2Z10 A;  5LYL A;  1CM0 A;  1BPN A;  2VI7 A;  2Z0Z A;  1B6B A;  4B5P B;  4IK2 A;  2Z3K A;  4WJB A;  3WAB A;  4F9U A;  2CXA A;  3FBU A;  2Z3P A;  4IUS A;  1XEB A; 
#chains in the Genus database with same CATH homology
 2G3A A;  1KUV A;  1M4D A;  4ZBG A;  2ZXV A;  2JEV A;  1M1D A;  2J8M A;  4EVY A;  3EO4 A;  3TOB A;  2ZW5 A;  1RO5 A;  4KUA A;  3GKR A;  5A27 A;  3CXQ A;  4DNC A;  3BJ8 A;  3FXT A;  1Z4E A;  1IIC A;  2DPS A;  4U9Z A;  2FIW A;  3C26 A;  2BSW A;  4FD4 A;  4UFX A;  1YGH A;  4F0Y A;  3SHP A;  4YGO A;  2EVN A;  2BUE A;  3IU2 A;  3IWE A;  3BLN A;  1Q2C A;  2Q4Y A;  4A32 A;  4HNY B;  4AVC A;  4MFL A;  2PQ8 A;  2BEI A;  4MY3 A;  3LOD A;  2P6E A;  4H6U A;  4C2Y A;  2PR1 A;  1BO4 A;  4RI1 A;  4KOX A;  2FS5 A;  5G20 A;  4L8A A;  3SXN A;  1I12 A;  3VWD A;  4OAD A;  4GS4 A;  2R8V A;  4I49 A;  1WWZ A;  4UFW A;  1XE4 A;  4AB7 A;  2PRB A;  4A31 A;  3NE7 A;  2JLM A;  1QSO A;  4E8O A;  4UCP A;  3R96 A;  4MBU A;  4UWI A;  1IID A;  3P2H A;  4Q36 A;  4MFP A;  2EUI A;  1QSM A;  4U5Y A;  5KTC A;  1CJW A;  2D4P A;  2H5M A;  1XMT A;  3K9U A;  3S6H A;  1N71 A;  3FIX A;  2OB0 A;  3IWG A;  4C7H A;  4M3S A;  2R98 A;  3DR8 A;  4CGN A;  1Z4R A;  4YFJ A;  1S7F A;  1VKC A;  1MJB A;  3BJ7 A;  3G3S A;  4LX9 A;  4YRH A;  3SXO A;  1U6M A;  4E2A A;  4H6Z A;  4HKF A;  4OLL A;  2QML A;  3R1K A;  4Q38 A;  1LRZ A;  5EBV A;  3W6X A;  2WPX A;  3EFA A;  5F48 A;  4CYO A;  3CXS A;  1S5K A;  1ON0 A;  4X5K A;  2GAN A;  2YGW A;  4B14 A;  2ARH A;  2X7B A;  4J3G A;  4E0A A;  3WR7 A;  2GE3 A;  4BMH A;  3PGP A;  5HH1 A;  3DNS A;  2B4B A;  5JQ4 A;  1K4J A;  3PP9 A;  2OH1 A;  2B3U A;  4NXY A;  2P0W A;  4QVT A;  4QC6 A;  2AJ6 A;  1MK4 A;  3A9L A;  1MJA A;  3TT2 A;  2QEC A;  5G21 A;  3R9G A;  1IB1 E;  3V8I A;  4CAV A;  2B3V A;  4FD7 A;  2F5I A;  4B5P A;  3DR6 A;  4F0X A;  4B5O A;  4AG7 A;  2B5G B;  2ZW6 A;  2B4D B;  4MJ8 A;  1IYL A;  4CYP A;  4A33 A;  3FNC A;  2DXQ A;  4KVM E;  2CNS A;  4LUA A;  2WUU A;  4BBH A;  5DWM A;  1P4N A;  3TTH A;  4XNH B;  3R9F A;  5JPH A;  2Z11 A;  5I0C A;  3LD2 A;  1NSL A;  4CGL A;  2OZU A;  2VEZ A;  2YNC C;  4CAW A;  5AG7 A;  3IU1 A;  4B12 A;  4MFJ A;  2B58 A;  3QB8 A;  2C27 A;  3D2P A;  2ATR A;  5F49 A;  1L0C A;  4KSF A;  4KOV A;  2D4O A;  2Q7B A;  4Y49 C;  2FL4 A;  5AG4 A;  1ZO0 A;  4MFK A;  5H84 A;  4PK3 A;  4CGP A;  4HNW B;  4FD6 A;  3VWE A;  2Z3M A;  3KKW A;  1KUX A;  2FXF A;  4KOT A;  1IYK A;  3H4Q A;  1RXT A;  3TOA A;  5HMN A;  1UFH A;  2NMT A;  4B10 A;  1PUA A;  2CNT A;  2FIA A;  2JDD A;  4MFZ A;  4ONU A;  4A95 A;  3ZZI A;  1Q2Y A;  1Q2D A;  4QUS A;  2FE7 A;  3I9S A;  5J8F A;  3H5Z A;  2ZW4 A;  3R95 A;  3EY5 A;  3ZJ0 A;  3P2F A;  3G8W A;  3JVN A;  4CRY B;  1MJ9 A;  4XNH C;  4JD6 A;  4HNX B;  5C82 A;  2JDC A;  1QSR A;  2OU2 A;  2QIR A;  2REE A;  4U9Y A;  4KSA A;  5C88 A;  1QSN A;  4CGM A;  2Z3L A;  1M4G A;  4XPD C;  4JLY A;  1S7L A;  1R57 A;  4XPL A;  2AE6 A;  4R57 A;  4NSQ A;  5F47 A;  1YX0 A;  2PC1 A;  2R1I A;  3R9E A;  4IF5 A;  2VBQ A;  5E96 A;  2J8N A;  4PSX A;  4L89 A;  1J4J A;  2P6G A;  4QBJ A;  5IV0 A;  1Z9U A;  3TO7 A;  1M4I A;  4II9 A;  3I3G A;  1FY7 A;  2VZY A;  4CAF A;  4ORF A;  4CYN A;  4OAE A;  5H86 A;  2A4N A;  4Y49 B;  5AGE A;  3F0A A;  1S60 A;  1YR0 A;  2Q4V A;  2OZH A;  4QB9 A;  1WK4 A;  5IX3 A;  5J8C A;  2Z3N A;  3W91 A;  4CS0 B;  3MGD A;  4PK2 A;  3D2M A;  3FB3 A;  2FCK A;  4CRZ B;  2VQY A;  2YND A;  3FRM A;  2WSA A;  1I1D A;  1B87 A;  3TFY A;  1NE9 A;  1P0H A;  1BOB A;  1XF8 A;  2CY2 A;  3GY9 A;  4K30 A;  4R87 A;  2WPW A;  2RC4 A;  3W6S A;  3DDD A;  1SQH A;  1TIQ A;  3D3S A;  3F5B A;  4R3L A;  2O28 A;  2PSW A;  5BWA B;  2ZW7 A;  4H89 A;  5EC4 A;  4UBR A;  2B5G A;  3S6K A;  2B4D A;  1OZP A;  4KOY A;  4XPD B;  5FVJ A;  4JJX A;  3TO9 A;  4B13 A;  4CYQ A;  4KUB A;  4KLW A;  4KOU A;  2REF A;  2IL4 A;  4AG9 A;  3RYO A;  4MI4 A;  5F46 A;  2HUZ A;  4UWJ A;  3JUW A;  4JXR A;  4KOW A;  4R3K A;  4A2Z A;  4AVB A;  2HV2 A;  4NCZ A;  2G3T A;  4ZGY B;  3TO6 A;  1GHE A;  5GCN A;  2Q04 A;  5KTA A;  3T9Y A;  3EC4 A;  4PSW A;  4KS9 A;  3GYA A;  4MHD A;  1YRE A;  4B11 A;  5AG6 A;  4C7I A;  1I21 A;  3N7Z A;  5IB0 A;  2VZZ A;  3OWC A;  3UY5 A;  2FSR A;  4F6A A;  1VHS A;  3T90 A;  4CAX A;  4KVO E;  2BL1 A;  4UCM A;  3E0K A;  3PZJ A;  5DWN A;  3D8P A;  3F8K A;  1S7N A;  1KZF A;  2OZG A;  2GIV A;  2DPT A;  4NF1 A;  5G22 A;  4A30 A;  4MFQ A;  4KOR A;  4UFV A;  2Q44 A;  4KZT A;  2HQY A;  1S7K A;  1YLE A;  1QST A;  4KLV A;  2P6F A;  4PV6 A;  2ZPA A;  2VXK A;  4CGO A;  4C68 A;  1V0C A;  4KVX A;  2Y0M A;  2G0B A;  3TE4 A;  1KUY A;  2Z3O A;  4CAE A;  2YNE A;  1YVO A;  1M44 A;  5AG5 A;  5A28 A;  2K5T A;  4MY0 A;  5ISV A;  1NMT A;  4AVA A;  1YVK A;  2Q0Y A;  3CXP A;  1PU9 A;  3FYN A;  5CNP A;  1S3Z A;  2I79 A;  2CNM A;  4JWP A;  3S6G A;  2I00 A;  4JXQ A;  4UA3 A;  4XPK A;  3S6F A;  1Y9W A;  4M85 A;  2PDO A;  1YK3 A;  3EXN A;  3QAH A;  2FT0 A;  4RS2 A;  3B8G A;  5KTD A;  2YNC A;  3DSB A;  3JTK A;  4C2Z A;  3IGR A;  2KCW A;  3TCV A;  4KOS A;  5G1Z A;  2J8R A;  1Y7R A;  4FD5 A;  1Y9K A;  2R7H A;  2PR8 A;  4R9M A;  4UCN A;  4NEX A;  1XIX A;  4C2X A;  2Z10 A;  1CM0 A;  2VI7 A;  2Z0Z A;  1B6B A;  4B5P B;  2Z3K A;  2CXA A;  3FBU A;  2Z3P A;  4IUS A;  1XEB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...