1YK3A

Crystal structure of rv1347c from mycobacterium tuberculosis
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
198
structure length
198
Chain Sequence
ADDALVRLARERFDLPDQVRRLARPPVPSLEPPYGLRVAQLTDAEMLAEWMNRPHLAAAWEYDWPASRWRQHLNAQLEGTYSLPLIGSWHGTDGGYLELYWAAKDLISHYYDADPYDLGLHAAIADLSKVNRGFGPLLLPRIVASVFANEPRCRRIMFDPDHRNTATRRLCEWAGCKFLGEHDTTNRRMALYALEAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein Rv1347c/MT1389
publication title The crystal structure of Rv1347c, a putative antibiotic resistance protein from Mycobacterium tuberculosis, reveals a GCN5-related fold and suggests an alternative function in siderophore biosynthesis
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 58
structure length 198
sequence length 198
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2005-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13523 Acetyltransf_8 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1yk3A00
4IUSA 3B8GA 2B3UA 4XNHB 1Q2YA 4B5PB 3R96A 1I1DA 4PK3A 3VWEA 5ISVA 4FD7A 2K5TA 3EC4A 3GYAA 3IWGA 5C82A 4XPKA 4JXQA 4R3LA 2JLMA 1BO4A 3BLNA 4M3SA 3V8IA 1MK4A 1RXTA 4B5OA 4MY3A 4UWJA 2PQ8A 4RS2A 4DNCA 4AVBA 4AB7A 1QSNA 3GKRA 2REFA 4R9MA 3DDDA 3TO9A 2D4PA 4MJ8A 4U5YA 2Z11A 3G3SA 1UFHA 1S7LA 3R95A 2C27A 1QSTA 2X7BA 4KOUA 1VHSA 1KUVA 3EFAA 2G3TA 2ZW5A 4XPDC 2FT0A 3D2MA 2DXQA 5J8FA 4QUSA 3N7ZA 3D3SA 2Q7BA 4QB9A 2Q0YA 1IYLA 1NSLA 2B58A 3F5BA 1SQHA 4K30A 4KOSA 1Z9UA 2B4DB 1YVKA 1IICA 2CNTA 4E0AA 3QB8A 4PK2A 4B5PA 3ZJ0A 5F47A 3S6KA 2Q4YA 4AVAA 2B3VA 4MHDA 1GHEA 1Z4EA 3TCVA 4KVXA 2BL1A 2HV2A 2HUZA 1KUYA 4ONUA 1XEBA 3TE4A 1BOBA 2ZW7A 2EUIA 2VBQA 4KOXA 1OZPA 4NCZA 2REEA 3E0KA 4KUBA 4XPDB 2R98A 1B6BA 3FRMA 4KLWA 4GS4A 3PZJA 1K4JA 2VXKA 4JD6A 2JEVA 5EC4A 2QIRA 4KVOE 1YVOA 3S6GA 1M4DA 3QAHA 2VZZA 4BMHA 1P0HA 4MI4A 4JLYA 3TO6A 1LRZA 1WK4A 4ORFA 2OB0A 4F0YA 2OZUA 1QSMA 3K9UA 2P0WA 3PGPA 2PRBA 3RYOA 2ATRA 5H86A 1S5KA 3H4QA 4JJXA 4LX9A 2B4DA 5FVJA 3FXTA 2I79A 2QECA 2J8MA 1MJAA 2R1IA 2WPWA 1Y9KA 1PU9A 4Y49B 3G8WA 4KOTA 1KZFA 4QBJA 2Y0MA 2CNMA 2GE3A 3D8PA 2B4BA 3P2FA 3LD2A 3VWDA 1ON0A 1XIXA 3IGRA 2AJ6A 2ZPAA 4H6UA 1WWZA 4KUAA 3TFYA 4CAVA 1I12A 3F0AA 4F6AA 4H89A 2JDCA 2A4NA 1S60A 1IYKA 4KOYA 5F48A 2PDOA 3FIXA 4KLVA 1IB1E 4R57A 2AE6A 4NXYA 5KTCA 2PR1A 4ZBGA 2CNSA 1V0CA 3JVNA 3CXSA 5E96A 4L8AA 5GCNA 2OZHA 4OAEA 1N71A 4KOVA 4HKFA 2Q04A 1M1DA 3MGDA 1I21A 5KTDA 4MY0A 5JPHA 5KTAA 2PR8A 2Q44A 2OZGA 4KZTA 5IV0A 3DR6A 3KKWA 1Y9WA 3EO4A 1Y7RA 3W6SA 5CNPA 4FD6A 3SXNA 1L0CA 3F8KA 3DNSA 3ZZIA 5C88A 4CAWA 2R7HA 2FIAA 4XPLA 1IIDA 1VKCA 2O28A 2P6GA 4HNWB 2FL4A 4NF1A 4UWIA 2G3AA 3JUWA 4YFJA 2VI7A 1PUAA 2NMTA 2VQYA 4RI1A 2D4OA 3UY5A 2BUEA 4U9YA 1YGHA 1J4JA 2HQYA 4CRZB 1YK3A 2GIVA 5HH1A 4JWPA 4UBRA 2Q4VA 1XMTA 2J8RA 4UA3A 3R9GA 1MJBA 3FNCA 2R8VA 4FD5A 4J3GA 3TTHA 2Z10A 4CS0B 2OU2A 1Q2CA 1B87A 1MJ9A 3CXQA 4QC6A 1U6MA 4PSWA 3W6XA 3BJ8A 4AVCA 3FBUA 4X5KA 1S3ZA 5F49A 4LUAA 4AG9A 2FSRA 2F5IA 1R57A 2G0BA 2JDDA 4R87A 1CJWA 2QMLA 4QVTA 1NMTA 2B5GB 4AG7A 2ARHA 2BSWA 3DSBA 2WPXA 3I3GA 1YX0A 5EBVA 2I00A 2FCKA 3T9YA 2P6EA 5IX3A 1NE9A 1YREA 1S7FA 1KUXA 1XF8A 3LODA 3SHPA 1YR0A 3CXPA 4OLLA 2KCWA 2VEZA 3DR8A 2FXFA 3FYNA 4NSQA 1M44A 4IF5A 3EXNA 4CAXA 4U9ZA 3OWCA 2CY2A 4HNYB 3R9FA 4M85A 4OADA 2GANA 1TIQA 2FIWA 2RC4A 1YLEA 5J8CA 3TOBA 5F46A 4H6ZA 3D2PA 3C26A 2FE7A 1XE4A 3FB3A 2H5MA 2J8NA 3T90A 2ZXVA 4CRYB 2OH1A 5DWMA 4XNHC 3P2HA 1M4GA 1CM0A 4E2AA 5DWNA 5JQ4A 2FS5A 4KOWA 2BEIA 4PV6A 4JXRA 4KORA 1QSOA 4E8OA 2Z0ZA 3BJ7A 3I9SA 2PC1A 3SXOA 4HNXB 4MBUA 2ZW4A 4Y49C 5HMNA 1Q2DA 4PSXA 1QSRA 2B5GA 4L89A 1S7NA 3PP9A 4R3KA 3R9EA 1M4IA 1P4NA 5H84A 2EVNA 2ZW6A 4FD4A 4YRHA 1Z4RA 3GY9A 2PSWA 3WR7A 1RO5A 4KVME 4I49A 5I0CA 3NE7A 3TT2A 3W91A 1S7KA 3EY5A 4EVYA 4II9A 5IB0A 1FY7A 2P6FA 3S6HA 4YGOA 2VZYA 3TOAA 2IL4A 4NEXA 3TO7A 3R1KA 3S6FA
chains in the Genus database with same CATH superfamily
2F7VA 4MFJA 4OP4A 4IUSA 3B8GA 4MHNA 2NSMA 3CPAA 2B3UA 4XNHB 1Q2YA 4B5PB 3D67A 3R96A 3MN8A 1I1DA 4PK3A 1Z8WA 3VWEA 1ZO0A 4NGRA 3LACA 5ISVA 3PB9X 4MFPA 4FD7A 2K5TA 3ISZA 3EC4A 3GYAA 1XJOA 4WWVA 3NH8A 3IWGA 5C82A 4XPKA 4JXQA 4R3LA 2JLMA 1BO4A 3BLNA 4M3SA 3V8IA 1MK4A 2V8DA 4A2ZA 5JGFA 3DGVA 1RXTA 4B5OA 5LRJA 1QQ9A 4MY3A 1TXRA 4OMEA 4UIBA 4UWJA 3SI0A 2PQ8A 5AG6A 1TKFA 3PRTA 4RS2A 2PIZA 4AVBA 4DNCA 4AB7A 2ABZA 2GFQA 1QSNA 3GKRA 2REFA 4R9MA 3BXMA 3DDDA 3MRUA 3CZXA 3D7FA 1KWMA 1FNOA 2XEIA 2ZENA 3VARA 3TO9A 3SJGA 2D4PA 3PFEA 4MJ8A 3IU2A 2EK8A 4U5YA 5F09A 3L2NA 2Z11A 1X12A 3G3SA 3NFZA 1UFHA 2RB7A 1S7LA 3R95A 4EWTA 2C27A 3S9NA 1QSTA 2X7BA 1AYEA 1VHSA 4KOUA 1KUVA 4WJBA 4FBEA 4F9UA 1Z2LA 5LYLA 3EFAA 2G3TA 1BLLE 3DLJA 4MHZA 4R76A 2G9DA 2ZW5A 4XPDC 4OC5A 2FT0A 2PJ8A 2DXQA 3D2MA 4OKOA 4A94A 5J8FA 4QUSA 2DEAA 3N7ZA 5CPAA 3TC8A 1ZLIA 4RN7A 3D3SA 1EE3P 4M6HA 2Q7BA 1AUGA 3NE8A 4QB9A 5A28A 1Q7LA 1ZG8A 2C6PA 1CP7A 2Q0YA 3KQXA 1IYLA 2PJ3A 5CBMA 1NSLA 2B58A 1YSJA 4W9YA 4M6IA 1BPMA 4Z65A 3H8GA 3F5BA 1RTQA 1LFWA 1SQHA 4K30A 4MHPA 4KOSA 4OIDA 4PXBA 1Z9UA 2B4DB 4UEFA 1YVKA 5K8PA 4PXDA 1IICA 2F8HA 2CNTA 2BOAA 4MFQA 4E0AA 3QB8A 2QYVA 1BAVA 2ODFA 4MMOA 5G20A 4A33A 4HPSA 4PK2A 4P4DA 3SI1A 3TOAA 5LRKA 2IJZA 4B5PA 3ZJ0A 1ZG9A 5F47A 3KZWA 2EO8A 3S6KA 2Q4YA 1LAMA 1VGYA 3WC6A 4OC2A 4AVAA 2B3VA 4F9VA 4OC1A 4MHDA 1IGBA 2GLJA 2PJ7A 3D7DA 2ZEEA 1GHEA 4IAVA 2AFXA 1Z4EA 3B35A 2CXAA 3B3VA 3N5FA 4NGNA 4NGSA 4KVXA 4UCNA 3TCVA 2BL1A 1ELMP 2HV2A 2HUZA 5ELYA 4JZ0A 3V38A 1KUYA 1TF8A 3KI9A 4R6TA 1TF9A 4ONUA 4TNUA 4BINA 5AG4A 2WYRA 1XEBA 5G22A 3TE4A 4UIAA 4P45A 2CTBA 3VH9A 2NYQA 1BOBA 4FAIA 5JH9A 2ZW7A 2EUIA 2Z3PA 4PXCA 2VBQA 4MHYA 1XOVA 5I4MA 2FVGA 5HXDA 4KOXA 1OZPA 4NCZA 1R43A 2REEA 3E0KA 4CAFA 4KUBA 4XPDB 2R98A 4CGNA 4CYPA 1B6BA 2WZNA 2C1CA 3FRMA 3K9TA 4GS4A 3PZJA 1K4JA 3PEIA 4KLWA 2VXKA 2PVWA 2JEVA 4JD6A 5EC4A 1QMUA 4B12A 2AFWA 4NGTA 4B13A 4YU9A 2QIRA 2PJ6A 3PBBA 4KVOE 1LCPA 1YVOA 3PB7X 3S6GA 2PJ4A 2IMOA 5HVHA 1M4DA 3QAHA 2VZZA 4OC3A 4BMHA 2BO9A 1F2PA 1P0HA 4A30A 3B3WA 3FJUA 4MI4A 4A95A 4JLYA 2O4HA 3FX6A 3TO6A 2PJBA 1LRZA 1WK4A 1PCAA 4ORFA 2OB0A 4F0YA 2OZUA 4UFVA 2Z3MA 1M4LA 1CPSA 3RAMA 1QSMA 3K9UA 2P0WA 2ZEGA 3PGPA 4P4FA 3HLPA 2IQ6A 2PRBA 3RYOA 4PPZA 2YNCA 2PJ9A 2JBKA 2ATRA 3PB6X 5H86A 3IC1A 1S5KA 3KQZA 4A38A 3H4QA 4JJXA 4LX9A 4ZY2A 2B4DA 5FVJA 3FXTA 2WSAA 2I79A 3HUVA 2CTCA 2QECA 3GB0A 2J8MA 4UCMA 4C7IA 1MJAA 4ZX8A 3TX8A 4R7MA 1JWQA 2R1IA 5HVFA 2WPWA 2ZOFA 4F0XA 2YGWA 1Y9KA 1PU9A 4Y49B 1ARMA 2RFHA 3G8WA 4KOTA 5AG5A 2AFUA 1KZFA 4TWEA 3SI2A 2Y0MA 2CNMA 4QBJA 4UCPA 2GE3A 4EMEA 2OR4A 3D8PA 1XFOA 3IWEA 4CYNA 2B4BA 3P2FA 3RO0A 2ZEHA 1AMPA 3LD2A 3VWDA 2Q51A 3CPXA 5AG7A 1ON0A 3WT4A 1XIXA 1ZG7A 3IGRA 1DE4C 2AJ6A 2ZPAA 4H6UA 1WWZA 4KUAA 1A2ZA 4CGMA 4MFKA 2POKA 1Z5RA 1I12A 4CAVA 3D4UA 3TFYA 2Q43A 2HC9A 3F0AA 2PVVA 4F6AA 4MFZA 3PB4X 4H89A 4CGLA 2JDCA 4GXHA 2A4NA 1S60A 1IYKA 4KOYA 5LYIA 4R8FA 4RUHA 5F48A 3KHZA 2Z3OA 4P4JA 2PDOA 3S9MA 3FIXA 3FH4A 1IB1E 1Z8LA 4KLVA 4R57A 4B11A 2AE6A 4NXYA 5KTCA 2EBJA 2PR1A 4ZBGA 2CNSA 1V0CA 3JVNA 4A31A 4P10A 3CXSA 5E96A 3FVLA 2PJ0A 3KASA 2ZOGA 4L8AA 2PCUA 3LWUA 5GCNA 3NH4A 2I3CA 4KSFA 4BBHA 2OZHA 5K8NA 4OC0A 1X10A 4OAEA 4ZX9A 1N71A 4ONWA 1XBUA 4C7HA 4KOVA 2ZEMA 3IIBA 4KSAA 4HKFA 4UFWA 2Q04A 1M1DA 4MXUA 4MCPA 3MGDA 3H8EA 2QJ8A 2ZELA 1I21A 5KTDA 1IOFA 1XMBA 4MY0A 4CYOA 5JPHA 4LQGA 5KTAA 2PR8A 3BI0A 2Q44A 2OZGA 3T8WA 5HVGA 4KZTA 5DS0A 5IV0A 3DR6A 1JQGA 3KKWA 1Y9WA 3EO4A 2PJCA 1GYTA 1Y7RA 3D66A 2CF4A 2AFZA 5CNPA 4FD6A 3SXNA 3W6SA 2DF5A 4EFDA 1L0CA 3SJXA 3F8KA 3DNSA 3ZZIA 5C88A 3IO1A 3JTKA 2R7HA 2FIAA 4CAWA 3GIUA 2EWBA 4CAEA 2Q4ZA 5EMIA 4JYWA 4XPLA 2OOTA 1IIDA 1VKCA 2O28A 2P6GA 2V8HA 4HNWB 1CG2A 2FL4A 1IU8A 4NF1A 3D68A 4LQ6A 1CPXA 4OIWA 4BD9A 2XEFA 4Q36A 4CPAA 4UWIA 2G3AA 1YQEA 2AFSA 4DYOA 3JUWA 4YFJA 2VI7A 2ZEOA 2GLFA 1PUAA 2NMTA 2VQYA 4X8IA 1FT7A 2YNEA 2V8VA 4RI1A 4C2XA 2D4OA 3IFEA 3UY5A 2BUEA 4PXEA 4U9YA 1YGHA 4OC4A 1J4JA 4IHMA 6CPAA 2HQYA 4CRZB 4NGQA 1YK3A 4KSIA 1Y0RA 4NJQA 2DPSA 2GIVA 5HH1A 3H5ZA 4JWPA 4YWYA 4G1PA 5AGEA 5IB9A 7CPAA 4MCQA 3K2KA 3VATA 4UBRA 2PIYA 1XMTA 2J8RA 2Q4VA 4B6ZA 4UA3A 4MCSA 2DPTA 2YNDA 2GU2A 1LOKA 1MJBA 3R9GA 1OBRA 2PRQA 4MCRA 3KR4A 4IK2A 3IEHA 3FECA 3FNCA 2AFOA 2R8VA 3IWWA 2HB6A 4FD5A 4J3GA 3TTHA 4ZYQA 5BWAB 3PFOA 2Z10A 4CS0B 2CIJA 3FMCA 2OU2A 1Q2CA 1B87A 1MJ9A 1Y7EA 2PJ2A 3CXQA 4QC6A 3RBUA 1Y0YA 3WABA 2YNCC 3FEEA 5LRGA 1U6MA 4PSWA 1R3NA 5G21A 3W6XA 3BJ8A 1HEEA 4AVCA 2C6GA 1VHEA 3FBUA 1HDQA 3QNVA 4X5KA 4UF4A 1S3ZA 1YW4A 4FWUA 4LUAA 2PJ5A 3NA6A 5D8NA 5F49A 2JEWA 4AG9A 3GUXA 2FSRA 2F5IA 1R57A 2G0BA 2JDDA 4R87A 4ZI6A 1CJWA 1XRYA 1YMEA 2QMLA 3LMSA 2QVPA 4NGMA 1YLOA 1F2OA 4QVTA 1F57A 1NMTA 2B5GB 2JBJA 4AG7A 2ARHA 2BSWA 3B3TA 2WPXA 3DSBA 3SJFA 3I3GA 1YX0A 3BHXA 1LAPA 5EBVA 3KHXA 4P4EA 5G1ZA 2I00A 4C2ZA 1CX8A 4B10A 1CP6A 2FCKA 4GM5A 2ANPA 1Z8XA 3FEDA 3CDXA 1Z8TA 1ARLA 4UEZA 3T9YA 2P6EA 3B3CA 2ZEDA 4ZY0A 5IX3A 1NE9A 1YREA 1S7FA 4MFLA 4K3NA 1KUXA 4A37A 2Z3KA 5J1QA 1XF8A 3LODA 3SHPA 1VIXA 1YR0A 5JM6A 2BCOA 1NSAA 3CXPA 4OLLA 2KCWA 2VEZA 1IOIA 4FUUA 3DR8A 2FXFA 3FYNA 4NSQA 4A39A 3KGQA 1UWYA 1M44A 4IF5A 3EXNA 4CAXA 3D7HA 4U9ZA 4CYQA 3OWCA 1CBXA 4P6YA 2CY2A 3FF3A 4HNYB 1ZLHA 3R9FA 3WC5A 4M85A 4OADA 2GANA 1TIQA 2FIWA 2RC4A 2XEJA 4Q38A 4F8ZA 1YLEA 2VL1A 3TOBA 3B2YA 4KS9A 2V77A 4H6ZA 5F46A 5J8CA 3D2PA 3C26A 2FE7A 2PE3A 1XE4A 5K8OA 3IU1A 3FB3A 1LANA 2H5MA 4NFRA 2J8NA 1IY7A 3T90A 2PJAA 2ZXVA 2Z3NA 2OH1A 4NJRA 5DWMA 4A32A 4P44A 4CRYB 5LYFA 3S9LA 4XNHC 3P2HA 5LYDA 1ELLP 4AXVA 2V8GA 1M4GA 1CM0A 3KL9A 5DWNA 4E2AA 3WC7A 4C68A 2WUUA 5JQ4A 4DUKA 2FS5A 3SJEA 4KOWA 2BEIA 2C6CA 4PV6A 4B14A 4DJLA 5K8MA 1YW6A 1HDUA 3KR5A 4M6GA 4JXRA 1VHOA 1QSOA 2GREA 4KORA 2EK9A 4O23A 4E8OA 4UFXA 2Z0ZA 4X3RA 3BJ7A 3I9SA 4CGPA 2PC1A 4NGPA 3SXOA 4C2YA 8CPAA 4HNXB 4MBUA 2O53A 2ZW4A 3QAYA 4Y49C 5HMNA 1TKJA 1Q2DA 4PSXA 4ZGYB 1DTDA 1QSRA 2B5GA 1S7NA 4L89A 3ISXA 4CGOA 3PP9A 4H2KA 1H8LA 3RNZA 1TKHA 4R3KA 3R9EA 4MRIA 1M4IA 1P4NA 4PQAA 4P4IA 5H84A 2PJ1A 2EVNA 2ZW6A 4FD4A 5THWA 4YRHA 3GLJA 1Z4RA 3GY9A 3V7ZA 2XEGA 2ZEPA 5A27A 2Q7SA 3CT9A 2Z3LA 2ZEFA 1BPNA 2PSWA 3WR7A 2J9AA 1RO5A 4KVME 3BI1A 4I49A 1PYTB 3RZAA 5I0CA 3NE7A 4P4BA 3TT2A 3W91A 1S7KA 3EY5A 4EVYA 3B7IA 4II9A 5IB0A 4Q7AA 1FY7A 2P6FA 3H8FA 3S6HA 4YGOA 3A9LA 2VZYA 3JRUA 3NH5A 3PBEA 2IL4A 3B3SA 3PB8X 3I1UA 4NEXA 4UEEA 4X2TA 5D29A 3TO7A 4ZY1A 3IJ3A 3R1KA 3D7GA 2AFMA 3S6FA
chains in the Genus database with same CATH topology
4MFJA 4IUSA 3B8GA 2B3UA 4XNHB 1Q2YA 4B5PB 3R96A 1I1DA 4PK3A 3VWEA 1ZO0A 5ISVA 4MFPA 4FD7A 2K5TA 3EC4A 3GYAA 3IWGA 5C82A 4XPKA 4JXQA 4R3LA 2JLMA 1BO4A 3BLNA 4M3SA 3V8IA 1MK4A 4A2ZA 1RXTA 4B5OA 4MY3A 4UWJA 2PQ8A 5AG6A 4RS2A 4DNCA 4AVBA 4AB7A 1QSNA 3GKRA 2REFA 4R9MA 3DDDA 3TO9A 2D4PA 4MJ8A 4U5YA 3IU2A 2Z11A 3G3SA 1UFHA 1S7LA 3R95A 2C27A 1QSTA 2X7BA 4KOUA 1VHSA 1KUVA 3EFAA 2G3TA 2ZW5A 4XPDC 2FT0A 3D2MA 2DXQA 5J8FA 4QUSA 3N7ZA 3D3SA 2Q7BA 4QB9A 5A28A 2Q0YA 1IYLA 1NSLA 2B58A 3F5BA 1SQHA 4K30A 4KOSA 1Z9UA 2B4DB 1YVKA 1IICA 2CNTA 4MFQA 4E0AA 3QB8A 4A33A 5G20A 4PK2A 4B5PA 3ZJ0A 5F47A 3S6KA 2Q4YA 4AVAA 2B3VA 4MHDA 1GHEA 1Z4EA 4UCNA 2CXAA 3TCVA 4KVXA 2BL1A 2HV2A 2HUZA 1KUYA 4ONUA 5AG4A 1XEBA 5G22A 3TE4A 1BOBA 2ZW7A 2EUIA 2Z3PA 2VBQA 4KOXA 1OZPA 4NCZA 2REEA 3E0KA 4CAFA 4KUBA 4XPDB 2R98A 4CGNA 4CYPA 1B6BA 3FRMA 4KLWA 4GS4A 3PZJA 1K4JA 2VXKA 4JD6A 2JEVA 4B12A 5EC4A 4B13A 2QIRA 4KVOE 1YVOA 3S6GA 1M4DA 3QAHA 2VZZA 4BMHA 1P0HA 4A30A 4MI4A 4A95A 4JLYA 3TO6A 1LRZA 1WK4A 4ORFA 2OB0A 4F0YA 2OZUA 4UFVA 2Z3MA 1QSMA 3K9UA 2P0WA 3PGPA 2PRBA 3RYOA 2YNCA 2ATRA 5H86A 1S5KA 3H4QA 4JJXA 4LX9A 2B4DA 5FVJA 3FXTA 2WSAA 2I79A 2QECA 2J8MA 4UCMA 4C7IA 1MJAA 2R1IA 2WPWA 4F0XA 2YGWA 1Y9KA 1PU9A 4Y49B 3G8WA 4KOTA 5AG5A 1KZFA 4QBJA 2Y0MA 2CNMA 4UCPA 2GE3A 3D8PA 3IWEA 4CYNA 2B4BA 3P2FA 3LD2A 3VWDA 5AG7A 1ON0A 1XIXA 3IGRA 2AJ6A 2ZPAA 4H6UA 1WWZA 4KUAA 4CGMA 4MFKA 3TFYA 4CAVA 1I12A 3F0AA 4F6AA 4MFZA 4H89A 4CGLA 2JDCA 2A4NA 1S60A 1IYKA 4KOYA 5F48A 2PDOA 3FIXA 4KLVA 1IB1E 4R57A 4B11A 2AE6A 4NXYA 5KTCA 2PR1A 4ZBGA 2CNSA 1V0CA 3JVNA 4A31A 3CXSA 5E96A 4L8AA 5GCNA 4KSFA 4BBHA 2OZHA 4OAEA 1N71A 4C7HA 4KOVA 4KSAA 4HKFA 4UFWA 2Q04A 1M1DA 3MGDA 1I21A 5KTDA 4MY0A 4CYOA 5JPHA 5KTAA 2PR8A 2Q44A 2OZGA 4KZTA 5IV0A 3DR6A 3KKWA 1Y9WA 3EO4A 1Y7RA 3W6SA 5CNPA 4FD6A 3SXNA 1L0CA 3F8KA 3DNSA 3ZZIA 5C88A 3JTKA 2R7HA 2FIAA 4CAWA 4CAEA 4XPLA 1IIDA 1VKCA 2O28A 2P6GA 4HNWB 2FL4A 4NF1A 4Q36A 4UWIA 2G3AA 3JUWA 4YFJA 2VI7A 1PUAA 2NMTA 2VQYA 2YNEA 4RI1A 4C2XA 2D4OA 3UY5A 2BUEA 4U9YA 1YGHA 1J4JA 2HQYA 4CRZB 1YK3A 2DPSA 2GIVA 5HH1A 3H5ZA 4JWPA 5AGEA 4UBRA 2Q4VA 1XMTA 2J8RA 4UA3A 2DPTA 2YNDA 3R9GA 1MJBA 3FNCA 2R8VA 4FD5A 5BWAB 4J3GA 3TTHA 2Z10A 4CS0B 2OU2A 1Q2CA 1B87A 1MJ9A 3CXQA 4QC6A 2YNCC 1U6MA 4PSWA 5G21A 3W6XA 3BJ8A 4AVCA 3FBUA 4X5KA 1S3ZA 5F49A 4LUAA 4AG9A 2FSRA 2F5IA 1R57A 2G0BA 2JDDA 4R87A 1CJWA 2QMLA 4QVTA 1NMTA 2B5GB 4AG7A 2ARHA 2BSWA 3DSBA 2WPXA 3I3GA 1YX0A 4C2ZA 5G1ZA 5EBVA 2I00A 4B10A 2FCKA 3T9YA 2P6EA 5IX3A 1NE9A 1YREA 1S7FA 4MFLA 1KUXA 2Z3KA 1XF8A 3LODA 3SHPA 1YR0A 3CXPA 4OLLA 2KCWA 2VEZA 3DR8A 2FXFA 3FYNA 4NSQA 1M44A 4IF5A 3EXNA 4CAXA 4U9ZA 4CYQA 3OWCA 2CY2A 4HNYB 3R9FA 4M85A 4OADA 2GANA 1TIQA 2FIWA 2RC4A 4Q38A 1YLEA 5J8CA 3TOBA 4KS9A 5F46A 4H6ZA 3D2PA 3C26A 2FE7A 1XE4A 3IU1A 3FB3A 2H5MA 2J8NA 3T90A 2ZXVA 2Z3NA 2OH1A 5DWMA 4A32A 4CRYB 4XNHC 3P2HA 1M4GA 1CM0A 4E2AA 5DWNA 4C68A 2WUUA 5JQ4A 2FS5A 4KOWA 2BEIA 4PV6A 4B14A 4JXRA 4KORA 1QSOA 4E8OA 4UFXA 2Z0ZA 3BJ7A 3I9SA 4CGPA 2PC1A 3SXOA 4C2YA 4HNXB 4MBUA 2ZW4A 4Y49C 5HMNA 1Q2DA 4PSXA 4ZGYB 1QSRA 2B5GA 4L89A 1S7NA 4CGOA 3PP9A 4R3KA 3R9EA 1M4IA 1P4NA 5H84A 2EVNA 2ZW6A 4FD4A 4YRHA 1Z4RA 3GY9A 5A27A 2Z3LA 2PSWA 3WR7A 1RO5A 4KVME 4I49A 5I0CA 3NE7A 3TT2A 3W91A 1S7KA 3EY5A 4EVYA 4II9A 5IB0A 1FY7A 2P6FA 3S6HA 4YGOA 3A9LA 2VZYA 3TOAA 2IL4A 4NEXA 3TO7A 3R1KA 2Z3OA 3S6FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IUS A;  3B8G A;  2B3U A;  4XNH B;  1Q2Y A;  4B5P B;  3R96 A;  1I1D A;  4PK3 A;  3VWE A;  5ISV A;  4FD7 A;  2K5T A;  3EC4 A;  3GYA A;  3IWG A;  5C82 A;  4XPK A;  4JXQ A;  4R3L A;  2JLM A;  1BO4 A;  3BLN A;  4M3S A;  3V8I A;  1MK4 A;  1RXT A;  4B5O A;  4MY3 A;  4UWJ A;  2PQ8 A;  4RS2 A;  4DNC A;  4AVB A;  4AB7 A;  1QSN A;  3GKR A;  2REF A;  4R9M A;  3DDD A;  3TO9 A;  2D4P A;  4MJ8 A;  4U5Y A;  2Z11 A;  3G3S A;  1UFH A;  1S7L A;  3R95 A;  2C27 A;  1QST A;  2X7B A;  4KOU A;  1VHS A;  1KUV A;  3EFA A;  2G3T A;  2ZW5 A;  4XPD C;  2FT0 A;  3D2M A;  2DXQ A;  5J8F A;  4QUS A;  3N7Z A;  3D3S A;  2Q7B A;  4QB9 A;  2Q0Y A;  1IYL A;  1NSL A;  2B58 A;  3F5B A;  1SQH A;  4K30 A;  4KOS A;  1Z9U A;  2B4D B;  1YVK A;  1IIC A;  2CNT A;  4E0A A;  3QB8 A;  4PK2 A;  4B5P A;  3ZJ0 A;  5F47 A;  3S6K A;  2Q4Y A;  4AVA A;  2B3V A;  4MHD A;  1GHE A;  1Z4E A;  3TCV A;  4KVX A;  2BL1 A;  2HV2 A;  2HUZ A;  1KUY A;  4ONU A;  1XEB A;  3TE4 A;  1BOB A;  2ZW7 A;  2EUI A;  2VBQ A;  4KOX A;  1OZP A;  4NCZ A;  2REE A;  3E0K A;  4KUB A;  4XPD B;  2R98 A;  1B6B A;  3FRM A;  4KLW A;  4GS4 A;  3PZJ A;  1K4J A;  2VXK A;  4JD6 A;  2JEV A;  5EC4 A;  2QIR A;  4KVO E;  1YVO A;  3S6G A;  1M4D A;  3QAH A;  2VZZ A;  4BMH A;  1P0H A;  4MI4 A;  4JLY A;  3TO6 A;  1LRZ A;  1WK4 A;  4ORF A;  2OB0 A;  4F0Y A;  2OZU A;  1QSM A;  3K9U A;  2P0W A;  3PGP A;  2PRB A;  3RYO A;  2ATR A;  5H86 A;  1S5K A;  3H4Q A;  4JJX A;  4LX9 A;  2B4D A;  5FVJ A;  3FXT A;  2I79 A;  2QEC A;  2J8M A;  1MJA A;  2R1I A;  2WPW A;  1Y9K A;  1PU9 A;  4Y49 B;  3G8W A;  4KOT A;  1KZF A;  4QBJ A;  2Y0M A;  2CNM A;  2GE3 A;  3D8P A;  2B4B A;  3P2F A;  3LD2 A;  3VWD A;  1ON0 A;  1XIX A;  3IGR A;  2AJ6 A;  2ZPA A;  4H6U A;  1WWZ A;  4KUA A;  3TFY A;  4CAV A;  1I12 A;  3F0A A;  4F6A A;  4H89 A;  2JDC A;  2A4N A;  1S60 A;  1IYK A;  4KOY A;  5F48 A;  2PDO A;  3FIX A;  4KLV A;  1IB1 E;  4R57 A;  2AE6 A;  4NXY A;  5KTC A;  2PR1 A;  4ZBG A;  2CNS A;  1V0C A;  3JVN A;  3CXS A;  5E96 A;  4L8A A;  5GCN A;  2OZH A;  4OAE A;  1N71 A;  4KOV A;  4HKF A;  2Q04 A;  1M1D A;  3MGD A;  1I21 A;  5KTD A;  4MY0 A;  5JPH A;  5KTA A;  2PR8 A;  2Q44 A;  2OZG A;  4KZT A;  5IV0 A;  3DR6 A;  3KKW A;  1Y9W A;  3EO4 A;  1Y7R A;  3W6S A;  5CNP A;  4FD6 A;  3SXN A;  1L0C A;  3F8K A;  3DNS A;  3ZZI A;  5C88 A;  4CAW A;  2R7H A;  2FIA A;  4XPL A;  1IID A;  1VKC A;  2O28 A;  2P6G A;  4HNW B;  2FL4 A;  4NF1 A;  4UWI A;  2G3A A;  3JUW A;  4YFJ A;  2VI7 A;  1PUA A;  2NMT A;  2VQY A;  4RI1 A;  2D4O A;  3UY5 A;  2BUE A;  4U9Y A;  1YGH A;  1J4J A;  2HQY A;  4CRZ B;  1YK3 A;  2GIV A;  5HH1 A;  4JWP A;  4UBR A;  2Q4V A;  1XMT A;  2J8R A;  4UA3 A;  3R9G A;  1MJB A;  3FNC A;  2R8V A;  4FD5 A;  4J3G A;  3TTH A;  2Z10 A;  4CS0 B;  2OU2 A;  1Q2C A;  1B87 A;  1MJ9 A;  3CXQ A;  4QC6 A;  1U6M A;  4PSW A;  3W6X A;  3BJ8 A;  4AVC A;  3FBU A;  4X5K A;  1S3Z A;  5F49 A;  4LUA A;  4AG9 A;  2FSR A;  2F5I A;  1R57 A;  2G0B A;  2JDD A;  4R87 A;  1CJW A;  2QML A;  4QVT A;  1NMT A;  2B5G B;  4AG7 A;  2ARH A;  2BSW A;  3DSB A;  2WPX A;  3I3G A;  1YX0 A;  5EBV A;  2I00 A;  2FCK A;  3T9Y A;  2P6E A;  5IX3 A;  1NE9 A;  1YRE A;  1S7F A;  1KUX A;  1XF8 A;  3LOD A;  3SHP A;  1YR0 A;  3CXP A;  4OLL A;  2KCW A;  2VEZ A;  3DR8 A;  2FXF A;  3FYN A;  4NSQ A;  1M44 A;  4IF5 A;  3EXN A;  4CAX A;  4U9Z A;  3OWC A;  2CY2 A;  4HNY B;  3R9F A;  4M85 A;  4OAD A;  2GAN A;  1TIQ A;  2FIW A;  2RC4 A;  1YLE A;  5J8C A;  3TOB A;  5F46 A;  4H6Z A;  3D2P A;  3C26 A;  2FE7 A;  1XE4 A;  3FB3 A;  2H5M A;  2J8N A;  3T90 A;  2ZXV A;  4CRY B;  2OH1 A;  5DWM A;  4XNH C;  3P2H A;  1M4G A;  1CM0 A;  4E2A A;  5DWN A;  5JQ4 A;  2FS5 A;  4KOW A;  2BEI A;  4PV6 A;  4JXR A;  4KOR A;  1QSO A;  4E8O A;  2Z0Z A;  3BJ7 A;  3I9S A;  2PC1 A;  3SXO A;  4HNX B;  4MBU A;  2ZW4 A;  4Y49 C;  5HMN A;  1Q2D A;  4PSX A;  1QSR A;  2B5G A;  4L89 A;  1S7N A;  3PP9 A;  4R3K A;  3R9E A;  1M4I A;  1P4N A;  5H84 A;  2EVN A;  2ZW6 A;  4FD4 A;  4YRH A;  1Z4R A;  3GY9 A;  2PSW A;  3WR7 A;  1RO5 A;  4KVM E;  4I49 A;  5I0C A;  3NE7 A;  3TT2 A;  3W91 A;  1S7K A;  3EY5 A;  4EVY A;  4II9 A;  5IB0 A;  1FY7 A;  2P6F A;  3S6H A;  4YGO A;  2VZY A;  3TOA A;  2IL4 A;  4NEX A;  3TO7 A;  3R1K A;  3S6F A; 
#chains in the Genus database with same CATH topology
 2F7V A;  4MFJ A;  4OP4 A;  4IUS A;  3B8G A;  4MHN A;  2NSM A;  3CPA A;  2B3U A;  4XNH B;  1Q2Y A;  4B5P B;  3D67 A;  3R96 A;  3MN8 A;  1I1D A;  4PK3 A;  1Z8W A;  3VWE A;  1ZO0 A;  4NGR A;  3LAC A;  5ISV A;  3PB9 X;  4MFP A;  4FD7 A;  2K5T A;  3ISZ A;  3EC4 A;  3GYA A;  1XJO A;  4WWV A;  3NH8 A;  3IWG A;  5C82 A;  4XPK A;  4JXQ A;  4R3L A;  2JLM A;  1BO4 A;  3BLN A;  4M3S A;  3V8I A;  1MK4 A;  2V8D A;  4A2Z A;  5JGF A;  3DGV A;  1RXT A;  4B5O A;  5LRJ A;  1QQ9 A;  4MY3 A;  1TXR A;  4OME A;  4UIB A;  4UWJ A;  3SI0 A;  2PQ8 A;  5AG6 A;  1TKF A;  3PRT A;  4RS2 A;  2PIZ A;  4AVB A;  4DNC A;  4AB7 A;  2ABZ A;  2GFQ A;  1QSN A;  3GKR A;  2REF A;  4R9M A;  3BXM A;  3DDD A;  3MRU A;  3CZX A;  3D7F A;  1KWM A;  1FNO A;  2XEI A;  2ZEN A;  3VAR A;  3TO9 A;  3SJG A;  2D4P A;  3PFE A;  4MJ8 A;  3IU2 A;  2EK8 A;  4U5Y A;  5F09 A;  3L2N A;  2Z11 A;  1X12 A;  3G3S A;  3NFZ A;  1UFH A;  2RB7 A;  1S7L A;  3R95 A;  4EWT A;  2C27 A;  3S9N A;  1QST A;  2X7B A;  1AYE A;  1VHS A;  4KOU A;  1KUV A;  4WJB A;  4FBE A;  4F9U A;  1Z2L A;  5LYL A;  3EFA A;  2G3T A;  1BLL E;  3DLJ A;  4MHZ A;  4R76 A;  2G9D A;  2ZW5 A;  4XPD C;  4OC5 A;  2FT0 A;  2PJ8 A;  2DXQ A;  3D2M A;  4OKO A;  4A94 A;  5J8F A;  4QUS A;  2DEA A;  3N7Z A;  5CPA A;  3TC8 A;  1ZLI A;  4RN7 A;  3D3S A;  1EE3 P;  4M6H A;  2Q7B A;  1AUG A;  3NE8 A;  4QB9 A;  5A28 A;  1Q7L A;  1ZG8 A;  2C6P A;  1CP7 A;  2Q0Y A;  3KQX A;  1IYL A;  2PJ3 A;  5CBM A;  1NSL A;  2B58 A;  1YSJ A;  4W9Y A;  4M6I A;  1BPM A;  4Z65 A;  3H8G A;  3F5B A;  1RTQ A;  1LFW A;  1SQH A;  4K30 A;  4MHP A;  4KOS A;  4OID A;  4PXB A;  1Z9U A;  2B4D B;  4UEF A;  1YVK A;  5K8P A;  4PXD A;  1IIC A;  2F8H A;  2CNT A;  2BOA A;  4MFQ A;  4E0A A;  3QB8 A;  2QYV A;  1BAV A;  2ODF A;  4MMO A;  5G20 A;  4A33 A;  4HPS A;  4PK2 A;  4P4D A;  3SI1 A;  3TOA A;  5LRK A;  2IJZ A;  4B5P A;  3ZJ0 A;  1ZG9 A;  5F47 A;  3KZW A;  2EO8 A;  3S6K A;  2Q4Y A;  1LAM A;  1VGY A;  3WC6 A;  4OC2 A;  4AVA A;  2B3V A;  4F9V A;  4OC1 A;  4MHD A;  1IGB A;  2GLJ A;  2PJ7 A;  3D7D A;  2ZEE A;  1GHE A;  4IAV A;  2AFX A;  1Z4E A;  3B35 A;  2CXA A;  3B3V A;  3N5F A;  4NGN A;  4NGS A;  4KVX A;  4UCN A;  3TCV A;  2BL1 A;  1ELM P;  2HV2 A;  2HUZ A;  5ELY A;  4JZ0 A;  3V38 A;  1KUY A;  1TF8 A;  3KI9 A;  4R6T A;  1TF9 A;  4ONU A;  4TNU A;  4BIN A;  5AG4 A;  2WYR A;  1XEB A;  5G22 A;  3TE4 A;  4UIA A;  4P45 A;  2CTB A;  3VH9 A;  2NYQ A;  1BOB A;  4FAI A;  5JH9 A;  2ZW7 A;  2EUI A;  2Z3P A;  4PXC A;  2VBQ A;  4MHY A;  1XOV A;  5I4M A;  2FVG A;  5HXD A;  4KOX A;  1OZP A;  4NCZ A;  1R43 A;  2REE A;  3E0K A;  4CAF A;  4KUB A;  4XPD B;  2R98 A;  4CGN A;  4CYP A;  1B6B A;  2WZN A;  2C1C A;  3FRM A;  3K9T A;  4GS4 A;  3PZJ A;  1K4J A;  3PEI A;  4KLW A;  2VXK A;  2PVW A;  2JEV A;  4JD6 A;  5EC4 A;  1QMU A;  4B12 A;  2AFW A;  4NGT A;  4B13 A;  4YU9 A;  2QIR A;  2PJ6 A;  3PBB A;  4KVO E;  1LCP A;  1YVO A;  3PB7 X;  3S6G A;  2PJ4 A;  2IMO A;  5HVH A;  1M4D A;  3QAH A;  2VZZ A;  4OC3 A;  4BMH A;  2BO9 A;  1F2P A;  1P0H A;  4A30 A;  3B3W A;  3FJU A;  4MI4 A;  4A95 A;  4JLY A;  2O4H A;  3FX6 A;  3TO6 A;  2PJB A;  1LRZ A;  1WK4 A;  1PCA A;  4ORF A;  2OB0 A;  4F0Y A;  2OZU A;  4UFV A;  2Z3M A;  1M4L A;  1CPS A;  3RAM A;  1QSM A;  3K9U A;  2P0W A;  2ZEG A;  3PGP A;  4P4F A;  3HLP A;  2IQ6 A;  2PRB A;  3RYO A;  4PPZ A;  2YNC A;  2PJ9 A;  2JBK A;  2ATR A;  3PB6 X;  5H86 A;  3IC1 A;  1S5K A;  3KQZ A;  4A38 A;  3H4Q A;  4JJX A;  4LX9 A;  4ZY2 A;  2B4D A;  5FVJ A;  3FXT A;  2WSA A;  2I79 A;  3HUV A;  2CTC A;  2QEC A;  3GB0 A;  2J8M A;  4UCM A;  4C7I A;  1MJA A;  4ZX8 A;  3TX8 A;  4R7M A;  1JWQ A;  2R1I A;  5HVF A;  2WPW A;  2ZOF A;  4F0X A;  2YGW A;  1Y9K A;  1PU9 A;  4Y49 B;  1ARM A;  2RFH A;  3G8W A;  4KOT A;  5AG5 A;  2AFU A;  1KZF A;  4TWE A;  3SI2 A;  2Y0M A;  2CNM A;  4QBJ A;  4UCP A;  2GE3 A;  4EME A;  2OR4 A;  3D8P A;  1XFO A;  3IWE A;  4CYN A;  2B4B A;  3P2F A;  3RO0 A;  2ZEH A;  1AMP A;  3LD2 A;  3VWD A;  2Q51 A;  3CPX A;  5AG7 A;  1ON0 A;  3WT4 A;  1XIX A;  1ZG7 A;  3IGR A;  1DE4 C;  2AJ6 A;  2ZPA A;  4H6U A;  1WWZ A;  4KUA A;  1A2Z A;  4CGM A;  4MFK A;  2POK A;  1Z5R A;  1I12 A;  4CAV A;  3D4U A;  3TFY A;  2Q43 A;  2HC9 A;  3F0A A;  2PVV A;  4F6A A;  4MFZ A;  3PB4 X;  4H89 A;  4CGL A;  2JDC A;  4GXH A;  2A4N A;  1S60 A;  1IYK A;  4KOY A;  5LYI A;  4R8F A;  4RUH A;  5F48 A;  3KHZ A;  2Z3O A;  4P4J A;  2PDO A;  3S9M A;  3FIX A;  3FH4 A;  1IB1 E;  1Z8L A;  4KLV A;  4R57 A;  4B11 A;  2AE6 A;  4NXY A;  5KTC A;  2EBJ A;  2PR1 A;  4ZBG A;  2CNS A;  1V0C A;  3JVN A;  4A31 A;  4P10 A;  3CXS A;  5E96 A;  3FVL A;  2PJ0 A;  3KAS A;  2ZOG A;  4L8A A;  2PCU A;  3LWU A;  5GCN A;  3NH4 A;  2I3C A;  4KSF A;  4BBH A;  2OZH A;  5K8N A;  4OC0 A;  1X10 A;  4OAE A;  4ZX9 A;  1N71 A;  4ONW A;  1XBU A;  4C7H A;  4KOV A;  2ZEM A;  3IIB A;  4KSA A;  4HKF A;  4UFW A;  2Q04 A;  1M1D A;  4MXU A;  4MCP A;  3MGD A;  3H8E A;  2QJ8 A;  2ZEL A;  1I21 A;  5KTD A;  1IOF A;  1XMB A;  4MY0 A;  4CYO A;  5JPH A;  4LQG A;  5KTA A;  2PR8 A;  3BI0 A;  2Q44 A;  2OZG A;  3T8W A;  5HVG A;  4KZT A;  5DS0 A;  5IV0 A;  3DR6 A;  1JQG A;  3KKW A;  1Y9W A;  3EO4 A;  2PJC A;  1GYT A;  1Y7R A;  3D66 A;  2CF4 A;  2AFZ A;  5CNP A;  4FD6 A;  3SXN A;  3W6S A;  2DF5 A;  4EFD A;  1L0C A;  3SJX A;  3F8K A;  3DNS A;  3ZZI A;  5C88 A;  3IO1 A;  3JTK A;  2R7H A;  2FIA A;  4CAW A;  3GIU A;  2EWB A;  4CAE A;  2Q4Z A;  5EMI A;  4JYW A;  4XPL A;  2OOT A;  1IID A;  1VKC A;  2O28 A;  2P6G A;  2V8H A;  4HNW B;  1CG2 A;  2FL4 A;  1IU8 A;  4NF1 A;  3D68 A;  4LQ6 A;  1CPX A;  4OIW A;  4BD9 A;  2XEF A;  4Q36 A;  4CPA A;  4UWI A;  2G3A A;  1YQE A;  2AFS A;  4DYO A;  3JUW A;  4YFJ A;  2VI7 A;  2ZEO A;  2GLF A;  1PUA A;  2NMT A;  2VQY A;  4X8I A;  1FT7 A;  2YNE A;  2V8V A;  4RI1 A;  4C2X A;  2D4O A;  3IFE A;  3UY5 A;  2BUE A;  4PXE A;  4U9Y A;  1YGH A;  4OC4 A;  1J4J A;  4IHM A;  6CPA A;  2HQY A;  4CRZ B;  4NGQ A;  1YK3 A;  4KSI A;  1Y0R A;  4NJQ A;  2DPS A;  2GIV A;  5HH1 A;  3H5Z A;  4JWP A;  4YWY A;  4G1P A;  5AGE A;  5IB9 A;  7CPA A;  4MCQ A;  3K2K A;  3VAT A;  4UBR A;  2PIY A;  1XMT A;  2J8R A;  2Q4V A;  4B6Z A;  4UA3 A;  4MCS A;  2DPT A;  2YND A;  2GU2 A;  1LOK A;  1MJB A;  3R9G A;  1OBR A;  2PRQ A;  4MCR A;  3KR4 A;  4IK2 A;  3IEH A;  3FEC A;  3FNC A;  2AFO A;  2R8V A;  3IWW A;  2HB6 A;  4FD5 A;  4J3G A;  3TTH A;  4ZYQ A;  5BWA B;  3PFO A;  2Z10 A;  4CS0 B;  2CIJ A;  3FMC A;  2OU2 A;  1Q2C A;  1B87 A;  1MJ9 A;  1Y7E A;  2PJ2 A;  3CXQ A;  4QC6 A;  3RBU A;  1Y0Y A;  3WAB A;  2YNC C;  3FEE A;  5LRG A;  1U6M A;  4PSW A;  1R3N A;  5G21 A;  3W6X A;  3BJ8 A;  1HEE A;  4AVC A;  2C6G A;  1VHE A;  3FBU A;  1HDQ A;  3QNV A;  4X5K A;  4UF4 A;  1S3Z A;  1YW4 A;  4FWU A;  4LUA A;  2PJ5 A;  3NA6 A;  5D8N A;  5F49 A;  2JEW A;  4AG9 A;  3GUX A;  2FSR A;  2F5I A;  1R57 A;  2G0B A;  2JDD A;  4R87 A;  4ZI6 A;  1CJW A;  1XRY A;  1YME A;  2QML A;  3LMS A;  2QVP A;  4NGM A;  1YLO A;  1F2O A;  4QVT A;  1F57 A;  1NMT A;  2B5G B;  2JBJ A;  4AG7 A;  2ARH A;  2BSW A;  3B3T A;  2WPX A;  3DSB A;  3SJF A;  3I3G A;  1YX0 A;  3BHX A;  1LAP A;  5EBV A;  3KHX A;  4P4E A;  5G1Z A;  2I00 A;  4C2Z A;  1CX8 A;  4B10 A;  1CP6 A;  2FCK A;  4GM5 A;  2ANP A;  1Z8X A;  3FED A;  3CDX A;  1Z8T A;  1ARL A;  4UEZ A;  3T9Y A;  2P6E A;  3B3C A;  2ZED A;  4ZY0 A;  5IX3 A;  1NE9 A;  1YRE A;  1S7F A;  4MFL A;  4K3N A;  1KUX A;  4A37 A;  2Z3K A;  5J1Q A;  1XF8 A;  3LOD A;  3SHP A;  1VIX A;  1YR0 A;  5JM6 A;  2BCO A;  1NSA A;  3CXP A;  4OLL A;  2KCW A;  2VEZ A;  1IOI A;  4FUU A;  3DR8 A;  2FXF A;  3FYN A;  4NSQ A;  4A39 A;  3KGQ A;  1UWY A;  1M44 A;  4IF5 A;  3EXN A;  4CAX A;  3D7H A;  4U9Z A;  4CYQ A;  3OWC A;  1CBX A;  4P6Y A;  2CY2 A;  3FF3 A;  4HNY B;  1ZLH A;  3R9F A;  3WC5 A;  4M85 A;  4OAD A;  2GAN A;  1TIQ A;  2FIW A;  2RC4 A;  2XEJ A;  4Q38 A;  4F8Z A;  1YLE A;  2VL1 A;  3TOB A;  3B2Y A;  4KS9 A;  2V77 A;  4H6Z A;  5F46 A;  5J8C A;  3D2P A;  3C26 A;  2FE7 A;  2PE3 A;  1XE4 A;  5K8O A;  3IU1 A;  3FB3 A;  1LAN A;  2H5M A;  4NFR A;  2J8N A;  1IY7 A;  3T90 A;  2PJA A;  2ZXV A;  2Z3N A;  2OH1 A;  4NJR A;  5DWM A;  4A32 A;  4P44 A;  4CRY B;  5LYF A;  3S9L A;  4XNH C;  3P2H A;  5LYD A;  1ELL P;  4AXV A;  2V8G A;  1M4G A;  1CM0 A;  3KL9 A;  5DWN A;  4E2A A;  3WC7 A;  4C68 A;  2WUU A;  5JQ4 A;  4DUK A;  2FS5 A;  3SJE A;  4KOW A;  2BEI A;  2C6C A;  4PV6 A;  4B14 A;  4DJL A;  5K8M A;  1YW6 A;  1HDU A;  3KR5 A;  4M6G A;  4JXR A;  1VHO A;  1QSO A;  2GRE A;  4KOR A;  2EK9 A;  4O23 A;  4E8O A;  4UFX A;  2Z0Z A;  4X3R A;  3BJ7 A;  3I9S A;  4CGP A;  2PC1 A;  4NGP A;  3SXO A;  4C2Y A;  8CPA A;  4HNX B;  4MBU A;  2O53 A;  2ZW4 A;  3QAY A;  4Y49 C;  5HMN A;  1TKJ A;  1Q2D A;  4PSX A;  4ZGY B;  1DTD A;  1QSR A;  2B5G A;  1S7N A;  4L89 A;  3ISX A;  4CGO A;  3PP9 A;  4H2K A;  1H8L A;  3RNZ A;  1TKH A;  4R3K A;  3R9E A;  4MRI A;  1M4I A;  1P4N A;  4PQA A;  4P4I A;  5H84 A;  2PJ1 A;  2EVN A;  2ZW6 A;  4FD4 A;  5THW A;  4YRH A;  3GLJ A;  1Z4R A;  3GY9 A;  3V7Z A;  2XEG A;  2ZEP A;  5A27 A;  2Q7S A;  3CT9 A;  2Z3L A;  2ZEF A;  1BPN A;  2PSW A;  3WR7 A;  2J9A A;  1RO5 A;  4KVM E;  3BI1 A;  4I49 A;  1PYT B;  3RZA A;  5I0C A;  3NE7 A;  4P4B A;  3TT2 A;  3W91 A;  1S7K A;  3EY5 A;  4EVY A;  3B7I A;  4II9 A;  5IB0 A;  4Q7A A;  1FY7 A;  2P6F A;  3H8F A;  3S6H A;  4YGO A;  3A9L A;  2VZY A;  3JRU A;  3NH5 A;  3PBE A;  2IL4 A;  3B3S A;  3PB8 X;  3I1U A;  4NEX A;  4UEE A;  4X2T A;  5D29 A;  3TO7 A;  4ZY1 A;  3IJ3 A;  3R1K A;  3D7G A;  2AFM A;  3S6F A; 
#chains in the Genus database with same CATH homology
 4MFJ A;  4IUS A;  3B8G A;  2B3U A;  4XNH B;  1Q2Y A;  4B5P B;  3R96 A;  1I1D A;  4PK3 A;  3VWE A;  1ZO0 A;  5ISV A;  4MFP A;  4FD7 A;  2K5T A;  3EC4 A;  3GYA A;  3IWG A;  5C82 A;  4XPK A;  4JXQ A;  4R3L A;  2JLM A;  1BO4 A;  3BLN A;  4M3S A;  3V8I A;  1MK4 A;  4A2Z A;  1RXT A;  4B5O A;  4MY3 A;  4UWJ A;  2PQ8 A;  5AG6 A;  4RS2 A;  4DNC A;  4AVB A;  4AB7 A;  1QSN A;  3GKR A;  2REF A;  4R9M A;  3DDD A;  3TO9 A;  2D4P A;  4MJ8 A;  4U5Y A;  3IU2 A;  2Z11 A;  3G3S A;  1UFH A;  1S7L A;  3R95 A;  2C27 A;  1QST A;  2X7B A;  4KOU A;  1VHS A;  1KUV A;  3EFA A;  2G3T A;  2ZW5 A;  4XPD C;  2FT0 A;  3D2M A;  2DXQ A;  5J8F A;  4QUS A;  3N7Z A;  3D3S A;  2Q7B A;  4QB9 A;  5A28 A;  2Q0Y A;  1IYL A;  1NSL A;  2B58 A;  3F5B A;  1SQH A;  4K30 A;  4KOS A;  1Z9U A;  2B4D B;  1YVK A;  1IIC A;  2CNT A;  4MFQ A;  4E0A A;  3QB8 A;  4A33 A;  5G20 A;  4PK2 A;  4B5P A;  3ZJ0 A;  5F47 A;  3S6K A;  2Q4Y A;  4AVA A;  2B3V A;  4MHD A;  1GHE A;  1Z4E A;  4UCN A;  2CXA A;  3TCV A;  4KVX A;  2BL1 A;  2HV2 A;  2HUZ A;  1KUY A;  4ONU A;  5AG4 A;  1XEB A;  5G22 A;  3TE4 A;  1BOB A;  2ZW7 A;  2EUI A;  2Z3P A;  2VBQ A;  4KOX A;  1OZP A;  4NCZ A;  2REE A;  3E0K A;  4CAF A;  4KUB A;  4XPD B;  2R98 A;  4CGN A;  4CYP A;  1B6B A;  3FRM A;  4KLW A;  4GS4 A;  3PZJ A;  1K4J A;  2VXK A;  4JD6 A;  2JEV A;  4B12 A;  5EC4 A;  4B13 A;  2QIR A;  4KVO E;  1YVO A;  3S6G A;  1M4D A;  3QAH A;  2VZZ A;  4BMH A;  1P0H A;  4A30 A;  4MI4 A;  4A95 A;  4JLY A;  3TO6 A;  1LRZ A;  1WK4 A;  4ORF A;  2OB0 A;  4F0Y A;  2OZU A;  4UFV A;  2Z3M A;  1QSM A;  3K9U A;  2P0W A;  3PGP A;  2PRB A;  3RYO A;  2YNC A;  2ATR A;  5H86 A;  1S5K A;  3H4Q A;  4JJX A;  4LX9 A;  2B4D A;  5FVJ A;  3FXT A;  2WSA A;  2I79 A;  2QEC A;  2J8M A;  4UCM A;  4C7I A;  1MJA A;  2R1I A;  2WPW A;  4F0X A;  2YGW A;  1Y9K A;  1PU9 A;  4Y49 B;  3G8W A;  4KOT A;  5AG5 A;  1KZF A;  4QBJ A;  2Y0M A;  2CNM A;  4UCP A;  2GE3 A;  3D8P A;  3IWE A;  4CYN A;  2B4B A;  3P2F A;  3LD2 A;  3VWD A;  5AG7 A;  1ON0 A;  1XIX A;  3IGR A;  2AJ6 A;  2ZPA A;  4H6U A;  1WWZ A;  4KUA A;  4CGM A;  4MFK A;  3TFY A;  4CAV A;  1I12 A;  3F0A A;  4F6A A;  4MFZ A;  4H89 A;  4CGL A;  2JDC A;  2A4N A;  1S60 A;  1IYK A;  4KOY A;  5F48 A;  2PDO A;  3FIX A;  4KLV A;  1IB1 E;  4R57 A;  4B11 A;  2AE6 A;  4NXY A;  5KTC A;  2PR1 A;  4ZBG A;  2CNS A;  1V0C A;  3JVN A;  4A31 A;  3CXS A;  5E96 A;  4L8A A;  5GCN A;  4KSF A;  4BBH A;  2OZH A;  4OAE A;  1N71 A;  4C7H A;  4KOV A;  4KSA A;  4HKF A;  4UFW A;  2Q04 A;  1M1D A;  3MGD A;  1I21 A;  5KTD A;  4MY0 A;  4CYO A;  5JPH A;  5KTA A;  2PR8 A;  2Q44 A;  2OZG A;  4KZT A;  5IV0 A;  3DR6 A;  3KKW A;  1Y9W A;  3EO4 A;  1Y7R A;  3W6S A;  5CNP A;  4FD6 A;  3SXN A;  1L0C A;  3F8K A;  3DNS A;  3ZZI A;  5C88 A;  3JTK A;  2R7H A;  2FIA A;  4CAW A;  4CAE A;  4XPL A;  1IID A;  1VKC A;  2O28 A;  2P6G A;  4HNW B;  2FL4 A;  4NF1 A;  4Q36 A;  4UWI A;  2G3A A;  3JUW A;  4YFJ A;  2VI7 A;  1PUA A;  2NMT A;  2VQY A;  2YNE A;  4RI1 A;  4C2X A;  2D4O A;  3UY5 A;  2BUE A;  4U9Y A;  1YGH A;  1J4J A;  2HQY A;  4CRZ B;  1YK3 A;  2DPS A;  2GIV A;  5HH1 A;  3H5Z A;  4JWP A;  5AGE A;  4UBR A;  2Q4V A;  1XMT A;  2J8R A;  4UA3 A;  2DPT A;  2YND A;  3R9G A;  1MJB A;  3FNC A;  2R8V A;  4FD5 A;  5BWA B;  4J3G A;  3TTH A;  2Z10 A;  4CS0 B;  2OU2 A;  1Q2C A;  1B87 A;  1MJ9 A;  3CXQ A;  4QC6 A;  2YNC C;  1U6M A;  4PSW A;  5G21 A;  3W6X A;  3BJ8 A;  4AVC A;  3FBU A;  4X5K A;  1S3Z A;  5F49 A;  4LUA A;  4AG9 A;  2FSR A;  2F5I A;  1R57 A;  2G0B A;  2JDD A;  4R87 A;  1CJW A;  2QML A;  4QVT A;  1NMT A;  2B5G B;  4AG7 A;  2ARH A;  2BSW A;  3DSB A;  2WPX A;  3I3G A;  1YX0 A;  4C2Z A;  5G1Z A;  5EBV A;  2I00 A;  4B10 A;  2FCK A;  3T9Y A;  2P6E A;  5IX3 A;  1NE9 A;  1YRE A;  1S7F A;  4MFL A;  1KUX A;  2Z3K A;  1XF8 A;  3LOD A;  3SHP A;  1YR0 A;  3CXP A;  4OLL A;  2KCW A;  2VEZ A;  3DR8 A;  2FXF A;  3FYN A;  4NSQ A;  1M44 A;  4IF5 A;  3EXN A;  4CAX A;  4U9Z A;  4CYQ A;  3OWC A;  2CY2 A;  4HNY B;  3R9F A;  4M85 A;  4OAD A;  2GAN A;  1TIQ A;  2FIW A;  2RC4 A;  4Q38 A;  1YLE A;  5J8C A;  3TOB A;  4KS9 A;  5F46 A;  4H6Z A;  3D2P A;  3C26 A;  2FE7 A;  1XE4 A;  3IU1 A;  3FB3 A;  2H5M A;  2J8N A;  3T90 A;  2ZXV A;  2Z3N A;  2OH1 A;  5DWM A;  4A32 A;  4CRY B;  4XNH C;  3P2H A;  1M4G A;  1CM0 A;  4E2A A;  5DWN A;  4C68 A;  2WUU A;  5JQ4 A;  2FS5 A;  4KOW A;  2BEI A;  4PV6 A;  4B14 A;  4JXR A;  4KOR A;  1QSO A;  4E8O A;  4UFX A;  2Z0Z A;  3BJ7 A;  3I9S A;  4CGP A;  2PC1 A;  3SXO A;  4C2Y A;  4HNX B;  4MBU A;  2ZW4 A;  4Y49 C;  5HMN A;  1Q2D A;  4PSX A;  4ZGY B;  1QSR A;  2B5G A;  4L89 A;  1S7N A;  4CGO A;  3PP9 A;  4R3K A;  3R9E A;  1M4I A;  1P4N A;  5H84 A;  2EVN A;  2ZW6 A;  4FD4 A;  4YRH A;  1Z4R A;  3GY9 A;  5A27 A;  2Z3L A;  2PSW A;  3WR7 A;  1RO5 A;  4KVM E;  4I49 A;  5I0C A;  3NE7 A;  3TT2 A;  3W91 A;  1S7K A;  3EY5 A;  4EVY A;  4II9 A;  5IB0 A;  1FY7 A;  2P6F A;  3S6H A;  4YGO A;  3A9L A;  2VZY A;  3TOA A;  2IL4 A;  4NEX A;  3TO7 A;  3R1K A;  2Z3O A;  3S6F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...