1YL6A

Crystal structure of mycobacterium tuberculosis dihydrodipicolinate reductase (rv2773c) (crystal form b)
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
245
structure length
245
Chain Sequence
ARVGVLGAKGKVGATMVRAVAAADDLTLSAELDAGDPLSLLTDGNTEVVIDFTHPDVVMGNLEFLIDNGIHAVVGTTGFTAERFQQVESWLVAKPNTSVLIAPNFAIGAVLSMHFAKQAARFFDSAEVIELHHPHKADAPSGTAARTAKLIAEARKGLPPNPDATSTSLPGARGADVDGIPVHAVRLAGLVAHQEVLFGTEGETLTIRHDSLDRTSFVPGVLLAVRRIAERPGLTVGLEPLLDLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of dihydrodipicolinate reductase (DapB) from Mycobacterium tuberculosis in three crystal forms.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
molecule keywords Dihydrodipicolinate reductase
total genus 72
structure length 245
sequence length 245
chains with identical sequence B
ec nomenclature ec 1.17.1.8: 4-hydroxy-tetrahydrodipicolinate reductase.
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05173 DapB_C Dihydrodipicolinate reductase, C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1yl6A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1yl6A01
2X23A 4K26A 4RZHA 4D79A 4FGWA 3DONA 3HDJA 2UDPA 4JN6B 3UFXA 3OA2A 2PGLA 3E9NA 4DLLA 3PTZA 2ILTA 4O5OA 2EP5A 1HLPA 3W4KA 2DLDA 1U3VA 2X5JO 1C1XB 1E1KA 1NFRA 4IZHA 5I8ZA 2V65A 4UVDA 4E5KA 4EJMA 5T8KC 2VHZA 1Z6ZA 4E5PA 3NDJA 5JYFA 1QG6A 4D3SA 3WQQA 2BMAA 4IXTA 1FDTA 1A4UA 1MG0A 1NBOA 1T26A 1ZSNA 1KVSA 4OYRA 4YBZA 5DBGA 4BNWA 2ZTLA 4QFDA 4BO2A 5J9GA 1ZSVA 1IHYA 1YQGA 3ZV6A 2ZYGA 4KQWA 3RIHA 1J5PA 1R0SA 4XQEA 4MVJG 2OOSA 1LEHA 3ZU3A 5B4UA 3M1AA 1NP3A 3CIFA 3JYOA 5COBA 4FQ8A 1R4NA 8ADHA 1LDGA 3AM5A 1X13A 3WJAA 1LRKA 3EUWA 3OH8A 1JVBA 1EDOA 2PTGA 5THQA 4RZIA 3C3XA 1DIAA 3HN7A 4Q3DA 4W82A 3RWBA 4R51A 1RJWA 2Q46A 1J49A 1OMOA 1Y6JA 5F3RA 2GO1A 3ZNNA 4EITA 3OJ0A 4MKXA 4XQGA 3U4HA 1HLDA 2PY6A 3I83A 4PZDA 1I10A 4GWKA 3U62A 1WLYA 4PLYA 2GZ1A 4Q3NA 1A7AA 1ISIA 4OHUA 1GQ2A 3ASUA 2C7GA 2BFAA 1WWKA 1XQ6A 1ISMA 1I3NA 4GL4A 4CMGA 4UEKA 4YR9A 4FD3A 5A9SA 5IZ4A 5H81A 5B4TA 4NU5A 1JTVA 4UVIA 3W8FA 3FBGA 3PEFA 5COAA 1JWAB 4J90A 1EQ2A 4E12A 5C7OO 1A4IA 4YJGB 3TL2A 2Y0DA 3MTGA 2YDYA 4D42A 1HE2A 4OAQA 2NVWA 1UDBA 5AXBA 1HDYA 3FTPA 1LSSA 4UUPA 2J3JA 3KOUA 4FCCA 3GFBA 3PPIA 5JAMA 4WK6A 4WLUA 5EJ2A 1WDMA 4A0SA 2FZEA 4Q3AA 4MP8A 1VSUA 4GLLA 2NU7A 2DPGA 4FFPA 4IJVA 5L4NA 3AY3A 4KWIA 3WQRA 1BXGB 4PLWA 1U28A 2C0CA 4J6FA 1E7SA 3KM0A 4QO7A 3S1LA 2IE0A 2Y99A 5AVOA 1GQYA 3UF0A 5KCZA 4BO3A 4UVGA 3RC1A 1FDWA 2V6BA 4CM4A 3MWDB 3ZWVA 5JFOA 2IYOA 3IS3A 3DAFA 4B3IA 1CYDA 4E21A 3NTRA 1KC3A 2I65A 2Q4EA 1AHHA 4ONEA 2UUPA 1ZH8A 1XIVA 4KDEA 3BHMA 1K3TA 1PU2A 3A1NA 3D7LA 2ZK7A 3H2ZA 4NIMA 4KUGA 4K6FA 4L4SA 3JQ6A 4CV0A 1ZNQO 4ZRNA 1JA9A 4HBGA 3DDNA 1O94A 5T64A 1PS8A 3RC9A 3WLFA 3WQSB 5TT0A 1T24A 1U3TA 1UUFA 4IDBA 4YTEA 5K0ZA 1I30A 2JFFA 3C24A 2VT2A 3L0DA 2I6TA 3O8QB 4NQZA 2DBRA 3K73O 3IMFA 1Y5RA 1KEVA 5DCWA 3RSHA 3WNQA 1H0KA 3N7UA 1V3VA 3DBLB 4PLZA 3H6KA 3ENKA 3SC6A 2RH8A 4OSOA 1ZK3A 4J7CA 3C1OA 5G4LA 1WW8A 2NQ8A 1BVRA 3RUEA 1LTHR 4RF4A 3CE6A 4GQAA 3E9MA 4R1SA 2HAEA 3X2EA 3K2BA 2PH3A 3ZNQA 4IDEA 3CPSA 1O5IA 4PG8A 4RVGA 4Y8VA 4EGFA 3F1LA 4BNJA 3DZJA 3UICA 2DFVA 3RBXA 3GGOA 1XU9A 3GRKA 5ICMA 1LQUA 2HCTA 3RBZA 4EEXA 2PWZA 3HFGA 2XF8A 4YJHB 4QSMA 1O8CA 3QA9A 2VZ9A 4LGVA 3VC7A 1PJCA 1CETA 4RLSA 3ZV5A 5C3MA 4D7AA 1M75A 1PJLA 3PDUA 3E9QA 3PHJA 3VTZA 1JN0A 5G2OA 3GGPA 4YT8A 3IUSA 3DAGA 4UEOA 4QX6A 4ZJUA 1YQXA 4O0LA 3BTVA 4NU6A 5AXAA 1QYXA 3F4BA 5GY7A 4HNGA 2H6EA 4BV9A 1UP6A 3M2PA 1MFZA 4CUKA 3BMCB 1GDHA 1Z74A 4FC6A 4RDIA 3PHHA 2CF5A 1YO6A 2I66A 2I76A 1RPNA 4J7XA 4RPJA 2O2YA 4DWVA 4R3NA 3DB2A 3H9GA 4BNIA 2PGJA 2DBVO 1JKJA 1UH5A 2Q1UA 3D3WA 5TS3A 1F06A 2NADA 1CWUA 1YQDA 3F9IA 3KETA 5TJ9A 2G0TA 1NR1A 5ILGA 1KY5A 3H3JA 2DBZA 3GQVA 1I5RA 4AJEA 2O4UX 4YAGA 1RWBA 3TNLA 3UW3A 1DBVO 4CQMA 3BAZA 1TI7A 4OM8A 1MUUA 3M1LA 1T2FA 4H15A 2FR0A 5BNIA 3KSUA 1IPEA 4NFYA 3VZPA 3ZV4A 1Z7BA 2HJRA 4CM8B 3GHHA 3MEQA 1ZSYA 2BGLA 3DTTA 2O3QA 3E8XA 4E32A 1N8KA 1PJ2A 1VJ1A 4UUMA 1MV8A 1F14A 3NDRA 2CVZA 2C20A 3CSDA 3T7EA 4XCVA 3FNGA 4PFJA 4EJ0A 1HYEA 3GK3A 4BHTA 3K2EA 1ZK0A 5B1YA 4QQRA 3QQPA 3LT0A 5BNFA 4LN1A 2PKRA 2VT3A 3JSAA 3ADPA 1I36A 1SEPA 1Y9EA 3VPFA 4GMGA 1V9LA 1UR5A 1HE3A 4DLAA 4PG6A 3OJFA 4E2ZA 3S8MA 1KEWA 1BG6A 4ESOA 3TFOA 2FPPA 2UAGA 2CZCA 1G0NA 1GYPA 4MIYA 1P33A 3CTMA 3L07A 3BA1A 3ZU5A 4R16A 5G0VA 1BDMA 4A7PA 3HSKA 3DEYX 3DOCA 5JC1A 3E1KA 2Y0CA 4IM7A 3W4IA 5JC8A 1C1DA 1NQTA 3OJLA 2NU6A 1VJTA 3JQBC 4IIUA 1PGJA 3OQBA 1DXYA 3EYWA 3KLMX 4ND4A 2DVMA 3L6OO 3I6QA 4J9UE 4QTZA 4PGFA 4JROA 2AHRA 1BRMA 4E6PA 3ANLA 4II2A 4YXFA 1PR3A 2AA3A 4BO0A 1D3AA 1QORA 5CDUA 3GHYA 4L76A 3AU8A 3IKTA 4QO8A 1W73A 3HDQA 1IOLA 3R0IA 2FR1A 3JQDA 1WDLA 5A5EA 4BMVA 1QMGA 1OC2A 1SO8A 4NK5A 1NPDA 2PK3A 5JYAA 4WE3A 5TGDA 1N92A 3D64A 4ALNA 4WUVA 4WCFC 2X9NA 1ZZEA 1MC4A 3SXPA 5TNXA 1E3JA 1ZMOA 3MJEA 4NHEA 4LMRA 3WGIA 2EG9A 3MWEB 4CQLA 2XAAA 4FN4A 4BO8A 1JDJA 3HB4X 2EJWA 3WGGA 1BXZA 4HADA 1R37A 5IDYA 3H9EO 3U5TA 4O63O 4NMHA 5BR7A 2YQ5A 3D0OA 2O3TA 2X0IA 3BYZA 3EY4A 3F3SA 4CM4B 4TSKA 4FJ0A 2ZB7A 4WOJA 1ISGA 1TT5B 4R69A 2JFGA 4DL9A 3MOIA 2AE1A 1LSOA 3AI2A 4ND2A 2BI7A 4U6SA 5G0WA 3GZNA 5K6AC 1SB9A 5LDGA 2GZ3A 4WJZA 1LDYA 3I9NA 1QP8A 1Z45A 3DHEA 1XR3A 1A71A 2FPGA 2YUTA 4A73A 1M67A 2VUTA 4CR6A 4MVJM 4DYVA 2BD0A 3KSZO 1PZHA 3WGHA 4DIOA 4P22A 3I23A 1CDOA 1XYGA 2AEFA 3BMOB 3JYNA 4G5HA 4J9VA 4MPDA 4NJMB 3PJDA 3WWYA 4IJUA 1UXJA 5IAAA 3Q9UA 2DQ4A 1KS9A 1UJMA 1EVYA 1JKIA 1AE1A 2VRCA 5LCXA 4JCOA 4TZTA 5EESA 3AOEC 4GVLA 1H9AA 2EP7A 2C2YA 5G4KB 1HRDA 4H3VA 4L8VA 2YFHA 4LVCA 4UULA 3DBHB 3L6DA 4MVJP 5JYDA 3ZWXA 4MVJD 2PZLA 2IYPA 1QSGA 1EVJA 3IC5A 3V2HA 4AL4A 3IJRA 3S2FA 4CLOB 1KBZA 3ZV3A 2NVBA 1NYTA 3GNTA 3VDQA 2O4CA 4BNKA 2E48A 1GTMA 1T25A 3HUDA 1E7WA 3W1VA 3CINA 3DXFA 1DLIA 4N5LA 5AOVA 4CPDA 4CLDA 3KSDO 1R6DA 3WDSA 4Q3EA 2HRZA 2B4TO 4TROA 4A5OA 2OO5A 4O1MA 1FK8A 5G0UA 4BNLA 3A06A 4CMAA 1B2LA 3BHJA 2HO5A 3BXXA 3C85A 3RUDA 3T4XA 2TMGA 3Q3CA 1X0VA 3SEFA 4R9RA 3UKOA 4PG4A 3ETEA 3JQ9A 4R54A 3SX2A 3L9WA 5EN4A 3RU9A 1F0YA 1TLTA 3EVTA 2FP4A 1LDNA 4AG3A 4PLPA 4XZ3A 2B5WA 1HDRA 2Y1GA 5T6BA 3RUCA 4CMIB 3DHYA 2UUOA 2LDBA 4B4WA 1KETA 1LDMA 2ET6A 1DOHA 4DMMA 4R41A 4I9HA 1DC6A 3U49A 5TX7A 4RF3A 3B6ZA 5AXCA 3P2OA 4BIIA 3TOZA 4WLEA 5TJHA 3GZNB 4PIVA 1NQAO 1EBFA 2X9GA 2BH9A 3U4DA 3TQHA 3QSGA 1O6ZA 1DLJA 5C7LO 4P8RA 1T4BA 4C7JA 1HSZA 4YWJA 1HDOA 2PFGA 2YFQA 1VPDA 3LU1A 4CM8A 3JQ9C 5FF9A 4WCFB 2EERA 2VHXA 2ZB8A 2J3KA 4TKMA 1P9LA 3HDYA 3OM9A 1NVGA 5A03A 1GUZA 4EDFA 1OC4A 3VKUA 1LRLA 2PV7A 1U4SA 4ND3A 2D4AA 4GVXA 2AEMA 1DO8A 1WVGA 3PP8A 3ZGYA 2VYVA 3JQCA 1YL5A 1ZMTA 3DQPA 3CZRA 2ZTVA 4E31A 1Y1PA 1SPXA 1XCBA 3WTCA 5L7WA 4XYMA 3S2IA 2BLLA 3RUAA 4E33A 1LRJA 1E6WA 3VTFA 1K2WA 5KJ6A 3DZIA 1B8VA 5TLSA 2O3JA 3C8MA 4IBOA 3ZWWA 4FPXA 3DTYA 3V5NA 5KTKA 4IMRA 3PJGA 5U4QA 3ZWCA 4F45A 4M55A 4CR8A 1E7YA 3LK7A 3KHUA 4RLHA 2P4QA 3IAHA 3GY0A 4UREA 1U5CA 3AOEA 3E5MA 4GGPA 4DREA 1H2BA 4LRSB 1Z7EA 3H9UA 1YONA 1EDZA 3DBLA 5DZSA 5JY1A 1S6YA 4ZQEA 5EPOA 4IUYA 1T2EA 4MVJA 3G49A 2GCGA 3I6IA 4DC1A 2CUKA 3KYDA 5JAZA 5L3ZA 4ZHSA 2WD7A 2QRKA 5I7EA 1UAGA 1IULA 3QV1A 3PDJA 2PD4A 4D0RA 4YAEA 2WSBA 1U9JA 4IS3A 4OGWA 3SLGA 1GADO 1XHLA 2QHXA 1BSVA 2DT5A 3ZCXA 4E5YA 4OIMA 1GV0A 4E5NA 3K30A 1P44A 4N7RA 3WMWA 1ZUD1 5JY6A 4CJXA 4JBIA 5H83A 3VH1A 2B4QA 1YXMA 4YRDA 1K5HA 3KUXA 3L9XA 4N5NA 4RVDA 3JD4A 4W99A 4DLBA 4ZD6A 4XR4A 1ULSA 2QYSA 2Z5LA 1NM5A 2YV2A 4IDFA 1FMCA 3FI9A 3A14A 4C7KA 4BUCA 4ND1A 5IJZA 3VPSA 3QY9A 4ZA2A 1KVQA 1YB5A 4MP6A 4CR7A 3DZGA 3OJOA 3ZNOA 4XKJA 1H6AA 1GUYA 3K5PA 2NACA 5EERA 2IODA 3R1IA 5L53A 4NBRA 4WOKA 3N74A 3M6IA 4JGBA 3RUIA 1U1IA 3IP3A 4J16A 5DOZA 3CKYA 3GEGA 3AUUA 4BGEA 4BKQA 3DMTC 1U2GA 1V6AA 3GEDA 1A5ZA 1UZMA 4NBTA 2I9PA 2VOJA 4PLGA 3EVNA 4PG5A 1UDAA 3PIDA 5CDTA 1KYQA 1P74A 1P1JA 3ETGA 1U2DA 2P9EA 1JW9B 4CV1A 3GT0A 4C4OA 3JTMA 4BO9A 1QLJA 4XB2A 3PHIA 5AYVA 1ZKMA 3WB9A 3LQFA 2D1YA 3GG2A 1GR0A 4PRLA 2G1UA 2O2SA 1SEVA 4LW8A 2EF1A 1NAIA 5A04A 3JQBA 3RJ5A 3WOHA 4KTVE 2UV8A 4CMKA 4AICA 1HL3A 1U3WA 4O59O 4M87A 1P0CA 2J3IA 5EQDA 3FNHA 1X7HA 2NTJA 2VWPA 1XGKA 3U0BA 5KJEA 2Q1TA 4II3A 3PQEA 4PZEA 3MJCA 5A9RA 4DPMA 4BOYA 2IZ0A 2J3HA 5JE8A 3UCXA 5FWNA 2IDZA 4JXKA 5TC4A 4RF5A 1PR9A 3FHLA 4DTIA 4MVJH 3GRPA 2J6IA 3DO5A 4IDDA 5IZCC 3BMNA 4NI5A 5DT9A 1EBUA 3GC6A 5BSHA 4R68A 4BKOA 2B36A 1PQUA 1L1FA 1CRWG 1QR6A 2ZYDA 4YJFA 1Y9AA 2CSUA 1K0UA 4JK3A 2NQTA 1ISFA 1ISHA 1ENPA 1Y8RA 2X1HA 4UEJA 3WBBA 1BXGA 1VJ0A 1LA2A 2RHRA 4Q3CA 2J5QA 3VAZA 4WCDA 5EQFA 3NRCA 1JAYA 4YAJA 4B8WA 4S1VA 5ER9A 2NWQA 3U09A 3ITDA 5I7FA 5I7VA 3H4VA 2OHXA 3NT2A 1LNQA 2WTBA 4PCVA 4U6QA 3IQDB 3EC7A 3NYWA 5G0SA 2NVUA 5CDYA 4I5DA 3WMXA 3IDSA 3ZU2A 2NSDA 1SC6A 4FJ1A 1QYCA 2EKPA 4K6CA 1VKOA 4AJHA 1LLQA 3L77A 1FDUA 1C3VA 2P9GA 3OETA 3TFQA 1PZEA 1I24A 4Q39A 3ZW9A 4XEHA 2CDBA 3FTNA 3NT4A 1EUCA 3OICA 1LSUA 3WSWA 1PGOA 2V7PA 1X15A 3VDRA 1L7EA 4B8ZA 4J49A 2I99A 4ALJA 2DKNA 1UXIA 1B14A 1C0IA 1P1HA 1E1LA 1LLDA 2UVDA 2Y1OA 2YW9A 3QWIA 3JYPA 3N58A 2SCUA 3HWRA 1NWHA 3PQDA 4TRMA 5JLAA 1G0OA 1V35A 4CQLB 4EEZA 2WWRA 3EK2A 4WLOA 5DCYA 3KZVA 3AUTA 5TF4A 2FPIA 4BO5A 3IP1A 3IL2A 4WLVA 3AFMA 1U7TA 2BGMA 2BFMA 1LJ8A 2YY7A 4I9UA 1EVIA 5BSFA 1WNTA 4LVUA 3ZN2A 3LC2O 4XRGA 5L45A 6ADHA 1Q7BA 3G3EA 4RV9A 2E4AA 5DDIP 2OP0A 3JD1A 2BF7A 1AN9A 1DIGA 1W6UA 1ZXLA 1PL6A 5KKAA 1EEHA 1DPGA 2JFHA 1B26A 4MIEA 4M89A 1VSVA 1N7GA 4YRBA 4MP3A 4AJ4A 1BDBA 1Y8RB 2Q3EA 4EI2A 4XA8A 1QYDA 1UAYA 2D8AA 3WBFA 3ZWPA 2Q2WA 1GL3A 4G2NA 4FFLA 4BNVA 1GYQA 3PLNA 3A4VA 4QUKA 4LK3A 1Q7GA 2JKVA 1HXHA 1O0SA 4A03A 3Q2KA 1ZK1A 1ARZA 3ITKA 3AU9A 4U8GA 4WECA 4BO4A 1PJSA 4ZQBA 2ZQZA 2VZ0A 4J1QA 4NR0A 4BNTA 1SNYA 4ZQHA 4WNCA 1KVRA 3DAPA 3ROKA 3ZWOA 5HS4A 2BFPA 5I8WA 1GAEO 2RAFA 3QLJA 3TL3A 3ABIA 1IHXA 3DBHA 1PGNA 4WEQA 4XYBA 3RUHA 4W6ZA 4IGEA 1O89A 2G5CA 5TT1A 5MGBA 4L0QA 5TIIA 4GBJA 3F46A 1C0PA 1T1RA 5ICSA 4YJHA 1P77A 3DFUA 4DUPA 2PZJA 4UUOA 5IXYA 4RPGA 2GPTA 4AJ2A 1B0AA 1ORRA 1VRWA 3GDGA 3JQGA 3B1FA 2VZ8A 1JWBB 3DBVO 4B7UA 3AI1A 1X7DA 1ENZA 3NX4A 4WPGA 4GLOA 3JQ8A 1HETA 3I1JA 1BHSA 1ZVMA 3D5QA 5C5IA 5EINA 4TVBA 4CQMB 2PD3A 1FXSA 3AJRA 1B7GO 1B3RA 1HF3A 1CEQA 4QECA 3ROPA 1I2CA 3FNEA 3D4OA 4QFCA 8LDHA 2G17A 2Q2QA 1IL0A 4RVSA 3K9QO 1FJHA 2P68A 3EDMA 3GF4A 1M66A 4D46A 2HQ1A 3I9KA 1HSOA 4CM1A 2D59A 4DRYA 3FBTA 3ANNA 4GKVA 1NFQA 4FB5A 3FN4A 3IUPA 3ROQA 3PGJA 5I9MA 1MX3A 3O4RA 4M1QA 4ZGWA 1K6IA 2A94A 3FR7A 1UZNA 4GKBA 1P31A 1NX6A 4TQGA 3RKRA 4E30A 4CLXA 1IB6A 2F1KA 3EZLA 2F00A 2EGHA 3C7AA 4NG5A 3KEOA 4JJIA 3TPCA 4Y9DA 2Q22A 3VH4A 2HSDA 1XQ1A 1MA0A 3C7CB 3HN2A 3BTSA 5THKA 4EYEA 1P45A 4GSLA 3FRJA 1H6CA 1P3DA 4QXMA 3UOGA 1SCUA 2HMTA 1ZEMA 4I5FA 3JQAA 3JV7A 3UAGA 3T7CA 1ENYA 2FR8A 1JAXA 4E5MA 1X14A 2WD7B 4DBVO 1F8FA 2CY0A 1K6XA 5A3VA 2IZ1A 2RBEA 3COSA 4EW6A 4IQ0A 3JQ7B 3VPGA 5HBRA 4WKGA 3DZHA 4DGSA 3WGYA 2JD2A 3MTJA 3INTA 3NDIA 4AVYA 2X86A 2X0NA 1EK5A 1Y8QB 3ADOA 3ST7A 3CZMA 4GX0A 5K6AA 5HTOA 1ONPA 3I4FA 3PZRA 1WAMA 4U0KA 5ENVA 1QV7A 4ZICA 1L7DA 3TWOA 3Q2IA 1NFFA 4J91A 2Q99A 4Q9NA 4E0BA 1CQJA 1ULUA 3S55A 1E5LA 3PGXA 5KIAA 5JMWA 5I7SA 4DPLA 1ZXBA 3PXXA 3D1LA 4HUJA 2C5EA 3LT1A 1XA0A 1V8BA 4HY3A 4YACA 5H82A 3VH2A 1VE9A 1XLTA 2C82A 1N1GA 2I5PO 3WYCA 2Q1WA 2Y93A 3GVIA 3MJTA 3O8QA 2X8LA 3I9JA 4IQGA 3OIDA 3D3EA 1I2BA 3E03A 4HV4A 1DC5A 3PYMA 1B8UA 4QEDA 4G65A 1HE4A 3GNQA 2GDZA 1LLCA 5BSGA 2BFOA 3DZBA 1ADBA 3RFTA 4TMFA 4BNHA 1NVMB 5J23A 3NGLA 4H16A 4JX8A 4JP2A 4XYLA 4NNJA 4UUNA 2VNSA 3LT4A 4F6CA 4RQUA 4WGGA 1GPDG 3UN1A 1AXEA 1KERA 3HADA 2NM0A 1HYHA 3VOSA 3BTUA 2P91A 1H9BA 4BNXA 5KJCA 3WIEA 1YB4A 3G17A 3RCBA 3LC7O 3LZ6A 4LCEA 1B15A 1ADGA 5HA5A 3GUYA 5DCUA 1WZIA 4CODB 2ZTMA 4WNIA 4PN3A 2PLAA 3W8DA 4A26A 2W2KB 1OZAA 1XDWA 3NJ8A 1DHTA 3OJEA 3KEQA 4WLNA 1LC0A 1RM3A 2Z1NA 3HQ4O 3I5MA 5IG2A 2QZ9A 2VWGA 4CV2A 1PGQA 3BMOA 4RPHA 2AMFA 1I3KA 1PWXA 4YYZA 5L4SA 4YPOA 2WDZA 4HWKA 2OL4A 3ICCA 2EW2A 4MO2A 3V1UA 1O9BA 1W0CA 4XJSA 4AJIA 4NK4A 4JBHA 3I3OA 3JQGB 1QV6A 4M54A 4FDAA 4N5MA 3GEMA 1VI2A 3C1AA 1IE3A 3V2GA 1E6EA 2NV6A 4M49A 4CLRB 2PNFA 4J4TA 2NTNA 3L6EA 2YJZA 4ID9A 4E4YA 4DIFA 4I1IA 3GVPA 4PVDA 4GGOA 2FZWA 4WLFA 2OMEA 2QQ5A 1E92A 3L4SO 3ZHXA 4D41A 3VVCA 2W8ZA 5G0TA 3PHGA 1T2CA 4JJFA 1N5DA 1H93A 2X22A 5F5NA 4PLVA 2X5KO 1U7HA 2HJSA 3ON5A 3WX0A 1NR7A 3FWNA 5IDQA 4W7HA 4FW8A 3LLSA 3FSRA 5KNLA 5A9SB 3DBRB 4J1TA 3UXYA 3IIEA 3UHAA 1VL8A 3INRA 3GAFA 1HDXA 3EW7A 3JQFA 4FFOA 4Y6PA 4BQRA 2JHGA 1XELA 4PLCA 1DSSG 4P4GA 3WJ7A 2VYND 4RVHA 5DBIA 2BHLA 4BMSA 4NFSA 2V6GA 3AW9A 3GNSA 2PGDA 2Y1CA 3GVCA 2H1SA 4A2CA 4NBWA 4CL8A 4XIJA 3D5TA 3DMTA 3R3JA 1DIHA 1PSDA 3GR6A 2VHWA 4PVCA 3SBOA 4CMHA 3PZBA 4KTTE 2IEDA 2R2GA 5T5QA 1DAPA 2GYYA 3KV3O 4NBUA 1X1EA 1LQTA 2JCXA 5ER6A 1PL8A 3U4CA 3HFSA 4XDZA 1YGYA 9LDBA 3RC2A 3H5NA 4FFNA 4ITUA 2V6MA 3VPXA 1YRLA 2EKQA 4YJDA 5CEFA 5T67A 4Y98A 3SLKA 1C0KA 3ZWNA 1ONNA 5F1PA 2QRJA 1TVEA 2CDCA 2C29D 3DFZA 1MGOA 1Y8QA 2J5RA 5A05A 3HNPA 3LDHA 3HHPA 1KEPA 1HE5A 4AJKA 4EBFA 4B7CA 4OMUA 4E2XA 1CIVA 3V2UA 2Q1SA 4W7IA 5COQA 2WE7A 1GFSA 2E6UX 1LDEA 4OH1A 4JLWA 3H65A 1CF2O 1E3LA 3ICPA 3V8BA 4B4VA 1I32A 3DOOA 5KKCA 3BIOA 1X0XA 3E5RA 2Q4BA 2O3UA 2D0IA 1E7MA 1SBYA 2Z95A 4HNHA 4Y6RA 4BNZA 1F17A 2XOXA 2DAPA 1X7GA 2GUGA 2VWQA 3P19A 2HMUA 5T57A 3WIDA 4BKUA 3JCZA 2R00A 3GUCA 3PJFA 5JDIA 4CM5A 1N2SA 3F1KA 2OZPA 4INAA 1GPJA 2CNBA 2C5AA 2HUNA 5EL0A 4L75A 1PGPA 4P4NA 5DF1A 2ZB4A 1QLHA 1R4NB 3JD3A 1YWGO 3NUGA 3VZQA 1AXGA 4AJNA 1EZ4A 3VVBA 3I9LA 1WP4A 2OORA 3DBRA 1KC1A 3SJ7A 3GPDG 1DC3A 3ORFA 4F3YA 3MJVA 4HFJA 3TZKA 1YE3A 2NU9A 2PD6A 1UP7A 2PZMA 3EGOA 4YAIA 4I5EA 5IDXA 1Q7CA 5A02A 3INGA 3OECA 3QP9A 2YHIA 4W9NA 4XIYA 4Z3KA 4XQCA 2AQHA 3WGZA 4J2HA 1M6HA 3NTQA 2YV1A 5JAIA 4IJWA 4Z0PA 4IGFA 3FPCA 1Q0LA 4OO3A 6LDHA 3WFIA 1TA4A 2R00C 3WSVA 3QVXA 3I9OA 3OA0A 4PRKA 3K92A 5JCJA 5L9AA 4J43A 3WFJA 3S2EA 3AM3A 1E3WB 3PRJA 5KVVA 2VYNA 1XU7A 5IXSA 1GY8A 5IF3A 3CEAA 1UP4A 1PJQA 1FDSA 4HFRA 3LYLA 3RAJA 4OQZA 4JIGA 2AW5A 3RKUA 3WYEA 4L73A 5U9CA 4A10A 5CDSA 2I67A 1XKQA 1ZEJA 4IQ8A 2QRLA 3MOGA 1JU9A 1D4FA 2GR9A 1N7HA 4GX2A 3TZCA 4BL5A 5MDHA 4XWYA 2PA3A 3EAGA 3ONEA 4LMPA 2R6JA 4KQXA 3ETDA 5ITVA 3GZ4A 3OHSX 3VZSA 1BW9A 2CDAA 4M86A 5KJ1A 4JBGA 4EZBA 2X0RA 4HKTA 5A9TA 1E0DA 4KUEA 2O48X 2X5OA 5L95A 1DJNA 2Y1DA 3GAZA 3RD5A 3B1KA 1ID1A 1HEUA 1PJ3A 2PKQO 4XYGA 2DTEA 2GGSA 4NJMA 1HKUA 4DBZA 5JS6A 4FOSA 1FF9A 1H6DA 1BXKA 1W4ZA 4XGIA 3TDKA 4CMBA 4BO7A 4BNMA 3RFVA 1T2DA 1ZW1A 3BMCA 4RDHA 4BVAA 1LI4A 1YDWA 5CPFA 3TZ6A 4YB8A 5M6DA 1D1TA 3AUSA 5DN9A 3UGKA 2BRUA 3OQ1A 1H5QA 9LDTA 5CDGA 1P0FA 2UYYA 2WEKA 3GPIA 2BKAA 3ASVA 3DWFA 3MJ4A 1GU7A 1YKFA 2YHIB 5C7IO 1K6JA 4HFNA 2HK7A 4MDHA 2RIRA 5FEUA 3DR3A 1SOWA 4R1TA 3JYQA 2DFDA 2ZTUA 1YB1A 1J0XO 1EUZA 3IJPA 1DRVA 2VNAA 2FSSA 4FSHA 3KYCB 1PJ4A 3VZRA 3WGTA 3QW2A 2DM6A 2E82A 1HDGO 4GWGA 4KWHA 3LF2A 1E6UA 1XWFA 1VL0A 3OF2A 5A06A 2ZIZA 4PZCA 4RL6A 3C7DB 4U5QA 2WE8A 2CVQA 2W2LA 1R12A 1UXKA 3DMYA 4URFA 3NJ4A 3HJAA 1PWZA 5ITWA 1EQUA 3NTOA 1EE2A 3BMQA 4GX5A 4GAEA 2YHUA 2ZATA 4BV8A 4E2WA 2JAPA 3WNVA 3FNFA 1HYGA 2IRWA 5IDWA 2HMSA 5GZ3A 1E3WA 2JCVA 4IY1A 3Q1LA 4DA9A 7MDHA 4RF2A 2JD0A 1E5QA 3FR8A 3ZHZA 1Q0QA 2VN8A 2FOIA 2VHYA 1KY4A 4NDNE 4B3JA 4EUFA 4TWRA 3AM4A 3F47A 1YL6A 1A9YA 1Y81A 2H5LA 2VUUA 3E48A 2B0JA 3CMMA 2WD8A 2O23A 5KWEA 3KYBA 4UVHA 4KMSA 4BMNA 4BS9A 1AGNA 4MOWA 3H5AA 2DPHA 3CMCO 1VL6A 4WCFA 1XEAA 4CMEC 4U7WA 1GCUA 4FS3A 1CQIA 4CMIA 4LSMA 4R1NA 1M76A 3RJ9A 4R01A 2VQ3A 2QZZA 1V3UA 4CM7A 2C07A 2FY8A 1NQOA 4XRRA 1EUDA 4RVFA 2VRCD 3TZQA 3BTOA 5CG1A 3HZZA 1G6KA 3PWZA 3NKLA 1TXGA 4BO6A 5I9NA 4B7XA 1SB8A 2Y68A 2O3RA 1NAHA 4B4UA 4AJJA 1DJQA 3S2GA 1OFGA 2IEBA 5KVSA 2GN8A 4RVUA 3MZ0A 1LC3A 4ALMA 1KIFA 1HTBA 1R0LA 1JKFA 3RU7A 3I52A 5K9ZA 3PLRA 4J1SA 2FRDA 1WPQA 2C54A 4J4HA 1D8AA 1Z75A 3QVOA 1FDVA 3GG9A 4YT4A 2P5UA 1GV1A 3UUWA 3TZHA 3QVTA 3Q0EA 3GVXA 4E2YA 3FD8A 3ZWBA 1YDEA 2RHCA 5FI3A 4XDYA 4MVJF 3K8ZA 2P9CA 1ISJA 1D1SA 2GN4A 3OSUA 3G1UA 4YJGA 5JXWA 5ES3A 2A92A 3VPHA 2W98A 1NQ5A 3O38A 5CEEA 4L4XA 4YCAA 2QYTA 3C1TA 4O6VA 3AWDA 4XQ9A 3JQEA 5AQ1A 2POQX 4CLOA 3A28A 4IS2A 5F21A 3KRTA 1SMKA 3WYBA 4AFNA 4XB1A 4I08A 4OXYA 1WZEA 1MC5A 3AFNA 3KO8A 5GZ6A 3BZUA 1YVEI 4W9NC 4LSWA 1OI7A 1X1TA 4Z9YA 2GZ2A 4CM9D 4FIZA 4MVJE 5GMOA 2AQIA 1R15A 2VWHA 1I2ZA 5DULA 4UAGA 2B35A 1LX6A 1YBVA 1DC4A 4R3WA 2GSDA 3ZH2A 5A3JA 4R1UA 4XJTA 5IN4A 3KXDA 4J2OA 3PI7A 5JW6A 2NNLD 2X4GA 2X0JA 4QT0A 4EJ6A 5DP1A 3ZDFA 1ZFNA 4TRRA 3ZW8A 2EHDA 3T4EA 4NBVA 1V0JA 4DIBA 3DZFA 4NJOA 1PZFA 4LISA 4RORA 2YZ7A 4YT2A 1U4OA 2O7QA 2IZZA 2J5KA 2VUSA 4OSPA 3I9MA 4FOOA 2GN6A 4GX1A 3R6DA 4B3HA 4B79A 4CLEA 1IUKA 5HRUA 1PS9A 4CM3A 1RM4A 1R4MB 1XG5A 1GYRA 2CVOA 2DC1A 3GMDA 4YQZA 5L4LA 3U9LA 1I01A 4J7UA 2FMUA 1PQPA 4TRJA 4FGSA 2EKLA 2HDHA 3SC4A 1YBAA 1DEHA 1ADFA 1GEEA 1DRUA 1VM6A 1J4AA 3GN1A 3LT2A 3PHLA 3IOYA 3OIFA 4FC7A 3DOJA 1C1XA 4KUHA 1NVTA 1U3UA 5CFZA 5A1TA 5L51A 1ZJZA 2HLPA 1ADCA 4BNNA 1I8TA 4HX5A 3G0OA 3QE3A 1MFPA 4R9SA 4RJTA 2FWMX 4WASA 4IDGA 1P1RA 1U5AA 2Y66A 4BKPA 2X9VA 2OGUA 4ALKA 3P5SA 3MCVA 1ENOA 3O9ZA 4MVJI 2P2SA 2WYUA 4BNUA 1DFGA 1HT0A 2WMDA 3UCFA 1HZJA 4MINA 1E1NA 1V3TA 3AY6A 3ENNA 1YS4A 1A27A 1MXHA 4OQYA 5JNLA 5EIOA 1EVZA 2E49A 3E82A 1PS0A 1GD1O 4EUEA 3B1JA 3GMSA 3M2TA 5CEJA 3RROA 7ADHA 2O50A 1U8FO 3BHIA 1GEGA 2CMDA 3RVDA 3F5QA 1I0ZA 4P4LA 3AY7A 3ZWMA 4CMCA 1NTOA 1PJBA 1ML3A 1LXCA 1BTOA 1OBFO 4FBGA 5F1KA 2EGGA 4YRAA 1E7RA 2GF2A 3B70A 3WR5A 2EW8A 5U1PA 2AXQA 2ZKLA 2C7VA 1WXDA 4D45A 2Y67A 2OBYA 1B8PA 1KVTA 3WICA 4E13A 2C59A 2O3SA 3A9WA 2JCYA 3IKVA 4FJ2A 4BQPA 1GZ3A 2D2IA 1EFLA 4LCJA 4OJNA 2ZQYA 4NPCA 4AJPA 4FFRA 5KVCA 4XR9A 5TRTA 4IMPA 1E7QA 1Y5MA 5L40A 3PQFA 3AI3A 4CM9A 1NHGA 5FFFA 1JVSA 3RASA 5F5LA 4BB5A 3WGOA 1I3MA 4W4TA 3O26A 1MP0A 2XXBA 2B83A 3JYLA 4GSKA 4MKRA 3HE3A 1SOVA 2DU8A 1C0LA 4BKRA 2Q50A 2I3AA 5JSFA 2PKQP 2GNAA 2W2KA 3PK0A 3QWAA 4R4JA 2OFPA 3RQSA 1NPYA 2PR2A 3H7AA 4XX0A 4BNGA 2EJVA 5B12A 2ZJ1A 1LSJA 3JQ8B 3PWKA 2P5YA 4RQTA 2EV9A 4BGIA 1DIBA 2OBNA 3ANMA 3FCOA 3ZHYA 1Z82A 2YQ4A 5CP8A 4KP7A 4OXKA 4GI2A 1DFHA 1PJTA 2NTVA 1UZLA 4R5MA 2FSVA 5IZCA 2GASA 1B16A 3WGQA 1M2WA 1WMAA 3JQAB 3JD2A 1OAAA 4HFMA 5JO9A 4DVJA 3OQ6A 4XD2A 1RM5A 3RBVA 2EEZA 2QIOA 3GOHA 1NNUA 1CERA 2GLXA 1UXGA 3D3WB 3FWZA 4L4RA 5B4VA 2ZCVA 3ZHBA 5JDCA 4GPD1 1NASA 4BGVA 4YT5A 2GN9A 1O95A 2AG5A 3KTDA 1NPTO 2JJYA 1E1MA 1OOEA 2Y1EA 3ULKA 5HM8A 3KLPX 1QKIA 1EFKA 5DBFA 5IN5A 4RPLA 2A4KA 1KOLA 3CXRA 2EWMA 1I33A 3HDHA 3NGXA 4Y6SA 4A27A 1E77A 1ZCJA 3RFXA 2H63A 5IFLA 5JBIA 2Y1FA 2VTDA 2W4QA 1PX0A 1H94A 2DUWA 1WDKA 4L9RA 4J4BA 3W6UA 3O03A 1N9GA 2CFCA 1DIRA 1R4MA 5GZ1A 3QRWA 4H7PA 4IIVA 3ZU4A 2ZB3A 4HP8A 2VOEA 1MXFA 4LRTB 1N1EA 4KDFA 2B5VA 3OP4A 3TN7A 3ZNPA 2PZKA 4DQVA 2HK9A 1GCOA 3GGGA 1BW9B 2QW8A 4UVEA 1GQQA 4CLHA 2O7SA 3EMKA 4BNYA 2TMDA 1ZK4A 4JNKA 5JO0A 4YEDA 4AJ1A 1HZZA 1BMDA 1JQBA 1TT7A 1EE9A 3H9QA 4CV3A 2Y0EA 1PTJA 5JDCC 2XXJA 5EMHA 1C14A 2NUAA 1QRRA 2WJPA 3E6AA 5KOIA 3STHA 3R3SA 4NZ9A 4PLFA 4D3DA 2WM3A 3L4BA 2B69A 3ZWYA 1LBEA 3ZZNA 2CF6A 2IXAA 1R16A 3SJUA 2JHFA 4DQUA 3ZI0A 1EMDA 1PL7A 3GDOA 3CUKA 3LVFO 1IY8A 2JL1A 4D0SA 2BI8A 1LU9A 5BSEA 1N9GB 3TJRA 2VHVA 1MLDA 3PVZA 1K89A 3F5SA 5B37A 1BWSA 1YJQA 2H9IA 2Q45A 3U4IA 3SVTA 3OEYA 1C1DB 3HB5X 3PYLA 4NFHA 3PWSA 3TF5A 1DB3A 4M8SA 2V6FA 1Z73A 3P2YA 3QWFA 1E3EA 1RYEA 1MG5A 2HU2A 2VYVD 1DAOA 2D5CA 4BGUA 1ZO8A 3L4BC 2A9FA 4YAKA 2AEJA 2D3TA 3KB6A 3ONDA 3GA0A 3PIIA 1LLUA 4Z0HO 5CPBA 3UVEA 4JQCA 2OP1A 3KVOA 1ZJYA 4ALIA 3PFFA 3NAQA 4ZRMA 3OFSA 1KVUA 4RO0A 4FR5A 4CUJA 4MIOA 1XSEA 4CUZA 2Z1MA 1PQWA 2EXXA 3B20A 5T73A 4CQMD 3F4LA 3EZYA 4XYEA 4EUHA 3H8VA 2GD1O 5TQVA 1TEHA 3GVHA 5C37A 2BGKA 3QVWA 3QHAA 5A4DA 3WS7A 2W90A 1UDCA 4AJLA 4CL3A 1PIWA 4Z9XA 4WEOA 1RKXA 4CMEA 3Q11A 3D4NA 2AQKA 4TZKA 1HWYA 4TVOA 2NU8A 3VH3A 2GRAA 3NV9A 2HMVA 4R5HA 4F6LA 2VCYA 5JCXA 4IJKA 4PLHA 1J6UA 2QG4A 3LF1A 2AG8A 4MKZA 4Q3BA 2ZCUA 5T8KA 1T4DA 1P1IA 3LLVA 1TT5A 3QVSA 5A5FA 2DUUA 3UCEA 4B4OA 3BMNB 4YQYA 5KJFA 3RC7A 1H2HA 3P7MA 2WYWA 5ILOA 4XGNA 1GZ4A 4CM6A 3AUAA 3OIGA 4K9DA 4G81A 4N18A 4MJLA 3Q6IA 5LC1A 4Z0TA 4Z3DA 4OOEA 1A72A 2Q49A 2ZYAA 4JP3A 2CD9A 4P38A 4GMFA 1LUAA 4J1NA 4TRNA 3VHRA 3GH3A 1CJCA 4RPKA 3HG7A 4OKIA 3G79A 1Y7TA 3WTBA 5BNTA 3OMLA 3TRIA 3W6ZA 3E18A 1A9ZA 3AOGA 3H3FA 3UH1A 3W8EA 4ILKA 1IZ9A 2HK8A 2WYVA 2X6TA 1F8GA 5HS6A 1ZBQA 3PJEA 3AK4A 4X54A 5JMPA 3DZKA 3WXBA 5DOVA 3EHEA 3JQ7A 4I8XA 5L7YA 1SZJG 1RYDA 1E3SA 1JLLA 1GZ6A 2B37A 2C2XA 1IZ0A 2QX7A 3MJSA 4CMJA 4OL9A 2IXBA 4ZQFA 3GN2A 4OXNA 4ZU3A 4J0FA 4K1LA 1P1KA 3H5RA 2G82A 1AUPA 3W4JA 1Q2XA 3K31A 3WWZA 3JQFC 1IYZA 4IZIA 4L74A 4HXYA 5CHEA 1NHWA 3TOXA 3VKVA 1PEDA 1NWCA 4RCVA 5JPIA 1DFIA 3V1TC 5FYDA 5JYEA 3G1TA 4I9NA 4ZVVA 1F12A 4DQXA 2VRBA 3QWBA 3U3XA 2RCYA 2X58A 1EK6A 5LDHA 2W2LD 2NVUB 4BB6A 4DYDA 4Z6KA 5FI5A 4GH5A 5L7TA 4YVFA 4D44A 4PG7A 4IDCA 3NEPX 3ZWAA 1GUFA 1YH3A 4D43A 4S3MA 4K28A 3K6JA 4DPKA 3GDFA 1BGVA 1VC2A 2E37A 2FHSA 4IDAA 4IXWA 3PFWO 3NT5A 5JDIC 3QWHA 3TSCA 3QJ5A 1LDBA 3QIVA 4DMLA 1YL7A 3DL2A 4D3FA 2JAHA 4RGBA 4DXHA 4YJFB 2FN7A 3LC1O 2YV3A 1E3IA 4ALLA 2YYYA 5JAQA 3WLEA 1BVUA 1YJ8A 2HRBA 2J8ZA 2LDXA 2YDXA 4FFMA 3FPLA 3OEWA 1DHRA 3GFGA 2DTDA 1Q0HA 3DHNA 1YBMA 1U8XX 1DRWA 2PH5A 3H2SA 3LSYA 3WG9A 1D7OA 3JQAD 3ROMA 1UXHA 4IINA 2B4RO 3JD0A 3Q9NA 5AXDA 1KEUA 1YOVB 2DBQA 3I4CA 4KOAA 2NLOA 4BNFA 3KBOA 4J0EA 1R0KA 4IPTA 3K96A 5CAEA 2Q2VA 4YA6A 2RH4A 4N54A 2VTEA 3PYXA 1VKNA 1ZIDA 4J3FA 1QYWA 5CG2A 2HKIA 5DNAA 4ZQGA 3V1YA 1AHIA 2ZJ0A 3D4PA 3CH6A 4PLTA 5F1OA 2XPCA 1T1SA 1QYVA 4I5GA 1IPFA 1M6WA 1A7KA 5BT9A 2Y05A 3RUFA 4CLRA 3H9JA 4KZPA 4Z9FA 2G76A 3KYDB 1S7CA 2DTXA 5ENDA 4E3ZA 1SAYA 4OKNA 5BQFA 2A35A 2AQ8A 2I3GA 5JCJD 4BO1A 4DC0A 3ONFA 1PZGA 4U0JA 3BMQB 4TKLA 2HMWA 3F6YA 4NH4A 1NXQA 1TB4A 1I3LA 1VLLA 4OOFA 1YOVA 1ZK2A 4ZN6A 4ROSA 3GLQA 5DP2A 1R66A 4AJOA 2OUIA 4ND5A 2OXIA 4F46A 2AE2A 1RM0A 1HDCA 1HDZA 2JD1A 4Y67A 5TSDA 1W8DA 3X2FA 1MB4A 3OBBA 2GERA 3RI3A 4XGKA 1QXSA 1H6BA 4YDRA 1WMBA 1DDOA 3KYCA 5I9LA 1G1AA 3DC2A 1ONOA 2D5AA 1T2AA 5G4KA 5HWSA 4JJGA 1Q1NA 2EIHA 1P1FA 3FF4A 5KVQA 2P4HX 5ADHA 2BELA 1B3BA 2X7HA
chains in the Genus database with same CATH superfamily
2X23A 1E2MA 2QRPA 1FFCA 2NNWB 4RZHA 2VBFA 4GR5A 1I6MA 1VE1A 1ATIA 1GQRA 3CZQA 3O8BA 4K86A 1WCIA 2Q1YA 4G25A 4C43A 1VLVA 3G2PA 3RTEA 4IOJA 2I2FA 3ZZTA 5CT6A 2WWFA 1G8YA 2J9YB 4CXMA 4EGAA 2JFVA 3B12A 2FN3A 2JK0A 4O5OA 4K9LA 3GLIB 3U48A 1UINA 2EP5A 3PR2B 2PHZA 2CL0X 2KMLA 3GB9A 4HB4A 1UDXA 4PX2A 1REQB 1C1YA 2DLDA 2JGEA 4C30A 3W4KA 1L7QA 2OFXA 4F60A 4LHYA 4V02A 3DHVA 3R3VA 4OMDA 1Q84A 1D5CA 1DDIA 4KQGA 1E1KA 1Y82A 2ZBDA 1TYZA 3HVIA 5TPZD 1G8SA 3EF3A 2I1WA 1E2EA 3HJTA 4X6YA 2RD2A 2IHTA 4KO1S 3TDMA 3MBOA 4JYZA 1MZPA 1W75A 1Z8FA 4EJMA 1EFRD 3O2SB 1WKVA 3L1VA 1KE1A 4E5PA 3NDJA 3P9IA 3NWEA 1U6KA 5ALLA 4D3SA 4D4GA 2CNKA 2UYQA 5CCXA 1GLGA 1W5BA 3MRTA 4QVKA 4IXTA 4P34A 4TSFA 2YICA 3M8KA 1NJ1A 4FNMA 2GX6A 2GPYA 4PCLA 4AKHA 3BERA 3NHSA 2EKBA 1T26A 1OXVA 2X41A 3TTSA 5DBGA 5DGXA 2ZTLA 3DPSA 4C2TA 3MQFA 5IJ0A 1F2TA 2Z9BA 3RIHA 5FI0B 1ZM2A 1T1GA 2ZETA 3TGLA 5BSKA 4MVJG 1NVUQ 3DOIA 1GCGA 4FKBA 2IHUA 1LEHA 1SOAA 3M1AA 1BQ3A 4RZQA 4QYTA 3JYOA 2C5SA 2YS7A 2GHIA 3MMXA 4H6VA 3UAVA 4A16A 3ZK8A 1QX4A 1R4NA 4MPRA 5EPUA 1AKYA 4NLLA 1MR3F 1X13A 3JAWA 1BS1A 1LRKA 2RARA 3SDSA 2DSTA 4GYWA 5GWXA 2WU3A 3QVGB 4Y0AA 2CXHA 1ADYA 4LDAA 3LUKA 4RZIA 2IS4A 4O2BF 1OVMA 2W71A 1DIAA 3C3XA 3OLWA 4IX1A 3BXEA 4ZT3A 3X3HA 2Q46A 1FFEA 2ORED 1OMOA 2QZSA 1CFZA 4JT4A 1RWVA 1VMDA 3R5HA 2ASEA 3AJ8A 4I8DA 3TQSA 2JEZA 3TYXA 2PY6A 1WXIA 1RIIA 2ADOA 4GWKA 4DDTA 2AEEA 1N34B 2J67A 2R8EA 4EIWA 4AUNA 2WWGA 4O08A 1A7AA 4JVMA 4QOIA 5KSPA 2PGOA 3O8DA 3I53A 4R40A 6CHYA 4V0RA 1XQ6A 1ISMA 3KTOA 1Z4NA 4GL4A 4LZOA 4XAQA 5F1YA 5IZ4A 4GP6A 2IV2X 1DU4A 4NZYA 5LOVA 1J90A 3L49A 1UIRA 1URPA 2E4YA 2OBBA 3FBGA 3PEFA 4Q15A 2ZUVA 2V7XA 4D4LA 3MCTA 1K7XB 5B6JA 1X3SA 4TTTS 5LLTA 3TEJA 2H4XA 4TXLA 4N7BA 2N3ZA 1CUSA 1MT3A 1TZ2A 4RFSA 1EXVA 1P5ZB 2FN9A 2NVWA 2QMQA 4RVCA 2BHSA 5AXBA 2JIQA 3KHKA 1WV0A 4X7PA 5D00A 4BLSA 4CMKA 1HDYA 2VP6A 1JIQA 1A9TA 2J3JA 3KOUA 5JAMA 2BBTA 3GFBA 3N8NA 1E94E 1TC1A 2X14A 1U2ZA 5EIFA 5EJ2A 3PEYA 1WDMA 1CQJB 5JRDS 3B2EA 3CPHA 2QAGB 4MP8A 3VYTB 1AS2A 1BKDR 3WOVA 4F91B 1PR4A 3E3OA 3MWGA 4KWIA 2Q6KA 1ZY2A 5AJTA 1I7MB 5AW5A 3WQRA 4PLWA 2QD3A 3K6SA 1L5MA 2PBZA 2PYDA 2W6ID 3N87A 4J6FA 1VP9A 3UIEA 1I94B 5A4IS 1Z8HA 4U39A 2FLVA 2IE0A 5DFAA 2IXFA 4JWKA 3QI7A 3UF0A 2DKOA 3ESRA 1E4OA 1VMIA 2BJHA 2AZDA 2VLBA 3ONWA 3DCIA 3DO6A 5EA2A 4DUGD 3R8FA 1FDWA 2V6BA 1YE8A 1XJCA 2CNDA 4D92A 1AGYA 1U1DA 1TEXA 3I9V1 3MRSA 2CCJA 3VSCA 4BAUA 4L8WB 3T4PA 2IPXA 3SQXA 2IYOA 3MWYW 5KNCD 3H42B 5LLSA 3NTRA 1KC3A 4DLSA 2Q4EA 5FULA 1EVLA 4DIDA 1XIVA 2P5SA 3BHMA 4KDEA 1EIWA 4CHGA 2ZK7A 4NIMA 4L4SA 3CWZA 5AHOA 2X3YA 4A0HA 4B74A 3VR0A 3NV7A 4XSVA 1CUHA 3C5WP 4ZRNA 3H8JA 5C1OA 2VKTA 4EMTA 3Q40A 5SY6A 1Z7WA 2C4UA 5EMJA 4D8WA 2PGXA 3RYCA 1Q12A 3IQGX 2VCEA 2XW6A 1P9WA 1X42A 1WSDA 2WIJA 2BFCB 4RZXA 5IC5A 1Z6AA 1QRSA 5TT0A 3KAPA 1T24A 1UUFA 1VKRA 2WP8J 3C8ZA 3LVRE 4IDBA 2R8OA 4YFVA 1I30A 2OC9A 2Q28A 3BM5A 3C24A 3O8QB 4IUBS 3FWHA 4U8HA 4NQZA 3SAJA 1NKTA 2HRCA 2A30A 3N07A 1HL7A 3WLPA 2JIZD 1QVAA 1GKUB 2CE7A 3ESZA 4W5JA 5DCWA 1E1YA 3TE6A 1OFIA 1V3VA 2WB2A 1OJLA 1V11B 2ATEA 2R5WA 5CT8A 3T0GA 3VSBA 4S24A 3QUTA 4OSOA 3SC6A 3WK4A 5IT0A 4G1MB 1Z6GA 2RKBA 1N0UA 2QUJA 1DBWA 1PVDA 1YI0A 3MAJA 4LV6A 4RNDB 4RHFA 4V0ME 5DIZA 5EWMB 4AURA 5KNDD 1Z62A 5A7HA 1EDEA 4LJ5A 3WMRA 1KOFA 2A5DA 2CKDA 3JVDA 4KHZA 3T7KA 2DQSA 4ERXA 2YMPA 4L28A 3DEJA 1CVIA 3M7IA 2Y4OA 4QTUB 3CE6A 1H85A 3AC0A 4G86A 3F5MA 5HDBB 2C5LA 2P8JA 3X2EA 2NYUA 1OAKA 3WK9A 3ZNQA 1UBLS 5JYBA 3F1LA 3Q0IA 5G3YA 2DFVA 3RBXA 3GGOA 1JIKA 1YCDA 3GRKA 1C3OA 1LPAB 1GGFA 1LQUA 3OZTA 3QXSA 1KP2A 4HTAA 4O4IF 4Z8YA 3RBZA 1DI0A 3TBFA 1E1CB 2XF8A 3OY7A 4QC2A 4DA8A 3HJBA 1QYRA 3LWZA 1MEEA 2OGTA 3R3WA 4DNPA 5KUTA 1XK6A 1QAMA 3KLBA 1EHYA 1SCAA 3P0RA 1PJCA 1GQOA 2RMKA 3BRCA 4X6UA 1U1CA 1DRKA 5KYTA 1DEXA 1M7GA 3PC4A 5KINB 3E9QA 1CNEA 3H75A 3L7OA 1DBRA 1WY5A 4LZLA 1CDDA 5FP0A 1M6EX 2O8DA 4OHWA 1HFEL 4U7FA 3IEPA 1Y1LA 5D1NA 3IUSA 3PSHA 2XQIA 5F33A 1ABBA 4YUXA 5SZJA 3IWCB 4QX6A 1ZD2P 3AF4A 3NS7A 4O2BB 2YJ4A 4BQEA 4TL7A 4ENUA 5B53A 2NPOA 3M81A 5HZMA 3KWLA 2V03A 4HNGA 3G7NA 1T0UA 2H6EA 3HYTA 1FLVA 5JI2E 2ZE5A 2OLEA 3HV2A 1XZJA 4N40A 1GA4A 5E4YA 4ZCMA 1XUOA 1FLDA 1XQYA 1DPFA 1Z17A 1GDHA 4WBNB 3KQKA 3MN1A 3THYA 2LR0A 3FGNA 2FYTA 2CF5A 4NE2A 4L0DA 1RPNA 5GV7A 1TM3E 5AOBA 1I6LA 1E60A 3NO4A 2WMOB 2L82A 2YWGA 3H9GA 2AN1A 4ENRA 1OFUX 1CY1A 4A8JA 3EJWA 4JOBA 4I1UA 1L5VA 5TS3A 2BIFA 2RGNA 2NADA 3RVPA 5TJ9A 4IYRA 5ILGA 2I4TA 3H3JA 2DBZA 3VHXA 3AESB 2RSLA 1G8HA 1E2JA 3TNLA 2NU9B 3WYFA 3RO7A 2FMTA 2IPNA 2XTZA 2C84A 4HUQA 5F4ZA 5BSTA 3JALB 2RAUA 2PG3A 5AK6A 2FR0A 5C5CA 1P17A 2H1FA 4K9PA 2FMIA 3H2KA 1JHVA 2HJRA 3IESA 1GNQA 1G19A 1W30A 1Z28A 2H00A 1ZSYA 3MEQA 3I72A 2V7UA 2OFFA 3ETCA 4GXQA 2P9QA 1RFLA 4BJ6A 3PCXA 1PJ2A 4LDNA 1XU4A 3NDRA 1HG0A 3R0ZA 4ZPXA 3UJ8A 4FT2A 5A2QA 2Y2VA 1NN0A 2XUPA 5JSKA 2GCOB 3SVZA 1E61A 1ABEA 1HYEA 3GK3A 4BHTA 3EPLA 8MHTA 4HD8A 1BRTA 2R3SA 3KE9A 4QDOA 4EWLA 3A70A 3FTFA 3QQPA 1VBKA 2X6RA 3LT0A 4UBNA 3K6SB 3JSAA 2X5NA 4QUHA 5AW8A 4RK6A 4ATNA 1E98A 4P0PB 3N8IA 5K3AA 1RACA 3BDVA 1D2EA 3ORRA 4UU7A 4G5RA 3RTDA 4CKWA 3OJFA 3OCVA 4IKOA 4WY8A 4E2ZA 1BJTA 1BG6A 1NF9A 3N6VA 4ESOA 4HQKA 2UAGA 5AW0A 1YVDA 2FSIA 1Z15A 2ODAA 4UJ3A 2B20A 4G0ZA 5EXPA 2ZSAA 3TLKA 1DKLA 2V9PA 2NN3C 2Y4NA 3GMTA 2Y71A 3F5DA 5CK5A 5BSUA 1Q95A 2PRSA 4ABYA 1NSTA 4UHEA 3R7BA 4BMPB 4QU9A 3WO0A 3DEYX 3BRWA 3UJ3X 2IYFA 3E1KA 5JC1A 4LYJA 5EOVA 2PX3A 2Y0CA 1WZCA 3GLHB 5C9ZA 9GPBA 2GTHA 1C1DA 4L8FA 5JC8A 4OX9Y 4FR2A 2NU6A 3D2CA 3V7YA 4DCGA 4EG7A 1TVCA 1E9DA 1PV2A 5I4KA 3UZUA 5KSZA 3B1YA 3QXJA 1PGJA 4BASA 4AY5A 4CCWA 1DXYA 3R09A 1SZPA 3NTVA 1CJSA 1TOAA 2CBXA 3FYCA 4OGLA 4LZZA 4YONB 5JD3A 3RIXA 5ICGA 3K0SA 3TOSA 4RDXA 1Q5PA 2AHRA 3HVJA 1VIYA 1OH8A 3ANLA 3PTAA 2AOUB 1THZA 1PR3A 4RD2A 4DEXA 3SY8A 2DB3A 1QORA 2PRKA 2QL9A 3GHYA 1LVGA 3AU8A 5FQNA 1VPWA 3KFLA 1OGJA 4S2UA 3THYB 1MIOA 2QBYA 1GKLA 1UPAA 2ISSD 3LGSA 3R0IA 2ZJBA 3FUCA 3T7DA 3QLUA 4WGFA 5A5EA 5A5GA 3QITA 4G4SP 4IKEA 1GTSA 4NYMR 1OC2A 3IV6A 3KQVA 1FSGA 4U7HA 4DZRA 3O8NA 4Z51A 3D3JA 4B5KA 3IEMA 3V46A 2PK3A 2ZP1A 4IIJB 3P2KA 4AF8A 5F9HA 3WKCA 5B55A 4NYIR 4WE3A 4PWYA 1L4NA 1E3JA 3WGIA 4NHEA 1ECFA 1YZGA 2HSJA 3LIIA 3QKWA 4HXEB 3MWEB 4CL2A 2ZPTX 2C9YA 1XA4A 3DL4A 1XD2A 4FN4A 2ONJA 4DSZA 3HB4X 5KQMA 4A3SA 1M33A 4KLRA 4UE2A 3WGGA 4BTVA 2ZIXB 4TGLA 3A26A 3WL3A 5IDYA 1Z5WA 2JLAA 3M6XA 2C00A 1KFEB 2H51A 3U5TA 2FEOA 1QRUA 4CTNA 4O63O 1DEKA 3LBIA 3CX8A 1SK9A 4QQNA 1GO2A 2YQ5A 3OPQA 3D0OA 2O3TA 5JMTA 4OF4A 1JIJA 4IL5A 1ZA1A 3KQTA 5D84A 1GPBA 3FFAA 4JZYA 4DL9A 3ZWDA 1LSOA 3AI2A 3TJZA 3SMQA 4DJFC 4XVCA 1K75A 4M7OA 2CLFB 2QM3A 4AG5A 2BISA 4F3KA 5K6AC 2R751 3AHCA 3WIBA 2MDTA 2R96A 1ITZA 1PN3A 1WL8A 2CHQA 3OCYA 2XE4A 4RJIA 4DUZB 4B3SB 1H4VB 4KN8A 3DHEA 4IFEA 1X1QA 2FPGA 1SKAA 4CR6A 1M67A 2JJ8A 2P2YA 4PWZA 4NICA 1X77A 3MSXA 5BRJA 3GPBA 3M6VA 3U81A 4LV5B 4QJ5A 5FXMA 1PFUA 4MVJM 1W2HA 1NMSA 2GKGA 4DIOA 4CIBA 1W25A 3IRUA 3BMOB 4UTOA 4OHYA 3ZTWA 3PI6A 1AQNA 3PJDA 5ICFA 1WSAA 2WV9A 5IAAA 4L22A 1L7AA 5K4AA 2PX2A 1KS9A 3LRTA 2DY1A 5C31A 1AE1A 3RK1A 4LOLA 3FYDA 2VRCA 5LCXA 2JFUA 1H9AA 2EP7A 1Z5GA 5ANRB 5HF9A 1IUNA 1Y8AA 3ANTA 3I0MA 3V9AA 4MV0A 1B73A 4H3VA 1BS9A 1J0BA 4UFPA 5LQMA 4ETMA 2BONA 3ELYA 4O1HA 3K6RA 4KRFA 1UZUA 4UD2A 4MV3A 3DBHB 3L6DA 4MVJP 4X92A 2SECE 3KD3A 4G8CA 3FX2A 2PZLA 2ZAYA 3Q10A 2RGBA 3DLAA 4IDPA 3BH7A 3V2HA 3IQWA 3IJRA 4Q3KA 3VRHA 4C03A 5C81A 4PTZA 1CUZA 1EJ0A 2R60A 2ZUDA 2ANBA 2BE9A 2ZDQA 1W52X 4P5EA 4V1CI 2PZBA 3CEPB 1JXAA 2NVBA 1NYTA 1Q2UA 4ZREA 3OAAA 3VDQA 5HQ3B 1V7CA 2E48A 1E7WA 4M7RA 2M6LA 1RYYA 1SBNE 2CBZA 3O4GA 5EJIA 1DLIA 3TO5A 3VR5D 4EJSB 1S9DA 3WL4A 3K0BA 3IAM6 1R6DA 2IFTA 3WDSA 4TROA 2HRZA 4B83A 4BO6A 1FK8A 3AVVA 4KG7A 1VGVA 2XLCA 4CMAA 1ZI6A 2GCIA 4W8OA 4U1RA 4EHKA 4DR1B 5CBPA 2QNBA 2HO5A 1U0NA 4WKCA 4JNCA 4G0QA 4HWSA 5L3RA 3PG5A 5L3SA 3RSCA 1XTKA 3ETEA 3JQ9A 4JB0A 3C6QA 2E4VA 4TYNA 4PQYA 1PP4A 2FP4A 3KQSA 4PLPA 1NW9B 5IW8A 4F96A 3KQNA 5DHSA 1OSNA 4B4WA 1QS0A 1Z16A 3A8TA 4BDSA 1L8XA 1WPGA 3QU9A 1XZQA 4KJZA 221PA 4QOHA 4EJSC 3Q8LA 3MB8A 1KO7A 3U49A 1RLMA 2HEIA 3EVDA 3S2SA 3S5JA 1GGVA 3LP8A 3V8RA 4EX7A 3AVXA 4Z49A 1YFZA 2BAGA 1NNI1 1NN5A 2GFIA 1PUJA 4GP9A 4WZBA 3TOZA 3TNYA 2IQIA 1Z83A 5EP1A 4PIVA 3VV2A 1VG1A 2BH9A 2X9GA 3M6AA 3MTIA 1WG8A 4AO7A 5HOEA 3H0CA 4BBPA 5B3JA 4MQ5A 1O6ZA 2JFBA 1L9KA 2MT9A 3RG2A 1CP3A 3SSOA 4DCTA 3KJEA 1T4BA 4C7JA 3LUPA 2GAFA 3BGDA 1V1JA 1NUTA 4DSOA 3KEGA 1OH7A 3ZD9A 4H27A 1VPDA 2IYWA 3IPRA 3LU1A 2Z83A 4MKIA 3GLVA 4TKVB 3ZZ0A 3CISA 4WCFB 4LGMA 4AIIA 2FPRA 5E4TA 3D8TA 3EXFA 1NLZA 4ENVA 3W5UA 3PKJA 1KDZA 4R83A 1YK0A 3LV8A 1NJ8A 1OWMA 2C2MA 4LV8B 5G53C 2R7AA 2C1XA 4MYRA 1FXUA 3HP4A 4NJEA 1U4SA 4ND3A 3CN9A 5I9IA 1CLEA 2R97A 3O8CA 1KYTA 4FYWA 2VSYA 3D6VA 2IIVA 1WVGA 1Z0AA 2H2WA 3PP8A 4XVHA 3ZGYA 5FAKA 1G2OA 2P11A 5ES4B 2BGWA 1KWGA 2DPLA 3Q7SA 3K5HA 3CZRA 3LQ2A 4PZZA 5F73A 4GFDA 4V0MA 5JSZB 5J1SB 1XCBA 1PVOA 3B2QA 2GZMA 3HR7A 3RUAA 5C8DA 1U0GA 4KODA 4KO3S 4E33A 1LRJA 1E6WA 2N46A 5DXJA 3T15A 1K2WA 5EHZA 2YFKA 4JU9A 5FWYA 4YUYA 3TPZA 4N39A 4QARA 4IBOA 1MJFA 1QV9A 1RLUA 3LFTA 5KTKA 4HAZA 1B8OA 3NBUA 3PJGA 4UHJA 5LUAA 4C01A 3LHIA 4M55A 2B78A 2FGJA 2YHSA 3LK7A 2HSGA 2IHZA 2CXRA 2F6RA 5C34B 1TZMA 1RR6A 3FVRA 3E5MA 4M0PA 1H2BA 1EFAA 1ST2A 1ODTC 1Z7EA 2QJTA 2ZJ2A 4LHSA 4AZSA 5DZSA 1EDZA 3DBLA 1UKZA 1G20A 1SQFA 2XB4A 4FSXA 4M0UA 4C4ZA 5J2UF 2KI5A 4XVQA 4ZTZB 2C9DA 4IUYA 1YR2A 3ZD6A 1UDRA 2W83A 2YNMD 4IV5A 1Y4DE 3ELWA 2GCGA 4N3CA 4LXTA 5ADVA 3ZWKA 5EIBD 4HVAA 3ZOZA 1J2JA 2CNOA 2VDVE 1TJNA 2OD9A 1OX5A 1NE7A 1T9GS 2IXGA 3KYDA 4LJKA 1DZ3A 4DJAA 5I7EA 3ICWA 1GZHB 4FE4A 3P26A 1ODLA 5FHRA 4UBLA 1ORIA 2NG1A 5JNSA 5HIKA 2J30A 1U9JA 1QPZA 3LX8A 1FFAA 4BFWA 3V33A 1J9EA 1DELA 1XHLA 2W6MA 3QVUA 3FJOA 1MOSA 4WN9B 3R3UA 4OLBA 4CEJA 3KXLA 3TRKA 3RK4A 2MHCA 3ZCXA 3IMGA 4QNNA 2QY9A 4E5YA 2XKKA 4MVYA 2I33A 3P71T 2AN3A 2Q8PA 1Y98A 3ZIUA 4ETIA 1P44A 4N7RA 3H2HA 3PGVA 5JY6A 2Y3IA 1VPEA 4GC5A 1CEYA 1L7NA 1YXMA 4IVRA 1NMEA 1K5HA 3SZUA 2P6NA 2HLDA 3JD4A 4ZARA 3ZGVA 4BU0A 3EC1A 5HJEA 4XR4A 1HT3A 4ECEA 3K70D 5E8RA 3B6JA 2PJZA 1UAAA 2V9ZA 1GFIA 1OUMA 4AUEA 2J7PA 3F8TA 3FI9A 3A14A 2AK2A 3RS9A 1QTQA 1BOFA 1CUVA 1A9RA 3TRHA 3O0DA 3DYBA 4BUCA 2J3QA 3FROA 4ND1A 4Y6GB 4ZA2A 1Y6GA 3QJYA 4MP6A 3V7WA 1XYVA 2ZWOA 1GUYA 2Z8XA 3K5PA 3R5JA 4H31A 5G1OA 1XB2A 1YDMA 1U7UA 2HNBA 2VUIB 5JWRA 3MT7A 1E2NA 4OLAA 1H1TA 1L7PA 1TU0A 1ECBA 3A6FA 2NIPA 3IP3A 4J16A 1QOQB 4OU4A 2J6BA 3BXZA 5I7OA 3IR7A 1K2VN 5KWJA 2FVYA 1W76A 3ZHUA 3DL0A 1QQ7A 3GEDA 2R7NA 5M3BA 4XWGA 1EUQA 4TTVA 3VJMA 4PG5A 2Q6LA 1YIAA 1O6FA 1QF9A 1PR0A 3UMYA 5CR9A 1P1JA 3ESCA 3EOBI 3NWOA 1NY6A 4YP1A 1QONA 2P9EA 4RXMA 1O08A 4C4OA 3JTMA 1KZ7B 2AFHE 2P6PA 3NBXX 1S8AA 1J33A 1G21A 3KQLA 5DH9A 4C3UA 2D1YA 4JXXA 3DDOA 3PDWA 1PBTA 2C4MA 1SEVA 2A3RA 3WHIA 1NOJA 4Z4EA 4M9ZA 3MFQA 3JQBA 3EMDA 2QRGA 1WQ3A 1DZIA 2F3TA 4IFBA 4MS1A 4NF2A 4EPXA 4F38A 2UV8A 3H17A 4QFMA 121PA 3E1SA 4FHCA 2IXDA 2BMWA 2WUGA 1U3WA 3RYIB 3MTQA 3VM6A 4B75A 2P9TA 4MDFA 1ESZA 1IXZA 2QN7A 3IDQA 1G2PA 4C87A 3KPVA 2PUAA 4WD3A 1MEJA 5FEMA 3H9CA 1DTSA 5A9RA 3PQEA 2D54A 3R0VA 4BY9E 3REGA 2IZ0A 2J3HA 1QVVA 5YASA 2H1WA 3AUXA 5TC4A 1LV7A 1V1MB 2YYZA 2V8OA 4ZAVA 4DTIA 4HNAA 2CWWA 5TMEA 5AJVB 4EVSA 1DUSA 1JT9A 3DO5A 3COVA 4L8YA 1OWNA 4LXHA 1CW2B 4YAOA 5CVUA 3CHYA 1XTSA 5BSHA 2GWRA 5AICA 4JI4B 2Q0QA 2B36A 2IU4A 2AD5A 2J9XB 4YAFA 4COKA 1VHWA 2AN4A 1UKBA 1L1FA 1CRWG 5LZ4A 2CSUA 1K0UA 4NPHA 4FD2A 2VJNA 1ISFA 3KR0A 3WBBA 1BXGA 1VJ0A 1LA2A 3M4XA 1WP9A 4Q3CA 4LKRA 2J5QA 1S2MA 2X2OA 3VAZA 1TFRA 3DULA 4Z99A 3U37A 1AS0A 3IWBB 1S8NA 3F0TA 3NRCA 1V37A 3KQOA 2BKEA 1PLLA 2NWQA 4S1VA 3ITDA 3UXHA 4D9EA 5CFPA 1ODSA 13PKA 2JAOA 2DLNA 2PQ2A 4PCVA 2OA0A 3WHLA 3ZGLA 1O4VA 2I87A 3EC7A 3T3HA 1YZQA 2PQMA 2CLCX 2NVUA 3F9RA 4FP9A 4I5DA 2O54A 3ILYA 4GIBA 2RGYA 4H9GA 1EWVA 5IKPA 1B23P 4LSGA 1YULA 5ALSA 1E9FA 1CRLA 4F11A 2CDRA 3V8MA 5TQ2A 1TD1A 1S96A 3DD1A 2ZB2A 5H68A 4B48A 1LLQA 1ODIA 1J0CA 2CXNA 2QRZA 1FDUA 3L1KA 4GI5A 1C3VA 4HRYA 4KGZA 4W1PA 1M9NA 2FB9A 1T36B 3N2NA 1H5NA 3ESXA 3FDZB 3QPDA 3TVTA 4MUBA 4ZOCA 3RC8A 4Q39A 3LRPA 4XEHA 2PUTA 1QVZA 2QX8A 2CB9A 2F48A 3OICA 1JHYA 1WCIB 2NUPA 2V7PA 1JG7A 1X15A 1L7EA 1CPYA 3GLIA 4JUIA 2I99A 2PTHA 5BY2A 4FHDA 1I72B 2YW9A 1P1HA 2UVDA 1I14A 2Y1OA 2ZUWA 2XJ9A 3L3BA 3JYPA 2VDJA 3DF7A 3RFCA 3D8SA 4QJ4A 2ZIGA 5HF5A 1M1NA 2EEPA 2CK3A 3PR1A 4DUYB 4CQLB 4EEZA 4MK4A 2WWRA 4WLOA 5DCYA 3T7RA 3KZVA 3AUTA 5E9QA 1P4AA 1P8AA 2CLKB 1UOPA 5IARA 5TF4A 3ZXXA 4V1CA 3IP1A 3ZGNA 2Z4TA 1C0EA 1G3QA 2ZIEA 4PAMA 2LXNA 3IL2A 2YZMA 4WBSA 2BFMA 2QVXX 2DE0X 5BNZA 1ISRA 3V4OA 5BN3A 4PPNA 1EVIA 1PT6A 5BR8B 1WNTA 5AHKA 3FM9A 3ZN2A 3AL0C 4IWYA 4DM4A 1H0RA 3HWWA 5LZ7A 4HWOA 3B1ZA 3AG5A 2XTMA 5DXFA 3CGGA 1GKIA 2BF7A 3BF8A 1AN9A 1W6UA 2WB4A 1ZQ9A 2MINB 3T52A 4JZKA 1E1QD 1DPGA 2JFHA 1ZG3A 3K9LA 3MGKA 3IR5A 4XGRA 1KQPA 2QEQA 3L7JA 4CCYB 4JI8B 2ZVJA 4M89A 1YR6A 3O21A 4EUSA 4RTRA 4G1EB 1VMAA 4MP3A 1BDBA 1Y8RB 1E1QA 4FGUA 1TYCA 4QXOA 4XA8A 1VJRA 2E85A 4CKEA 1AV7A 4GLJA 5JR3A 4IILA 2QJFA 2J87A 1J5XA 3WBFA 1VIAA 2RC5A 4L51A 5JD6A 2XT0A 1EFVB 4I3HA 4P35A 3D81A 4KPGA 1GL3A 2I6QA 2NZVG 3HYCA 2NO4A 3NTXA 4FE3A 1FSFA 4ID3A 2F1HA 2RI6A 4G2NA 4V3BA 1S1CA 2UUBB 3A4VA 4QUKA 2JKVA 4RH3A 2XY4A 1ZK1A 2M6RA 1J1ZA 4IZOA 3ITKA 3SFTA 3AU9A 4BMDA 5JNTA 3FXAA 4E4TA 3QKIA 1QOPB 2ZQZA 3ZVKA 1V1MA 2VZ0A 4F12A 4ZAXA 4RH1A 4EZIA 4GI1A 3B51X 3D6NB 4FFSA 5BYBA 4PANA 1CE8B 3DAPA 1Z2PX 3ZWOA 5LU8A 2VYCA 4G09A 3U4QB 2NMVA 1GAEO 3NKFA 1CT9A 2I2WA 1IHXA 4GZMA 3QU5A 5JLJA 4HZIA 3ESYA 5FLYA 3UXMA 1HFKA 4KH1A 2RG7A 4DLKA 4EGQA 4L0QA 5TIIA 1GG8A 1C0PA 1T1RA 4H7IA 4F9GA 4W5TA 4YJHA 1XMOB 3ZGZA 1V6CA 2BL4A 2EJTA 4DUPA 3ACDA 1LW6E 2GPTA 3DMDA 5ITSA 3AV0B 3F6BX 3O4VA 3GDGA 2XA2A 3P20A 1AS3A 1G3MA 4YAWA 3DBVO 2OCAA 4N3GA 3PQVA 3PQ4A 3U31A 3AI1A 4LYFA 4B7UA 4EI8A 1M2JA 1MB2A 1WOYA 4BFUA 1OXUA 4UOQA 1OXTA 3FSEA 4GLOA 3I1JA 4MUJA 4F8YA 1Y5LA 5AI0A 1Q1AA 2Y6UA 3GGJA 3TEFA 1FP6A 2PD3A 2QTLA 2GRUA 3WQBA 3M6FA 4DIEA 3A32A 3ROPA 3RWMB 3S1AB 1NE2A 4A8JC 3HO6A 1YIOA 3YASA 1NMZA 2BFFB 2Q2QA 2UYCA 1NNLA 5ALPA 1IATA 1K9SA 1MZVA 3I64A 1R10A 4D8XA 5A0VA 3FBTA 3TS1A 3DGEC 4Q3LA 4CW7A 3C14C 3PUIA 1X80B 4EJFA 3O4RA 3IP9A 4M1QA 3EXEB 7AT1A 5AKKA 2FSFA 3IA2A 4AT1A 4UQLA 3GJSA 2JGAA 5L3SB 4HXFB 4YY3B 1NX6A 1W2WB 4JYBA 2ZYUX 3DD5A 2FPXA 2W2XA 3OC6A 4FZVA 2JJQA 2F1KA 4QREA 3ER6A 4RMGA 4DCVA 2CUTA 1M8PA 3C7AA 2A59A 3KEOA 4P3OA 4K2HA 1F3OA 2QN1A 4TUYB 5KDLA 4GP7A 2HSDA 4KAAA 4YI5A 3NORA 2JLUA 3WIUA 3MJRA 1NUAA 1UODA 2Y9PB 2H5JA 5A0FA 4FUQA 3BTSA 1Q0ZA 3R3YA 1G8MA 4AJ9A 1WB9A 1P3DA 4Q1CA 3V6MA 1K0FA 1JVNA 2HMTA 4Q1EA 2B82A 4CKCB 2O8FB 3EP5B 1BHO1 3NHKA 1HPLA 3JQAA 3JV7A 3L46A 4HEHA 5EJ9A 1RI1A 1ENYA 1UK8A 1N4AA 2PWPA 2FR8A 1J24A 1FTYA 4D8UA 1ATZA 1JAXA 2PWAA 4X7BA 2WD7B 4Q7QA 1QZXA 5A3VA 2P3OA 1I7SB 2ZSEA 1OX6A 4TLBA 1NT2A 4JLOA 1Y7LA 5P8WA 4UHDA 4JAVC 3N3BC 5HBRA 3SJBA 2NZXA 4N5HX 4KQ1A 3OJXA 5KTPA 1WA5A 5KNDA 4DGSA 3ENQA 2I71A 2JD2A 3T4UA 3WLIA 3MTJA 3INTA 3KYJB 5CM2Z 3NDIA 3R9IA 3ZXUB 4LFBB 4JXZA 5ARCA 4GEGA 2WKQA 4GX0A 4AMZA 4GHWA 3TI7A 1S3SA 4KFSA 3ED5A 1ONPA 1ZUWA 3PZRA 5DMHA 3KL2A 3RRXA 5J4YA 3EP7B 1L7DA 2IEZA 3TWOA 3WGMA 4J91A 1VRVA 4DLXA 2Q99A 1GTZA 4Q9NA 1OGYA 1CHNA 1JJFA 2ZDGA 3EBPA 2K2WA 1E5LA 3PQ7A 1QWSA 2XADA 3PGXA 4UM7A 3FH0A 1QP7A 5I7SA 3GA7A 5A4KA 3ZLBA 3D1LA 1ZM7A 4D9FA 2C5EA 2ADFA 1AK2A 1V8BA 3TH5A 2IPMA 5H82A 4IHJF 1XLTA 2C82A 1EB9A 1Z0SA 2N9UA 1G5TA 2Q41A 2Y93A 3ABQB 3O8QA 1KQNA 2X8LA 2IHBA 4YCJA 3KIPA 3VO1A 2AOTA 3CUYA 3EFHA 3G7UA 1HGXA 1Q22A 2AV6A 4FHFA 4MR8B 4UEWA 4DARA 1I2BA 1VA4A 4DDMA 2AB0A 1HY3A 4QEDA 1QO7A 1QB8A 4DY4A 2HWYA 3WB0A 3DZBA 3H05A 1DO0A 1ADBA 3RFTA 4BNHA 1L9XA 3CU5A 4JX8A 1RC1A 2VJOA 4L57A 5CA0F 3QIAA 1B43A 1BH6A 4H3HB 3AYXB 1DARA 2QL6A 3IHWA 4J16C 1M8FA 4O2BA 4EG8A 4F6CA 4OXXA 5DYWA 3LX5A 3E7XA 1WD7A 3BKWA 2E9SA 4BRUA 1MO6A 3CY6A 4KO8A 4ZEMA 3BTUA 4LK2A 4KRXA 3ORYA 5KJCA 5IT4A 1BD4A 4UTVA 3BFPA 5EUQB 4XWOA 1XZBA 4AMVA 2Q7XA 3ROZA 1B15A 3GUYA 1V16B 4TKVA 5FTLA 2TRSB 4O8JA 4PN3A 2PLAA 3W8DA 4FDVA 3Q1KA 3W9BA 4FGJA 4A26A 3PXCX 1XDWA 1DHTA 2C3YA 1LF5A 4BAGA 1N6NA 1OH5A 5GP1A 3MWJA 1NMYA 3S0JA 4P0TA 5JXHA 2IVZA 1NRXA 4D3XA 4NENA 4HNRA 5IG2A 1L3IA 1LPSA 2VWGA 3U4MA 1R4AA 1UMCA 4V3CA 4XWAA 2R62A 3GQBB 2PVCA 3DVSX 3KZOA 2QAJA 3G13A 2X5XA 1NBWB 1JFFA 4HWKA 2ZT5A 4QSHA 5L4SA 1IBMB 3IP7A 5SY9A 2AKAB 4LA4A 2EW2A 1UBNA 1Z18A 1O9BA 1R18A 5HIAA 1ST3A 4FI3F 4BBJA 4TXMA 3PC8C 4N5MA 3GEMA 4NAUA 4I2NA 3BD9A 2BI4A 3AEZA 4KKXB 2NV6A 4OBWA 5GGXA 1M2GA 1Z0DA 2RC6A 4YS6A 1ILWA 4XX1A 4CT0A 3EEYA 1CVRA 4DIFA 4PVDA 1ZGGA 3LY9A 2QLMA 2I6GA 3C48A 3IR6A 3ZHXA 4XVUA 4Y9RA 2VSNA 3CNQS 4F71A 1IEXA 1H93A 1FMLA 2VK2A 3E2IA 1I13A 1RKUA 1TYDE 3EGVA 1RE1A 3NZEA 2B0CA 4NEQA 2J46A 3BF7A 1ND5A 4TKZA 1U2SA 3PNBA 2VTBA 1WZ2A 4S0ZA 4EECA 5A9SB 3EP9B 3DBRB 1CC1S 1ISPA 1IXKA 3IVCA 3UJPA 4EBBA 4EO7A 1VDZA 2D1TA 5T4HA 3T35A 1HDXA 1QQBA 4JVSB 1P91A 4H6PA 1FYWA 3A1SA 4GPEA 4ND6A 1I7QB 2R5NA 5LXTA 2R6R1 3EIUA 5LA6F 2O0KA 4P4GA 4YP9A 3ZDRA 1KI9A 4ZOBA 5DLQC 2VYND 3TUJC 1KEEB 3H2GA 4NFSA 1VB5A 2UZIR 2YWBA 3AW9A 3GNSA 4BFTA 1K9VF 2H7XA 1P4RA 2OSBA 3L79A 5HM6A 3O8OA 5C32A 1ESMA 1X7WA 1YTLA 4XIJA 2AKYA 1NSYA 3DMNA 1QMIA 3OBIA 3VI3B 4FB4A 3LPAA 1K5PA 2QPTA 3HTXA 1DAFA 5FCDA 4L0MA 1WB6A 1E1RD 3SBOA 2YOFA 1C9KA 2WAXA 3WWCA 2BZSA 2C2HA 4D9CA 1X2BA 3EJ6A 5T5QA 2AOUA 4B71A 4F5DA 3ID6C 4HG2A 4DLPA 5IPFA 3GJ8A 1TUGA 1RPTA 2JCXA 2JVJA 3PD0A 5JSYA 3UAYA 1E3TA 1AKUA 1LBHA 2AZMA 3RC2A 5LVAA 4QRHA 4A2PA 4ITUA 4DE5A 1HNXB 1SPBS 2K4MA 3O6VA 2K7FA 4Q9AA 3FAKA 4X1OA 4YJDA 1X7ZA 5T67A 3O31A 4NENB 1BFDA 1ONNA 4YFYA 5AW6A 2ZPUA 3UBMA 4C08A 1VIVA 1GKYA 2QRJA 1Z4MA 4MLZA 5JXJA 3E4CA 2C29D 3DFZA 2II6A 3IT0A 4H4EA 5AJYA 3WKDA 4HT3B 1OZFA 2QU7A 5A05A 3DAHA 5AM4A 1HE5A 3A3KA 4YDQA 4MEJA 1JR4A 2VIIA 3IPAA 4DLWA 2ZS7A 1L6IA 4YUVA 2PR7A 3URMA 2Q1SA 3FRHA 3DMFA 5A62A 2JVKA 1CBUA 3O1HB 2E6UX 1LDEA 1NQXA 1ULBA 4OH1A 1GPWB 2WM2A 4MEBA 5MN4A 4GXTA 2HRDA 1JG2A 4L5CA 3ZQKA 2KX7A 2JCBA 4HN9A 4Z8XA 1PO7A 1C3JA 1X0XA 1JYSA 2HDNB 2Q4BA 4Z7OB 5HR5A 1RXVA 1QQ5A 3QVLA 1TTTA 4XIFA 1E7MA 1SBYA 4Y6RA 5CJJA 4BNZA 1AKNA 2BHTA 3HXKA 3KHTA 4X94A 3WLHA 3I05A 2XOXA 1SR8A 2FZKA 3M3PA 5FD8A 2HMUA 2PMKA 3DDCA 3RRMA 3VUEA 4KVFA 4BKUA 2WU8A 1BA2A 3IIIA 4CM5A 1U0BB 1X3LA 3CCCA 5DLDA 3Q7IA 5IBPA 1A4XA 2ECFA 2Q9UA 4XB6B 5JZ9A 4JUBA 5DF1A 2ZB4A 1T9HA 4HWGA 4KLZA 1GQSA 3NUGA 2WJ3A 1JEDA 2I4LA 1XD9A 1FU8A 1WMEA 2HJWA 3C97A 1AQ6A 1IDOA 2H65A 3DBRA 4X93A 1KC1A 1J06A 3ORFA 3P9YA 3QELA 4BBZA 4C3ZA 3M49A 4F5YA 2KSQA 3FTDA 2J0VA 4HFJA 2IYZA 3PX7A 1YE3A 1SXJD 4D25A 1UP7A 5IJXA 4RJJA 4ZODA 4YAIA 1NVVQ 1Q7CA 1C2YA 3WNCA 5IDXA 4N82A 4JENA 3NXKA 4M1KA 1OLSB 2VP9A 4TLLB 4GKAA 4OHXA 4W9NA 4XIYA 4XQCA 4QXPA 4ENSA 1HT2E 3HRKA 3LQYA 4J2HA 1IDN1 3O5AA 1A82A 4DXDA 4IJWA 4IGFA 1WDTA 3HV0A 3FPCA 3BE6A 1Q0LA 3L41A 3DV0A 3O9VA 3WSVA 3I9OA 1N6PA 5LQKA 1E2BA 4XLTA 4PRKA 1QTNA 4LJ7A 4Q7JB 3EH2A 2ZJZA 4EUKA 5JCJA 2A1UB 4W5OA 2OLKA 4X20B 3KKMA 3T9DA 1PLKA 3T1OA 4WCVA 4DJDC 1G41A 1I1QB 2CMKA 1CZOA 3AM3A 2NZJA 1GY8A 2V7EA 4BAZA 1KZ9A 2ZIUB 4MCIA 5GIOE 4G5OA 4YAUA 3W7AA 2BP7B 2IS2A 2VK8A 3EXHB 2I7TA 3K1YA 1OHHA 3LYLA 4HO1X 5J63A 4CN8A 4JIGA 3A9VA 3W5VA 3DEKA 2PS1A 4EY5A 4L73A 3B48A 5U9CA 4B6EA 1EDBA 4MUAA 3V7NA