1YL6A

Crystal structure of mycobacterium tuberculosis dihydrodipicolinate reductase (rv2773c) (crystal form b)
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
245
structure length
245
Chain Sequence
ARVGVLGAKGKVGATMVRAVAAADDLTLSAELDAGDPLSLLTDGNTEVVIDFTHPDVVMGNLEFLIDNGIHAVVGTTGFTAERFQQVESWLVAKPNTSVLIAPNFAIGAVLSMHFAKQAARFFDSAEVIELHHPHKADAPSGTAARTAKLIAEARKGLPPNPDATSTSLPGARGADVDGIPVHAVRLAGLVAHQEVLFGTEGETLTIRHDSLDRTSFVPGVLLAVRRIAERPGLTVGLEPLLDLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of dihydrodipicolinate reductase (DapB) from Mycobacterium tuberculosis in three crystal forms.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
molecule keywords Dihydrodipicolinate reductase
total genus 72
structure length 245
sequence length 245
chains with identical sequence B
ec nomenclature ec 1.17.1.8: 4-hydroxy-tetrahydrodipicolinate reductase.
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05173 DapB_C Dihydrodipicolinate reductase, C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1yl6A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1yl6A01
1C14A 3OETA 3MTJA 4CLRA 1P31A 3WX0A 3ZWBA 2X0JA 1X0XA 1MFZA 1XELA 3PRJA 1YQGA 4Q3NA 4QXMA 3ZNOA 5ILOA 3DO5A 4JJIA 1O8CA 3TZCA 2EJVA 4XB1A 1LDEA 4L9RA 1DJQA 4QQRA 4BUCA 4GPD1 1I2CA 4I08A 2X0RA 3T4EA 2YUTA 2QZZA 3D4PA 4FC6A 1M2WA 4ZGWA 4F45A 1BXGA 1TXGA 5DN9A 4CM4A 3SVTA 3K6JA 3PJEA 3OJLA 4PLWA 4A5OA 2VHVA 3ANMA 4KOAA 1Q0LA 3DXFA 3GN1A 5JW6A 3GDFA 4PVCA 3FPCA 4J43A 3D1LA 3WXBA 4IDBA 3ZCXA 3N7UA 2RAFA 3KVOA 1U8XX 4IGFA 2RBEA 1RM4A 1Z82A 4B8ZA 2Y0DA 3P5SA 1E7MA 4EW6A 2GN9A 4RF2A 1HL3A 2ZATA 1SO8A 5JNLA 3ORFA 2BMAA 1GUFA 2XF8A 1OC2A 4RF4A 4HNGA 3RD5A 1E92A 4G65A 4NJOA 3KRTA 1I2BA 2XXJA 4TVBA 4MP8A 5EJ2A 1R37A 3NV9A 3IMFA 4K1LA 1I10A 5B12A 2GZ1A 1ONOA 2W4QA 2O23A 3C8MA 1O5IA 1KY4A 3AI3A 4LN1A 1B3RA 5TX7A 4D3SA 2HAEA 2I99A 4FFLA 4PCVA 4YDRA 4DPMA 5G0WA 2V6BA 4F3YA 2JL1A 1A4UA 1XCBA 5CPBA 3Q2KA 1K6IA 3WNQA 1X1TA 3C85A 2LDXA 5TQVA 3QVSA 4Y9DA 2B35A 3GHYA 3LVFO 3ZV4A 2HSDA 1SOVA 1ENYA 1ZNQO 3K2EA 1QV7A 3GZNB 1Z73A 1ZK1A 4PLYA 4XQCA 2I9PA 2PKQP 2G76A 4CLOA 3ZWNA 5A9RA 1DHTA 1MA0A 2VT3A 3PDJA 4K9DA 3AUAA 4R01A 4P4GA 1JA9A 1E1LA 2DVMA 3OIGA 5JSFA 1SMKA 4KQXA 2AA3A 4B7CA 1G6KA 3UN1A 2PR2A 1D8AA 4GSKA 3O8QA 3ZZNA 5L45A 1PWXA 2JCYA 1UXHA 4J3FA 4FOOA 5MDHA 3VTFA 3I9NA 2GN4A 3UHAA 3RC7A 4M89A 2NVBA 5BSGA 3RBXA 4BIIA 1LSOA 3IP1A 3DQPA 5ICMA 1H6CA 4PIVA 4MVJM 2Y05A 2P91A 3HDJA 4B3JA 4L0QA 3PWSA 4CLRB 3M2TA 3L9WA 3INRA 4J4TA 3OJEA 1Y8RA 4BNTA 3MOIA 4QX6A 3M1AA 3NGXA 3TRIA 3CUKA 1K89A 1QKIA 4FB5A 3COSA 1GAEO 3WIEA 2HRZA 5CFZA 4RQTA 5C37A 4TQGA 5CDGA 1LEHA 1KEPA 3GVPA 3EZYA 3ULKA 2Q46A 1OZAA 1LU9A 1EQ2A 4IMRA 2AQKA 5GZ6A 1VJ0A 3AOGA 3GEGA 3GOHA 4LK3A 3RUDA 5F1PA 4CM5A 1V6AA 5B37A 3V8BA 3LK7A 1SBYA 3L6OO 3I4FA 4ALMA 2VYVD 3E03A 3KBOA 4I9UA 1OI7A 1CIVA 3JV7A 1ZCJA 3FTNA 4R3NA 1HXHA 1XSEA 3GPIA 5IN5A 4WPGA 2EV9A 1O6ZA 1IZ9A 1M76A 2VUUA 4NNJA 3OJFA 4A2CA 1NP3A 4W4TA 2ZK7A 2HMVA 5CEEA 1E7RA 1F8FA 1SAYA 3L07A 4PZCA 4NZ9A 4BNFA 4BGUA 2NV6A 3PFWO 2YFQA 4RVGA 2DT5A 1E6UA 4J0FA 5A04A 3IIEA 4YEDA 2JFFA 3FRJA 2I3GA 3KSDO 4UUNA 2QW8A 3ICCA 4CM8A 1WVGA 5F5NA 3IQDB 3R3JA 4BKQA 4CMGA 4IMPA 4NR0A 3UXYA 3ST7A 5TLSA 4W7HA 1I3NA 4QFDA 1OMOA 3JSAA 2AG5A 4XD2A 1UZMA 4GQAA 4PLCA 3JQ7B 1Y8QB 1E3SA 4D42A 3CPSA 3E48A 5I9NA 4E5YA 4GSLA 3DMTC 3DBRA 1C1DB 1D1TA 1UDBA 3QJ5A 1SNYA 3KXDA 2Z1MA 3PEFA 5GZ3A 1I3KA 1P1FA 1U7HA 1N9GB 4J4BA 4LVUA 4P8RA 1IUKA 3TZKA 5IDXA 1VSUA 1QLJA 2X9GA 1B2LA 3AUUA 2D59A 3SJ7A 4LMRA 1PJ4A 1NVTA 4OKIA 6ADHA 3HQ4O 1V3VA 3VAZA 3NRCA 5IXSA 5TF4A 4GKVA 4FFMA 2HLPA 4HADA 4CUKA 4GMGA 1YOVA 1I3LA 4JN6B 3RROA 3OA0A 3L9XA 1XYGA 2C5EA 3FF4A 1P44A 2YV1A 3HJAA 4F46A 1YXMA 1DFHA 4FCCA 2W90A 4FIZA 4H3VA 3PWZA 1F17A 4OOEA 3H8VA 1BTOA 2VYND 1PJSA 4JP3A 4EUEA 3ENKA 2AQHA 1QYVA 2QRJA 5K0ZA 4ZHSA 2OBNA 2IZ0A 5AXBA 4PG8A 3WLFA 4IBOA 1JWAB 1LSUA 2VNAA 2X86A 5JE8A 1AGNA 4DLAA 5L40A 1DC5A 5FF9A 4JJGA 1PWZA 5JFOA 1PZFA 4KMSA 1DO8A 1N92A 3QP9A 4L76A 4JCOA 1A7KA 5G0TA 4D3DA 2R6JA 1PGQA 2W2LA 1PX0A 4LGVA 1U2DA 1T24A 3PVZA 2ZJ1A 5G0UA 3B6ZA 5T8KC 5EMHA 2PKRA 1OFGA 2BD0A 4IDAA 3I1JA 1B16A 3G3EA 4GVXA 1H0KA 4I9HA 2BGLA 3DBHB 3NT5A 2IXBA 4U6QA 1X7DA 3ADPA 2HK8A 5DT9A 3L4SO 5COAA 2GASA 5CEFA 4ZJUA 1JTVA 1DIBA 5BR7A 1A72A 3CZRA 5DNAA 4XIYA 2RIRA 4BV9A 4E2WA 2BGMA 4BNKA 4CM9D 2B83A 2O3UA 1VI2A 4TKLA 5ICSA 4I1IA 3PZBA 2YW9A 3HSKA 1YBVA 4DQVA 3L0DA 3DZIA 5G4LA 3UW3A 2CZCA 3WYBA 1U3WA 5DBIA 1DFIA 4D44A 3FNFA 3ETEA 1TT7A 3JQCA 3KEOA 5COBA 2Q49A 5AXAA 1I01A 5AXCA 1JVSA 2OXIA 5L51A 3U9LA 3AI1A 2DBRA 4XCVA 1H94A 4EYEA 3ONEA 4IY1A 4MKZA 4M86A 5IJZA 3WR5A 1P77A 3RFXA 4IJKA 2W2LD 5IG2A 3B1KA 1PGJA 1Q0HA 3HB4X 4UVEA 1NPDA 3EK2A 2J3JA 4UEOA 1U3UA 4WCFC 5THQA 4D0SA 1C1DA 3QWHA 2H63A 5DOZA 1D7OA 1R0LA 2NTNA 3K30A 4YJDA 4INAA 5JCXA 3RKUA 2H9IA 1EE9A 1TA4A 3AUSA 3VPGA 4Y6RA 3W8FA 3U4CA 3DWFA 2YV3A 2BFMA 4BO1A 1PZEA 2GUGA 2V6FA 1ARZA 2HMSA 4NFHA 4CM8B 1CETA 4FSHA 3G1UA 2G82A 2BGKA 1ZIDA 3HG7A 3B1FA 1E1MA 4RO0A 4K6CA 4X54A 4BGIA 2YDXA 3F47A 2I66A 1LDBA 2ZTLA 1DLJA 2PLAA 2G0TA 4ALKA 5JYFA 3AM4A 3P19A 4RV9A 2P5YA 2Y1DA 2RH8A 1PZGA 2IYOA 4FOSA 3A14A 4QECA 2Y1GA 4JQCA 2FPGA 1UP6A 1HRDA 4FS3A 3JQBA 2VWHA 4KTVE 4AL4A 2Y1OA 1HE3A 4DLBA 2DTDA 4WGGA 4CLXA 1PU2A 1NYTA 2NSDA 4YJFA 3HNPA 1T4BA 1R15A 1N5DA 4HWKA 2IDZA 5T8KA 1C0LA 1IULA 4IPTA 2HK7A 4R3WA 5JDCC 3GFBA 3RC9A 3WQQA 5EESA 4CL3A 2GZ2A 3QVXA 4J6FA 4RDHA 2E82A 1CEQA 1R4MA 5DP2A 1AHIA 2X58A 2WWRA 1B8PA 2H5LA 2O3JA 5EPOA 4PFJA 4LSMA 3Q1LA 2PTGA 3IJPA 4JK3A 3AWDA 3F5SA 3MJTA 4R1UA 1CQJA 4MKXA 5A3VA 2FWMX 1N7HA 2ZQZA 4E2YA 2GDZA 3C24A 3AFMA 1HSOA 3ZHZA 4BNGA 2V7PA 5AOVA 3DBLA 2VHZA 1HYHA 1FDTA 4U7WA 3ROMA 5JAQA 3AM5A 3G1TA 2AQ8A 3JQ9A 4AJNA 2CVQA 5IZCA 3JYNA 4UUPA 4P38A 4YT5A 1UR5A 1H93A 5K6AC 4YT2A 1KEVA 4JBGA 3QWIA 4OOFA 1B14A 1KOLA 4R1TA 1HDXA 2TMGA 3JQ6A 1HDCA 2I6TA 1Z45A 3O38A 4UULA 4DIOA 3JYPA 2IE0A 1ZO8A 2EIHA 1B0AA 2DBQA 3WTCA 1GDHA 5L4NA 3ZHYA 3WS7A 1DRUA 1KBZA 2NQTA 2WSBA 2Z1NA 1KEUA 3CE6A 1T2AA 1E5QA 1WLYA 4MVJA 4FBGA 3EAGA 4HV4A 4HKTA 2YHUA 2J8ZA 3KSZO 3KM0A 2HMUA 2O50A 1WAMA 3PHLA 5JYAA 4L73A 3WMWA 2DLDA 3NTQA 2WTBA 4W82A 3VDQA 1VPDA 4UUMA 3ICPA 1M6WA 2QHXA 1NWHA 3TQHA 4BNHA 4CMEC 4BO2A 2NM0A 3OM9A 4AJ2A 1O9BA 4CM6A 3FWNA 1YBMA 2PWZA 2W98A 4BNIA 1GYQA 1I3MA 2YZ7A 4O0LA 3BYZA 2WMDA 3RSHA 2Y0EA 3RUFA 2J3IA 4YQYA 2E4AA 1ULUA 3W4JA 5JAIA 3EVNA 4OSOA 2ZJ0A 4GWKA 4FFPA 4NBUA 2I67A 3BMOB 4PLHA 4CR6A 4QEDA 3NTRA 1ML3A 1WMBA 1WDKA 3T7EA 3RQSA 5JS6A 1DDOA 4DC1A 5A9SA 5JO9A 2HRBA 3O03A 1J5PA 4CR7A 4NK5A 4RPJA 3DBRB 2HK9A 4IDGA 4DPLA 2OZPA 3IKVA 4EJ6A 1N9GA 4IDEA 4W9NA 3S2IA 4CQMA 3H9QA 2ET6A 3IUSA 3LT2A 4U8GA 4BKOA 4BNMA 1FMCA 4BNYA 1BG6A 2YV2A 4E12A 1BDBA 4MVJP 4J7XA 1Y5MA 1GPDG 2DBVO 1E0DA 4I5GA 5KVSA 1ENOA 1LLUA 4J1QA 3WGHA 1WZIA 1Y9EA 1BW9B 4ND3A 2NTVA 3E9NA 4R69A 5JC8A 4AJHA 2DTXA 2FP4A 3TZQA 1XIVA 3H3FA 1GR0A 3JCZA 5EQFA 5TRTA 4HY3A 3WB9A 1JKIA 3K96A 3G49A 3KOUA 2VRCD 4LCEA 2VHYA 2H6EA 2PFGA 1BXKA 3KYBA 4PLPA 2X5JO 3E8XA 1ULSA 2X5KO 4DYDA 4Q39A 4E32A 1H6AA 4ESOA 5JAMA 1PIWA 4RVFA 3JD0A 2EW8A 5I8WA 1YJ8A 1ZKMA 2GN8A 3CZMA 4CM3A 3T4XA 1YH3A 4B7UA 5CDYA 1Z7EA 4YPOA 1XHLA 4IS3A 1RKXA 3ZW9A 4AJPA 4RPLA 1M66A 1B15A 4RF3A 3GGOA 3GK3A 1HZZA 4PRKA 4ITUA 4RGBA 1MX3A 1NHWA 1J49A 5BSFA 2EXXA 4OKNA 4M54A 3DBVO 4URFA 2C07A 3ONFA 5FI5A 5CP8A 4IDDA 3ZN2A 4BO9A 4PN3A 4XYMA 3V1TC 4E5PA 2PH5A 3Q0EA 2Q4BA 3GUCA 3U09A 2DC1A 4CMEA 3WOHA 2Q2WA 3CSDA 3BA1A 3KLMX 1P45A 5EINA 4BHTA 1LBEA 4TRNA 1VKNA 3FI9A 4RJTA 4XGNA 5GY7A 2JAHA 1FDSA 3E5RA 3AK4A 1P0FA 4XYBA 4ALIA 1DSSG 1ZUD1 2DPGA 4J7UA 1GEEA 3JQGB 1T2FA 3OJ0A 2IZZA 4XRRA 2JJYA 2XAAA 1YBAA 5FEUA 3C7DB 5JDIA 2DQ4A 4W99A 2A9FA 1IOLA 1P1HA 1EVYA 1NBOA 2X9NA 2ZTUA 4NJMA 3AY3A 3AU8A 1DAPA 2POQX 5KCZA 3FR8A 2WM3A 3OF2A 4DMMA 4UVDA 1A4IA 4BQPA 3X2FA 1VC2A 3WYCA 2EERA 4A27A 1DPGA 4ZQEA 1EEHA 4RZIA 1DAOA 4MIYA 1YWGO 4YJHB 5A9TA 2CUKA 1ZJZA 1PJTA 1GADO 1GCUA 2CMDA 3GZNA 3RASA 3ZNPA 1UJMA 4O6VA 3BTUA 2VZ8A 3KYCB 4JXKA 4N5NA 3LLVA 2GF2A 3GDOA 1BXZA 4HX5A 3NT2A 4DPKA 4PZEA 4XJTA 3GGGA 1ID1A 5JY1A 5JLAA 4HFJA 2VRBA 3K2BA 3R6DA 7ADHA 2BHLA 3DAGA 4J16A 1CQIA 1BGVA 3GF4A 3GG9A 4LRTB 1DJNA 5AQ1A 3BTVA 1PQWA 2A94A 3NX4A 3EGOA 3WGGA 4AVYA 4YRBA 4WCDA 3ROKA 4MVJG 5J9GA 3ZWMA 3Q9UA 2Y99A 1PL8A 3AOEA 1EK5A 1V0JA 5DCYA 4MP3A 8ADHA 4DIBA 2OO5A 1AUPA 4XQEA 2HUNA 2DKNA 2Y93A 4GLLA 4XRGA 1PJ3A 3UCFA 2AXQA 3I9OA 3TNLA 3VH4A 1XQ1A 3KETA 4WNCA 1BMDA 2GO1A 4TZTA 4WLNA 1GZ6A 4I5FA 3LU1A 3VKVA 1QSGA 2VUSA 5A03A 3OICA 3BIOA 4GL4A 4GVLA 2RCYA 4N5MA 4OQYA 3ZHXA 2JKVA 1MC5A 1ZSYA 4NMHA 5JC1A 3GEMA 1KVQA 4XQ9A 4YJFB 3U0BA 2O3RA 3AUTA 2Y1CA 5KKCA 5JXWA 2GRAA 1PJ2A 3Q9NA 4YA6A 3ZWXA 2FOIA 2PA3A 5ENVA 3Q6IA 1GYRA 3JD3A 4O1MA 1XR3A 2J5RA 2CFCA 3P7MA 3JQEA 1DC6A 2D2IA 2EGGA 1R4NB 4MJLA 1TVEA 2C82A 1R4MB 2FR0A 4WK6A 1JAXA 2DPHA 2PNFA 3ZNQA 4IIVA 1OC4A 3DONA 1PS0A 4UVIA 4GX0A 3BTSA 1HDRA 1ZMTA 3OQBA 2WJPA 3GVIA 1WPQA 4NBVA 4J2OA 4Y8VA 1R16A 4CR8A 1M6HA 4S1VA 4II2A 1C1XA 3WSWA 2YQ4A 4PGFA 4YAJA 1F06A 2JD0A 4L8VA 2EW2A 1GFSA 4R4JA 3D5TA 3UCEA 1HDZA 5G4KA 1R12A 4CPDA 3H2SA 1EFLA 4EEXA 5I7SA 2OOSA 1OAAA 3PZRA 2XPCA 3NAQA 5HBRA 2Q22A 1SC6A 3UF0A 5A5EA 1WMAA 3IC5A 4C7JA 1UXJA 3E6AA 3U5TA 1I8TA 2Z5LA 1VSVA 4YJGB 1ORRA 3W6ZA 2VCYA 2PD6A 3B70A 3BMCB 3ZWAA 1V35A 1VRWA 5JMPA 5A05A 5CDUA 3GPDG 2RHRA 5HS6A 3K73O 1PJLA 2RH4A 2HKIA 2C20A 2EWMA 2IXAA 2IRWA 2W2KB 3TDKA 1AHHA 1MG0A 1UAYA 3VKUA 1KERA 3I5MA 1HLPA 3VZSA 1T2CA 3JQ8B 1HKUA 3GVHA 3ON5A 4L75A 4GKBA 3M1LA 4FDAA 4Z3DA 5KWEA 1NQTA 4ID9A 5A1TA 3VH1A 1U7TA 3I9JA 1ZBQA 3AOEC 3I3OA 4ROSA 1P9LA 1Z6ZA 5IDYA 4OQZA 5AYVA 1LRJA 3ETDA 3GMSA 5F3RA 4BKRA 1GU7A 3I9MA 3MJVA 5L7YA 3JQ7A 4MPDA 4KQWA 3GLQA 4CQMD 4J7CA 2P4HX 3DAPA 2WE8A 4WJZA 1TB4A 1PS9A 3VPFA 3ITKA 3WDSA 4A03A 3ENNA 1MFPA 2GD1O 4BS9A 1W8DA 1NFQA 4Y6PA 4B4UA 4YJHA 4NQZA 2CY0A 2ZB3A 3BMOA 3HUDA 1NNUA 4XWYA 4R9RA 5L7TA 3KYCA 3SBOA 3P2OA 4LSWA 4WOJA 1CJCA 5CAEA 1LDYA 3TN7A 4JGBA 1V8BA 2ZKLA 4AJKA 1ISJA 4M1QA 3WGTA 4BVAA 2AEJA 2SCUA 3RUCA 1N1GA 3TSCA 3CXRA 1VKOA 1Y6JA 4CLEA 4S3MA 5IZCC 4Y6SA 3BAZA 3WGIA 3MJEA 1F12A 2JCVA 3C1TA 3TL2A 1Y9AA 4L74A 5G2OA 1L7EA 3LZ6A 3DBHA 3V2UA 3G0OA 2HJSA 1X15A 1SPXA 3FBTA 3JQ9C 1TT5B 3PHHA 4RPHA 3OHSX 3R0IA 1IZ0A 2O2SA 1HDYA 5K6AA 2ZB4A 3MWDB 2NVUB 1JDJA 2Y0CA 4OYRA 4FW8A 3WICA 3I9LA 1H9AA 4ZQHA 3GVCA 2CF5A 4DLLA 1DOHA 1LRKA 4DXHA 3EZLA 1EVIA 3EVTA 1BDMA 4FJ0A 4P4LA 4RLSA 4Z9XA 5I9LA 4Z0TA 5ILGA 5G4KB 3DR3A 3T7CA 1MUUA 1X7GA 4PG7A 2WEKA 1WWKA 1EBFA 4IZIA 3LC1O 3D4NA 2D8AA 1YJQA 2BFAA 2C2XA 2HU2A 3UUWA 2VZ0A 3CEAA 4YXFA 2PZKA 3WGZA 3ZV6A 1UAGA 2A92A 3KB6A 4FGWA 2HQ1A 5TGDA 1LLQA 4BB6A 3DZJA 4RLHA 3K92A 4WE3A 1N8KA 3D3EA 4FC7A 4R9SA 4UEKA 2XOXA 1ZK0A 4ONEA 1KVRA 2Q2QA 5KJCA 4BNWA 1SB8A 4RQUA 4AJLA 2B4TO 2D1YA 1BSVA 1N2SA 9LDTA 1DB3A 3R1IA 4JROA 3MJSA 4XGKA 1U3VA 3HADA 5FWNA 1LSJA 2CNBA 5KNLA 3V5NA 3AM3A 1D3AA 1E7WA 1LSSA 4HUJA 4EJ0A 5DBGA 1EDOA 3O4RA 2CVOA 1C1XB 4N5LA 3VPHA 5TIIA 1O95A 4DMLA 2Y1FA 1PGNA 2NVWA 3HDQA 3PGJA 3DHEA 1I24A 5ER6A 1E3EA 1NHGA 5HWSA 5KOIA 5BSEA 1KS9A 2PZJA 1EVZA 3OEYA 4BNZA 1NM5A 3IKTA 5THKA 2F1KA 4LW8A 4YTEA 2Y1EA 3GAZA 2F00A 3AFNA 4IZHA 3F3SA 2I65A 3OIDA 3GA0A 3KTDA 2CF6A 4OMUA 2NUAA 1YB1A 3ZWPA 4PG6A 3F1KA 3OECA 3D64A 3R3SA 1IB6A 2P9CA 4JLWA 1XDWA 3I52A 4B3IA 1Y8QA 4CMIA 1YL5A 1EQUA 1QP8A 2WYUA 3WBFA 2FPPA 1WP4A 2C7GA 2PGJA 1T4DA 1QR6A 1ZXBA 4HBGA 4PRLA 3FCOA 1QORA 2JAPA 5TT0A 4BO5A 3L77A 1G0OA 1A7AA 1ISHA 1D4FA 3PXXA 1WDLA 4Y98A 2IZ1A 4G5HA 1UDAA 1Q2XA 2QIOA 4CLOB 3U4HA 2HMWA 5KJFA 2HCTA 1HWYA 4I9NA 4G2NA 4XJSA 1A71A 2J5QA 1IPEA 1UZNA 1H6BA 1NR7A 2GR9A 2NACA 4L4RA 4E4YA 3I6IA 4ND2A 1HSZA 4WASA 4E6PA 2UYYA 2PGDA 1Q1NA 3RC1A 4N7RA 3RIHA 2PD4A 2HMTA 1ZMOA 3HZZA 1T25A 1PZHA 5JPIA 4JP2A 2O48X 1EK6A 2X1HA 1E5LA 3QIVA 3S55A 1B7GO 3V1UA 1O94A 4EBFA 2AE1A 1NQAO 4O59O 1F14A 3JQDA 2BI7A 1ISMA 4E13A 1MXFA 3VPXA 4LCJA 2OL4A 5KKAA 1PR9A 1U9JA 2UDPA 1YL6A 4NU5A 1IHYA 2WYVA 3A1NA 4HFRA 3IS3A 2Q45A 2ZTMA 2D5AA 3LF2A 2VWQA 4LVCA 1DFGA 3JQAD 3IAHA 1W6UA 2EP7A 2OBYA 3QVOA 4CMKA 4WOKA 2QZ9A 3ZWYA 3BHMA 2X5OA 2JFHA 3TZHA 3IL2A 5IDQA 1CERA 4QSMA 4OAQA 1EUCA 4DA9A 1A9ZA 4TRRA 4XX0A 3U4DA 3RUHA 1VL8A 1Y5RA 4XEHA 1J0XO 1V9LA 2FN7A 2Q3EA 3JD1A 1YO6A 2C54A 2GERA 4RORA 3TFQA 3DFUA 5L4LA 1MXHA 1ZSNA 1NASA 1XWFA 4PLGA 4XDYA 4DIFA 2X8LA 2Q4EA 3H7AA 4OM8A 1LDGA 4B3HA 4CL8A 2J6IA 1TLTA 5LDGA 4C4OA 3I9KA 2NU9A 1GL3A 3S2FA 4GH5A 2G17A 1QLHA 4U5QA 4CLDA 1YL7A 4MVJI 1VJ1A 2NADA 1A9YA 2AW5A 3VZRA 1K5HA 4BMVA 1RJWA 1LLDA 2Q1TA 4EI2A 2PD3A 4CM4B 4CUJA 2VYVA 2NQ8A 2VT2A 4R54A 4CUZA 1DC3A 4RL6A 4OXKA 1C0PA 2H1SA 4GBJA 3OQ6A 1JW9B 5MGBA 1HYEA 3E9QA 4EUHA 4YYZA 3BMCA 3GY0A 5C5IA 2VYNA 2FR1A 5AXDA 3WGQA 3AU9A 1P33A 3KO8A 3VVCA 4XQGA 3HB5X 4Q9NA 3WIDA 5EIOA 3ABIA 2O4UX 1EFKA 4XA8A 2E37A 1S6YA 3JYLA 3KSUA 3ZWOA 3GAFA 3ASVA 5KTKA 3FTPA 1PQUA 3OBBA 5FFFA 3KLPX 3JQ8A 2X4GA 1O89A 4LMPA 5JY6A 4A7PA 3S1LA 1W4ZA 1SEVA 1EDZA 1KYQA 3PLRA 1X1EA 1PJBA 3D4OA 2BH9A 2PGLA 3AY7A 1HEUA 1QRRA 3GUYA 4Q3EA 5HS4A 2OP0A 1PL6A 1MP0A 4ND1A 1LDMA 1CF2O 1DIRA 3LQFA 2R00A 1T2DA 2AG8A 1PTJA 1RPNA 1T2EA 3NJ4A 4AICA 4BGVA 4CLHA 4ALNA 4CMIB 4DC0A 1X13A 2EF1A 3PWKA 1N7GA 1LC0A 3MOGA 4WCFA 4BNLA 3SLGA 1EBUA 5F21A 3WWZA 5C7OO 4CMAA 4H16A 2B5VA 2VTEA 1RYEA 3PK0A 4DRYA 3LT0A 1FJHA 3BMQA 4Q3CA 1ZFNA 2B69A 5L3ZA 4DL9A 1XA0A 2BELA 3CINA 5ENDA 1JKFA 5BQFA 1QYXA 4J49A 4OGWA 3H9JA 3UFXA 1GQ2A 4CMCA 4DUPA 4ND5A 4NG5A 2VZ9A 3BTOA 1NVGA 5EL0A 4BO4A 3WGYA 4HFMA 5FI3A 2OGUA 2QX7A 3DOCA 4AJJA 3GEDA 9LDBA 1U2GA 5LC1A 1N1EA 5EQDA 5L9AA 1Z74A 2QYSA 5A4DA 1YDWA 1FK8A 4NFSA 3KZVA 4E5NA 5CPFA 4NI5A 2VN8A 4I8XA 1TT5A 3L4BC 2UUPA 3UVEA 1MLDA 4FFNA 1CYDA 4AJ1A 3RJ5A 2DBZA 4GGOA 4O5OA 2IODA 4U0KA 4MINA 1SB9A 4CJXA 4J9UE 1B8VA 1NAHA 3RI3A 4EDFA 3LLSA 1WZEA 1K0UA 1ZW1A 4PG5A 5TNXA 3ZNNA 5JBIA 2B37A 3DHYA 5I7VA 1HTBA 4BGEA 4ALLA 2Y68A 4WLUA 4B4OA 3PYXA 3LC2O 1SEPA 1YRLA 4FPXA 2FPIA 3UCXA 3GHHA 4XKJA 3VH3A 2C0CA 1HLDA 2CDAA 1PQPA 3E1KA 1W0CA 4UVHA 4XB2A 1GCOA 4AJ4A 2FSVA 1PEDA 3CTMA 3W8DA 5IXYA 1DEHA 3GRKA 1UH5A 4Z9FA 3QLJA 4BNUA 4CM7A 4YRAA 1S7CA 1RM5A 3RUEA 5U1PA 1GD1O 4CMBA 3SLKA 1D1SA 1XGKA 3ROQA 1LC3A 3Q11A 1K2WA 1P0CA 3ZWWA 5JO0A 2Q99A 1H5QA 4RVDA 2GYYA 1BVUA 3WQRA 2B4RO 1E6WA 3GG2A 3DHNA 1X0VA 2AMFA 5AVOA 1GQYA 3H65A 3JQGA 5I7EA 1A27A 2FRDA 4ZD6A 3NGLA 4MVJE 2BFPA 4TRJA 1XQ6A 4FGSA 1O0SA 4FQ8A 1FDWA 2P2SA 2OHXA 3ONDA 4CV1A 3INTA 5U4QA 1RYDA 1VL6A 3DTTA 3UAGA 5M6DA 3QWBA 4Z3KA 2FZEA 3GR6A 1I33A 3GT0A 4PLZA 2XXBA 2QYTA 3PJDA 4J0EA 4O63O 5DOVA 3EDMA 1M67A 3OQ1A 4RF5A 5C3MA 4UVGA 1WDMA 3MTGA 3WQSB 1KIFA 3PQEA 1E77A 4RDIA 2UV8A 1FF9A 2TMDA 3KYDA 2HO5A 1QYCA 2P68A 3L6EA 2V6MA 1NTOA 4A73A 3DB2A 1QYDA 3JD4A 3P2YA 4NBTA 4R16A 1DRWA 1JU9A 3LC7O 1AXEA 2Q1UA 2X9VA 4ZQFA 1SZJG 1F8GA 2AE2A 3I6QA 1K6JA 2J5KA 3H3JA 4LISA 4IXTA 4TWRA 1LXCA 1K3TA 2GGSA 2JFGA 4RPGA 2DU8A 4JNKA 3IP3A 1HE2A 1YOVB 1MB4A 5F1OA 3GDGA 1U1IA 1I5RA 3DC2A 1WXDA 2NLOA 2CDBA 3PJFA 4UEJA 4R51A 1ZK3A 4K26A 1NVMB 4BB5A 4NDNE 4NU6A 1GYPA 4WUVA 2E48A 1H2HA 4D41A 1LDNA 3DEYX 1DIHA 1P1RA 4KDFA 1HF3A 4C7KA 2GLXA 5A5FA 2DUUA 1ISGA 3ADOA 4GI2A 4IDCA 4NBWA 1GEGA 4NFYA 2VHXA 3ZGYA 4HXYA 3ZV5A 2Q1WA 1JQBA 3MJ4A 2I5PO 5T67A 5ITVA 1KEWA 1LLCA 2O3SA 2X7HA 1E7SA 5CG2A 1Y1PA 5JCJA 1IYZA 1E3JA 1EUDA 1FXSA 3QA9A 4U6SA 2QQ5A 4TMFA 4DGSA 2WD7A 5T6BA 2YJZA 4K28A 4BNJA 4YVFA 3DZGA 3LT1A 2WE7A 4E2ZA 5GZ1A 5FYDA 4N54A 1JVBA 1HETA 5JYEA 3V2HA 3WWYA 4EEZA 3MJCA 1U4OA 1P1JA 3RCBA 1UXIA 3QHAA 3E18A 2YYYA 3KV3O 3WBBA 4QO7A 3WTBA 4GGPA 1GV0A 2YY7A 4XR9A 4F6CA 3JD2A 5L95A 2PV7A 1KC1A 4R41A 4OHUA 4BNVA 1Q7GA 2EJWA 5KJ6A 4YRDA 1FDVA 2GZ3A 3DMTA 3GC6A 4TVOA 4XGIA 4YQZA 3LSYA 2NU8A 5ITWA 2JCXA 4J2HA 5EN4A 1LX6A 4R1SA 1GUYA 2IEDA 4A26A 2FZWA 4AJOA 1V3TA 3IOYA 3ZDFA 3K5PA 4Z0HO 1VE9A 2GN6A 4ZRMA 1R0SA 5T57A 2BFOA 3SXPA 3JTMA 4JX8A 3OEWA 2CD9A 2PH3A 5DCWA 1XG5A 2ZCUA 1TEHA 1WNTA 2UAGA 4GX2A 3EY4A 1YQDA 5C7LO 4ZQBA 5IFLA 3KEQA 8LDHA 4DBVO 1T26A 3C3XA 3FPLA 4KUGA 5KVQA 3EYWA 3HWRA 3BHIA 3QVWA 3VC7A 3PFFA 2GSDA 2NWQA 4L4XA 2W8ZA 3UICA 4NJMB 4II3A 4BQRA 4M55A 4OL9A 4TKMA 1ZSVA 1HDGO 3RFVA 2BLLA 4AJEA 2OUIA 4J9VA 3HFGA 3FNHA 1UP7A 3W6UA 3AY6A 3WJAA 3WSVA 4I5EA 5U9CA 4MVJD 1F0YA 3SJUA 5B4UA 1LI4A 4YAGA 3F46A 4OJNA 3PIIA 3QVTA 2ZB8A 1WW8A 3A28A 1LQTA 1Q7BA 1DIGA 1U4SA 1H2BA 2P5UA 4B8WA 2EP5A 5DULA 3U49A 1KVUA 1YVEI 4PLVA 2P4QA 4TRMA 2X6TA 3N74A 5COQA 1DBVO 4LRSB 2BF7A 1AE1A 2PK3A 4OXYA 4H15A 4NBRA 3QWFA 4ZVVA 6LDHA 1I0ZA 3LT4A 1HZJA 3F5QA 2ZTVA 4Z9YA 2X23A 3ZU2A 2P9EA 5B1YA 3TPCA 3DZBA 3DL2A 4ALJA 3VZPA 2JD2A 4KWHA 4FN4A 4DQXA 3BXXA 4AJIA 2EGHA 1Q0QA 4IGEA 1NFFA 3LYLA 3PPIA 4BMNA 4CMJA 5IF3A 5T64A 2X0IA 1T1SA 4XZ3A 3FR7A 1SOWA 2HDHA 5TSDA 4GMFA 2VUTA 3RBVA 3W1VA 1LNQA 4IINA 3E82A 3NYWA 4J1TA 4E3ZA 1B3BA 2WDZA 2FHSA 5BT9A 4BO7A 5IN4A 5G0VA 3ANLA 3HN7A 4WLFA 2BRUA 4PG4A 3DZKA 2QRLA 1DC4A 4OSPA 4ZN6A 4IUYA 2CVZA 2DTEA 4P22A 2ILTA 2J3KA 3WYEA 1VLLA 1LRLA 1MV8A 1XLTA 5A02A 3PLNA 3SC6A 1Q7CA 3K9QO 2YFHA 2ZQYA 1IL0A 2C29D 5CEJA 2AEMA 1U8FO 5JCJD 4DYVA 2V65A 2Y67A 4M49A 3MZ0A 5LDHA 2O4CA 1EVJA 4WEQA 4JBHA 4QO8A 5I8ZA 5TJ9A 4MIOA 4BO8A 4ND4A 1YDEA 4EITA 3PTZA 4HNHA 5H81A 5DF1A 4BOYA 2VRCA 4BNXA 4WLOA 1FDUA 1PS8A 4NHEA 3RU9A 4Q3BA 4P4NA 3WLEA 4JBIA 3PP8A 5F5LA 3RVDA 2FR8A 1JKJA 3GVXA 3DAFA 4YBZA 3SX2A 4IJVA 3IUPA 3HE3A 4KUEA 5JMWA 3W4IA 1GY8A 4XYGA 2BI8A 3SEFA 4FD3A 2R2GA 3CKYA 4UUOA 3LDHA 4F6LA 5BNFA 3NKLA 3MEQA 5BNIA 3ITDA 1JN0A 1BRMA 4D79A 2E49A 1NWCA 1P74A 3QSGA 1ZK2A 1RM3A 1JAYA 2GNAA 1W73A 2NU7A 4GWGA 4YCAA 3SC4A 5JAZA 4ZRNA 5EERA 4DTIA 4R5HA 2C2YA 2Y66A 1C3VA 2HJRA 3K8ZA 4NH4A 4FJ1A 3CH6A 4GX1A 3ZI0A 1HYGA 3KUXA 2G1UA 1GPJA 5JDCA 3CMCO 3FNEA 1PL7A 1R6DA 3D3WA 3RKRA 3F4BA 2QG4A 3JQFA 3TWOA 3FWZA 4UREA 1YB4A 4PLTA 4XYLA 4UAGA 1I32A 1VM6A 4YAKA 1MG5A 3JYQA 4BKPA 1CDOA 5I7FA 1BWSA 3INGA 3ZV3A 3NTOA 4OO3A 4BO6A 3PGXA 5ES3A 1IE3A 2JHGA 2VWGA 3QY9A 3KYDB 2PZLA 1NR1A 4QT0A 1HE4A 1ISFA 1NAIA 3AW9A 3F4LA 5A06A 3E5MA 3L4BA 3DFZA 4IJUA 4CV0A 3ZWVA 3PQFA 2DUWA 3I4CA 4EJMA 1NFRA 5IZ4A 1IY8A 4FJ2A 2Q50A 1T1RA 3ZU3A 5DZSA 2VNSA 3TJRA 4PVDA 5BNTA 1NPTO 2C59A 3AI2A 5CDTA 3D7LA 4XIJA 5GMOA 7MDHA 1JLLA 1MC4A 1ADFA 4M8SA 4WLEA 4NPCA 1ADCA 1EE2A 1GQQA 1ONPA 2Z95A 4IQ0A 1U5CA 4BMSA 4FFOA 4CM9A 3D5QA 1Z75A 5I9MA 4E33A 3DZFA 4DWVA 1R0KA 3STHA 4EGFA 1ZZEA 2JHFA 3B20A 3FD8A 2DFVA 1SCUA 4WLVA 3RAJA 5HM8A 3WGOA 4GLOA 1KY5A 1ONNA 4IJWA 3C7CB 3TOXA 3TF5A 1U3TA 3VDRA 1HT0A 1R4NA 2A35A 1RM0A 3OH8A 1J6UA 2VQ3A 1DXYA 1ZK4A 5DP1A 3BHJA 3DBLB 4KUHA 4PZDA 3EHEA 4D3FA 3JQBC 5H83A 1OBFO 2WD8A 4W9NC 4AG3A 3NDJA 2CDCA 4H7PA 1P1KA 1ZH8A 5TC4A 2UUOA 2IYPA 2X0NA 1E7QA 4YACA 1TI7A 3VPSA 4BL5A 1ZVMA 4J91A 1ISIA 4A10A 1E3WA 4MO2A 2P9GA 3NDIA 1VJTA 3NT4A 3C7AA 3FBGA 5IAAA 5DDIP 1LJ8A 4B7XA 1E1NA 2E6UX 3PIDA 1R66A 2A4KA 1BXGB 5B4TA 4N18A 1ENZA 2AHRA 4B4VA 4CV2A 1CRWG 1Y81A 2VHWA 4MP6A 4ZICA 1X7HA 4D43A 4WKGA 3G17A 1UP4A 5J23A 1XU7A 4IQ8A 5BSHA 1YONA 3EMKA 3H2ZA 3UGKA 4YJGA 5G0SA 4KP7A 3OJOA 1DHRA 3W8EA 1PR3A 1I36A 2EHDA 5ER9A 4CQLB 2OMEA 3JYOA 4U0JA 2PKQO 3DTYA 1C0KA 1ZEJA 2NTJA 3M6IA 4ZQGA 4Z0PA 5L53A 4IQGA 1GZ4A 3MWEB 3A4VA 3GGPA 5KVVA 3Q3CA 2JD1A 2IEBA 3D3WB 4WEOA 1QG6A 4B79A 3X2EA 2ZB7A 2FMUA 5DCUA 5HTOA 4E5MA 1E3IA 4XYEA 3GMDA 2ZYGA 3ZHBA 3WFJA 1NXQA 2EKLA 3WJ7A 4W7IA 4OIMA 3PHIA 3N58A 3HN2A 3F6YA 2C5AA 1EZ4A 1QYWA 3L6DA 4QFCA 3H4VA 1LA2A 1I2ZA 4TZKA 5TS3A 3VOSA 3ZW8A 2DM6A 3IDSA 3MCVA 4Y67A 2GCGA 1E7YA 3HHPA 4XDZA 4WCFB 3UOGA 3VTZA 1JWBB 4D45A 3QE3A 2ZYAA 1NPYA 4RVSA 4KWIA 1AXGA 3TFOA 3OP4A 4YR9A 5HRUA 5A9SB 3OMLA 2AQIA 1G0NA 2B4QA 2OP1A 4E31A 4TSKA 4R68A 3RUAA 3JQAB 2O3TA 3H9UA 3WFIA 1YS4A 1XKQA 3S2GA 3BMNA 2PZMA 3DOOA 5L7WA 4CQMB 4YWJA 4NIMA 4A0SA 4J1SA 5JYDA 4BNNA 4OXNA 2X22A 4IXWA 3H6KA 1DIAA 3H5AA 4M87A 3GNTA 5H82A 3O8QB 4E30A 3W4KA 1KVSA 3TOZA 3H9GA 4E5KA 1C0IA 3ETGA 1PGPA 4W6ZA 2BKAA 1X14A 4ZU3A 4CMHA 3PHGA 1HDOA 4JJFA 3NUGA 1IHXA 5KJEA 1GUZA 2VTDA 4KZPA 1KVTA 1UXGA 1UXKA 2YDYA 2GPTA 4MOWA 4YAIA 2UVDA 4E21A 1AN9A 1CWUA 3PHJA 2FSSA 1UZLA 1YB5A 1B8UA 3OA2A 2I76A 5TJHA 3QW2A 2NVUA 1E6EA 1B26A 4K6FA 1DLIA 1BVRA 3VVBA 3UKOA 3V1YA 3O26A 4IDFA 2NNLD 1P1IA 4ZA2A 3RWBA 4R1NA 4YT4A 3DMYA 2PY6A 4WNIA 3DDNA 5LCXA 1E3WB 4RCVA 4BO3A 1U5AA 2YHIB 4JIGA 5T73A 4Q3AA 4KTTE 4YAEA 2OFPA 5KIAA 3CIFA 2C7VA 1Z7BA 3F1LA 2QRKA 5F1KA 1J4AA 2EKQA 4MIEA 2O2YA 3C1OA 3H5NA 3KHUA 3PDUA 4I5DA 3PI7A 3H9EO 1K6XA 2DFDA 3EC7A 3GRPA 3QRWA 4CV3A 1IPFA 4RPKA 4XR4A 4IM7A 3RC2A 1A5ZA 1YGYA 2B36A 4TROA 3D0OA 4CQLA 3AJRA 3ASUA 3ZU5A 3HFSA 3QQPA 1E3LA 3RFTA 4R5MA 2ZYDA 1YE3A 4AFNA 4QTZA 1GV1A 3OSUA 2Q2VA 4GX5A 3FNGA 4BO0A 2CSUA 4HP8A 2D3TA 5B4VA 4B4WA 1PSDA 1E1KA 4GAEA 4YB8A 4CODB 3GN2A 4D46A 1DRVA 4IS2A 2D0IA 4MKRA 1PGOA 2ZIZA 1P3DA 2OORA 1KETA 1ADGA 3A9WA 5HA5A 2R00C 4DREA 2VWPA 3OFSA 1M75A 3HDHA 4KDEA 5K9ZA 1ADBA 1PJQA 1NQ5A 3QV1A 1GTMA 1LTHR 2O7SA 3DOJA 3ROPA 5A3JA 2B5WA 3TL3A 2W2KA 1EMDA 3I83A 3BZUA 3RUIA 3EUWA 3WNVA 1LQUA 2VOJA 3BMNB 4FR5A 4E2XA 3UH1A 3CMMA 3GH3A 2I3AA 3IJRA 3GZ4A 1Y7TA 4BKUA 1QMGA 3E9MA 2WYWA 3HDYA 5DBFA 5ADHA 4OH1A 4PLFA 5TT1A 1NX6A 1ENPA 1L1FA 3U3XA 1RWBA 3FSRA 4J90A 3B1JA 2O3QA 1BHSA 3NJ8A 3GQVA 4DQUA 2O7QA 5JDIC 3PYLA 5CG1A 4L4SA 2AEFA 3GFGA 1QXSA 3GNSA 4YT8A 3NEPX 5L4SA 3RJ9A 5KVCA 4WECA 2RHCA 2G5CA 3O9ZA 3JQFC 3Q2IA 4MVJH 4CM1A 3JQAA 5CDSA 3LF1A 4EUFA 3S8MA 3ZU4A 4FFRA 4HFNA 3NDRA 1H6DA 3ZWCA 1PJCA 1XEAA 3A06A 4RZHA 1XU9A 3U4IA 3V2GA 4EZBA 1UUFA 1EUZA 1LUAA 3C1AA 2D4AA 4RVHA 2YHIA 1YKFA 3GNQA 4RVUA 3PQDA 5C7IO 3BMQB 2Q1SA 4J4HA 1VL0A 2YQ5A 3VH2A 3WG9A 5T5QA 1UDCA 3QWAA 3DZHA 1Y8RB 4D0RA 2V6GA 1MGOA 1HE5A 1KC3A 2DAPA 1H9BA 3VZQA 2ZCVA 1I30A 3F9IA 3WMXA 3RBZA 1ZEMA 2LDBA 2EEZA 5IDWA 3ZH2A 1GZ3A 1OOEA 4IIUA 3PJGA 1L7DA 4ILKA 3FN4A 4BV8A 2EG9A 4DBZA 3G79A 1V3UA 5KJ1A 4Z6KA 2VOEA 4G81A 1U28A 4MDHA 3EW7A 1G1AA 1ZXLA 1NQOA 4Q3DA 3K31A 3U62A 4E0BA 1BW9A 3I23A 4J1NA 1ZJYA 3RU7A 3FHLA 4NK4A 3VHRA 2B0JA 2D5CA 2EKPA 3PYMA 3TZ6A 3M2PA 4MVJF 1YQXA 4DVJA 2WD7B 3H5RA 2NU6A 3OIFA 2FY8A 4QUKA 5CHEA 2J3HA 1QV6A 3S2EA 4D7AA 3ANNA
chains in the Genus database with same CATH superfamily
3ZWDA 1C2TA 3GFVA 1GGJA 4JY7A 3SMVA 4CLRA 3TG2A 4BTVA 2IVFA 4OBEA 3VBEA 3F9RA 2GBIA 4G8CA 2OCGA 1DX4A 4J76A 1Z5NA 1H0HA 2G8LA 3AUKA 1VKHA 3PDHA 3SQDA 2BW0A 1UOPA 3ZNOA 3V7UA 5CLFA 5ILOA 3CGWA 1MMFB 1D2GA 1O8CA 1OLSB 1OPRA 1DJQA 3AJDA 3C39A 4NAVA 5FUWA 4BUCA 4G5SA 4IQ4A 3H19A 4NXNB 5E3JA 4I08A 1WA5A 1XTQA 5GPBA 2A0WA 2YUTA 2QZZA 4FC6A 4IKOA 1WKBA 2Q9AA 1R8QA 3DTVD 5IYZF 2VKQA 4H1UA 1BXGA 1H22A 1B0UA 1TXGA 2VTBB 1M5RA 2ZSJA 2Y2UA 4G4JA 3PJEA 4A5OA 1WV0A 4M8NE 5C5DA 1PR0A 4REQB 4ZVLA 1Q0LA 1ZHHA 5JZVA 3JWPA 4AG6A 3DMPA 2YBEA 2NO1A 3ZIAD 3QPCA 4FGZA 4PVCA 5JHGB 4J43A 1QHHB 1QIJA 1TD9A 4IDBA 3T15A 2QUZA 4RFSA 3RSZA 4B71A 4O2AB 2GK4A 4U1RA 5FO1A 3SYRA 3UQYS 4QA9A 4G63A 5DXJA 1RM4A 1Z82A 3V32A 5ADWA 1H4TA 1HR0B 2DETA 1KDYA 3P5SA 3HR7A 4KAXA 1LBSA 2HQBA 2V98A 1OI3A 2HJGA 2MT9A 5BOVA 4ZI7B 2J3MA 3HRKA 4LTMA 3CLRC 3OLQA 4O2BB 3IVMA 1MH9A 3RD5A 2G9NA 1E92A 4NJOA 4V0QA 1KDPA 1I2BA 4XH9B 3GWZA 4C4XA 5AVVA 4TVBA 3HSYA 3KU1A 1QONA 1R37A 1UJBA 1SK8A 1TK9A 2QTFA 2VDOB 1I10A 2ZIAA 1XJWA 4MHTA 1Y4AE 3L7OA 1IN8A 2I3BA 1E2JA 1KA9H 221PA 3AI3A 2I0FA 2L42A 2Q41A 4U2BA 4YRPA 4AZ3B 4XM1A 2X0EA 4BP8A 2QPLA 3H6HA 3KQWA 3MLAA 3NUQA 4AP5A 3WNCA 4P2GA 3R74A 3S8EA 1BNCA 4KR9A 4DPMA 5G0WA 3WAKA 1M8GA 3ETHA 2HX1A 3UK6A 2C2GA 4I8DA 4DLYA 4PAMA 2ZU0C 2YKGA 5IS2A 3WNQA 3PQ8A 4EABA 5C7YA 1Q11A 1RTTA 2X9LA 1PX2A 5AW6A 2BGUA 2H5JA 2PN1A 3MMNA 5C53B 2Q4RA 1SA0B 7YASA 1SOVA 3SYNA 1PSZA 3K2EA 2FP3A 2RK3A 3GZNB 1ZK1A 3K35A 4FKMA 4HAZA 4HH1A 1TJ5A 2PKQP 5CUQA 2Z3WA 2XMDA 3U7HB 3A3NA 3SZUA 4ZAGA 3UT0A 5LUAA 2HJHA 3FHCB 3RS0A 3RHZA 1E1LA 1JLHA 1KRHA 3BG5A 4Q47A 4HWOA 3A2KA 1IIRA 4JOQA 1IOZA 2PR2A 3K1AA 5LB2A 3DHWC 3U6KA 5BSRA 4FYYA 5GV7A 1UXHA 3ESBA 4OH7A 3UOWA 2OCPA 1QGOA 4TV9A 1YDFA 1Q5PA 1H2YA 1LPSA 1EH5A 1ZW6A 3KXKA 1H0SA 4FE7A 2GN4A 3WGVA 3RVNA 4GR9A 4M89A 5TDHA 1PZMA 2EBFX 3SQOA 3DQPA 2VUIB 5SZHB 1KY2A 2P2CA 1QLWA 4FZRA 2F9FA 3ZZTA 4UCWA 1ODIA 2P91A 3FYTA 1IM2A 3GT4A 4L0QA 4Y7DA 3P2MA 5ETJA 3INRA 1X2BA 4MZDA 1Y8RA 3MUEA 4K88A 4BJ3A 2ZRQA 5KHOC 3M1AA 2CEKA 4C88A 3TRIA 4TM8A 3AERA 1N6PA 4FFBB 3CTPA 3KZ1E 1K89A 1QKIA 1GAEO 4NECA 5AHXA 5FIUA 1F6BA 3IBFA 1DAEA 2XZPA 1FU8A 2BBSA 2ZJ3A 3ACBA 2Q6OA 3CRNA 2UUCB 1F5NA 1Z2OX 2VPQA 1ODTC 4Q05A 1XK7A 1OTXA 4DCMA 1EQ2A 3WGNA 4IMRA 2OSBA 4LV6A 4XFJA 5DT2A 3AOGA 3GEGA 5IYZA 2O1XA 4PXSA 4CM5A 3HPQA 4N7MA 3UK0A 1RADA 3LK7A 4UDXX 1SBYA 3GD7A 3L6OO 3I4FA 1E9CA 1GTVA 2Z1DA 4FEGA 5E4YA 1XZJA 4BEBA 6Q21A 1XXHE 4JVNA 3UEOA 1ZCJA 1A5TA 4R3NA 3LY8A 4IIGA 4H2DA 4R1MA 3KDSE 1HXHA 1VG9B 3A2LA 2VAMA 2VUHB 4J8PA 3BE6A 1O6ZA 4NNOA 5EZQA 1YE8A 3N0XA 5AVUA 4F9FA 4IL5A 1NP3A 1SXJB 4FI3C 4AECA 3REQA 2G40A 3L07A 4G8BA 3ILYA 3KJZA 2OK7A 4WXPA 3V3KA 1FVXA 1G4UR 2NO9A 4DCSA 5LNK6 4U7GA 4PHFA 4P36A 1R64A 1EDEA 2X40A 2WKRA 4HDMB 2JFFA 3T7DA 1CLEA 3E4DA 3FRJA 3KSDO 2WF5A 2OG1A 5MN6A 2HI0A 2PSSA 3SQNA 2XUAA 1U9ZA 3CN7A 3ICCA 4CM8A 1RBZA 3SR0A 1J9EA 3Q9LA 1WVGA 3AF6A 1Y9DA 3MGKA 4MJ7A 4BKQA 2EEPA 2YN4A 3UJAA 4LECA 1N6LA 2XNCA 2FW8A 2I2XB 2YCBA 3QLVC 3ST7A 3Q5DA 1I3NA 5LJIA 1XEWX 3L43A 3P1JA 2AG5A 4ZDJA 4PLCA 4YAUA 3JQPA 1Y8QB 5DGIA 1XD2A 2WIJA 4D42A 3KFVA 4KDRA 3QKRA 2G4CA 4HYYA 4RLFA 2A3NA 1KWGA 4M9RA 3A1WA 3HJCA 2HU5A 4RM3A 2AJBA 1D1TA 1A8UA 1UDBA 2IF2A 2ZJAA 4DA7A 5HILA 1R0XA 2EJCA 4INPA 4C5CA 3GLGE 2Z1MA 1DELA 4JQOA 1N9GB 1U7HA 1NUHA 4P8RA 1IUKA 2C9ZA 5FTWA 2X8JB 1XRMA 3DUFB 1JHQA 4ZAXA 3EYAA 2P8JA 4E08A 3EH2A 4FYWA 4QOEA 2P79A 2XKJE 3QNWA 5K99A 1C3OA 5CDFE 1XK6A 2NUTA 3E9ZA 2D59A 4BMDA 4LMRA 1PJ4A 1JYEA 3ESQA 1CT9A 3COVA 4PEVA 1U7UA 2F67A 2Y6VA 3OQPA 4DWOA 2N1MA 5T4BA 2EBHX 4GKVA 2HLPA 4GMGA 1YOVA 1I3LA 4M1TA 3PIRA 3OUUA 4QPJC 4ENQA 1YUNA 2BMDA 2XGGA 4MCHA 5LP6B 1TJYA 2ZE8A 3OA0A 4WACA 1XYGA 4O89A 2ODPA 3IAAA 1R3UA 1OBOA 2YJNA 4MMXB 4TZ6A 1C3XA 4OBBA 5TQJA 3WMRA 3I73A 4WW0A 3TJMA 4FSXA 4HL6A 1YXMA 4FIZA 1R8SA 3J81k 1I2MA 2C2MA 3PWZA 1RPAA 1S0UA 3H8VA 1EHCA 2XE8A 2VYND 1MO6A 1PWYE 2HA5A 2VA8A 4JP3A 4EUEA 2ZJ2A 1QYVA 3DOEA 5K0ZA 4PE5B 4ZHSA 2OBNA 3K70B 5CIWA 4X7BA 5AXBA 1E9DA 3PG5A 4B3HA 3SK0A 4ZCIA 2H5EA 3PNVA 2X86A 1Q0SA 1O08A 5KDDA 1JB9A 4TQ9A 5FF9A 3Q88A 3L40A 3A04A 2HMYB 5TS2A 4B47A 3AKZA 2AJ8A 1R0BA 2P2ZA 4JLOA 4JKYA 5EMNA 2V58A 2CXTA 2V59A 1Q6YA 3GRRA 3QUAA 5G0TA 4D3DA 4G1FA 1PGQA 3O1LA 2DSNA 3H97A 3PUIA 3PVZA 2D7CA 4B8YA 3CZ5A 3WIBA 4WY5A 5JNUA 3AR7A 3KT6A 3G3EA 2D2VA 1YS1X 5DRTA 3FAZA 4D56A 3BKXA 3BWBA 2F9MA 1JHYA 1XTTA 3KTOA 2IXBA 4FYJA 5KNDA 3EGIA 4L02A 4MHSA 1A2OA 1B6RA 1M2VA 3HO1A 3DFFA 5COAA 2GASA 5DYGA 1T1IA 3EGXB 4ZJUA 1JTVA 1KJ8A 3O7MA 4F4JA 2AZTA 1J99A 2F43B 4TWIA 4C0HA 4CN8A 3LNCA 4GLJA 4E2WA 1FA9A 1NNSA 3KQKA 1KO8A 4G0ZA 4URWR 3SY8A 4C4PA 3SZLA 3KJGA 3VRHA 4CM9D 1WF3A 2A14A 1CUUA 3C14C 1RJFA 2HK6A 3MFYA 3OPVA 4KV7A 4MTLA 1H1DA 1YBVA 4FYKA 4C2TA 3L0DA 3DZIA 2B2NA 2WJYA 1SIWA 4W9RA 2H29A 2Q4DA 2FK8A 1DFIA 1TKCA 3BF7A 4RC9A 2X41A 3WVNA 3H6GA 2YTZA 1ML4A 3FNFA 3ETEA 4O4IA 2GUWA 4BBZA 2Q49A 1V3QE 1I01A 2OXIA 2P75A 3AL2A 1UZUA 3U9LA 1W35A 2Y8EA 3KWJA 4QU9A 1SHKA 5EJEA 4OHYA 3GJ8A 4IX1A 3F5DA 1VBKA 1V11A 2EL7A 4TS9A 3WR5A 1P77A 4X95A 4LYJA 5DHRA 1H3NA 1YV9A 4TV8F 5ALIA 4X1YB 5KI6A 1Q0HA 3HB4X 5DM60 2JGJA 2GJKA 2R7KA 4TSFA 1M9NA 2PSHA 2E5LB 1U3UA 1U8AA 1MF7A 3ZCVA 4D0SA 4A2PA 4RK4A 2ZWIA 4A8TA 1ELOA 2GXUA 4BFZA 4CKEB 3GFFA 4WV3A 3WWDA 1ZG3A 4OQQA 4OIFA 4RHTA 5B3JC 4B3FX 4XCXA 1RXYA 1UC8A 3AG6A 3MW8A 1QPBA 3D0KA 2W2NA 4L07A 2PUJA 1JHAA 4H1HA 4PR3A 5GVRA 1E99A 4Q1FA 1OF1A 3OD1A 4MKIA 3U4CA 2EJBA 1E94E 3P4XA 2EBWA 2BFMA 4B0PA 3RRFA 1D4OA 2IH5A 2PZAA 2V6FA 3AL3A 4H7FA 3O93A 2UZ1A 4NFHA 4RIIA 5BQ3A 2PFKA 3DYIA 1RXIA 3G1UA 4FDMA 4U2EA 5ALUA 2BGKA 2REBA 2WFLB 3T99A 4DGQA 2ZUVA 3KLOA 1KE2A 4BRZA 3IVRA 4RO0A 1Y7PA 2V9PA 4YV0A 1SU8A 4BGIA 2YDXA 4P82A 3F47A 2I66A 2ZTLA 4PSVA 3ONNA 4Y1EA 2G0TA 4RV9A 1IWBB 1RKUA 1PD1A 3ELYA 2RH8A 1PZGA 1PV4A 2IYOA 2DCMA 5DYIA 3A14A 3EWSA 3G0HA 1JDPA 2FPSA 2NUAB 4IIFA 2NZ2A 1PJAA 1GZHB 2FPGA 1G2PA 3PUHA 4YUAA 3HLTA 1M6NA 1WBDA 2R8ZA 1RQPA 2WR8A 3LWZA 5ANRB 1C7ZA 3OZTA 4G0PA 4DLBA 1HE3A 3N7TA 1M54A 3LS2A 4CLXA 3NVDA 3OSZA 4Y2XA 5AI4A 4DJAA 1PU2A 1NYTA 2NSDA 3OQJA 4HGZA 1UFRA 4PO9A 3TQSA 5JASA 1AHPA 2AOUB 1DBIA 1P18A 2HA4A 3ESRA 4LBVA 1R15A 1K92A 1HL7A 3Q7RA 1QVZA 3X44A 4G56A 1YCFA 1DT3A 3KOWA 4NICA 3F7OA 4IPTA 4POOA 2BUAA 3OZAA 4N12A 4BLOA 3PUZA 5DH9A 3V4OA 3LECA 4ARZB 3WQQA 4AF8A 4C20A 4UARA 2VDLB 3FLBA 1UJ2A 2GZ2A 3DR5A 3FROA 3JW8A 3KTFA 2ZIEA 4GYYA 1JEDA 4LNUB 3PXUA 4WWHA 4J6FA 1J00A 4R05A 1ZRSA 1PQYA 3R6GA 2VF8A 2XVZA 1U5BB 1R4MA 3A26A 4LXUA 5AJHA 5DSXA 4YP6A 1T0UA 1VCIA 2VJPA 4ENRA 5EPOA 3ZUGA 4ZMSA 2EZ4A 3E27A 5KNCH 4LSMA 1ZZGA 3C5EA 3OU2A 4B6OA 3F5SA 2J09A 4R1UA 4X24A 1MIHA 3UG6A 5K0JA 4MKXA 5A3VA 3UPUA 1PNQA 2OECA 5HF8A 2ZQZA 4YR7A 3FOEC 4MAFA 1L5MA 3X1WA 3BD9A 4AXBA 5EJ6A 3I6MA 4BNGA 3EXG1 1W94A 1YI1A 3JWJA 4WOCA 3U81A 4NPHA 2DX7A 3H5WA 3OOHA 3ZQJA 4AJNA 4YP7A 2YH2A 4P38A 5TMDA 5JLJA 5EPEA 2X13A 1H93A 4H7HA 4PZLA 1K7XB 4MULA 5D5QA 3HJHA 1NI4B 4YT2A 2ZUUA 3ZGNA 1N34B 4NH0A 4XUCA 3R3UA 3I61A 2HCRA 2LW7A 3CF4A 4C87A 3GLFE 2OFXA 1VG8A 4XCQA 1XCJA 5LL6P 1OZHA 4LNHA 3ZCQA 4EECA 2TMGA 5CCXA 3JQ6A 2X19A 1HDCA 3BQNB 3GPCA 1F0PA 3HNOA 1IK4A 3USCS 3O38A 4AS3A 3R5SA 4UULA 1P2FA 3P96A 3IMEA 4CTJA 4PHHA 4MRRA 1Z16A 5E2AA 2AF3C 4ZU1X 4H35A 3E7FA 1UMBB 4CKCB 2WKQA 3ZHYA 2WZBA 2ZBGA 4XTCS 1N0IA 3IQZA 1HFJA 1DRUA 4O4HA 2NQTA 1ICEA 3SSMA 3ZQ6A 5HCIA 1W4AA 4Q18A 2VJAA 4K6MA 5AFSA 3ZE8A 4FBGA 2Z98A 3DOUA 3EAGA 4LJRA 2YHUA 2J8ZA 1CUJA 4LUCA 1Y8ZA 4DOMA 2O50A 3HU1A 3NZEA 3AG5A 3BXEA 4ACBA 5JYAA 1T4CB 3DCNA 3PQ4A 4JEHA 4NBKA 1DV1A 1VPDA 4A3SA 4YS6A 2W2OA 3L8MA 3ICPA 1M6WA 5C8YB 2H7VA 4COKA 1QTRA 5HXAA 1W4LA 1VMAA 5ARBA 3HYNA 3OCWA 1KK0A 2P6PA 2Q8PA 5B1DA 4BFWA 3DGEC 4ZAZA 4QVKA 3OM9A 4JUCA 2NN3C 2YC4C 3N2NA 2I4TA 4ZEWA 2QD5A 1GUAA 3C3AA 3UUFA 4ZYXA 3UAYA 4CM6A 2ZSHA 2CNLA 3OBIA 1O9HA 1VRCA 1DAHA 3I9V1 1S2LA 1QCYA 1OUMA 4RXMA 2YZ7A 1FBNA 3BYZA 3RSHA 3RUFA 1N6HA 2J3IA 1JSRA 4YQYA 1B76A 2WV9A 4KQGA 5A7GA 1E69A 2HRQA 5JAIA 3EGWA 1Q3KA 3KG2A 1KXZA 2FETA 3YASA 2HCJB 2ZJ0A 4RD0A 3VHXB 3TNJA 3BMOB 1T3HA 4PLHA 4AZWA 1S4QA 3OMXA 4CR6A 3NMUF 3NTRA 1ML3A 3B8EA 3OUTA 2B1QA 4DV2B 3GXOA 1YE5A 1MPTA 3K4PA 1G3IA 4DWJA 3H4TA 4HRXA 1FP7A 4DC1A 1MPXA 2V3VA 5JH7A 2B5OA 2C99A 3N5KA 1AQNA 4NK5A 4RPJA 3DBRB 3UO8B 2VDQB 3P0JA 1AGXA 3P71T 3TTUA 4EJ6A 2NAPA 1J7KA 1XZMA 2W8BA 4IDEA 2GVNA 4W9NA 4CQMA 3K15A 1L4LA 1L4FA 4MPTA 2CHGA 4NE9A 4BNMA 3WYNA 3MJDA 1BG6A 2CVHA 4Q9JA 1Y7LA 2DBVO 2W37A 4JITA 5BR1A 1G66A 2BP7B 2IYNA 1WZIA 4OHCA 3B9BA 4XLTA 3SC2A 2CV1A 4R69A 2NTVA 3E9NA 4H1TA 5CXSA 5TPWB 3W5HA 1C7JA 3W6PA 3I8OA 3WHPA 2BGGA 1WB5A 1AF7A 1GR0A 5K6TA 3JAKB 4I55B 3WJ2A 5LD2C 3AVWA 2FN3A 3WB9A 1ZGBA 3K0CC 2CCGA 2IHNA 3T3PB 1I4DD 1X8KA 2I3DA 5CLGA 3MQ4A 3UJPA 3KYBA 4MEJA 2CFRA 5JWHA 2YWEA 3BOSA 4JI6B 3E8XA 5DW0A 4MS3A 3BQ9A 3V3TA 5B6PA 1XPRA 1AA9A 1S9DA 4DYDA 2BHNA 5E2BA 4C6HA 2A78A 1HYBA 1UYJA 4RMJA 1H6AA 3M5CA 1PIWA 5FBZA 1JG3A 4MUAA 5JAMA 1HV8A 1P2BA 4RVFA 3TD9A 1L6RA 4KR7A 2V9ZA 3GAAA 3E58A 4DANA 2XIQA 1EB8A 2HJ9A 5E3HA 2YNMA 3T4XA 5TE9A 4TV8A 4CM3A 1C29B 2GRJA 3L0SA 4IWNA 2QNBA 4RIFA 5K05A 2AFHA 4QHSA 1D0IA 3MQFA 2WHYA 1XPUA 3DTVA 2WF7A 3T12A 3ZW9A 2J9FA 2IHUA 1MVNA 1M66A 2V96A 2XTZA 4RPLA 4S1PA 3GEPA 2NO6A 3LFHA 4HDSA 2KLHA 3CH5A 5KSOA 2YJ5A 1G21A 1UT8A 2C0PA 4N6NA 2I91A 4ITUA 4PYMA 4O4IF 2BAGA 3FOBA 3TSAA 5BSFA 4ZZ0A 2EXXA 4CXMA 1UQRA 1KDOA 1RYFA 1SXJE 4JL6A 1T34A 1AS3A 2E5FA 2XWBF 2V8BA 4PN3A 3DMDA 2Z9BA 3WWPA 1T8RA 3KEFA 4LGCA 5KNCD 5AM3A 2D06A 2WSIA 3V1TC 4F56A 3QVKA 3T52A 3I2GA 4AG5A 2O8BA 3R40A 5I5EA 2DGDA 4K9OA 2IUUA 3CSDA 1ULTA 2WABA 2HOQA 1P45A 3BA1A 3UGTA 5EINA 1XN4A 2HBYA 3WL8A 5LOVF 1R2QA 2A7XA 4EY7A 4HS9A 1LBEA 5AKKA 4GM1A 3FI9A 5E4TA 5HVNA 3L01A 4Q19A 1PT6A 3A6KA 1E8NA 3DZ5B 1FZQA 1T35A 2VXOA 3AK4A 3BKWA 3BIWA 4XYBA 4EX6A 3OQNA 1DSSG 1CEXA 1RHQA 1P5ZB 1LVUA 3JQGB 2BY4A 1KI3A 3MIZA 3T5AA 4E11A 3X1ZA 2IZZA 1CZNA 2R6AA 3FW1A 2HTEA 2JJYA 2XAAA 4HH3C 3OX3A 1Q21A 3DFMA 5FEUA 2E2WA 3LCCA 5JDIA 4Q1BA 1O4VA 4K81B 5IUNC 4UM7A 3H16A 3N70A 2CXUA 2ACVA 4YMSA 4A1FA 3UMVA 2R79A 1P1HA 2VTBA 1R0ZA 4HMQA 1KOJA 1OPXA 2PKWA 1SCKA 3AY3A 1CUXA 3IIIA 1V2GA 4N6OA 2ONJA 3EE6A 5KC9A 1R9JA 3RTDA 4ZODA 2LIPA 3H1AA 1RIIA 4E7PA 4ABTA 2FQ1A 2C77A 3X2FA 2EERA 2A0UA 2BCEA 1QIHA 2FUG1 2VDKB 1NY5A 1EEHA 3PQ6A 4ZQEA 3SCZA 4A27A 2X0FA 4XB6B 1T4CA 1FSPA 5A9TA 1QMIA 1PJTA 1VGRA 1GCUA 2CMDA 3GXBA 3GZNA 4U7FA 2RKOA 1OTHA 3WNBA 1UWLA 4HWPA 1I7SB 5ELXA 3N0TA 5E3IA 1QUEA 2ORED 2PUGA 3LLVA 3R5KA 1RWQA 4UTVA 1H1TA 1BXZA 1ZVQA 4V0SA 3PI6A 3CJRA 1BEEA 5LFAA 1TJ3A 3L6UA 3WLKX 4MROA 3RS2A 4QYIB 4HFJA 1W34A 7ADHA 3I42A 5BVGB 4J16A 5HGXA 2DR0A 1UBKS 1DJNA 1FFDA 2QY6A 1UL1X 4DT1A 1YFLA 2WPNA 3Q10A 2I7CA 1R88A 4BFCA 1CVRA 2CLEB 1XZPA 1PQWA 2IYQA 3NX4A 3OZWA 1G8HA 4RA6B 3TIGA 4BCCA 5J9GA 2XLCA 2ZULA 1KZGB 2F6RA 2GJ9A 1P81A 3PFKA 1T4MA 5C1IA 2G88A 1DUVG 1UFOA 3KIPA 4DCUA 4MP3A 2D13A 3PD7A 5AI6A 1I1HA 2EDAA 4GLLA 1PFUA 3G5LA 3TNLA 1V8PA 3UQZA 5FV4A 4MJ3A 3GJTA 3RO7A 2WHPB 1XQ1A 3EIWA 5THXA 1BMDA 4WLNA 1JQLB 1UK8A 4I5FA 2W83A 3CIOA 2O7RA 5A03A 5ED4A 2RCYA 5LD2B 5EJAA 3ZHXA 4NMHA 1ZSYA 3VX3A 1FJXA 4FYXA 3Q8KA 3I58A 4YJFB 3CSSA 3LPDA 4FNOA 5BN5B 4OGGA 4DV3B 3WKEA 3E4CA 2WJZB 2GRAA 4N4AA 2ZPUA 1SU7A 3ZWXA 5FBHA 2X1MA 3P2IA 1KAMA 4MO9A 2FOIA 2PA3A 2SKEA 2NPFA 3Q6IA 4IKPA 2X5NA 2X7XA 3H3XA 5AW0A 1O0CA 3P7MA 2ZZNA 1SKMA 1NBME 2AK3A 2XGOA 2EGGA 1DC6A 1P62B 1TUIA 2XQFA 2IOFA 3UNXA 1OAOC 1QIDA 4LA4A 1TVEA 2GPAA 4P54A 3KJHA 3A1TA 3TRJA 3CLHA 4PGGA 2DPHA 4BVGA 2PNFA 1DO0A 4A0QA 3BORA 3DONA 4P4UA 4UVIA 4M1YA 2R1UA 4CFSA 4A0HA 1ZMTA 1RHRA 3MCTA 4OSEA 3A7EA 3PKIA 4NENA 5B36A 5FBRB 3NNSA 2AFVA 3ORYA 3TS1A 4GRDA 1M6HA 4KU4A 4W5WA 3LY7A 2BTEA 1GUDA 4FDUA 3UAWA 1C1XA 4RYDA 2PBLA 1WD7A 2MR5A 5CT8A 3RIGA 1NUTA 4FKZA 3RLFA 1KH3A 2JD0A 4IJ6A 2GN2A 2EW2A 2P90A 3E8SA 4M6WB 1EUDB 2PRYA 3D5TA 3I92A 1HDZA 5I48A 2ZJ4A 3AVOA 3IAXA 1F60A 2YWJA 4FNMA 5LOVB 5TGTA 3KSRA 3AXSA 1L4KA 2OKGA 1F2DA 4FHDA 4FW9A 3O4IA 4TTPA 1OFUA 3A11A 4ERXA 4JYCA 4TMYA 1NXWA 1WCWA 1AD2A 4K3UA 4QPZA 1J0CA 4ZOCA 1ZQ1A 1NA5A 2WM9B 3NAQA 3Q0IA 4PGHA 2J32A 1SC6A 4MR7B 2PRSA 3OM8A 2I7TA 1XTKA 3VYRB 2E5WA 3LT5A 3E6AA 3U5TA 1I8TA 1N2ZA 3CPHA 2ZS8A 1FX0B 1SCBA 2GHQA 3LGXA 1U8CB 2H1IA 1X42A 3B70A 1RXEA 4D80A 3AHGA 1VRWA 2AMLA 1US8B 2OBMA 4MI3A 1C81A 2BMEA 1NUUA 2AFIA 3IUEA 5JATA 2RHRA 5HS6A 3K73O 3LHIA 2C20A 1BA3A 2W2KB 5TMBA 4I1YA 5HKKD 1EGMB 4V1CA 4BATA 3EBOA 1C3OB 5F4ZA 1KTIA 4JKOA 3VKUA 2I1QA 1I0IA 1KERA 4I6JA 1XRRA 1M1XB 3R5TA 4Z9AA 1BXRB 3JQ8B 4TV9F 1V8DA 3VZSA 4M53A 1DRJA 4FDAA 1JG1A 1R4AA 4BTLA 4ID9A 1KYVA 1HG1A 1UKCA 4OQ4A 1P9LA 4CI9A 4OQZA 5K0CA 2EF0A 5AYVA 1UPBA 3LYUA 1H8EA 1N3YA 4QGSA 3V4LA 2AN4A 1PK7A 4U4AA 4ARIA 2IHJA 1YNSA 2NV0A 2H1WA 3COWA 3GLQA 4MPDA 4BFSA 3DAPA 1CUZA 3LKZA 4MICA 4DQ0A 4E5UA 1QR2A 2A9OA 3NP7A 3T3GA 1TB4A 1NGSA 2R6FA 2Q5LA 3K9LA 5HFNA 2O0HA 5CYPA 3S70A 4WOPA 5BUZA 3ENNA 1EXMA 4MPRA 4C07A 4ZZIA 4Y6PA 1XMPA 2XDQA 1V1JA 4NQZA 3P52A 2JIPA 3HUDA 1WHSA 3HKBA 4XWYA 4DEXA 3EBPA 4P1ZA 2PUEA 3HSSA 5L7TA 3SBOA 3DLCA 4LSWA 1GPH1 5E4FA 3TI7A 3HL0A 1ZONA 4YMGA 4O29A 3GFQA 1JEEA 1XEXA 1V8BA 2ZKLA 4C06A 1Q1EA 1RJ9B 2OD2A 4DC9A 4LDJA 1JR3E 4FFVA 3IP8A 4M1QA 1EVEA 3KQMA 4NRDA 4F8JA 4BVAA 3OQIA 3RUCA 2YVLA 4WK4B 3CXRA 3QU2A 4KQIA 1Y6JA 2KBEA 4S3MA 3VYTB 4CLEA 3BAZA 1IZYA 1QAOA 1WKCA 5AK4A 1COZA 2JCVA 3SFVA 2GYWA 1MVOA 3ILHA 1SCUB 3TL2A 3L49A 4CHTA 1GRCA 2VTKA 1L7EA 2F17A 5I7UA 3JQ9C 4HNAA 1M5UA 3EXEB 3ICQB 2QN8A 3MGGA 3L05A 1TT5B 4RGQA 1IJEA 4RPHA 4D99A 4O33A 4TTRA 1IZ0A 4XM0A 4FZ5A 2ZB4A 3MSXA 5FUBA 2Y0CA 3NETA 1M6VA 4QPPA 4CQNA 1Z17A 2D00A 4DXHA 5ITZA 1Z6PA 1N1MA 2O57A 5ELMA 5IW8A 1VQ1A 4FJ0A 1T15A 2V7QA 5KYUA 5L8VA 2JA1A 4RLSA 2ZUEA 3GLFB 3MUOA 4DHEA 4GMXA 3L7CA 5G4KB 2GYVA 4BRWA 2Q5JA 3AF2A 2HY7A 3VO8A 5LA6F 1I4TD 2FOLA 2QVYX 2OQ2A 1YJQA 4PRZA 2C2XA 2NQ2C 1Y6FA 1DJPA 4TQUS 5FNVA 3L2OB 1TC2A 4YXFA 5B57C 1G55A 3ZV6A 2A5FA 4U39A 4EFLA 4G5XA 2A92A 3HR4A 3KB6A 3IQFA 3OUZA 4NE2A 4MUNA 4GXNA 1GPUA 1S2IA 4GO1A 1LLQA 4N3BA 4GICA 1E4OA 4KSCA 4R2MA 5K51A 3PQVA 1DEKA 1N8KA 3CW2A 3E61A 4ZO7A 4FC7A 3ZKWA 4ONEA 5KJCA 1CCWA 2RONA 5GVSA 2WQ6A 4RD4A 2B4TO 2A5DA 2I29A 4QDUA 2ZSAA 1N2SA 3RSOA 4IEFB 3VU0A 3MK31 1RABA 2WYHA 3HADA 1AK2A 4Q4DA 3HP1A 3V5NA 1GXSB 1YRQA 2BDUA 2PZEA 2V7EA 2V97A 2I4NA 4HUJA 4JV5B 1H8HD 5EUQB 2PCLA 3IALA 2XOEA 3F4KA 1OZGA 4OQMA 3NIDB 4RY8A 3HDQA 5IBPA 3A70A 4ZOQI 4I7EA 2M6KA 3GA5A 4DJ5X 1I24A 5K09A 5ER6A 1E3EA 1RZUA 4JT8A 4O4IB 5EUMA 5KOIA 2OCIA 1QC5A 2WFLA 2ZDHA 2ERCA 3HY6A 3G0IA 4UJ5A 4FWTA 3OEYA 2F1KA 3QHQA 1FY2A 5AI8A 3OURA 1Y63A 1VYVA 3EXIB 3L7IA 4IZHA 2I65A 3L7BA 2HBQA 3OIDA 4NBNA 1SG9A 1M34E 2CF6A 3A0UA 3FNRA 1Y6QA 4BP3A 2NUAA 1YQTA 1HEYA 3DYBA 1WEHA 2V55B 3MLEA 4XDHA 3R7BA 1RRFA 3EJWA 4DCPA 2XADA 5KDOA 3PX7A 1K1EA 2H2HA 1D07A 4PANA 2ZE7A 2P9CA 3L5OA 4DCTA 5BOSA 1WV1A 1X19A 3HVJA 1Y8QA 4B3IA 4CMIA 1YL5A 3RYHB 1WP4A 1PUIA 3IV6A 5AOCA 2YZMA 4X1IB 4K6OA 1T4DA 1F48A 1RYHA 3IPRA 1QR6A 1UBJS 1ZXBA 3QPWA 2WTXA 4HBGA 5ERXA 1RAFA 1RHUA 4DWWA 2PSDA 1ZGHA 2WJ3A 3FA2A 1QORA 4LYEA 4LE1A 4RIEA 4Q37A 5TT0A 4BYGA 2QN3A 5D6NA 1THZA 2PUHA 1A7AA 3C5VA 1PHRA 1VJGA 3HM9A 4P92A 4LQDA 1U4NA 1WDLA 1M1YE 3KWMA 2Q5QA 5CA0F 1NUPA 1X80B 3CY6A 1UJ4A 1E1CA 1Q2XA 2JAUA 4FHGA 5BYAA 2HMWA 1KKMA 2HCTA 4I9NA 4DKXA 1FDRA 2VBIA 4YRQA 4TYMA 1CHNA 4G2NA 1L4GA 5KBYA 4XJSA 2J5BA 4X92A 3IWDB 2A9RA 4UFNA 1BE0A 1QDEA 4BWVA 1E1QD 2BM9A 3I6IA 5I5GA 3UAOA 3QFTA 5F52A 2UYYA 1EJ6A 3L1VA 1EFPB 1VSQA 3HLYA 3ADCA 2NVOA 3IX7A 4GFDA 3BJRA 4OX9Y 1RI4A 1T25A 5JPIA 4JP2A 4X64B 4Q7JB 3TIIA 3ABQB 4JB8A 5JZSA 4IXNA 3HI4A 2ENWA 4JL5A 1ZOLA 2AE1A 2YXDA 2IZOA 4UQPA 2JS7A 1NLUA 2IDMA 3NHAA 3ZX5A 5JD4A 1WU8A 5AJXA 1RTKA 1RXCA 2BI7A 4O2BF 2GJ8A 4CCYB 2OK8A 3NHRA 3GJ6A 3QPVA 1VECA 4C6RA 3GEIA 1PR9A 1E9RA 1TA0A 4HFRA 3EP4B 3IS3A 2ZUTA 4MV8A 1J8MF 1GTRA 2AOTB 1YUBA 3NPAA 2GVZC 1JEQA 5B2FA 3U44B 3SSAA 1LVGA 4UFPA 1IOVA 3VR0A 1KYZA 2DPMA 3LCJA 4PONA 2O5EA 4NDAA 4KRFA 3TZHA 1NDQA 1NW6A 2H07A 1U0RA 5HE8A 3PLAE 3IL2A 4CIBA 4LHSA 3IH5A 3T0GA 2E9SA 3GT3A 4ZVKA 5JXIA 1A9ZA 4XX0A 5ALGA 3U4DA 2J6BA 4PPGA 4D0NA 3DPSA 3CO0S 4TVKA 4DM7A 2CXQA 4R1OA 1Y5RA 2PT5A 3A31A 1WCV1 1XD9A 4I50A 4F9GA 2P5TB 1YO6A 2C54A 1MN6A 1ZMXA 1OJLA 2GERA 5NLLA 4DN6A 3B60A 2KPOA 3LWBA 2OD7A 2J48A 1V6SA 4DIFA 2GZHA 4NZNA 2QMYA 2W58A 2IW1A 3LTEA 5G1PA 3DCIA 3EIUA 2I7XA 3IV9A 3N39C 1KQGA 3L7YA 5EIBD 1J09A 2VL7A 2XEDA 3FZEA 4G1EB 4HLCA 2J6IA 1TLTA 4HZGA 1TK2A 4B2PA 3ICOA 4UOEA 1UMCA 3D1VA 2NU9A 4H6PA 1Z2DA 2O2GA 4LWQA 5DLPA 1ZX1A 1GM5A 2G17A 4U5QA 4LF5B 3HJFA 9GPBA 3SQWA 1JEYB 4MVJI 1EAYA 1L9XA 3KB2A 2ZVQX 2FMXA 4HGPA 4LOHA 1P7YA 2PAFA 2AW5A 4OKSA 4YYEA 5FCDA 1K5HA 2A0YA 4JEMA 4YXWA 5JNVA 2CVFA 3FPKA 1PJ8A 5LQRA 2AC7A 2QUJA 1XDDA 1OYOA 2VYVA 2VT2A 5IVPA 4R54A 3DSRA 4W8HA 4LX8A 2Y1XA 3QOFA 1N9ZA 2IX3A 1DC3A 1CRQA 4OXKA 3TSWA 1JEJA 3NM5A 2EARA 3HU3A 3UXMA 4KO3S 4KE9A 1V1MB 3E9QA 4MSUA 4YYZA 3IURA 2IYEA 3E84A 3ET4A 3F8SA 5AR1A 4TKUB 3RRYA 3SPXA 3FYUA 1NIPA 4BEWA 3DOIA 4PZAA 4QUBA 4XOIA 5CJ2A 4MEAA 1BHO1 4QYWA 4D25A 5F77A 3NALA 2XMZA 3DAYA 1G4HA 2O4UX 3IYLW 2E37A 4P6VF 2XQVA 3KSUA 3ZYZA 1YB2A 2OCKA 1HQKA 3O9VA 3OTWA 3PB3A 5GM2A 4RNCA 1PQUA 5FFFA 3UZUA 1ECFA 2C4TA 1I4OA 3DEFA 1O89A 4NY1A 5JY6A 4Z0NA 5LZ5A 3WB0A 4EHNA 5CIYA 1XLUA 3QFSA 1KO5A 2UZ1B 3KP1A 4MW5A 4EHIA 5ALPA 3ZVNA 1JJFA 1SUEA 3FYSA 4Z4IA 1QRRA 3NHKA 5HS4A 4HI0E 3H5IA 5IT9A 4MQEA 3CRZA 5BW6B 2HXSA 1J22A 1U8UA 3MNFA 3ZPXA 1CF2O 4YIHA 1K8XB 1IDN1 3LQFA 2K2WA 1DZ3A 3AF0A 3QLUC 2A30A 3OOYA 4X71A 1RPNA 3P4UA 4QDZA 2QP9X 4CMIB 3CRW1 3ADBA 1FRFS 2PH7A 1JHMA 3NATA 1IATA 1VLMA 2I6QA 3HDVA 4V0RA 5LZ4A 4JC8A 1KDVA 3WAJA 5FPTA 4KPUA 3EQ6A 1VHWA 4C6TB 4I4IA 4H16A 4YRJA 2VF5X 4JI2B 4QDJA 3LT0A 1FJHA 1V37A 4OFBA 5AJYA 5L3ZA 4DL9A 721PA 4RTSA 4X8HA 5HIIA 4YMTA 1A8HA 4KH0A 1B0PA 1TRKA 4JT9A 3FAKA 3H9JA 1GQ2A 4DUPA 5LM3A 2CXRA 1T36A 3ZDQA 1DWUA 1N2BA 3UV7A 3FMVA 1QQ6A 4PYKA 4WN9B 3W5DA 4BO4A 1VLHA 1FP4B 2DRIA 3SC2B 2C9CA 3OVMA 1GNLA 1EWTA 1TECE 2QX7A 1VSBA 1K9SA 2ODNA 2WOOA 4AJJA 2R1ZA 3N7AA 4QOGA 5LC1A 5BORA 3CW8X 4DR3B 5L9AA 4I55A 2KX7A 4BLUA 3K6KA 3UT5B 3FCUB 4NFSA 3KZVA 3G8BA 3WISA 1WABA 3GI1A 5EP3A 1TT5A 3L4BC 4QOJA 2H16A 3UVEA 4RULA 1K88A 3QU7A 3BFJA 2BH2A 3AJAA 2DBZA 2QLFA 4KLCA 1YB6A 1USUA 1IQUA 2VJBA 2WLTA 1Q7EA 3LRPA 4MINA 1NE7A 1J42A 3OZ7A 1W1UA 3BXOA 5G3YA 1XZHA 2E4WA 1D2NA 2GAOA 3RI3A 2OVFA 1A96A 1J0EA 3RANA 2R1TA 1UIMA 3TG8A 5BUCA 1HK7A 1K0UA 4PG5A 1Z06A 5FD8A 1O97C 2CLLB 1ZJ4A 3DHYA 3MILA 2X2FA 5JBIA 2HA6A 3KHSA 1HTBA 2WTNA 2GF9A 4UTXA 4BGEA 5I7VA 3LOPA 4KFUA 4DLTA 2RMKA 3F3YA 2FPIA 3UCXA 5HZGA 2A59A 1WB6A 4QQNA 3SLRA 4BBAA 2EX4A 1MRNA 1NI4A 3RT9A 2CDAA 1DXHA 1W0CA 2WF8A 4CNBA 2Q0HA 4XB2A 3S29A 3IBTA 2C9DA 1PEDA 2C2WA 2GA9A 2R7NA 3QELB 1ZXXA 2LKDA 2GEFA 4M7OA 2FOXA 4XWAA 3W8DA 3IRVA 3QLJA 5EHZA 1EUCB 1JMYA 2BZ1A 1S7CA 1RM5A 2C7PA 3FSJX 5J5AA 2QN9A 4ZRDA 3H0EA 4K6KA 1E9AA 5B5SA 2OCLA 4BE7B 3RARA 1OBVA 1E2FA 2I6XA 3SEZA 1D1SA 4BVLA 4REMA 3ZDAA 5H3HA 2B1JA 3RFFA 1JJIA 3IHWA 3PQCA 3B1WA 3K0EA 4IWYA 3S99A 1KJNA 1RHJA 2GYYA 2P9YA 2FPOA 4KXYA 3V2IA 3QUCA 2QYOA 2B4RO 5C1DA 3M6MD 1E6WA 1GHTA 2PGXA 2VPTA 4ZT2A 1QYRA 4HUTA 1ZN9A 4ZOLA 1P3Y1 2F1IA 2YICA 2R8PA 3JQGA 5A6SB 4EPRA 1KRWA 3WE7A 2E4UA 2ZAYA 2HYIC