1YL6A

Crystal structure of mycobacterium tuberculosis dihydrodipicolinate reductase (rv2773c) (crystal form b)
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
245
structure length
245
Chain Sequence
ARVGVLGAKGKVGATMVRAVAAADDLTLSAELDAGDPLSLLTDGNTEVVIDFTHPDVVMGNLEFLIDNGIHAVVGTTGFTAERFQQVESWLVAKPNTSVLIAPNFAIGAVLSMHFAKQAARFFDSAEVIELHHPHKADAPSGTAARTAKLIAEARKGLPPNPDATSTSLPGARGADVDGIPVHAVRLAGLVAHQEVLFGTEGETLTIRHDSLDRTSFVPGVLLAVRRIAERPGLTVGLEPLLDLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of dihydrodipicolinate reductase (DapB) from Mycobacterium tuberculosis in three crystal forms.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
molecule keywords Dihydrodipicolinate reductase
total genus 72
structure length 245
sequence length 245
chains with identical sequence B
ec nomenclature ec 1.17.1.8: 4-hydroxy-tetrahydrodipicolinate reductase.
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05173 DapB_C Dihydrodipicolinate reductase, C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1yl6A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1yl6A01
1MFPA 1PQWA 2I76A 4YR9A 5G0VA 4CL3A 4NZ9A 1CQJA 5IFLA 3LF2A 3EZYA 4RLSA 1FJHA 4Z3DA 3VH1A 1DOHA 4IBOA 1CYDA 5A9SB 5A4DA 3G1UA 2J3JA 4IDAA 4KWHA 2ZB7A 3F5SA 1GYQA 3QVWA 3NEPX 3ADPA 3ZV3A 5DBFA 1BWSA 2OL4A 3MJVA 3O26A 2ZTLA 4GQAA 4FDAA 4BS9A 3UCFA 3GK3A 2CDAA 3ZI0A 1X7DA 2O50A 2O23A 3DBLB 3JYLA 3MJTA 5A06A 4MKXA 1ENPA 3GFBA 1GQYA 5IZCA 3OEWA 2JKVA 4CM8B 4MVJE 4BV9A 3ZWCA 1GYPA 1E7SA 4W9NC 5CEEA 1YVEI 5F21A 3KOUA 1GPDG 3WNVA 1N7GA 3ADOA 1ZNQO 4A2CA 1LQTA 2Q1SA 3PEFA 3L6DA 4DRYA 1LA2A 2DC1A 4E3ZA 4CLRA 4UVIA 5TQVA 5AXBA 4OL9A 4ZQFA 4FCCA 1T24A 3PK0A 5K0ZA 1R4MA 1U2DA 5L4NA 3V1TC 5JY6A 2RIRA 2LDXA 1YS4A 5JSFA 2D4AA 3D5TA 1HLDA 3MOGA 1KC3A 1KERA 4OO3A 1F8FA 1IHYA 2X9GA 4CLOB 4FGSA 4BNXA 2GPTA 4BNFA 4E31A 3TDKA 4IIUA 1V3TA 1Y9AA 3JQ8A 1OC2A 3TZ6A 2POQX 4E2XA 3DMTC 4MJLA 2B5WA 4NFYA 2VUTA 3ST7A 3EK2A 4YRBA 5MDHA 4HKTA 1K5HA 5COAA 5A5FA 1B15A 3GQVA 5IAAA 3CEAA 1E1LA 5TGDA 2NACA 4AJPA 3FPLA 4ILKA 2QYSA 5JMPA 3UCXA 3WGGA 4DLLA 2G5CA 2X58A 3PTZA 1KVTA 4J91A 2VRCD 1OZAA 4ZICA 3DTTA 4OOFA 2G1UA 4OXNA 4HFMA 1WMAA 1BXGB 1ENZA 5F1KA 1ZO8A 4CLRB 4I8XA 1PQPA 1YL7A 3GDOA 1NASA 1EVYA 1PJCA 4JBHA 4L74A 5F5NA 2ZB3A 3ASUA 4ALMA 5JYAA 4NK4A 2VRCA 3ON5A 3KM0A 1G0OA 2JFGA 4D44A 1E6UA 3ZWPA 1D1SA 3R6DA 2VUSA 4ZRNA 4PG4A 1ZK4A 1DIBA 3WBBA 1Q0LA 3A06A 3ZHYA 4J7XA 2FP4A 2VWQA 4I5EA 4RVUA 3A28A 4ALLA 3GZNB 3JYQA 5CDUA 4J4TA 4N5NA 3CKYA 1K3TA 5DOZA 2HRZA 5H82A 3D64A 4LISA 3WJAA 2J3IA 2HMVA 2UAGA 2HQ1A 4NDNE 5TSDA 5CEFA 1U4OA 5AVOA 5LCXA 2YV1A 4WUVA 3OJOA 2FR8A 4J7UA 4BNMA 3EW7A 4W99A 4RDIA 4F6CA 2HLPA 3AWDA 1U5AA 3JQFC 1KEUA 4FJ0A 3GUCA 3JQ9A 1XWFA 4EZBA 2O4CA 3WX0A 3BMNB 5CG2A 3EVNA 4WLOA 4BNNA 4IDFA 1JDJA 3BMCA 1PR9A 1KVRA 1QSGA 2D3TA 1MXFA 3T7CA 1NFFA 3M1AA 3AOEC 5IZ4A 2EW2A 3GG2A 1K89A 2PWZA 3PPIA 4CQLB 3ZDFA 3GOHA 4LSWA 5ICSA 3H9QA 4ESOA 8LDHA 4UREA 1LSJA 4KP7A 1RM0A 3LDHA 1V3VA 2X6TA 1PJQA 4PLTA 4UVDA 4B3HA 3DAFA 5ADHA 1Y5MA 4AFNA 2UDPA 4FFNA 3JV7A 4TZTA 4C7JA 5DCWA 4D3DA 2HDHA 3STHA 3WGYA 4GGPA 4OYRA 8ADHA 2CMDA 3RWBA 2HSDA 4CQMA 2AQ8A 5HA5A 4I5FA 1SZJG 5BT9A 1K2WA 1Q7CA 3TOZA 4RVGA 4IPTA 3NUGA 2I9PA 2VHYA 2HCTA 1PZHA 4OIMA 1E7MA 1GEGA 3WNQA 1ZZEA 2DBVO 3UH1A 3DEYX 3D4OA 5CDTA 4NPCA 1XSEA 3VPSA 4CLHA 1NVMB 1HZJA 3H5AA 2HO5A 1R66A 3ZNNA 4BNGA 5C37A 4KDFA 4BO2A 1AXGA 3B6ZA 1ENOA 2TMDA 3GMSA 1JQBA 5AXCA 4PRLA 4BNYA 2VHZA 3FTNA 3DBRB 5JDCA 1B16A 3IC5A 2VOEA 2ZIZA 4XJSA 4WK6A 5C7LO 2WSBA 3ICCA 5T8KC 4KUHA 2P4HX 3BYZA 1HE3A 4EJMA 1YDWA 2QW8A 2H6EA 2X0NA 3PJEA 4J4HA 1YBVA 1NFRA 4BKQA 4ZGWA 4AJHA 4U7WA 4IDEA 1V8BA 4CMGA 4WNIA 1Z74A 3ETEA 4IMPA 1V3UA 4KMSA 3HFGA 2UVDA 3GGOA 3GUYA 3BMOB 4XGIA 3VZQA 3IUPA 4P4GA 1ZUD1 5H81A 2CVOA 1LUAA 4Y6RA 2UV8A 4ITUA 1GY8A 1NWCA 1ISJA 2W4QA 5EQFA 3GVHA 4D79A 1DC6A 3UN1A 2IYPA 1MG5A 3WWZA 4N7RA 4H7PA 5U4QA 1N8KA 3O9ZA 2RH4A 2OZPA 3NT2A 3BA1A 1CWUA 1KEPA 1H6DA 3W6ZA 5T6BA 3GVPA 3KSZO 4KTTE 3WSWA 5BNFA 3EAGA 3H5RA 4K28A 3KSUA 2C0CA 1NQ5A 1XKQA 4J49A 3KXDA 1NAIA 2D0IA 3AI3A 5I9NA 4OM8A 1X14A 2YQ4A 3H6KA 4XRRA 2WDZA 4YCAA 2W90A 1DSSG 4CM1A 3M2PA 5ENDA 3JQ6A 3DL2A 4TRNA 1OAAA 3IJPA 2HU2A 4XDZA 4WPGA 1GZ3A 2CUKA 2YFHA 3H8VA 4MIOA 4DQUA 5JNLA 1EEHA 3GDGA 1H6BA 2ZTMA 2I67A 1H5QA 4RJTA 1X15A 2VTEA 1UUFA 1HKUA 4MPDA 4R1SA 4UUPA 2PKQO 4RCVA 2Q2QA 1E7QA 1HZZA 4BQRA 2WMDA 5IDYA 3K30A 4LVUA 4XEHA 3OH8A 1F06A 3M6IA 1YBMA 2GZ3A 2DUUA 2CF6A 4F3YA 3L4BA 2BF7A 4A7PA 1H9AA 2QQ5A 3N58A 2H9IA 4MVJA 3NGLA 1E5QA 3I6QA 5FI3A 4CLXA 2ZK7A 4U5QA 5CAEA 2C5AA 3RC2A 2B37A 5I9MA 2JD0A 2J6IA 1PS0A 4EJ6A 2GN9A 4C4OA 3WGIA 1E1MA 3H4VA 4MOWA 1J0XO 2AE1A 2C7GA 4J2OA 3VH3A 5L7YA 1N5DA 4CLDA 1XR3A 3ROQA 3S1LA 1T2CA 3JQ9C 4PLVA 4O59O 4J0FA 4O0LA 5COQA 3E48A 5L40A 1EBFA 3JQFA 3QVSA 5JYEA 2JAPA 2D5CA 4FFPA 3WYCA 3CMCO 1NP3A 5G0UA 1EK5A 4BNVA 4DYVA 4Q3EA 4MVJF 1OMOA 4WCFA 2PZLA 3F3SA 2EF1A 4IJKA 1A72A 1SO8A 4BGIA 4BO5A 5L9AA 3GHYA 1UJMA 2EWMA 3Q3CA 3KVOA 1GZ6A 2ZQZA 1HL3A 3GAFA 3T4EA 4L4XA 2W8ZA 3ZU5A 1E7RA 2P9CA 1YOVB 5ER9A 1Y6JA 3B20A 2VZ0A 1NR7A 5BSHA 4BQPA 1GUYA 4H16A 5KJCA 2Q3EA 4RZIA 3FD8A 2OP1A 2JAHA 4CPDA 2JHFA 1HLPA 3LC7O 3AI2A 3DDNA 4YB8A 1MLDA 1Y7TA 2RHCA 3BMQB 2IRWA 2H1SA 3LU1A 1KS9A 3SEFA 3OQBA 4RPGA 4KWIA 3X2EA 5CPBA 4LCEA 1BXZA 1LC3A 3GAZA 2DVMA 1KYQA 2Y68A 3GA0A 1UZLA 4KTVE 5GMOA 3QRWA 2Q50A 3WTBA 3GEGA 4IMRA 2V65A 1U8XX 3L4SO 1XQ6A 3RI3A 3IDSA 3VH4A 3DFUA 4NBVA 4ZHSA 1C0KA 3ICPA 2G17A 5GZ6A 1HDOA 2OMEA 3JD1A 4PVDA 3JQ8B 3NDRA 2EEZA 2YV2A 2OO5A 4J7CA 2NM0A 4LW8A 3GLQA 3AY6A 1CERA 5JCJA 5THKA 4M54A 5G0SA 1LEHA 1PL8A 3HADA 4XCVA 3MWEB 2PZKA 4FR5A 1XGKA 3ZWYA 2GO1A 2Z1MA 1CJCA 1ZFNA 4C7KA 4PG8A 2UYYA 4XR4A 4Q3AA 2J5QA 1QLJA 1A9ZA 3WYEA 4I9UA 3U4HA 3F9IA 4RF2A 1EK6A 3V2HA 4BHTA 3N7UA 4FOOA 2P2SA 1A4UA 4MP3A 4BNZA 4TROA 4JJFA 2JCYA 1K6XA 2QRJA 1JN0A 2E6UX 2VQ3A 3FWZA 3LK7A 2QX7A 4IDCA 2J5KA 4FOSA 4IJWA 1O95A 5K6AC 3HN2A 4OAQA 2X9NA 4MP6A 1N9GB 3ZWVA 1TI7A 4ND3A 4BB5A 1NR1A 6LDHA 1XELA 4KDEA 4W9NA 3ZNOA 4R5MA 5FFFA 2WE8A 1UP7A 5EESA 3KSDO 4R01A 4FSHA 3W6UA 5ENVA 4J3FA 4J1SA 1VJ1A 2Y1FA 3S2EA 5EQDA 4AJEA 4JBIA 4R68A 1I30A 2A35A 3OM9A 4D41A 1WDMA 1B2LA 3A14A 5L51A 3H3JA 3PHHA 3S55A 5DT9A 2AQHA 1QXSA 3DBHB 4YA6A 5BQFA 1LNQA 1L7DA 3S2FA 2P68A 4WLVA 2VNSA 3G17A 1A71A 1A9YA 1C0IA 1D8AA 4HNGA 3U9LA 4YDRA 3MJCA 5TJHA 5L53A 3L0DA 2NTVA 3WS7A 9LDBA 4U0JA 1PZEA 1HYEA 3DHNA 2VN8A 3EVTA 3SLGA 4OJNA 4BGUA 4WCFC 1B3BA 4CQMD 4YBZA 2BELA 4P4LA 1QLHA 1XQ1A 1JAXA 3ENKA 4K6CA 3QWAA 5JW6A 4N54A 1M67A 2DLDA 1ISGA 2Q4EA 4R4JA 5H83A 1I32A 5BSFA 3H3FA 4BO6A 2A92A 4BOYA 1W0CA 4RGBA 1DLJA 1DPGA 1P44A 5FF9A 2DUWA 2TMGA 3I52A 4XJTA 2P9EA 3DXFA 4RVSA 3QE3A 4UEOA 2FWMX 3G49A 3PDUA 1GEEA 1A27A 4L4SA 3KV3O 1MC5A 4DGSA 3AOGA 3G79A 2EP5A 1SEPA 2GLXA 4TVBA 3E5RA 1X1EA 2ZTUA 4N5LA 4EDFA 2ZB4A 5IN5A 5A3VA 1HSZA 2NADA 4CMAA 2DU8A 3AJRA 4GMFA 2HK9A 4Q3BA 5A9TA 4CQMB 4RLHA 5IXYA 5JS6A 2YDYA 4CMKA 1QYXA 4EYEA 1QYCA 3SVTA 1YQDA 1H93A 3PGXA 3IL2A 2Q1WA 5IJZA 3GFGA 3K31A 3E1KA 2OBYA 1HYGA 3P19A 3O8QA 4BNJA 4R9SA 3VOSA 2BMAA 3ASVA 4I9HA 4YJHA 3BHMA 4DBVO 2RH8A 4XQ9A 4M86A 2XXBA 4MVJM 5U9CA 3QVTA 5GY7A 4PVCA 3ZWNA 2NU8A 1ID1A 1T1SA 1ZBQA 1RPNA 3QWBA 2Q4BA 1ADBA 3DHEA 1HDYA 5TS3A 1W73A 2P9GA 4J6FA 5KVSA 4UUMA 2AEFA 1PX0A 2PFGA 4XYLA 5LDHA 4WCDA 3FPCA 3KYCA 5DULA 1HDGO 3KHUA 2IDZA 4D3SA 1BG6A 1UXJA 4X54A 4Y9DA 1LTHR 5TNXA 3VHRA 2QIOA 3ONFA 3PWZA 3PFWO 2E49A 3OP4A 1XHLA 2IZZA 4MP8A 4XQGA 5CHEA 1EUZA 5COBA 2DT5A 3QWIA 3KBOA 4AL4A 3FSRA 1PJSA 1DBVO 1FK8A 3H65A 1BXKA 4XKJA 2Z95A 3ZHBA 4LRTB 1XU9A 4AJ1A 3CPSA 3AUUA 1HDRA 1S6YA 4TSKA 1C0LA 3VVCA 4XYMA 4JNKA 3ZU4A 4B7UA 4RF4A 4RZHA 3JQ7B 4YJHB 2Q2VA 3D4NA 5DF1A 1LQUA 1PL7A 2ZCVA 1FDUA 3P7MA 4NFSA 4BNHA 3AUAA 3IOYA 1MUUA 3LYLA 4TKMA 1AUPA 3HB5X 3SXPA 1B14A 2DTXA 4A73A 3PIDA 3AU8A 3OECA 5JDIA 1J5PA 2EKQA 3OEYA 4P4NA 2QZ9A 1QP8A 4LMPA 4J9UE 3DZJA 5DNAA 4RQUA 1YL5A 1IY8A 5T8KA 3K2BA 1I0ZA 3LT1A 4AJIA 4DTIA 2Z5LA 1UAGA 2PH5A 2I6TA 5EMHA 5TLSA 1NPTO 1NVTA 1EBUA 2EERA 1WAMA 1J49A 1M75A 4R3NA 2E82A 2JCVA 3GVXA 3E9NA 3DFZA 2WTBA 1ZK1A 1Q7BA 1SPXA 1DRVA 2NTJA 4WE3A 5FWNA 2D5AA 3M1LA 4JQCA 4AJLA 1ZW1A 2NU9A 1I5RA 2CNBA 3UCEA 5B4UA 2FMUA 4QO8A 2I3AA 1R4MB 2B4RO 5G4LA 3W1VA 3BAZA 1FMCA 2EHDA 4FFRA 4NIMA 4HUJA 4NNJA 3ZHXA 3JQDA 4J2HA 1E3EA 4M89A 1TT5A 1EQUA 3ZCXA 1Z75A 1P1JA 3ZHZA 5BR7A 1VL8A 5CP8A 3ZZNA 4PN3A 2RAFA 1GR0A 4OSPA 1P1KA 3PHGA 4BNWA 2PGDA 1YL6A 4BO0A 4LK3A 1N92A 1H2HA 4MKZA 2A9FA 2X9VA 3PZRA 1IOLA 1DJQA 4IGFA 3VAZA 3VPXA 3JQEA 3IP3A 4EITA 5JO0A 3OIFA 4DYDA 1QKIA 2P5UA 2AEJA 4EJ0A 1R0KA 1F8GA 1AHIA 2DFDA 5JPIA 5A5EA 4PZEA 2YYYA 3RUFA 3TNLA 5TRTA 3HNPA 3OA2A 4R9RA 1VPDA 4OH1A 3KYBA 1Y8QB 2CY0A 4B4UA 4MVJI 4GH5A 5I7FA 4AVYA 2PGLA 1NTOA 3AK4A 1EFKA 4JP2A 1R15A 2I99A 2O3TA 2NVWA 1BVUA 1GZ4A 3NKLA 4E33A 1H2BA 2C82A 2SCUA 3COSA 3IIEA 4DREA 4CODB 1DAPA 1R12A 4FJ2A 4EBFA 3RBVA 3WMXA 1P0CA 4J1TA 3T4XA 4KUEA 2VRBA 4ALNA 1E7WA 4LCJA 1Z6ZA 1E7YA 4E0BA 1ISHA 5DBIA 4AJKA 4LRSB 3VTFA 4BGEA 1KEVA 1KY5A 1F17A 3WG9A 1DB3A 3ZWXA 1LSSA 4AJOA 1AGNA 1YGYA 4YT5A 4PLHA 4U6SA 4FFMA 1RKXA 1RM5A 4GX0A 1WMBA 1XLTA 3BMQA 2HRBA 2OORA 2PV7A 3VPFA 5KTKA 1I01A 4ZJUA 3MEQA 1BW9B 4LVCA 3GNQA 3PQFA 4NFHA 3F4LA 3HE3A 4NG5A 5JE8A 1GFSA 4LGVA 1PJ2A 4DVJA 3IJRA 2IZ1A 2JD2A 4HWKA 3SBOA 4XYEA 5TT1A 3PXXA 1O8CA 1Y5RA 1Q0QA 3A1NA 5IG2A 3WLFA 3DC2A 1JA9A 3IS3A 3VPHA 2GCGA 4GKBA 2VYND 2X5JO 2QRLA 4O6VA 3DWFA 3AM3A 4IQ8A 2DFVA 4QT0A 1E92A 4N18A 1U28A 4BO8A 1E3IA 4Q39A 2B69A 4YQYA 2IXAA 5A05A 3UVEA 5B12A 3DHYA 4CV2A 4MKRA 3S2GA 3WDSA 4R41A 4YT4A 4BO1A 4J9VA 4FD3A 3GN2A 3TZKA 4RVHA 1VL6A 2C29D 3QLJA 4DA9A 1HE2A 1YWGO 3GMDA 5AQ1A 1DO8A 4BMSA 1B26A 1H0KA 4GL4A 5MGBA 4B7CA 1TA4A 1NNUA 3GVCA 1PZFA 4I5DA 2O2YA 1P77A 4BO9A 5L7TA 2EW8A 2EJWA 1JVSA 3EMKA 2JFFA 3D0OA 3AY3A 3R1IA 2XPCA 4IDDA 3V1UA 4RPKA 3UW3A 1WDKA 5B4TA 1R37A 2ZJ1A 3H2ZA 4CM5A 1RJWA 1KOLA 1T2EA 1VKOA 1EMDA 4L4RA 2YHIA 3VPGA 3WMWA 1TT7A 3PIIA 1N1GA 3INRA 3ZU3A 4BL5A 2IODA 1NVGA 3ROKA 2NV6A 3DR3A 3L9XA 2YQ5A 4KUGA 5TT0A 3TFQA 1C1XB 2PD3A 5FEUA 3ZWWA 4O5OA 1N2SA 3LLVA 1JU9A 3SC6A 1LDGA 4DIBA 1WXDA 4YACA 3UUWA 2B5VA 4PZDA 2ZYGA 2DTEA 1FDTA 4IS2A 4E5NA 1NAHA 4HNHA 5GZ3A 4E2YA 1O94A 2GZ2A 1IE3A 4NHEA 3ZWBA 3FN4A 3JQAA 3B1FA 4OXKA 3DBHA 4D45A 3NTQA 3H7AA 1ZSYA 4Z9YA 1TB4A 4NBRA 1EFLA 3QW2A 3CH6A 3I6IA 3O4RA 5JYDA 1ZXLA 2UUPA 2C7VA 3DZKA 5CDYA 1OFGA 2DQ4A 3LT4A 3RBXA 3ZV4A 4W6ZA 1UZNA 2FZWA 4E21A 1E0DA 2VNAA 1X13A 1C14A 4PGFA 4XDYA 1EZ4A 2PK3A 2BFOA 5K9ZA 3V5NA 4GVXA 5KVVA 3CZMA 1GYRA 2EXXA 4YJDA 4BKRA 3DAPA 1E3SA 3QWHA 3JD2A 1ULSA 4E13A 3RJ9A 4YJGA 4H3VA 2DBZA 5HS4A 1ZH8A 1ZK2A 3RUDA 3FNHA 1HYHA 3TOXA 4JGBA 4NI5A 4GPD1 2WYVA 1N1EA 1YJ8A 2JHGA 4NBUA 1ONOA 3PI7A 1O5IA 3NJ8A 2C07A 4BNLA 3JYPA 3DOOA 1Q1NA 4YRDA 5B37A 2W98A 1KVSA 3GHHA 3RUHA 3NT4A 3JQAB 3RC7A 1UXKA 3F47A 4R1TA 2O2SA 4GLOA 4ROSA 2QRKA 1HT0A 2C20A 4II3A 3GF4A 5JDCC 1O9BA 5HM8A 4LMRA 5JXWA 4YWJA 4IUYA 3C7AA 5AYVA 2VZ9A 2ZYDA 4JJIA 3U09A 3C8MA 5EIOA 5DP2A 4B79A 5A9SA 2BH9A 1LJ8A 1NQOA 2QYTA 2FPGA 2W2KA 1JKIA 4L8VA 1BHSA 4WNCA 1EQ2A 2ET6A 1IYZA 1P45A 2HMUA 1EDOA 4FS3A 4RPJA 3WGOA 2GD1O 2BKAA 4K6FA 5DBGA 3ULKA 4GGOA 3Q9NA 3F4BA 2GDZA 3GRKA 3GY0A 2EG9A 4PCVA 4ZVVA 4PG7A 5EERA 3BZUA 1MP0A 4AJNA 3K6JA 2DBRA 4ZA2A 4CM8A 4JN6B 4CM7A 4J90A 1PGOA 3RKRA 5CG1A 1EVIA 5L7WA 3JD3A 1IL0A 3KYCB 3K96A 1ISFA 3Q1LA 4Y98A 1ZMTA 2PNFA 3QP9A 1ADFA 3D3WA 4NBTA 5IF3A 4CV1A 4RV9A 4W7IA 5F1OA 3KUXA 1XEAA 1VKNA 3GG9A 4DIOA 1HDXA 3GNTA 4AJJA 5HTOA 1B8UA 2OBNA 5BNIA 1LRLA 1MG0A 1SEVA 4ALKA 3QQPA 1R16A 2AEMA 2BI8A 1E1NA 4IGEA 3PWSA 1E6WA 2EJVA 4IIVA 4B4WA 3JQ7A 1PJTA 3IKTA 3RIHA 2YJZA 5K6AA 3HSKA 2W2KB 1I3NA 4GMGA 4TKLA 1B3RA 5ILGA 1HRDA 3GNSA 2X5KO 4BKOA 3MTGA 1ORRA 2NVBA 3OMLA 4BV8A 4R54A 1EE9A 2PY6A 4J1QA 2BLLA 5ER6A 1YOVA 3VTZA 4Z9FA 3CXRA 3FNGA 3QY9A 1XG5A 2NSDA 2ZYAA 4TQGA 4Z0HO 3U3XA 1DFIA 4M1QA 1QORA 2ZCUA 5KKAA 3OQ1A 1ISIA 5EN4A 3ZV6A 4IDGA 2PA3A 3RSHA 4R51A 1A4IA 3RC1A 5JAZA 1LXCA 4UVGA 5G0WA 1AN9A 3H9JA 4JK3A 3W8EA 3A9WA 2GYYA 3RFVA 4D0RA 3PHJA 1PGQA 3AU9A 4NMHA 1I3MA 1I33A 3RUIA 5KJ6A 1KVUA 3I9NA 1LLQA 1DAOA 2NLOA 3ABIA 3UKOA 3BTVA 1ZKMA 3HWRA 3RBZA 3RJ5A 1IUKA 4A5OA 3KETA 4B3JA 4AG3A 2NU7A 2OGUA 2X1HA 2VZ8A 5DDIP 5ILOA 3DOJA 2FPPA 3MJSA 1TT5B 1Z45A 1GUZA 1QYWA 3N74A 5IZCC 3LF1A 1ZSVA 3GGPA 3WB9A 1HE5A 4CMHA 4GAEA 1GD1O 1ADCA 2Y05A 1GQ2A 3OF2A 1QYDA 5AXAA 3KRTA 1DLIA 2HK7A 4IXWA 4YAKA 4XIJA 5HWSA 1PGJA 3GPDG 4EW6A 5I9LA 3WLEA 4IXTA 3LT2A 1NFQA 3C1AA 3DZHA 4F46A 3LZ6A 1QG6A 1M2WA 3H9GA 3DQPA 1RYDA 2O7QA 5G2OA 4D7AA 5TIIA 1BDMA 4QO7A 1ARZA 5KVQA 2IZ0A 4DLBA 4E2ZA 1R0SA 3EYWA 1YQXA 5JDIC 4Y6SA 4CR8A 2YZ7A 2Q49A 3QV1A 3INTA 1Y81A 4JBGA 1GAEO 2Y1DA 3UHAA 1DXYA 3RU7A 1WVGA 6ADHA 1Z7EA 4DPKA 3H9EO 1ISMA 2VUUA 3EUWA 4WOJA 4CMBA 4IQ0A 4XD2A 4CR7A 3SC4A 4WEOA 1WDLA 3VZRA 5G4KB 3ZNQA 3K73O 1T1RA 3WWYA 5JAMA 1JWAB 2E4AA 1DJNA 4L9RA 2Q2WA 2OFPA 4P8RA 4RO0A 2VYVA 4CLOA 5JC1A 3E82A 1PWXA 3JQAD 3SJ7A 1ADGA 3ENNA 3HG7A 4EI2A 3JD0A 4NJMB 3PFFA 3RUCA 2EV9A 4K9DA 3NV9A 2GF2A 3CZRA 1BSVA 1QR6A 3W8DA 4G2NA 2HKIA 4MVJD 3U5TA 2NQ8A 1BW9A 2YW9A 1CIVA 1LDNA 3NTRA 1YJQA 3C24A 5ES3A 3AY7A 3ZN2A 1GV1A 3UICA 2QZZA 1EVJA 2PTGA 2VWGA 1FDVA 3IAHA 1S7CA 3CIFA 3IQDB 3FI9A 1AHHA 1IHXA 3NTOA 4KQXA 1QRRA 5A1TA 5HS6A 3OIGA 3DTYA 2A4KA 3WXBA 4UULA 3LSYA 2NNLD 5FYDA 1UXIA 2Y93A 5B1YA 4G81A 3F1KA 3NDJA 1YRLA 4BMVA 2OHXA 2DBQA 3ZWAA 2J3HA 2VHWA 2R2GA 4Q3NA 5THQA 2EKLA 3FF4A 3Q9UA 1WP4A 3DBRA 3PHIA 1MA0A 2WM3A 5G4KA 2WYUA 5FI5A 1NWHA 4OOEA 4XA8A 1DFHA 1P9LA 4MVJH 4D43A 3D4PA 3ITDA 4ZQHA 3NDIA 1HWYA 4DL9A 3GH3A 3RUAA 5DCUA 4EEZA 1LLDA 5I8ZA 4YXFA 3HQ4O 2AQKA 4HFRA 1NXQA 5B4VA 2RBEA 2DPHA 3BTOA 1CETA 2Y0EA 1YE3A 3IUSA 1PZGA 3ZW8A 2Q22A 2YHIB 1UDBA 4DMMA 1ZJYA 2VCYA 3WFIA 4URFA 2C2XA 5TX7A 5KJFA 4OGWA 3LT0A 5EJ2A 2AG5A 1I36A 3VC7A 3FTPA 5L95A 1MXHA 2P5YA 2WJPA 3BMNA 4IJVA 3WGZA 1SOWA 3HHPA 3DBVO 3TZCA 4OXYA 4MIYA 3TPCA 3Q0EA 1WWKA 1U7TA 1Y9EA 2BRUA 3PWKA 1TXGA 4WECA 4M55A 3MJ4A 4R16A 3HUDA 5C7OO 3I9LA 1PJ3A 4OHUA 4TWRA 4BO4A 4CQLA 5KNLA 1EDZA 4BIIA 3JQCA 4XYBA 1CRWG 1HTBA 2F1KA 5A9RA 2V7PA 4HXYA 4KQWA 4MO2A 4UAGA 1ZK3A 4Z9XA 4YQZA 3MOIA 1LSUA 3QWFA 3R0IA 1CEQA 1OC4A 1ONPA 3GPIA 3I4CA 5TF4A 1SBYA 5G0TA 4NK5A 4B7XA 4N5MA 4UUNA 3SX2A 2R00C 3VKUA 3GEMA 4GSLA 3CINA 3QHAA 1DC4A 2P4QA 4IS3A 3RASA 3I5MA 3I83A 3ANLA 3E9MA 4IDBA 5JLAA 4E32A 2J5RA 4DWVA 1PU2A 1DRWA 3TL2A 3KEOA 5I7SA 2I66A 3H5NA 3U4CA 5TJ9A 1YQGA 3ZWMA 5LC1A 2JCXA 1YXMA 5TC4A 4E12A 3I9JA 4QFCA 4XR9A 3ITKA 4NBWA 4OQZA 4EEXA 1O6ZA 3TQHA 2DTDA 4FGWA 1I2BA 3E8XA 4DPLA 2EP7A 4EGFA 1LDYA 1DFGA 2GR9A 1Q7GA 3JD4A 1U2GA 3EC7A 5AXDA 3OJEA 3MJEA 2YV3A 3NYWA 4BO7A 1IB6A 1D3AA 2O3QA 2NU6A 1VL0A 3KLMX 4EUEA 3WGHA 4B3IA 2Y1CA 1PIWA 4CMIA 3TSCA 1Z7BA 3DZIA 1PJLA 5ITVA 2Q45A 5JC8A 4YPOA 1CF2O 4B8ZA 3HFSA 2BFMA 3X2FA 1DC3A 3QVXA 2DM6A 4ND2A 1UDAA 2FR0A 4JCOA 2IEDA 3AUSA 3K92A 4LSMA 1VSVA 4XQCA 1MV8A 2H5LA 2VT3A 2YUTA 3PVZA 1P0FA 4RF3A 4ZQGA 4CMCA 3RKUA 5C7IO 3CE6A 3TRIA 1CQIA 2UUOA 4RPHA 1E6EA 1P1HA 5KWEA 3JYOA 1H6CA 4PG6A 3HJAA 3KTDA 3LC1O 2J8ZA 4PZCA 4CM4A 4WLEA 3FHLA 3F1LA 4A26A 4DUPA 1EUCA 3C1TA 4I5GA 2C59A 5JO9A 1O89A 2FRDA 2W2LA 1C3VA 5I7EA 5JY1A 4WLNA 2OP0A 1M66A 3EHEA 1XDWA 2BGLA 4EUFA 2HMWA 3R3SA 2Q99A 1H94A 3TJRA 3DAGA 5T67A 1NHWA 4TMFA 1P33A 3O03A 1EVZA 4UVEA 4YAJA 2Y0CA 4D42A 1IULA 2D8AA 3WICA 4CMIB 7ADHA 2DAPA 4Q3CA 4CL8A 1Y8QA 3VDQA 2B35A 2Y67A 1BMDA 3OJFA 4Z0TA 4GWKA 1C1DA 1YDEA 4FN4A 2FOIA 3RFXA 1YB5A 1I2ZA 4II2A 5ICMA 3ONDA 1JW9B 3OIDA 1I24A 2X7HA 4ALJA 3GDFA 4ALIA 3S2IA 1P1FA 2VYNA 4OMUA 1VRWA 4FC6A 4ZU3A 3W4JA 2QHXA 4DLAA 2FHSA 3VZSA 3LQFA 3VDRA 1AE1A 2VWHA 1JAYA 4U8GA 4XGKA 1I10A 3RC9A 4DMLA 5A3JA 1OBFO 2O3UA 3WQRA 3GC6A 1X7HA 4I1IA 4IINA 1X0VA 1DIRA 3WIEA 1Y1PA 2C54A 2FSVA 5DZSA 4CR6A 4J16A 1HXHA 4YT2A 5GZ1A 3TN7A 5KJEA 4YEDA 3ZV5A 3RU9A 2EKPA 4JX8A 4TRMA 2FSSA 1PJBA 1B8PA 3RD5A 4OKIA 3MWDB 4DC0A 2BFAA 2O3SA 4XRGA 1KY4A 2JL1A 5JAIA 2BI7A 1ZCJA 4A03A 2O7SA 3HDJA 4ZD6A 3GR6A 3DB2A 4P22A 3TF5A 3U4DA 5IDQA 1E77A 2CF5A 4HFJA 5T73A 3HN7A 2HJSA 4PLYA 1C1DB 5BNTA 3VZPA 4DBZA 2VHVA 1OI7A 4K1LA 3TZHA 4GWGA 1XIVA 5JCXA 5T5QA 4DQXA 3U62A 4PRKA 4WCFB 3AW9A 1HDZA 3V2UA 2CVQA 4KOAA 4GX2A 3G1TA 1ZEMA 2I3GA 3UAGA 2RHRA 4FPXA 5M6DA 3EY4A 4IZIA 1V9LA 1PWZA 2OUIA 3AUTA 4E5YA 4HADA 3WGQA 4BKPA 2GSDA 1UZMA 4CMJA 1JLLA 4Q3DA 1D1TA 3KLPX 1BXGA 3KYDA 1JKFA 3PYMA 2J3KA 4GKVA 3DOCA 4YJFB 3UGKA 1GCOA 3H2SA 2BGMA 4HP8A 2Y1EA 5L3ZA 4TVOA 1LBEA 2Q1UA 3DMTA 2PZJA 3F46A 3JYNA 2O4UX 3UXYA 2AHRA 3HDHA 2GN8A 2FY8A 5J9GA 1NHGA 2XAAA 3K9QO 3ROPA 1WLYA 1DRUA 1JWBB 2PGJA 4RVFA 3D5QA 2E48A 1E3JA 3PYLA 1F14A 3Q2IA 4HBGA 2WEKA 3H9UA 1E3LA 4FQ8A 4R3WA 2HK8A 5CPFA 2EGGA 4YAEA 1UAYA 3W4KA 4L0QA 4XYGA 4L76A 1DHRA 1KETA 2CSUA 2HAEA 4XB1A 4RL6A 4B4OA 5F3RA 4IJUA 2VT2A 1J6UA 4E4YA 4R1NA 3FNFA 1K6JA 3MTJA 4RVDA 5C5IA 1ZVMA 4YT8A 2PR2A 1TVEA 3C7CB 2JJYA 4XGNA 1UP4A 2BGKA 2D59A 2GUGA 1ONNA 2V6GA 2H63A 3I4FA 4MDHA 4OSOA 1W8DA 4E5PA 3P5SA 1F12A 4NJOA 1A7AA 4RPLA 3C85A 4BB6A 3VKVA 1C0PA 4GBJA 3BHIA 3U49A 3L6OO 4XB2A 3PP8A 4WLFA 1BDBA 1UH5A 4JLWA 2A94A 4XQEA 1N9GA 1U3VA 1T2AA 1RM3A 3PQEA 4GI2A 1PGNA 1SAYA 1JKJA 3OSUA 3SLKA 3NAQA 4WOKA 4L75A 3TFOA 1KVQA 2PKRA 3OHSX 1WNTA 1MX3A 2AG8A 3SJUA 2C2YA 1MB4A 1P1RA 3OETA 3BIOA 4ND4A 1PR3A 1GCUA 3DO5A 4XX0A 2WWRA 4BVAA 4HFNA 4CUZA 5DCYA 1UDCA 3U4IA 4PIVA 2W2LD 2EGHA 3AM4A 1YB4A 1IPEA 1E3WB 3WIDA 3JCZA 2AXQA 4J4BA 2VHXA 3O38A 3ZNPA 2Y0DA 3P2YA 5CDSA 4DC1A 3C1OA 2JFHA 2YHUA 3I9OA 4HY3A 4NU6A 3LC2O 4PLFA 1E5LA 3C3XA 1LRJA 2IXBA 2E37A 1P31A 3OQ6A 3PGJA 4WASA 4A10A 3G0OA 3QIVA 3V2GA 4CLEA 5KVCA 1WZEA 2V6MA 3WFJA 4PLPA 1RWBA 3DONA 1GL3A 4MINA 1H6AA 4WKGA 3IMFA 3GZ4A 4R1UA 4BKUA 3QA9A 5JBIA 4BNIA 2YFQA 2X4GA 3VH2A 4J1NA 3UFXA 2PZMA 4J0EA 4TZKA 3ROMA 1Y8RA 1SB8A 4I9NA 1LLCA 4FJ1A 3FWNA 3W8FA 3I23A 5DP1A 3L4BC 1PGPA 2HMSA 3PDJA 1VJTA 3LLSA 1HE4A 2X86A 5C3MA 2NVUB 3FR7A 2FPIA 4B4VA 3FBGA 4GX1A 1A5ZA 4RQTA 3I9KA 4HV4A 4WGGA 4PLWA 1SB9A 3D3WB 4UEKA 1V6AA 3BMOA 1GPJA 1TLTA 2NQTA 5EL0A 4PFJA 1BRMA 3PJDA 3NJ4A 3PYXA 3AI1A 4QECA 4Y6PA 2IE0A 2WD7B 4YTEA 4B8WA 3CSDA 3GVIA 3HDYA 3JQGA 4DXHA 4JJGA 3AM5A 4YAGA 5CEJA 2AQIA 2G0TA 1FF9A 1PS9A 2PD6A 4FFLA 4HX5A 2D2IA 4MVJP 4BGVA 1BGVA 1R6DA 1XU7A 1D7OA 1XCBA 3BHJA 2ZB8A 4YVFA 3BTSA 1UR5A 3MZ0A 4O1MA 3DMYA 3C7DB 4XWYA 2I5PO 2R00A 1X7GA 4QQRA 9LDTA 5ITWA 4EUHA 1V35A 1UXHA 1MC4A 1U9JA 3K5PA 1FDWA 3WSVA 4PLZA 2CFCA 2ZKLA 3V8BA 3DBLA 1TEHA 5LDGA 1NBOA 3W4IA 4S1VA 4ONEA 2B83A 1HETA 3Q6IA 1NQTA 4FC7A 4QFDA 1P74A 5KJ1A 4MVJG 2XOXA 4DPMA 4M87A 2GASA 2R6JA 4XIYA 1XA0A 5JMWA 3OJLA 1GTMA 1L7EA 4R5HA 1HSOA 1LDMA 2FZEA 2ZJ0A 4P38A 5F5LA 2B36A 1P3DA 5I7VA 3BXXA 4BNUA 3IP1A 1RM4A 2I65A 1W4ZA 2X22A 4NR0A 1YKFA 1K0UA 5J23A 1J4AA 2YDXA 3E03A 2IYOA 3M2TA 2HJRA 1U8FO 1LDEA 1W6UA 1F0YA 4UEJA 3PJGA 3JSAA 1E1KA 2WD7A 1X0XA 1ZXBA 2FR1A 3JQGB 3PQDA 4WLUA 5JAQA 3DZFA 3BTUA 1M6HA 1ULUA 4ZRMA 2EIHA 2X0RA 3WYBA 3RROA 4FIZA 3D3EA 1T2FA 2GGSA 3WR5A 1JVBA 1NQAO 3VVBA 1VLLA 4E5KA 5JFOA 2X8LA 5L45A 1RYEA 4CM9D 2P91A 3RQSA 1ZSNA 3OJ0A 4UUOA 1BTOA 1B7GO 4PLCA 3WQQA 3FNEA 4D0SA 4ID9A 4QSMA 1R4NA 4RORA 3E18A 1Q0HA 3QSGA 4CM3A 1SCUA 4CMEA 1R0LA 1PTJA 4ZQEA 3RFTA 2PKQP 2LDBA 4ZQBA 1VI2A 3RAJA 4W82A 4DQVA 4IM7A 4Z3KA 4K26A 2AA3A 4TRRA 4S3MA 5IDXA 2C5EA 2X5OA 4GVLA 2GN6A 4KZPA 2Y1GA 2PLAA 2Y66A 2HMTA 3ZGYA 4BO3A 1LLUA 2HUNA 1KIFA 1IPFA 3DZBA 1EUDA 4Y67A 3WQSB 4FW8A 1ML3A 1B8VA 3CUKA 4U6QA 2O3JA 1GUFA 1IZ0A 1YO6A 4CV3A 3F5QA 1G0NA 4J43A 2BFPA 4E5MA 3GZNA 3U0BA 4NJMA 4FBGA 3L6EA 5IXSA 4M49A 1U3TA 5A03A 3P2OA 5EPOA 1HF3A 5BSEA 4GSKA 2AMFA 4JROA 1U3WA 1LX6A 1LRKA 2Y1OA 3NX4A 4U0KA 1QV6A 1DDOA 5KOIA 1M6WA 2ZATA 3JQBA 3L9WA 1R4NB 1SC6A 4AJ4A 4R69A 2XXJA 3OICA 4GX5A 3AFMA 2FN7A 4F45A 4MIEA 3UOGA 1LSOA 3HB4X 4CV0A 2OXIA 1C1XA 4LN1A 1T25A 1ZEJA 2XF8A 2CDBA 3WOHA 3FRJA 4UVHA 5L4SA 4D46A 4RDHA 3G3EA 3D1LA 3BMCB 1Z73A 1ZIDA 2WD8A 2ZQYA 1SNYA 1WPQA 1PJ4A 4W4TA 1LI4A 2X0JA 2OOSA 1O0SA 5L4LA 5BSGA 4W7HA 3RCBA 3WJ7A 2CZCA 4QUKA 1DC5A 1PS8A 1T4DA 1G6KA 3Q11A 3ANMA 4PG5A 3TWOA 3CTMA 3PLRA 5AOVA 1PL6A 2Z1NA 3QJ5A 1VM6A 1YONA 3I1JA 4CUJA 3RVDA 1QMGA 2PH3A 1LC0A 1GV0A 1U1IA 5DN9A 1KBZA 1XYGA 3PZBA 2B4QA 2WE7A 1GQQA 2Q1TA 3KYDB 2AW5A 2GRAA 4IQGA 3FR8A 4I08A 2NTNA 4NH4A 4YJFA 3GEDA 2G76A 1I3KA 1VSUA 1DEHA 1T26A 3UF0A 4FB5A 2GZ1A 2CVZA 2F00A 3PJFA 3KO8A 1PEDA 1D4FA 1OOEA 2VOJA 1FXSA 2ZTVA 3S8MA 3JTMA 4CJXA 1ENYA 1LU9A 1U7HA 3GGGA 3PLNA 4QEDA 4RF5A 2O3RA 5JCJD 3WBFA 4E30A 2QG4A 2DPGA 2CD9A 1IZ9A 1NPDA 3OBBA 3B70A 4BNTA 1WZIA 3PHLA 1VJ0A 3ONEA 2JD1A 4Y8VA 3NRCA 1NX6A 3L07A 5IDWA 4Z6KA 4DIFA 1MFZA 2RCYA 2BHLA 3K2EA 1ZMOA 1UXGA 2V6BA 3FBTA 3HZZA 1I2CA 4XZ3A 1U4SA 4OQYA 3ZH2A 1Z82A 1QV7A 3EZLA 3ZW9A 4TRJA 4Q9NA 1X1TA 3T7EA 2BD0A 4IY1A 2Y99A 1ZK0A 5CDGA 3OFSA 4GLLA 3ORFA 2VTDA 1L1FA 3I9MA 1U3UA 5T64A 1YBAA 5JYFA 3B1JA 1EE2A 4M8SA 4NU5A 3ZU2A 2PD4A 4JIGA 4FFOA 4E2WA 1UP6A 1ZJZA 2WYWA 3TZQA 1DIHA 4YRAA 1KEWA 4Z0PA 4D3FA 4WEQA 1VE9A 5KIAA 1LDBA 1V0JA 3WTCA 1DIGA 2GNAA 3A4VA 3E9QA 4AJ2A 3FCOA 1GADO 4CM6A 3LVFO 2AE2A 2X23A 4L73A 1JTVA 4QX6A 4IZHA 2V6FA 3D7LA 3K8ZA 3GRPA 1WW8A 4BMNA 1I8TA 3E5MA 3R3JA 2D1YA 1P1IA 2VYVD 3ZWOA 5KCZA 1VC2A 3PRJA 2B0JA 1N7HA 1Q2XA 3KZVA 3E6AA 3INGA 4PLGA 3KEQA 1H9BA 2ILTA 5A02A 1E3WA 1GU7A 2YY7A 3ANNA 1GDHA 1YB1A 4G65A 4NQZA 5F1PA 1M76A 5KKCA 3F6YA 3HDQA 3OA0A 5EINA 4YYZA 3EDMA 4JXKA 1NPYA 2GERA 5HRUA 1KC1A 3TL3A 4JP3A 4CMEC 3O8QB 1QYVA 3WGTA 4G5HA 3I3OA 3EGOA 4QXMA 1CDOA 2NUAA 3IKVA 4E6PA 1SOVA 4CUKA 4F6LA 4AICA 5A04A 4INAA 4A27A 2CDCA 5U1PA 3RUEA 4YAIA 1T2DA 1Y8RB 5T57A 1SMKA 3AOEA 4YJGB 1DHTA 4BNKA 5CFZA 3NT5A 4CM4B 3MCVA 1NM5A 1FDSA 3CMMA 4CM9A 4ZN6A 3GN1A 4QTZA 1HEUA 1MGOA 2Q46A 2DKNA 1DIAA 3JQBC 2B4TO 3AFNA 3V1YA 4OKNA 2NVUA 4ND5A 3Q2KA 2VWPA 2NWQA 1U5CA 1K6IA 2G82A 1YH3A 5DOVA 4BUCA 1T4BA 2IEBA 3B1KA 4O63O 1HDCA 3DZGA 2O48X 3L77A 4WJZA 3ETGA 1PQUA 3ETDA 3KB6A 5HBRA 7MDHA 1A7KA 5IN4A 1I3LA 1G1AA 2GN4A 3QVOA 5I8WA 4A0SA 1NYTA 1PSDA 1B0AA 1AXEA 3NGXA 3GT0A 4H15A 1BVRA 4ND1A 2X0IA
chains in the Genus database with same CATH superfamily
1MFPA 1MJ5A 4YR9A 5FBLB 1AQUA 5IFLA 3PXCX 1G55A 3GJXC 3A7EA 5F4BA 1WTAA 1TA0A 3U3RA 1FX0A 3EZYA 2WG1A 2FPPB 5KTOA 1PN3A 4G0WA 2GO7A 2ZT5A 4C14A 3QY0A 4S0ZA 2J3JA 4CI9A 2AN9A 2ZB7A 1O5TA 2WJWA 3F5SA 3QVWA 3OZEA 2EFDB 4CIXA 3ADPA 2NO7A 4G1MB 1BEEA 3W5AA 2GETA 2ZREA 4KYUA 2C2MA 5CLLA 1APBA 3R23A 3IFSA 2ZTLA 4L9WA 4FDAA 4UM7A 5DFAA 3WV5A 4YJ2A 4JA0A 3WRXA 3GK3A 1P1CA 3H75A 5AI6A 2JEYA 2CDAA 3DLIA 3VVLA 5E7IA 4QJBA 4XI9A 5HJ7A 3SVLA 3MJTA 3U7RA 2JBAA 3B51X 2FUG6 3PL1A 1ISRA 3GFBA 3WLLA 2DSNA 1RYBA 4DLPA 1P9WA 4G9BA 5E1DA 4BQOA 5AUPB 2OV6A 1UQUA 4UUQA 2ZYVX 1YVEI 2GX6A 4X94A 1N7JA 4L07A 1K3UB 1OU4A 2J3QA 3L49A 4QUEA 3ADOA 1ZNQO 5BSUA 4M1YA 1UWKA 4KOEC 4A2CA 4NYMR 2Q1SA 5JBNA 2IS4A 4O5AA 1LA2A 2HX1A 2DC1A 4JLAA 2QG6A 2BYTA 1F0NA 4UVIA 1P4AA 1EX7A 4P7BA 3VRHA 2R7LA 1G2QA 1RPAA 4WNAB 3LBIA 1VXRA 1T24A 3ASZA 2A9QA 4F2PA 1G4AE 5FOTA 3V1TC 3W6OA 5K3BA 2D4AA 1L7AA 1RQ2A 3FDXA 3A1DA 3LQKA 3MOGA 4R98A 4RKWA 1JQLB 2EYQA 1LZLA 5EWMA 3TQRA 2Z2KA 1RQNA 2XUPA 1IHYA 3V1MA 4W1QA 1C0EA 3ESCA 4BNXA 3HMQA 4BNFA 4E31A 5LZ2A 4IIUA 1ZCFA 3DT6A 1PDOA 3VR6H 2POQX 1HI9A 1W5AA 2BFEB 2P6NA 3F4KA 4UQOA 1DI0A 3R8CA 4P3PA 2HEGA 4FDMA 2WP0A 4X8OA 5BSWA 4NFYA 2O52A 5IRCD 5C4MA 4AY6A 1ATZA 4QU0A 1GHTA 5EE5B 4TYWA 3TZLA 4YRBA 1HORA 3CKMA 5MDHA 1YJBA 3ZLVA 4N6NA 5BSTA 3TDMA 3L0IB 3BH6A 3CEAA 1EI9A 2J87A 1L7VC 1TM4E 2BEWB 2OGWA 3MM4A 5D3MB 4B31A 3ZWDA 4OXXA 2QN2A 3EISA 4INPA 1YJ5A 2MSNA 1KVTA 3HVHA 1OIVA 2HA5A 4GKKB 2WPDD 4PO8A 4ZICA 1OH8A 1NW6A 4HFMA 4UTPA 2GCOA 5C1PA 4XH9B 2AFIE 1YZKA 4PQRA 2F7SA 3AIIA 3JASA 3OZVA 1ZIYA 2DHCA 1BGWA 3BFKA 3VR0A 3GDOA 1NASA 3A4YA 3ZY2A 4L74A 4FK8A 1Y6GA 2AXNA 3EYAA 5JYAA 1T9GR 3C48A 4I3GA 2HADA 4NK4A 1GAXA 2FN3A 5F3WB 2P6UA 1JR3E 1L5VA 5JXGA 4X00A 2O8EB 2JFGA 4OFXA 1V7QA 2YASA 4KO8A 4ZGBA 3ZWPA 3U4MA 1D1SA 3C3AA 1IM2A 1IRXA 1KJZA 1YACA 3R6DA 2BEVB 2VUSA 1AU9A 1KYZA 1FP7A 3C2QA 4OHOA 1NI4B 2BMFA 2VFAA 1VKRA 3PD7A 3AB3A 3HYTA 3SSOA 2FP4A 4I5EA 2IYWA 4RVUA 3J7TA 5EIHA 1TM3E 3RR2A 3GZNB 3JYQA 3CX4A 4ALLA 3ILYA 2VXYA 5K0LA 4BLRA 3PUXA 2F43A 2R48A 1ZIPA 1TL7C 3ENZA 3IB6A 3OO1A 3GCWA 5K0NA 1K86A 1S89A 2YV1A 2YIDA 5EHZA 4I55B 1XMXA 1AQ6A 1ULZA 3MCAA 3A31A 1R88A 3BJMA 3AHCA 4RAQA 3ANXA 1OIXA 5ERGB 3H2IA 4JL5A 4K3VA 3IRVA 2Z5VA 3AWDA 1U5AA 2C0PA 1YU9A 3BPSA 4MUIA 4DDMA 2IOFA 1W85A 3K0AA 4FJ0A 1L3BA 2OQVA 4D74A 2ZWAA 4B3TB 2QUZA 1GNRA 1FNDA 4KNVA 1XWFA 3CUEF 4N39A 1LK7A 3B1XA 1SUDA 3HCOA 3BMNB 3IA7A 4CKEA 4GC9A 1N2ZA 1JJBA 3BMCA 1PR9A 4ZT7A 2NSHA 4INZA 3HSYA 1W4CA 2XW6A 5IX8A 3M1AA 3AOEC 5DNWA 4ZVRA 1PD0A 5B64A 1K89A 2PWZA 4OYLA 3P1JA 4AKGA 3WO1A 2WV9A 1X8KA 2X1VA 3GOHA 3H13A 4LSWA 4OH7A 1GCIA 1ZI6A 3LQ2A 3LY7A 5EVCA 4KP7A 1P17A 3E9CA 3LDHA 2ORIA 2X6TA 1RI5A 3NIWA 3OT1B 4KXUA 4QDOA 4ZO6A 4YV1A 5LU8A 4RTJA 1LLFA 1QHIA 4HLQB 3AY0A 3HCFA 3SX0A 4ZZIA 2QF7A 1JENB 5AW1A 5KOHB 2A57A 2RI0A 1POXA 3OOSA 1P3JA 2CXQA 3IVXA 4Y2GA 5AUQA 3RTEA 8ADHA 2A9KA 2JEOA 3K1AB 4CQMA 3B82A 3A1TA 5HA5A 4I5FA 4MDEA 3UMFA 1WXFA 2GARA 1K2WA 5K4AA 1A88A 3C39A 4RVGA 4C6TB 3OJWA 1PZHA 1PQ4A 1T35A 1ZZEA 2DBVO 1DG3A 1W85B 3K0AB 3PUKA 1TZ2A 4NF2A 2QN6A 3UJ8A 3T15A 3VR4H 1Z25A 5KQRA 4NPCA 1LNSA 5TEWA 3D1VA 4MB0A 3U81A 2ZSFA 3EC1A 1E0JA 1DX6A 5EJMA 1Y3CE 2OHJA 4RIIA 4BRWA 1DAMA 1RRCA 2F1IA 3B6ZA 3ASYA 2TMDA 1QZUA 1JQBA 1RCUA 2X4IA 5EXSA 1UWVA 4PRLA 3SBXA 5DN6A 2OTCA 2VHZA 4MQ5A 2XZPA 3FYUA 4HDNB 1HE8B 4DJAA 5JDCA 3IC5A 2CFTA 3EXEB 3A9CA 2OCYC 3HEAA 1J9EA 3GRYA 3NWOA 5T8KC 4RH1A 4KUHA 3SR4A 3UKJA 3D6UA 1TAGA 1RMYA 3PD1A 1DO0A 3KL4A 4W8HA 2X0NA 3ZWKA 1Z22A 1JJIA 3LY8A 2PX2A 3DW3X 1HL7A 4BKQA 1FIUA 2R8PA 4EYQA 1PO7A 4U7WA 4B48A 1OLXA 4B1FA 5CU7A 3C97A 4Q3LA 3VR5A 5D6NA 4IMPA 4WXEA 5KSPA 3L8CA 3F7OA 1UQRA 4PC6A 4MV3A 2XYHA 4ZMSA 3GUYA 2PX3A 3IHLA 3F0TA 3QVUA 1ZUD1 2QPTA 5H81A 4IHQA 1LUAA 1WDWB 2H4WA 4GBMA 4GE3A 4U8HA 5HX7A 1GUDA 1E5DA 4ITUA 2JF0A 2KSQA 2N3ZA 3VO1A 5EYPB 5EQFA 3ZBQA 3QQ5A 4MEBA 4LSGA 1L4KA 1YB7A 3C6BA 3HKDB 3ONVA 3ZCSA 3WWZA 1ILWA 4N7RA 4I4TB 1H1LB 3O9ZA 3CLRC 2OZPA 3NT2A 4RY2A 3G0BA 4ZVSA 4RADA 3WYDA 3X1KA 1AMNA 4ZVOA 1N8SA 1E9AA 3RS4A 3IULA 1BZYA 1VIMA 4NCNA 3KSZO 521PA 5KDOA 1HM5A 2A1TR 2D2VA 5BNFA 1E5VA 2BE7A 3EAGA 5A5VA 1E6KA 4K28A 4Q1BA 2WB2A 1C81A 3EXAA 3M5CA 1QF9A 2C3PA 4NCKA 1NAIA 3P9QA 3KZKA 1X9HA 4BBPA 4UQLA 2P5SA 3EB9A 2YQ4A 1F3OA 4R8RA 3LT5A 5KMGA 1U28C 3D8TA 3Q9SA 4I66A 3MWLA 4EVQA 3IP5A 4BX2A 4CM1A 1CR6A 4Q0MA 6GPBA 1BMTA 4D2IA 2OHIA 2H0AA 4K6OA 1QCDA 3QU5A 4WPGA 1GZ3A 2WWWA 4HQ0A 4Y2RA 2YFHA 5K03A 1QU2A 5FTMA 1H6BA 1BGXT 4FBLA 4MEJA 3RS3A 1OREA 2ZTMA 1R6TA 3E9ZA 3Q8LA 2K4MA 1CXZA 2VTEA 5I4BA 4OB7A 1HKUA 1M34E 2VDWA 4QOHA 1UFVA 2NTEA 1GO2A 3W2EA 4UUPA 1R5JA 2ETVA 2Q2QA 1I4TD 2RGNC 3GX1A 3PHBE 5HIMA 5JAPA 2XBMA 3ICQB 3GW8A 1R5BA 1GZUA 1H9CA 2OKGA 2WMDA 3ZTWA 1F7VA 2H4XA 2VQEB 1CZRA 3KQPA 2A5FA 4MUKA 1IUPA 1F06A 5K0JA 3ZJ4A 3N7TA 5CLHA 1YBMA 4I4TA 1P7ZA 3IAEA 5D51S 4Q7MB 1VG0B 1JHUA 2Q41A 3Q40A 1W2GA 4QHYA 2VHUA 2YV5A 2QQ5A 1OXVA 3DFIA 1U3GA 3MAJA 5LA6F 1JMKC 1ZUNA 4CEHA 1IN7A 3I6QA 3JZMA 4LV6A 4TTRA 4DUZB 4KR6A 5J43A 3SCZA 5CAEA 1DV2A 3VHXA 3RC2A 4A8JC 4ZOCA 3VNQA 5IKXA 2J6IA 2VK1A 4FE4A 4C4OA 3HBFA 1EU1A 1GAQA 1PUJA 1TUIA 4MCAA 1J0XO 2BMEA 2ZVDA 4TS1A 2HBZA 3MRXA 4J2OA 5L7YA 2JLWA 2OPBA 1QIIA 3USES 1QDUA 4BTLA 3JZDA 1T2CA 1KXJA 2VJYA 3JQ9C 1RRKA 2X0FA 1I7MB 4CHTA 2ATCA 4O59O 1OI3A 4J0FA 4X3PA 5TMDA 4Q4JA 5L40A 1SH7A 3F6PA 1O7JA 3IQIX 2DLCX 1FX0B 1ZM9A 2CMKA 1KI9A 3FTFA 2WF6A 5AR1A 4C0AC 2XADA 2D5CA 4FFPA 3WYCA 4BNVA 1G2IA 3O95A 4Q3EA 4MVJF 1XP8A 4E07A 1VB5A 5L9AA 4HK4A 3LQYA 3USCS 2ZJOA 4D9BA 1UEJA 2EWMA 1NE7A 1ZGAA 1GZ6A 2PA0A 5EPEA 3QMVA 4BZQA 5JAUA 1D2CA 3CISA 4LZPA 1WPRA 3RHSA 3ZU5A 4TQAA 4FEAA 1P8JA 1S2MA 2R4UA 2RHHA 1OTHA 2R5NA 1Y5IA 5BMVB 2SECE 4BQPA 3MB8A 2C4KA 3NFYA 2CCJA 3W5DA 1VMAA 3FD8A 2NP7A 4B5KA 2FFJA 2ZRGA 2RGYA 1HLPA 2XY4A 2VJLA 3TKAA 3VJRA 5JWOA 2K5UA 3FUCA 3QYPA 4RY9A 1CS4C 3VNVA 3C3EA 4IEEA 1CV2A 1QC5A 5E2BA 3STXA 2GF0A 4H1HA 4KN6A 3VNSA 2BGUA 1CUGA 4Z4QA 4C7VA 2MT9A 4KWIA 4EATA 1XQ9A 2FX3A 1KAHA 2NV0A 3DFMA 4YAOA 5CPBA 3Q9LA 2AJCA 3AVTA 1BXZA 3QFHA 1LC3A 1ESDA 2Y68A 2EHJA 4HDSA 1O6GA 2Q4OA 2PQ2A 3BK7A 1DCFA 3VR3A 1EUQA 2JB9A 5C7YA 3Q0IA 5HIIA 1RZ3A 2PJDA 3EAFA 1PCXA 2UYHA 1KRWA 3C98A 5JISA 5BW5A 3HB1A 1M83A 4XSGA 5HKAA 1DAGA 5JSYA 4L5IA 5EXEA 2C78A 2C83A 3SF8A 3T5DA 1DE0A 3OJCA 3VH4A 2IBTA 4F6RB 4FDTA 4ZHSA 3DF7A 4TMXA 2GJKA 2MYTA 1HDOA 5F2NA 5K4GA 4P31A 3NDRA 1ZD9A 4A92A 1SU7A 1XI2A 1OAKA 3F71A 2VAWA 4MVYA 4J7CA 2YOFA 3KB8A 4G0YA 3A3NA 3RADC 3AY6A 3CWQA 4G4SO 5JCJA 1FNBA 2OD9A 1M2GA 1VLZA 1SQSA 5AW5A 4MQBA 4NONA 1BN6A 2N0SA 4C1NA 1SKYB 1DDGA 4FR5A 3SU8A 5AK3A 2Z1MA 4GZ5A 1ZI9A 1R8SA 4C7KA 4J03A 2C5LA 5AIBA 3FMVA 2W7TA 1YR2A 4RSGA 1A9ZA 1M1YE 3WYEA 3HK2A 4IV8A 3QBTA 4O8JA 2QSUA 2K2WA 4NL4H 5G3YA 1XU4A 3IQHX 4MP3A 1QH8A 2GBCA 1E0KA 3PFNA 2ZJYA 4KK3A 2H11A 3V46A 4QBTA 2AOWA 1FS5A 4IDCA 4TMTA 2H29A 3SN6A 2XDQB 4XUDA 1FP4B 2NUPA 3HN2A 1LX7A 4OAQA 4P83A 1AUOA 2GFIA 5AKGA 5K6AC 1KI8A 4LY3A 5ECYA 4FOPA 2QTAA 2XQJA 4LYEA 4OI1A 3ZWVA 2QN7A 4E7OA 1JMYA 2R79A 1TI7A 1ADYA 1NR1A 1A5BB 3LUFA 3TYXA 1YFZA 2XTNA 3WZMA 4I8IA 2WE8A 3LBNA 2W2TA 3OE4A 1QO7A 4IZ6A 1ABEA 2WIGA 3LGXA 4J3FA 1ES9A 3WK4A 3AO0B 1CP3A 4JBIA 3ENQA 3QF4B 1Q15A 2O20A 2Q5FA 2BDTA 4L7QA 4TS9A 2DXIA 3RE1A 1NF8A 2KS6A 1FPMA 3QLVC 3A14A 3RV4A 5K5EA 3AFOA 2AJDA 2HJGA 3DNMA 5EG5A 4TKUA 2AQHA 3R5HA 4M8IA 2OQIA 5BQFA 5ITZA 1MH9A 2VNSA 3H4TA 1A9YA 3LZCA 1D8AA 4GBGA 3Q7EA 3VHQA 3MJCA 5TJHA 5B3LA 3L0DA 2NTVA 2VHQA 1S8AA 3N2EA 5LZ4A 3R9WA 2ZDHA 4CE6A 4OP3A 4U0JA 1AGYA 2CCKA 3IUJA 4E70A 5CFPA 3SLGA 1QK3A 3VQTA 4BGUA 2CXUA 5KNBA 2UU9B 1FSPA 1TJNA 3HLTA 1M6VB 4P4LA 1RQRA 2IXGA 1XQ1A 2ACKA 5E3HA 4DRXB 4EZEA 4JJ7A 4K6CA 1SHUX 4F12A 4JB8A 4N54A 4JODA 1IEVA 1M67A 2HMAA 3OUZA 4FXOA 4Y7CA 1ISGA 3TQQA 1BWRA 4X90A 5H83A 2G04A 2E4ZA 5A3RA 1I32A 4C4PA 1DOZA 2O57A 4M36A 2X4DA 5MFZA 4W5JA 5JBQA 1U0RA 2A92A 2JIDA 4ZOLB 4D25A 4FYWA 4RGBA 2NQ2C 3FCAA 2DUWA 3CWZA 1G20E 2MWMA 2V45A 4XJTA 1V16B 4MQUA 3QE3A 1M33A 1GZSA 4UEOA 2I1VB 1P4GA 4HRAA 3TW3A 3CG4A 3EIWA 3KV3O 1MC5A 3R3WA 4O25A 1EBBA 5E9JA 4AP6A 2GLXA 3E5RA 1CIJA 2Q3MA 1KO1A 1U0EA 1X1EA 2ZTUA 3DMGA 4HDOB 2HZ7A 2ZB4A 1Z8DA 5AICA 3RAEC 3AIOA 2B1IA 1YE8A 4NE7A 4Q3BA 2Z6QA 1Q6YA 2HRQA 1CUFA 1JIQA 3FKJA 4RLHA 4WSOA 5FNZA 3TMAA 4KITB 1NXTA 4UTNA 2CLIB 3B6KA 3DDSA 4CMKA 1QYCA 3AR4A 1DAHA 1YQDA 3ORYA 2FF5A 1TYAE 3EG9A 1QHNA 2Q1WA 1TU3A 2FDRA 1KJIA 4JELA 4X6LA 3TIVA 3JW8A 4RULA 1IZZA 5BVGA 5KO2A 4ZXPA 4DSNA 2JH8A 2Z2ZA 2CHUA 1GL6A 2DQZA 2AX3A 2RH8A 1BS1A 3GCXA 3EVCA 4M86A 5FL7A 2XXBA 2R1ZA 2REBA 5F2OA 3VU0A 1ID1A 3GU3A 3TTXA 1ZBQA 2ESRA 4ZQCB 1BVYF 1D2GA 1TGVA 3SOPA 5I4KA 3ZHTA 3BMXA 3P26A 2X7JA 1HDYA 5EZ6B 1C9MA 4RMIA 4UOZA 1TTPB 4AB1A 4J3JA 3UJ7A 4CCSA 5CFRA 3KTAB 2AEFA 3IX7A 4BP3A 5DGTA 2PFGA 3AR7A 2FEKA 5KTTA 2B8JA 4WCDA 3EMBA 3KYCA 2XUAA 4V2IA 3SKYA 4B2IA 1HDGO 1G8PA 1WLSA 3DPIA 3ZS8A 3MLAA 4LFAB 1H0RA 2W0SA 2W6JD 2A86A 2FYTA 3DTNA 4GVPA 1TKCA 1KHHA 4ANFA 3ZDAA 3EXHC 5AJTA 3W1WA 5EIXA 5F9FA 4PRYA 3RHTA 2GS9A 4MP8A 4WOPA 2E55A 2LKDA 1S2IA 1IAQA 2V6IA 5DSTA 2CLOB 3FSRA 1PJSA 4BMZA 3H65A 1U8ZA 5IWCA 4XKJA 5I4IA 2CYBA 2Z95A 3ZHBA 1W59A 1US8B 1CY6A 2VH5R 1I4DD 2G4VA 1E1CA 2QT1A 3CONA 3D3NA 3CNHA 4LWZA 4N0DA 5B7QA 5CT8A 1HDRA 1S6YA 3LUAA 1C0LA 3VVCA 1N2JA 2IPXA 1NRXA 4RZHA 4Y30A 3IT2A 4DKXA 1CJVC 3DNPA 1MX9A 4OF4A 4WJKB 1AVTA 3MQ2A 4LWQA 1JDTA 4U7GA 1SXGA 4DCSA 1M1ZA 3E15A 3UWSA 1FDUA 3FPHA 1U9IA 2R1TB 3HU1A 1CLUA 4BNHA 2NU8B 5JARA 4RTMA 4TKMA 1A9TA 2HPZA 2ZVJA 4YIKA 4JLSA 4EO7A 1EVQA 2VH1A 2J6HA 3AU8A 2EKQA 3M3DA 2C84A 1QP8A 2OXTA 4QPJC 3D4BA 5DNAA 4RQUA 2WVHA 3WK5A 4RM2A 4RW0A 5GV7A 5JZVA 2Z5LA 3EGIA 4XVQA 2PH5A 1U8AA 3HVKA 3OAAA 5CCBA 2P2YA 1NPTO 3DLCA 4YV2A 4NAUA 5B5SA 3OTOB 1NVTA 2ZITA 2H48A 3P2KA 4RIEA 1Y8ZA 3L7LA 1WAMA 4JI2B 1J49A 2N47A 3KALA 2Q6VA 4WKPA 5KOJB 5EP1A 3R20A 3EGEA 2JCVA 2OM2A 1MAAA 1KOJA 5IC4A 3OF3A 4GOXA 3CXUA 2B8TA 2VK2A 3BQ9A 1Q7BA 3IYLW 1DRVA 4LXYA 4UU8A 5ALYA 1Y33E 3TW8B 1V8FA 2FPSA 4JQCA 3VKHA 1Z6QA 1E1RD 2P9JA 4AJLA 5ESWA 1I5RA 5KNCH 3HA3A 1FUUA 5B4UA 5KBYA 2X41A 3TLGA 3UJNA 4QDUA 2OV8A 4CTMA 2B4RO 2OQRA 2OSBA 4P3XA 5LP6A 4FMBB 5K05A 3DLPX 2JLAA 4NIMA 4JP8A 3JQDA 4PFKA 3VZBA 1E3EA 1FXWF 1YS2X 2C4VA 3OQJA 1Z4IA 4G01B 1EQUA 4ZAFA 2EFCB 4JUAA 4FWTA 4MW7A 4JBNA 1P1JA 4ND8A 5ALFA 4FFWA 3E0QA 4L2IA 1P1KA 1MH1A 1YZTA 1NMXA 2XQGA 4WQMA 4BO0A 1YL6A 3EZ6A 3IP7A 4LK3A 8GPBA 2IV3A 5IJWA 3DEAA 1IOLA 1U7UA 3HEMA 5TQJA 1DJQA 3WK7A 5JG7A 1H3EA 4EITA 5JO0A 4LTMA 3PXUA 3T3NA 2FWRA 4FI3C 4EY3A 3KNZA 3ZGLA 1OAOC 3H11A 2XE6A 3EN0A 4IV0A 2YMQA 4Q02A 3RANA 3RUFA 4D8WA 5HOQA 2VHJA 4UJ5A 1X3SA 3OA2A 4W1PA 3GJYA 4R9RA 5DYGA 3SE7A 4M0LA 1EP2B 4EFKA 4QOJA 3KYBA 1Y8QB 2LWIA 3Q3IA 1OLOA 2PLRA 1XRLA 4QXOA 4YHHB 5IAKA 1EFKA 2DFTA 2R6GA 3N8IA 2AI3A 4WZAA 3WRYA 1NBAA 2ZBEA 2ZROA 2FSVC 1GZ4A 4X1OA 1GT91 3FYHA 1NC1A 1TZMA 2EYUA 5CHYA 4YUZA 1G16A 4C4XA 2D7CA 3D0RA 4BJ5A 4CODB 1P2DA 3NG1A 1DAPA 4UATA 4EBFA 3OWOA 1A2BA 4PCAA 1M6EX 1P0CA 1RACA 2QB5A 1RBQA 1Y5NA 1JP7A 3NTXA 1Y8AA 2G4LA 3Q98A 4J1TA 4KUEA 1SBNE 3PDHA 3R5JA 4IHJB 3ZLTA 2B1QA 3TS1A 2I4NA 4LRSB 3KQMA 2H2DA 4JI5B 2FSUA 1WMSA 3T3MB 1QHYA 1QAMA 4L0DA 1KZGB 4FX5A 2RK4A 1CNEA 2VPWA 4AJOA 1XMQB 1J2RA 4PLHA 3DWGA 2ZJ6A 4RZSA 1RM5A 3P0IA 2DH5A 2WP8J 2J9FB 4QYIB 3JAKB 2ZI9A 4EWLA 1EWYA 1B42A 2Q1YA 3E81A 1WVIA 3R3UA 5E7QA 1I01A 5ULLA 3SR0A 4ZJUA 4A36A 4UTVA 3MEQA 3UG7A 5AW8A 2YWXA 4LVCA 1Q0UA 2FFRA 2X13A 2F9FA 3A1CA 3KEMA 1M1NB 4NFHA 3TD6A 4F3TA 4LGVA 3E84A 2JD2A 2VNHA 1FRNA 4HDSB 4HWKA 4XYEA 3T4XA 1C3OA 3O4VA 1Y5RA 3U26A 4H3HB 3A1NA 5IG2A 4DNOA 4WVLA 1FS6A 3DC2A 2H16A 3TI9A 1A7JA 4L6IA 3ZXXA 3GQBB 3DEFA 2NZXA 3VPHA 2H5IA 3F67A 4W63A 2VYND 1J5XA 3MJDA 5DNYB 3R3ZA 4ZJPA 2HBYA 4AKTA 5F78A 3QE2A 3UH0A 5FBHA 4QT0A 5G40A 3OM0A 4H6WA 4ON9A 4PO1A 5M7EA 2QZ4A 4N18A 5C31A 1U28A 4AXBA 5AKYA 1E3IA 1A76A 3S1AA 1CUJA 2R6R1 2VZLA 5A05A 1NT4A 7REQA 1W6RA 3EE6A 3I76A 2CMHA 4CV2A 4XVCA 3DOHA 3PDWA 3QKUA 1U8CB 4O4JA 1GTVA 2QVGA 5F73A 2PEZA 2IJGX 1C9EA 4FD3A 3MWGA 3VU9B 4JQOA 3TZKA 4RAOA 4RVHA 2C29D 3L4EA 1XRPA 4DA9A 1UT8A 3PPWA 1S8NA 1YWGO 5TPZA 1DO8A 1XEWY 1ONBA 2ZYUX 3IB3A 4BMSA 4D92A 1OLUB 2D2XA 1FRQA 1TA4A 1NU6A 2BFFB 2GLTA 1JF8A 3RRFA 2O2YA 3DD5A 2GZMA 2PAAA 2XVZA 1PRYA 1T0HB 2D7DA 4LV8B 5L7TA 2WOJA 4L3VA 2IA5A 4N03A 4RPCA 1PR0A 3WNBA 2YVLA 2FJ0A 2ZVQX 3C5CA 3V1UA 1JLRA 1JLLB 3R0ZA 4BFTA 1D6MA 5B4TA 3PC4A 1R37A 1BA3A 3AJ9A 4L16A 2A8YA 4E7PA 4EO4A 3IE2A 1RJWA 1IUOA 3VPCA 3MIIA 3DB1A 3A4TA 3SG0A 1RQ7A 1EG2A 3LWBA 1QGOA 2RAVA 3K4PA 2YHIA 3VPGA 5LMZA 4DADA 3N2ZB 3RYCA 3SQXA 2H2GA 3ZU3A 4EECA 3DZ8A 2E6KA 3H5LA 4G5SA 2FZCA 5IM5A 3PU6A 3PNOA 4FYXA 1NJFA 2PXHA 3NP7A 4R05A 3OP1A 1N2SA 2IHJA 4CI0B 4QUIA 1LDGA 4X5OA 4XM1A 1X6VA 1IBCA 3E7XA 3FWHA 5KQPA 3Q3VA 3H2GA 1VDMA 4LE0A 3D6NB 1QFXA 3W4JA 2JK1A 3F6RA 3I1FA 3RSCA 1QUEA 1Q84A 3UOWA 1SHLA 1J2JA 3BXHA 3A3PA 4E2YA 1UKYA 4AK9A 4W9MC 4FMDF 3D4LA 4CFZA 4UFPA 4YCBA 4WXHA 3HB0A 5CYPA 3ADDA 3ZWBA 2OENG 3FN4A 1RYYA 2WIFA 3B1FA 1SVLA 1JL3A 1LTQA 1MAWA 3S8YA 2IQ5A 1Z9BA 2XGJA 2NZVG 2HCJB 4XWKA 1YCHA 4Z9YA 4QT4A 4RTQA 5EXXA 5BURA 3FVRA 2NO6A 3JZFA 1H8HA 1GRRA 2RGWA 1NDHA 3CH6A 2RI6A 3I6IA 3O0TA 3QUQA 1UODA 3RNOA 3CRZA 2I3ZA 2VBIA 1OT3A 4PCUA 1PK8A 1QBKC 1XRMA 2QMUA 2OZVA 2E4XA 2R87A 4DSUA 2QRMA 1CY4A 2DQ4A 4DMRA 1KJQA 2CSXA 5E1BA 5I3ZA 1I0LA 2ZJ4A 1JR6A 1ZICA 1U0JA 2ZR9A 1T2VA 2ZT7A 3K6SB 4E21A 1E0DA 3BD7A 1EZ4A 4WWHA 1KY2A 4C08A 5JRJA 5K9ZA 3FPJA 4R84A 4TXMA 3H5OA 2FW1A 4LCBA 2CLFB 4GYJA 5CH5A 3USZA 2GK3A 1ORWA 2XNDD 3RF6A 1ULSA 3ICWA 4LY0A 1LJLA 2BF4A 3GA5A 5HS4A 1ZH8A 3W8RA 1E2PA 4ABTA 2XMGA 4CG3A 1EEXB 4GPD1 4JH0A 1N1EA 1B6GA 2F55A 4FVTA 3MB5A 3RTCA 4EBBA 3AEKB 1TUBB 3PNMA 4KH0A 2MMGA 2Z4RA 4M3NA 2F1OA 2C3OA 3LC0A 4MW5A 4AZWA 4XX0B 1G42A 3PNKA 1M8KA 3JYPA 1PE0A 3DOOA 2F3UA 4I1OA 4WK4B 1E20A 2R4TA 3WK8A 4C2AA 1GGEA 2W98A 3EVBA 3LRTA 1KVSA 5KYUA 4RTPA 3IEVA 3RWMB 2CXHA 3DMNA 2I9KA 3TKYA 5JYCA 3FFWA 3G2HA 4GRAA 1SY7A 1TLLA 1EIWA 1EFAA 1HT0A 3AEYA 3DF9A 1P4RA 1RWNA 3T35A 4TLDA 2VF5X 4UNIA 4Y1EA 2K7FA 3PUZA 5CVVA 2ON6A 3UC5A 4O4HA 2HXGA 2BZ0A 4EHAA 4JUIA 5EIOA 1HG1A 1U90A 4WTOA 3SDBA 1VHDA 3IPCA 4D4JA 4B79A 3GLRA 5KTPA 5T7BA 2BH9A 5WRFA 3PITA 4QARA 4DM4A 5BO5A 2YWFA 4L8VA 4I50F 4PYRA 3SP1A 2WF9A 5AVQA 2I33A 4G97A 2PUBA 1J1IA 4US1R 1JHPA 1P45A 2HMUA 4IHKA 3UBMA 2P2NA 1F38A 2BKAA 2GD1O 1QHGA 4RPJA 1LVHA 3H19A 3N1UA 1OH6A 3F4BA 2GDZA 4FYVA 1SXJA 1CEEA 1ND6A 3H0KA 1OY1A 3RVSA 4ZVVA 1PD1A 2WJGA 5LOVF 4M2LA 3K6JA 2DBRA 1JUDA 4RKQA 3UUFA 2CNDA 3ELYA 1EFUA 5E7JA 3PNBA 5CG1A 2ECPA 821PA 1NXSA 1FLVA 1Z35A 1IJBA 1EUCB 1L4NA 2JASA 2WT9A 4HATA 1XTIA 2KYRA 2IUSA 1XKLA 4ZOAA 4TWIA 3K96A 5D87A 1DBSA 4EX6A 4PGAA 4YUYA 3IEMA 1ISFA 3Q1LA 2GH1A 4R9VA 1BU8A 5BQ5A 2NG1A 4KQCA 4P4SB 1DQSA 4HGRA 2QVLA 5E2IA 5DNUA 3D3WA 4A6XA 4X62B 3NANA 2G7MC 4NBTA 4NX2A 4BPBA 1GXSA 3CNOA 1RJEA 2H5EA 1M2JA 1WW2A 3KUXA 4QM6A 4M1KA 5AKIA 1E0AA 3GG9A 4F9GA 2V8BA 4KFRA 4NE2A 3BHNA 1YU6A 1OBCA 1SEVA 1RZUA 3N6RA 3PPYA 1N4AA 4CN9A 4ESEA 1HYBA 2G9UA 3H05A 1SUSA 1S4QA 2IYLD 2VCHA 3LPMA 2EJVA 3QMMA 4IGEA 4NU0A 5HTKA 3F9CA 4KQEA 3HSKA 3GWGA 1G5PA 1I3NA 4TKLA 2O05A 5FNVB 1M5RA 1UC8A 1F60A 3G02A 3CZ4A 5G1NA 3E9YA 3O73A 2QDXA 1EWVA 1EIZA 2E4VA 2NVBA 4PV7A 3RUPA 4R54A 2IPAB 3OMWA 5IUNC 5AJHA 2VUHB 2WAYA 1QKKA 1CK4A 4XVHA 4RYDA 4I3HA 2CC2A 3I8XA 5K2OA 3VTZA 4MS1B 3SDSA 3R8FA 3CXRA 3EA5A 5IULC 4GYKA 4LBVA 1FTWA 4L0CA 3WLOA 1ORVA 1KI3A 3FOEC 4LF7B 3U3XA 3O4IA 1F7UA 1U7PA 3TPZA 1XK6A 3ZJYA 4YPFA 3UHFA 3QFSA 3SAJA 4NZZA 3U3JA 3EGDB 1LS1A 4IDGA 3DULA 3MK31 3OFJA 3RC1A 2OHVA 4MI9A 2QDKA 3SNKA 1MRSA 3VC1A 3IUMA 3PENA 2E2WA 3H9JA 2JPDA 3KQOA 4ID3A 3U7QB 2GYYA 3FFBA 3QFTA 1SELA 1VE6A 1XFAA 4MV5A 4NMHA 4G1FA 1RFGE 2GNPA 5DPMA 5LYJB 1IU9A 3I9NA 4DLUA 1RI4A 4R2KA 5AP9A 1H23A 4JJ4A 3U6BA 3FIJA 3W1VA 3UKOA 1WOYA 5DK4A 1DBIA 1I94B 3HDGA 4G1CA 1IUKA 2IL1A 1K2VN 5NULA 2PMEA 3MHTA 3CR7A 3NV7A 2H1VA 3K9BA 2OGUA 5DDIP 2FPPA 4GFDA 3MJSA 1NJ6A 2BLNA 5BW6B 1N6LA 4URWR 3LECA 3NHFA 1H4SA 5JJKA 4DZZA 3THWA 3MJHA 3KOOA 2HW8A 2HF8A 1SBQA 4IOKA 4P35A 2EU8A 1Y9DA 1HE5A 3L93A 4CMHA 4K1XA 1T4GA 2NPOA 2SICE 2YNMA 2ZZMA 2OGSA 4EY6A 3IOMA 3KRTA 2HK7A 4IXWA 5AHXA 1ODSA 1T8WA 4BCBA 1WU7A 3LHKA 4DY4A 5I5EA 4EW6A 3EUEA 2WUWE 5AH0A 1JG1A 4JC0A 4TS4A 3QYJA 5FOSA 3OESA 3T1QA 5I9LA 2R6FA 4IXTA 4F2DA 3LT2A 4F46A 5ADUS 1RKVA 3ABQB 1QG6A 1M2WA 2JLBA 1ZIXA 2ONYA 4HNSA 1CFZA 4KE7A 4KYVA 4OBXA 5G2OA 3RTGA 2Y0BA 5TIIA 4QO7A 3ADCA 1DBPA 3EOAI 5EKSA 1PL0A 4E2ZA 3AR5A 2Q3LA 1ZNXA 1WW3A 2XNHA 4WFIA 2E89A 4D8XA 2YJ3A 1XZIA 1PHRA 4WZAB 2YZ7A 3LXMA 2BFDA 5F1YA 1PEKE 5B2FA 3QV1A 2RE8A 1U9IC 3AYXB 1FMJA 3O3CA 4RFSB 3RSZA 2H92A 5KSWB 1U81A 4A0GA 3H9EO 4X61A 4JLMA 4LMBA 3GLIE 1V45E 2ZE6A 4RGQA 1Q6ZA 3HJGA 3L7YA 1JQDA 1HQKA 2EGUA 2B25A 1GKYA 1GPUA 1PAUA 4FCVA 4GR5A 3X0DA 1MJNA 4CR7A 4D57A 5BWOA 5C5EA 5JXJA 4MDFA 1ACJA 1JWAB 2HJHA 4EG6A 2E4AA 5AVZA 2Q2WA 5E6SA 3LUPA 4RO0A 2VYVA 2WUDA 3JQAD 1XROA 3N07A 3CZQA 4Y2HA 3PGA1 4H59A 3PQCA 4EI2A 2WILA 5F7OA 5IABA 1CUZA 3PFFA 3CEHA 4NJMB 3ITEA 2FFQA 3NV9A 5TR9A 5B3AA 2GF2A 2XGOA 3PNSA 3GXOA 1XQXA 1MQAA 1Q0PA 2C3YA 1QR6A 2JA2A 1NVUQ 2BUBA 1GPH1 3CJTA 2QLFA 4JVLA 3NETA 4MVJD 3JWEA 2BMWA 4ZDWA 3QUTA 1I4LD 4YRPA 1GFZA 5ARDA 3NTRA 4X97A 1SC9A 2D1RA 2PSEA 3BSFA 3C24A 3F6EX 3R3XA 4CEJA 1JBQA 2QZZA 4KGXA 1EVJA 1ORIA 2PTGA 3I5XA 1G8YA 4L1KA 1WS6A 5BORA 1I7NA 1QRRA 4IL5A 3ZKAA 1Z13A 4DLWA 2CLSA 2DX7A 5F51A 3RIGA 1YFJA 3LSYA 2RGEA 1I79B 1XDZA 3MINA 3AG6A 5F23A 2Y93A 1VRVA 3F1KA 4D5EA 3NDJA 2Q0HA 1PLKA 2OHXA 3HXMA 4PYIA 3T5BA 5E6RA 1L7BA 1P1BA 1Z17A 2Y1LA 4V0LA 2UZIR 2JRCA 3FF4A 5FQOA 1NKTA 1P18A 2PS0A 3DE0X 3LP6A 4N5IX 4D9HA 1T29A 3AIKA 3DBRA 3JWHA 3PHIA 2J0SA 1O54A 2PSDA 3LDGA 2WYUA 1AOXA 2JGLA 1OFUX 2ZUCA 4FCWA 4MUBA 4W5RA 1VCNA 1KDOA 3PGVA 1NI4A 3N9IA 4XA8A 4XXHA 1P9LA 4MVJH 4QLAA 3EXIB 1K1EA 3GP5A 4UDXX 1YR1A 2WJ4A 4X64B 4C5BA 2R1VB 4DYHA 3UK7A 1E3QA 3KUDA 4OI2A 5LMUB 3IEUA 5DHFA 3EP9B 4KIFA 4M1ZA 3JARA 4C7XA 5J5CA 4R71A 3BL8A 1YQEA 3O8LA 4HGOA 2Y4NA 3BTOA 2DPHA 1TECE 1MOQA 4AMZA 1NVBA 4DBLC 4ZT2A 1HFWA 2P41A 3D8NA 5F7ZA 2P2LA 5FI0B 4JS0A 3LQRA 4Q66C 1K8QA 4DMMA 5ESRA 1C7JA 3PI6A 3V8RA 1B74A 2VCYA 4M76B 1AGPA 1UK6A 1ZL0A 2DPXA 5M04A 3OCZA 3M8KA 3LT0A 3CLUD 3VC7A 1DWPA 4EP1A 1F2DA 1LJUA 2WZDA 4HYEA 1U3FA 1BEUB 1EGHA 3R2JA 3RHZA 3PT9A 1Z38A 4IJVA 1DVRA 2O2HA 1NVVQ 2H2AA 2ZB2A 1AKRA 3HHPA 1V5GA 4XARA 1XNHA 2OCKA 4OXYA 4TXNA 3TPCA 3Q0EA 4QGBA 1VFPA 2DETA 2JIOA 1M74A 2BRUA 1TXGA 1VLHA 4G5GA 4M55A 3HUDA 3O3MB 1Z56C 4TWRA 4Z8YA 2FQQA 4BO4A 1EDZA 5KNLA 3FTCA 2W42A 2VAPA 4DV3B 2FLVA 2ZFUA 1CUYA 2FK8A 3BFJA 3H97A 3LHFA 3CIOA 3NBXX 2V7PA 4IUBS 4CCYA 2PSHA 4F96A 1WCWA 1XEXB 4UAGA 2VQSA 3RG8A 3W6NA 3I04M 5E7MA 2CV1A 4ZVKA 4ZAVA 2ZS8A 4YQZA 3T3GA 3QWFA 4UHEA 1CEQA 1OC4A 2GXUA 3I4CA 1TKBA 5TF4A 2W2PA 4F1KA 3W3AH 1QG2A 4UZFA 4X20B 1QU3A 4B7XA 4OGGA 1B6RA 1Z8HA 2RB5A 3QXJA 4UUNA 1M7BA 3ZGVA 4KLRA 5BQ3A 5IU6A 1DEXA 1G3MA 2HXYA 1O08A 1DC4A 3DBOB 1JNYA 3PEUA 4JWTA 5DLDA 4AF6A 1PSWA 3W5JA 4E32A 3HWWA 1WCIA 3W34A 4DNPA 1QG0A 3BILA 1I2AA 1DRWA 3TL2A 3O5AA 1J7JA 2Z98A 3KEOA 3QNWA 4MW6A 2C1EA 4BWGA 1W5TA 4F4IA 5HSGA 2R6CA 2I66A 4B17A 2P6OA 4N3GA 4YGXB 1QHHA 3JS5A 121PA 5TJ9A 4YO7A 3ZWMA 3BIJA 2QTNA 4BVBA 5EKXA 3M9LA