1YLEA

The structure of arginine/ornithine succinyltransferase subunit ai from pseudomonas aeruginosa.
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
342
structure length
330
Chain Sequence
b'GHMLVMRPAQAADLPQVQRLAADSPVGVTSLPDDAERLRDKILASEASFAAEVSYNGEESYFFVLEDSASGELVGCSAIVASAGFSEPFYSFRNETFVHASRSLSIHNKIHVLSLCHDLTGNSLLTSFYVQRDLVQSVYAELNSRGRLLFMASHPERFADAVVVEIVGYSDEQGESPFWNAVGRNFFDLNYIEAEKLSGLKHYPIYVPLLPDAAQESMGQVHPRAQITFDILMREGFETDNYIDIFDGGPTLHARTSGIRSIAQSRVVPVKIGEKSGRPYLVTNGQLQDFRAVVLDLDWAPGKPVALSVEAAEALGVGEGASVRLVAVGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginine N-succinyltransferase, alpha chain
molecule tags Transferase
source organism Pseudomonas aeruginosa
publication title The structure of arginine/ornithine succinyltransferase subunit AI from Pseudomonas aeruginosa.
rcsb
total genus 93
structure length 330
sequence length 342
ec nomenclature ec 2.3.1.109: Arginine N-succinyltransferase.
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04958 AstA Arginine N-succinyltransferase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1yleA02
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1yleA01
2JA5A 2FIAA 4XNHC 3ZJ0A 4JLYA 4KZTA 5FTMA 1NMTA 5DYGA 2P6FA 1SFOA 4H6UA 1Z4EA 5T5MD 3FNCA 2PJHB 2Y0SA 1YK3A 1KUYA 3GTOA 1YGHA 1S60A 2I79A 3PZJA 4OLLA 2VEZA 4KLWA 5KTAA 1LRZA 1V0CA 1K83A 1YREA 2QECA 4I49A 1KQGA 1QCSA 5EC4A 3N7ZA 2JLMA 4ORFA 2GIVA 4KDIA 3TO9A 2FS5A 5DYIA 2PR1A 3HKZA 2Q04A 4FD5A 2BL1A 4KOWA 1PQEA 4L8AA 2CNSA 2V45A 4HKFA 3I9SA 5T5ID 4D7ZB 2JDCA 2WPWA 4HNWB 1S7FA 3GY9A 1Y1VA 4BMHA 4AVCA 2Y0MA 3MGDA 4AB7A 4CAWA 1VKCA 4J3GA 1FDOA 1J4JA 3FIXA 4F0YA 4LX9A 4KOUA 1MJ9A 4QBJA 4KO8A 4AVAA 3CXPA 5J8CA 2R7HA 1KUXA 2HQYA 4EVYA 2E2HA 1QSNA 3EXNA 3T90A 4RV0A 2V3VA 4QUSA 3GTKA 5EBVA 4ONUA 3S6HA 1B87A 5F47A 2B5GB 1SQHA 3B8GA 1L0CA 3CXQA 1DMSA 4YGOA 4Y49B 1Z4RA 1VHSA 5C1BA 4KLVA 3TIWA 3GTGA 3TFYA 2KCWA 3TOAA 1Y4ZA 1Q16A 1XE4A 3P2HA 4K30A 2VUMA 2B5GA 3R96A 2PC1A 2G0BA 4HNYB 5JQ4A 2CY2A 1OZPA 2J8NA 1TMOA 4F6AA 2C45A 4OADA 1WWZA 2GANA 4M3SA 5EPPA 2OZHA 2JIRA 3FXTA 1YR0A 1PUAA 2H5MA 1S5KA 2YU9A 2JDDA 1YX0A 4AOKB 1AA6A 2VQYA 2F5IA 2NMTA 2CNMA 1YLEA 1PYQA 1Q2DA 2Q4VA 5CNPA 1BOBA 4XPDB 4KOVA 2R93A 3H0GA 2B63A 5IX3A 1UFHA 4AYBA 3FBUA 3W6SA 2B4BA 2VPZA 3W91A 4ZBGA 1Z9UA 1H0HA 3CQZA 3TO6A 3G8WA 2IL4A 3OWCA 2ZXVA 2Q44A 3VWEA 4AONB 2OZUA 3TO7A 3R9FA 3HU3A 1NSLA 3QWZA 4RS2A 3QAHA 1MK4A 5FVJA 2AJ6A 3LODA 4FD4A 4IF5A 5JPHA 2REFA 1Q2CA 1S3ZA 1VC3B 4UBRA 2ZW7A 3EFAA 4QB9A 4JD6A 1I3QA 5DWMA 2VPWA 3OUGA 4CRZB 1U6MA 4AG7A 5GCNA 2DXQA 3GTQA 3K9UA 1E61A 4CRYB 3F5BA 1PYUB 2FL4A 3PGPA 1AW8B 3D2MA 1P0HA 1SIWA 1S7NA 1WLFA 2FXFA 2Z10A 3R1KA 3TE4A 2B58A 1TWHA 2QIRA 4CRYG 5DWNA 4II9A 2BSWA 2K5TA 4GA5A 1S3SA 4AAYA 2VPYA 2HUZA 3RYOA 4JXQA 4DNCA 3C26A 4KLNA 3FYNA 1B6BA 4E0AA 4GA6A 4LUAA 2ZW4A 3GTPA 1M1DA 2BUEA 4IUSA 4UWIA 2PMZA 1MJBA 1CZ4A 2E7ZA 3CF2A 2PSWA 3DNSA 3GTLA 3FRMA 3CXSA 5IB0A 1S7KA 2R1IA 4UA3A 4KVOE 2PR8A 3HU2A 3SXOA 2VPXA 1MJAA 2Q0YA 4CRZA 1TIQA 3ZZIA 4QVTA 2C27A 4YRHA 3QQ7A 5F48A 1Y9WA 1UHDA 1QSTA 2NAPA 1CR5A 3KKWA 4KOSA 1S7LA 5C18A 1Y7RA 2B4DA 1R7RA 1BO4A 4AG9A 1M4GA 5B6CA 4MI4A 1FY7A 1TWAA 4R3KA 2NVYA 1KQFA 1ON0A 1OGYA 3S6FA 4DMRA 1IYLA 1M4IA 1WK4A 3BJ8A 1WCMA 1E60A 2VZZA 2R92A 5GLFA 2FT0A 3D2PA 3DMRA 4NSQA 2P6EA 4CAXA 3TTHA 2NYAA 3TM7B 2I00A 2R98A 4QIWA 4U9ZA 4E8OA 1UHEA 2FCKA 2PDOA 1QDNA 2ARHA 5ISVA 4XPDC 3R95A 5IV0A 5H84A 4FD7A 1QSOA 4AVBA 4XNHB 1PT1A 2Z11A 4PV6A 3G3SA 4JJXA 3F0AA 4MJ8A 2WPXA 2JIPA 3QC8A 2JEVA 4B5PA 2JIOA 3R9GA 1M44A 4C2MA 2Q7BA 1G8JA 2OB0A 4H6ZA 3H4QA 1R27A 1DMRA 2G3AA 2PQ8A 3DSBA 2JIMA 2CNTA 4CAVA 1EU1A 3PP9A 1XIXA 2QMLA 1XMTA 1TWCA 2JA7A 2B3UA 1IW7D 3PLXB 1KZFA 4R57A 4PK2A 4R3LA 1RO5A 5F49A 4PSWA 4CS0A 3QB8A 3P2FA 2R8VA 3DDDA 3TOBA 2Z0ZA 3SXNA 4OAEA 4M85A 3JVNA 2FSRA 3ML1A 4UWJA 2B4DB 2EVNA 2D4OA 5KTDA 4NCZA 4KODA 2D4PA 4KOYA 4CS0B 4X5KA 2O28A 2EUIA 2RC4A 4H89A 1CZ5A 3JUWA 5E96A 3LD2A 1Q2YA 2VBQA 3D8PA 3E0KA 1YVOA 4U5YA 2HV2A 1E32A 5KTCA 5I0CA 4XPKA 2GE3A 4KORA 3EO4A 3BJ7A 1R9TA 1PQFA 3EY5A 4L89A 4PK3A 5FTNA 3V8IA 2R7ZA 3IGRA 2BEIA 3DR8A 5FTJA 2ZW5A 2JIQA 1GHEA 2B3VA 1E5VA 3O5AA 1CJWA 1CM0A 1PT0A 5HH1A 3S6GA 5C82A 3IR7A 2DMRA 2P0WA 4R9MA 3R9EA 2Q4YA 3HU1A 2PRBA 3NE7A 4R87A 3WR7A 1IICA 4GS4A 2VI7A 2X7BA 4NXYA 4RI1A 5F46A 4MBUA 5C88A 3SHPA 4KVME 2A4NA 1KUVA 1I50A 3I3GA 5FTKA 4QC6A 1E18A 2EEOB 4U9YA 1IB1E 1TWGA 4NF1A 4JXRA 5H86A 2AE6A 2J8MA 1FDIA 1Y5IA 1R57A 5HMNA 3D3SA 3GTMA 3UY5A 2FE7A 1H5NA 4JWPA 4YFJA 2IV2X 2G3TA 3T9YA 4Y49C 4B5OA 2ZPAA 2P6GA 2OH1A 1G8KA 3GYAA 1XEBA 4KUAA 3QQ8A 5FTLA 3GTJA 3BLNA 4E2AA 1RXTA 1QSMA 4PSXA 1I21A 2WB1A 4NEXA 4XPLA 3FKIA 4KUBA 2ZW6A 4MHDA 1Y1WA 1PQHA 2REEA 2FIWA 1IYKA 2KI8A 5J8FA 3IR5A 1Y9KA 3DR6A 4MY0A 2E2IA 4AZDA 1K4JA 1N71A 1I12A 3GKRA 1NE9A 3F8KA 3FB3A 2J8RA 2JA6A 1M4DA 1PPYA 3IR6A 3W6XA 1PU9A 3TT2A 3EC4A 2NVXA 3IWGA 2WAQA 3S6KA 2OZGA 1I1DA 1QSRA 2ATRA 4FD6A 4HNXB 4B5PB 4KDLA 1XF8A 1TWFA 1P4NA 2VXKA 3VWDA 1IIDA 4MY3A 1YVKA 3TCVA 4KOTA 2VZYA 4KOXA 4KVXA 2OU2A
chains in the Genus database with same CATH superfamily
4FG2A 2ZEFA 2JA5A 4NJQA 2HC9A 2FIAA 3KASA 4LQGA 4XNHC 4JLYA 4KZTA 5FTMA 3ZJ0A 5K8NA 3X2PA 1ELMP 1TKJA 4P44A 1NMTA 1BW3A 5DYGA 1ZC1A 2BO9A 2P6FA 1SFOA 4H6UA 4Z65A 1Z4EA 5T5MD 3FNCA 2PJHB 2KQAA 2Y0SA 1YK3A 1KUYA 2FVGA 3PBBA 7CPAA 3KQXA 3GTOA 2Z3NA 1YGHA 1S60A 2I79A 3WABA 3PZJA 1VHOA 2VEZA 2Z3KA 4KLWA 4OLLA 1LRZA 1V0CA 3SI2A 4B10A 5KTAA 1K83A 1YREA 2QECA 1YLOA 1KQGA 1QCSA 1CPXA 1YMEA 3FEDA 3N7ZA 4OC3A 4CAEA 2G5DA 2JLMA 2PIYA 4ORFA 4NGTA 1CG2A 4KDIA 2GIVA 3X2OA 3TO9A 1FNOA 2FS5A 2AE0X 1ARLA 2V8GA 3K9TA 5DYIA 1L8FA 5A27A 2PR1A 2A6ED 3HKZA 2Q04A 4FD5A 3X2MA 1CPSA 1XFOA 2BL1A 4KOWA 2I3CA 2PJ7A 1PQEA 2ZEDA 4L8AA 1Y0RA 2CNSA 4CGMA 2V45A 1TF8A 3NH8A 4EWTA 4HKFA 2G9DA 2CTCA 3I9SA 5T5ID 4D7ZB 2EBJA 2JDCA 2WPWA 1S7FA 3KZWA 3GY9A 2V8DA 3IJ3A 1Y1VA 4HNWB 4BMHA 2A69D 4Q7AA 1OBRA 4AVCA 2Y0MA 3MGDA 2GFQA 4AB7A 2PNWA 3D7DA 4A37A 4CAWA 4BD9A 3KR5A 3FMCA 2AFZA 5G22A 4FG4A 2PJ5A 5ELYA 1VKCA 1X12A 4J3GA 1FDOA 1CP7A 2BH0A 1J4JA 1F57A 4B11A 3FIXA 4F0YA 5CBMA 1AMPA 3GUXA 4KOUA 4LX9A 3VH9A 3RBUA 2AFXA 1MJ9A 4RN7A 3B3WA 4KO8A 4QBJA 3B3TA 4AVAA 5GM9A 1TF9A 2CXAA 3CXPA 4I49A 3PB9X 2ZENA 5J8CA 2R7HA 1KUXA 2HQYA 5AG4A 4MCPA 2E2HA 4EVYA 4CYPA 1QSNA 3FVLA 3CZXA 3EXNA 3T90A 4RV0A 1NSAA 2V3VA 3GTKA 4QUSA 5EBVA 4ONUA 3S6HA 2HB6A 1B87A 4Q36A 2B5GB 1CBXA 5F47A 1SQHA 3B8GA 1BLLE 2VL1A 4O23A 2A6HD 1L0CA 2XEJA 5D29A 3CXQA 4YU9A 4BBHA 1F2OA 1DE4C 5K8PA 1DMSA 2RFHA 3WC7A 2CIJA 4YGOA 4OIDA 2PJ2A 4Y49B 3D7GA 3KHZA 1Z4RA 4TWEA 1VHSA 5C1BA 2YNEA 2YGWA 4KLVA 4MFJA 3TIWA 1Z5RA 3GTGA 1Z8XA 3D7FA 4R6TA 5K8MA 4JZ0A 3TFYA 4OIWA 2KCWA 4B14A 3TOAA 1Y4ZA 1Q16A 1XE4A 5I4MA 3P2HA 4K30A 2VUMA 2B5GA 1ZG8A 2PC1A 4X3RA 3R96A 2WUUA 2G0BA 2Z3MA 4HNYB 5JQ4A 1XMBA 2JBKA 5LYFA 1ARMA 2J9AA 2CY2A 1OZPA 2J8NA 1TMOA 1SMYD 3D30A 3IEHA 3IWEA 3L2NA 4F6AA 4ZYQA 2C45A 1ZLHA 4OADA 1WWZA 1JWQA 4F9VA 2GANA 4M3SA 3IU2A 4ZGYB 5EPPA 2JIRA 2OZHA 3FXTA 1CP6A 3SI0A 1YR0A 3B2YA 1IY7A 4B13A 3KI9A 1PUAA 3PRTA 2H5MA 4NGRA 1OA7A 2O5JD 1S5KA 2Q51A 2YU9A 3RO0A 4EFDA 2JDDA 4KSIA 4UCMA 4P6YA 3KQZA 1YX0A 3QAYA 4AOKB 4PQAA 1TKFA 1AA6A 2VQYA 2F5IA 3CDXA 2DPTA 3PB6X 5BWAB 4KS9A 2NMTA 4ENGA 2YUJA 2CNMA 1YLEA 3FECA 3B35A 4OC2A 1GYTA 1PYQA 1Q2DA 2G6GA 3X2GA 2Q4VA 5CNPA 1BOBA 4YWYA 4XPDB 4KOVA 2R93A 3H0GA 1BW4A 3NH4A 2B63A 5IX3A 1UFHA 4AYBA 1A2ZA 4FUUA 4AVRA 3FBUA 2NSMA 3W6SA 1HDUA 2B4BA 2VPZA 4AXVA 3FH4A 3BHXA 3W91A 4ZBGA 1Z9UA 1H0HA 3CQZA 3TO6A 3G8WA 2IL4A 3D67A 4ZY2A 3OWCA 2ZXVA 4RUHA 2BE5D 1ZO0A 2Q44A 4MHPA 3VWEA 5K8OA 4AONB 2OZUA 3TO7A 3H8FA 3LWUA 5G21A 1YW4A 4C68A 1VGYA 3R9FA 1Z8WA 3JTKA 3HU3A 1XOVA 1NSLA 3QWZA 3GB0A 3JRUA 3QAHA 1MK4A 4RS2A 5FVJA 2AJ6A 4P4FA 1UWYA 4UFXA 5IB9A 2WZNA 2PRQA 3LODA 4FD4A 4IF5A 1R43A 2REFA 1Q2CA 1S3ZA 1VC3B 4UBRA 5JPHA 2ZW7A 3EFAA 4QB9A 4JD6A 4A31A 3IIBA 1FT7A 2CTBA 1I3QA 4KSFA 2VPWA 4P4EA 5DWMA 3OUGA 3RZAA 2V8HA 1U6MA 3X2KA 5AGEA 4CRZB 4UEFA 4PPZA 4AG7A 3SI1A 5GCNA 2Z3PA 1X10A 1XJOA 2DXQA 3GTQA 1YW6A 1E61A 3K9UA 3VATA 3F5BA 4CRYB 3S9LA 1PYUB 2FL4A 2BOAA 1AW8B 3D2MA 3H8GA 3PGPA 1P0HA 1H8LA 4MXUA 3IFEA 4UFVA 3PB8X 1SIWA 1LOKA 2QJ8A 4NGNA 1S7NA 1WLFA 2FXFA 4P10A 2Z10A 3R1KA 2Q4ZA 3TE4A 2B58A 2C6CA 3B3CA 1TWHA 2GREA 2QIRA 3FF3A 4WJBA 4CRYG 5DWNA 4II9A 4OP4A 2BSWA 1F2PA 4BINA 2K5TA 4MFZA 4ONWA 3HLPA 4MCSA 4GA5A 1S3SA 4AAYA 2GLFA 2VPYA 2HUZA 4LQ6A 3RYOA 3WC5A 4JXQA 4CGLA 4DNCA 3C26A 4KLNA 1QQ9A 3FYNA 1B6BA 4E0AA 4GA6A 2IMOA 3X2JA 1XRYA 4LUAA 2ZW4A 3GTPA 1M1DA 2BUEA 4HPSA 4IUSA 5JGFA 4UWIA 2PMZA 1MJBA 1CZ4A 2PJAA 2E7ZA 4MCQA 3CF2A 2PSWA 3DNSA 3X2LA 3GTLA 1JQGA 4UIBA 5JM6A 3FRMA 3CXSA 5F09A 1BPNA 5IB0A 4MFQA 5G1ZA 4H2KA 1S7KA 4P4DA 2R1IA 4FWUA 4KVOE 4UA3A 3LACA 2PR8A 2ENGA 4P4BA 4CPAA 3HU2A 3SXOA 3NH5A 4MHNA 2VPXA 1MJAA 2Q0YA 1M4LA 4CRZA 4ZX8A 1TIQA 3HUVA 3ZZIA 4QVTA 3V38A 2C27A 4P4JA 4YRHA 3QQ7A 5F48A 1Y9WA 1UHDA 1QSTA 3KL9A 3CZBA 2NAPA 4A95A 2Q7SA 1CR5A 3GIUA 2AFSA 2AFUA 3PB7X 3KKWA 4KOSA 1S7LA 4B12A 5C18A 1Y7RA 5LRGA 1KWMA 2B4DA 1R7RA 1BO4A 4C2ZA 4AG9A 4CGNA 2O53A 1M4GA 5B6CA 4MI4A 1FY7A 4OMEA 2GLJA 5A28A 3WT4A 2AFMA 1TWAA 3D4UA 3N5FA 4R3KA 2AFWA 5LRJA 2NVYA 2YNCC 1KQFA 1AUGA 1ON0A 1AYEA 1OGYA 4MHYA 1LANA 3S6FA 4DMRA 1IYLA 1M4IA 1WK4A 3BJ8A 4MRIA 1WCMA 1E60A 2VZZA 3H5ZA 2R92A 5GLFA 2FT0A 3D2PA 3DMRA 4Q38A 5AG7A 4NSQA 2ABZA 1LCPA 2P6EA 4CAXA 3VARA 4UCPA 3TTHA 2NYAA 2GU2A 3TM7B 2PVWA 4A39A 3KGQA 2I00A 2R98A 4QIWA 4C2XA 4CYOA 4U9ZA 3TC8A 4UF4A 2XEIA 4E8OA 1UHEA 2FCKA 5AG5A 2PDOA 1QDNA 2ARHA 5EMIA 2PJ0A 5ISVA 4XPDC 3R95A 3T8WA 1Z2LA 5IV0A 2PJCA 3BI0A 3PFOA 2DEAA 4FD7A 5H84A 1BPMA 2CW0D 2ZELA 1QSOA 2IQ6A 4AVBA 4XNHB 3MN8A 2ODFA 2WSAA 1YNJD 1PT1A 2Z3LA 4UEEA 2Z11A 4PV6A 4UIAA 4ZI6A 3G3SA 1VHEA 2POKA 3V7ZA 2Z3OA 4JJXA 4MMOA 3F0AA 4GXHA 4MJ8A 4X2TA 3WR7A 2WPXA 2JIPA 3QC8A 4YFJA 2JEVA 2ZEMA 4NFRA 4OC5A 4B5PA 3DLJA 3IO1A 2JIOA 3R9GA 3RAMA 1M44A 4A32A 4C2MA 4P4IA 2Q7BA 1G8JA 2OB0A 2Q43A 3LMSA 4H6ZA 4ZY0A 3H4QA 1R27A 4L48A 1DMRA 2G3AA 2PQ8A 3A9LA 3DSBA 4MFKA 3TX8A 4CYQA 2JIMA 2CNTA 4CAVA 1EU1A 3B3SA 1XBUA 3B3VA 3PP9A 1XIXA 2QMLA 1XMTA 4PXEA 1TWCA 2JA7A 2B3UA 2PE3A 1IW7D 3PLXB 1KZFA 4NGQA 4OKOA 4R57A 4PK2A 4R3LA 1RO5A 4NJRA 4M6GA 4R7MA 4PXBA 1ZYRD 2AFOA 2A68D 4PXDA 3S9MA 3MRUA 4UCNA 4UEZA 2GAEA 3CT9A 4JP6A 3FEEA 4PSWA 5F49A 3K2KA 4CS0A 4R8FA 4A94A 3QB8A 3P2FA 2R8VA 3DDDA 2PIZA 3TOBA 2Z0ZA 3SXNA 4ZY1A 4OAEA 3IC1A 4M85A 3JVNA 4TNUA 2FSRA 3ML1A 3CPXA 1YQEA 4UWJA 1HD5A 3DGVA 5DS0A 3X2NA 3SJXA 3I1UA 2B4DB 2EVNA 1IU8A 2EWBA 2D4OA 2PJ6A 4W9YA 5KTDA 4CYNA 1QMUA 1RTQA 1TKHA 4KODA 4NCZA 3PB4X 2D4PA 4OC0A 3SJGA 4KOYA 4CS0B 4X5KA 1YSJA 3SUJA 2O28A 4F0XA 2DF5A 3KHXA 4C7HA 1OA9A 2EUIA 2RC4A 4H89A 1CZ5A 3JUWA 2QVPA 3LD2A 5E96A 2PJ9A 2ZEHA 1IGBA 1LFWA 5HVGA 2WYRA 1Q2YA 2VBQA 4B6ZA 3SULA 2F8HA 3D8PA 3E0KA 3QNVA 4F9UA 3S9NA 1YVOA 4U5YA 5GLXA 4JYWA 2HV2A 1E32A 4JJOA 3ISZA 4DJLA 5I0CA 5KTCA 4X8IA 3SUMA 4XPKA 1ELLP 2RB7A 2GE3A 2ZEPA 4KORA 3EO4A 2QYVA 3BJ7A 1R9TA 1PQFA 3EY5A 2PJ3A 4L89A 5FTNA 2C1CA 4PK3A 5LYDA 3V8IA 2V8VA 2R7ZA 4MHZA 3PEIA 3IGRA 3ENGA 2O4HA 2BEIA 3M3GA 4FFTA 1LAMA 5LRKA 5J1QA 2PJJA 3DR8A 5FTJA 2ZW5A 4DUKA 2JIQA 3FX6A 5G20A 1GHEA 2B3VA 1E5VA 3O5AA 1CJWA 1CM0A 3SJFA 5JH9A 1PT0A 1Q7LA 5HH1A 2ZOFA 2F7VA 3S6GA 5GLYA 5C82A 1LAPA 2NYQA 3PBEA 3BXMA 3IR7A 2DMRA 2P0WA 4R9MA 3R9EA 4NGSA 2Q4YA 1R3NA 4NOHA 5D8NA 4C2YA 3HU1A 5H4UA 2PRBA 4JP7A 3B7IA 3NE7A 1DTDA 2PJBA 4R87A 1IICA 4GS4A 4ZX9A 2VI7A 2X7BA 4NXYA 4RI1A 8CPAA 2PJ8A 5F46A 4MBUA 1ZLIA 5C88A 4MFPA 4R76A 4JCWA 3SHPA 4A30A 4KVME 2A4NA 1KUVA 1I50A 4NGPA 4P45A 3KR4A 2C6GA 3I3GA 5FTKA 1Y7EA 4QC6A 1E18A 2EEOB 4IHMA 4CAFA 4U9YA 1IB1E 1TWGA 1TXRA 4NF1A 2JEWA 4NGMA 4C7IA 6CPAA 5HXDA 4JXRA 4M6IA 4GM5A 4PXCA 5H86A 2AE6A 2OOTA 2J8MA 1IOFA 1FDIA 1Y5IA 1R57A 4KSAA 5HMNA 3D3SA 3GTMA 1IOIA 3UY5A 2ZOGA 2FE7A 3BI1A 1H5NA 3SUKA 1PYTB 1Z8TA 1PCAA 2IV2X 2G3TA 4JWPA 4Y49C 5THWA 3T9YA 2ZPAA 2P6GA 2OH1A 4B5OA 4EMEA 1G8KA 1Z8LA 3IWWA 3NFZA 2YNDA 4DYOA 3GYAA 1XEBA 2EO8A 4KUAA 3QQ8A 5FTLA 3GTJA 3BLNA 2BCOA 2XEFA 3IU1A 4E2AA 1RXTA 1QSMA 4PSXA 3D68A 2JBJA 2EK8A 1EE3P 4FERA 1I21A 4IAVA 2ANPA 2WB1A 4NEXA 4ZM7A 3FJUA 4XPLA 3FKIA 4KUBA 3PFEA 2ZW6A 1YNND 1BAVA 4MHDA 1Y1WA 4G1PA 1PQHA 2PJ1A 1CX8A 2REEA 5HVHA 4MFLA 2FIWA 2PI8A 1IYKA 3X2HA 2PCUA 3D7HA 2KI8A 5J8FA 3IR5A 1HEEA 1ZG9A 1Y9KA 3DR6A 4MY0A 3SJEA 2E2IA 3ISXA 4OC1A 4WWVA 4FBEA 4AZDA 1K4JA 1N71A 1I12A 5HVFA 3GKRA 5EC4A 1N10A 1NE9A 2CF4A 1ZG7A 2XEGA 3D66A 3F8KA 3FB3A 2J8RA 4JS7A 1HDQA 4K3NA 2JA6A 1M4DA 2V77A 1PPYA 5CPAA 3IR6A 3W6XA 5LYIA 2YNCA 1PU9A 2EK9A 2HCZX 3TT2A 4A33A 4F8ZA 2ZEEA 1WC2A 3EC4A 2NVXA 3IWGA 3NE8A 2WAQA 5AG6A 4A2ZA 3X2IA 3S6KA 3CPAA 2OZGA 1I1DA 4CGOA 1QSRA 2ATRA 4FD6A 2C6PA 4HNXB 4B5PB 4KDLA 1XF8A 1TWFA 3WC6A 1P4NA 3H8EA 4MCRA 2DPSA 2OR4A 2PICA 2VXKA 4M6HA 3VWDA 1IIDA 4MY3A 4OC4A 1YVKA 4A38A 2PVVA 2ZEOA 3NA6A 4CGPA 4IK2A 3TCVA 4FAIA 5LYLA 2PJ4A 3RNZA 1Y0YA 2VZYA 4KOXA 1VIXA 4KOTA 3GLJA 2IJZA 2ZEGA 4KVXA 4UFWA 2OU2A
chains in the Genus database with same CATH topology
2JA5A 2FIAA 4XNHC 3ZJ0A 4JLYA 4KZTA 5FTMA 1NMTA 5DYGA 1ZC1A 2P6FA 1SFOA 4H6UA 1Z4EA 5T5MD 3FNCA 2PJHB 2Y0SA 1YK3A 1KUYA 3GTOA 2Z3NA 1YGHA 1S60A 2I79A 3PZJA 4OLLA 2VEZA 2Z3KA 4KLWA 5KTAA 1LRZA 1V0CA 4B10A 1K83A 1YREA 2QECA 4I49A 1KQGA 1QCSA 5EC4A 3N7ZA 4CAEA 2G5DA 2JLMA 4ORFA 2GIVA 4KDIA 3TO9A 2FS5A 2AE0X 5DYIA 5A27A 2PR1A 2A6ED 3HKZA 2Q04A 4FD5A 2BL1A 4KOWA 1PQEA 4L8AA 2CNSA 4CGMA 2V45A 4HKFA 3I9SA 5T5ID 4D7ZB 2JDCA 2WPWA 4HNWB 1S7FA 3GY9A 1Y1VA 4BMHA 2A69D 4AVCA 2Y0MA 3MGDA 4AB7A 2PNWA 4CAWA 5G22A 1VKCA 4J3GA 1FDOA 1J4JA 4B11A 3FIXA 4F0YA 4LX9A 4KOUA 1MJ9A 4QBJA 4KO8A 4AVAA 2CXAA 3CXPA 5J8CA 2R7HA 1KUXA 2HQYA 5AG4A 4EVYA 2E2HA 4CYPA 1QSNA 3EXNA 3T90A 4RV0A 2V3VA 4QUSA 3GTKA 5EBVA 4ONUA 3S6HA 4Q36A 1B87A 5F47A 2B5GB 1SQHA 3B8GA 2A6HD 1L0CA 4BBHA 3CXQA 1DMSA 4YGOA 4Y49B 1Z4RA 1VHSA 5C1BA 2YNEA 2YGWA 4KLVA 4MFJA 3TIWA 3GTGA 3TFYA 2KCWA 4B14A 3TOAA 1Y4ZA 1Q16A 1XE4A 3P2HA 4K30A 2VUMA 2B5GA 3R96A 2PC1A 2WUUA 2G0BA 2Z3MA 4HNYB 5JQ4A 2CY2A 1OZPA 2J8NA 1TMOA 1SMYD 3IWEA 4F6AA 2C45A 4OADA 1WWZA 2GANA 4M3SA 3IU2A 4ZGYB 5EPPA 2OZHA 2JIRA 3FXTA 1YR0A 4B13A 1PUAA 2H5MA 2O5JD 1S5KA 2YU9A 2JDDA 4UCMA 1YX0A 4AOKB 1AA6A 2VQYA 2F5IA 2DPTA 5BWAB 4KS9A 2NMTA 2YUJA 2CNMA 1YLEA 1PYQA 1Q2DA 2G6GA 2Q4VA 5CNPA 1BOBA 4XPDB 4KOVA 2R93A 3H0GA 2B63A 5IX3A 1UFHA 4AYBA 3FBUA 3W6SA 2B4BA 2VPZA 3W91A 4ZBGA 1Z9UA 1H0HA 3CQZA 3TO6A 3G8WA 2IL4A 3OWCA 2ZXVA 2BE5D 1ZO0A 2Q44A 3VWEA 4AONB 2OZUA 3TO7A 5G21A 4C68A 3R9FA 3JTKA 3HU3A 1NSLA 3QWZA 4RS2A 3QAHA 1MK4A 5FVJA 2AJ6A 4UFXA 3LODA 4FD4A 4IF5A 5JPHA 2REFA 1Q2CA 1S3ZA 1VC3B 4UBRA 2ZW7A 3EFAA 4QB9A 4JD6A 4A31A 1I3QA 4KSFA 2VPWA 5DWMA 3OUGA 4CRZB 1U6MA 5AGEA 4AG7A 5GCNA 2Z3PA 2DXQA 3GTQA 3K9UA 1E61A 4CRYB 3F5BA 1PYUB 2FL4A 3PGPA 1AW8B 3D2MA 1P0HA 4UFVA 1SIWA 1S7NA 1WLFA 2FXFA 2Z10A 3R1KA 3TE4A 2B58A 1TWHA 2QIRA 4CRYG 5DWNA 4II9A 2BSWA 2K5TA 4MFZA 4GA5A 1S3SA 4AAYA 2VPYA 2HUZA 3RYOA 4JXQA 4CGLA 4DNCA 3C26A 4KLNA 3FYNA 1B6BA 4E0AA 4GA6A 4LUAA 2ZW4A 3GTPA 1M1DA 2BUEA 4IUSA 4UWIA 2PMZA 1MJBA 1CZ4A 2E7ZA 3CF2A 2PSWA 3DNSA 3GTLA 3FRMA 3CXSA 5IB0A 4MFQA 5G1ZA 1S7KA 2R1IA 4UA3A 4KVOE 2PR8A 3HU2A 3SXOA 2VPXA 1MJAA 2Q0YA 4CRZA 1TIQA 3ZZIA 4QVTA 2C27A 4YRHA 3QQ7A 5F48A 1Y9WA 1UHDA 1QSTA 3CZBA 2NAPA 4A95A 1CR5A 3KKWA 4KOSA 1S7LA 4B12A 5C18A 1Y7RA 2B4DA 1R7RA 1BO4A 4C2ZA 4AG9A 4CGNA 1M4GA 5B6CA 4MI4A 1FY7A 5A28A 1TWAA 4R3KA 2NVYA 2YNCC 1KQFA 1ON0A 1OGYA 3S6FA 4DMRA 1IYLA 1M4IA 1WK4A 3BJ8A 1WCMA 1E60A 2VZZA 3H5ZA 2R92A 5GLFA 2FT0A 3D2PA 3DMRA 4Q38A 5AG7A 4NSQA 2P6EA 4CAXA 4UCPA 3TTHA 2NYAA 3TM7B 2I00A 2R98A 4QIWA 4C2XA 4CYOA 4U9ZA 4E8OA 1UHEA 2FCKA 2PDOA 1QDNA 2ARHA 5ISVA 4XPDC 3R95A 5IV0A 5H84A 4FD7A 2CW0D 1QSOA 4AVBA 4XNHB 2WSAA 1YNJD 1PT1A 2Z3LA 2Z11A 4PV6A 3G3SA 2Z3OA 4JJXA 3F0AA 4MJ8A 2WPXA 2JIPA 3QC8A 2JEVA 4B5PA 2JIOA 3R9GA 4A32A 1M44A 4C2MA 2Q7BA 1G8JA 2OB0A 4H6ZA 3H4QA 1R27A 3A9LA 1DMRA 2G3AA 2PQ8A 3DSBA 4CYQA 4MFKA 2JIMA 2CNTA 4CAVA 1EU1A 3PP9A 1XIXA 2QMLA 1XMTA 1TWCA 2JA7A 2B3UA 1IW7D 3PLXB 1KZFA 4R57A 4PK2A 4R3LA 1RO5A 1ZYRD 2A68D 4UCNA 2GAEA 5F49A 4PSWA 4CS0A 3QB8A 3P2FA 2R8VA 3DDDA 3TOBA 2Z0ZA 3SXNA 4OAEA 4M85A 3JVNA 2FSRA 3ML1A 4UWJA 2B4DB 2EVNA 2D4OA 5KTDA 4CYNA 4NCZA 4KODA 2D4PA 4KOYA 4CS0B 4X5KA 2O28A 4F0XA 4C7HA 2EUIA 2RC4A 4H89A 1CZ5A 3JUWA 5E96A 3LD2A 1Q2YA 2VBQA 3D8PA 3E0KA 1YVOA 4U5YA 2HV2A 1E32A 5KTCA 5I0CA 4XPKA 2GE3A 4KORA 3EO4A 3BJ7A 1R9TA 1PQFA 3EY5A 4L89A 4PK3A 5FTNA 3V8IA 2R7ZA 3IGRA 2BEIA 2PJJA 3DR8A 5FTJA 2ZW5A 2JIQA 5G20A 1GHEA 2B3VA 1E5VA 3O5AA 1CJWA 1CM0A 1PT0A 5HH1A 3S6GA 5C82A 3IR7A 2DMRA 2P0WA 4R9MA 3R9EA 2Q4YA 4NOHA 4C2YA 3HU1A 2PRBA 3NE7A 4R87A 5AG5A 3WR7A 1IICA 4GS4A 2VI7A 2X7BA 4NXYA 4RI1A 5F46A 4MBUA 5C88A 4MFPA 3SHPA 4A30A 4KVME 2A4NA 1KUVA 1I50A 3I3GA 5FTKA 4QC6A 1E18A 2EEOB 4CAFA 4U9YA 1IB1E 1TWGA 4NF1A 4C7IA 4JXRA 5H86A 2AE6A 2J8MA 1FDIA 1Y5IA 1R57A 4KSAA 5HMNA 3D3SA 3GTMA 3UY5A 2FE7A 1H5NA 4JWPA 4YFJA 2IV2X 2G3TA 3T9YA 4Y49C 4B5OA 2ZPAA 2P6GA 2OH1A 1G8KA 2YNDA 3GYAA 1XEBA 4KUAA 3QQ8A 5FTLA 3GTJA 3BLNA 3IU1A 4E2AA 1RXTA 1QSMA 4PSXA 1I21A 2WB1A 4NEXA 4XPLA 3FKIA 4KUBA 2ZW6A 1YNND 4MHDA 1Y1WA 1PQHA 2REEA 4MFLA 2FIWA 2PI8A 1IYKA 2KI8A 5J8FA 3IR5A 1Y9KA 3DR6A 4MY0A 2E2IA 4AZDA 1K4JA 1N71A 1I12A 3GKRA 1NE9A 3F8KA 3FB3A 2J8RA 2JA6A 1M4DA 1PPYA 3IR6A 3W6XA 2YNCA 1PU9A 3TT2A 4A33A 3EC4A 2NVXA 3IWGA 2WAQA 5AG6A 4A2ZA 3S6KA 4CGOA 2OZGA 1I1DA 1QSRA 2ATRA 4FD6A 4HNXB 4B5PB 1XF8A 4KDLA 1TWFA 1P4NA 2DPSA 2VXKA 2PICA 3VWDA 1IIDA 4MY3A 1YVKA 4CGPA 3TCVA 4KOTA 2VZYA 4KOXA 4UFWA 4KVXA 2OU2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JA5 A;  2FIA A;  4XNH C;  3ZJ0 A;  4JLY A;  4KZT A;  5FTM A;  1NMT A;  5DYG A;  2P6F A;  1SFO A;  4H6U A;  1Z4E A;  5T5M D;  3FNC A;  2PJH B;  2Y0S A;  1YK3 A;  1KUY A;  3GTO A;  1YGH A;  1S60 A;  2I79 A;  3PZJ A;  4OLL A;  2VEZ A;  4KLW A;  5KTA A;  1LRZ A;  1V0C A;  1K83 A;  1YRE A;  2QEC A;  4I49 A;  1KQG A;  1QCS A;  5EC4 A;  3N7Z A;  2JLM A;  4ORF A;  2GIV A;  4KDI A;  3TO9 A;  2FS5 A;  5DYI A;  2PR1 A;  3HKZ A;  2Q04 A;  4FD5 A;  2BL1 A;  4KOW A;  1PQE A;  4L8A A;  2CNS A;  2V45 A;  4HKF A;  3I9S A;  5T5I D;  4D7Z B;  2JDC A;  2WPW A;  4HNW B;  1S7F A;  3GY9 A;  1Y1V A;  4BMH A;  4AVC A;  2Y0M A;  3MGD A;  4AB7 A;  4CAW A;  1VKC A;  4J3G A;  1FDO A;  1J4J A;  3FIX A;  4F0Y A;  4LX9 A;  4KOU A;  1MJ9 A;  4QBJ A;  4KO8 A;  4AVA A;  3CXP A;  5J8C A;  2R7H A;  1KUX A;  2HQY A;  4EVY A;  2E2H A;  1QSN A;  3EXN A;  3T90 A;  4RV0 A;  2V3V A;  4QUS A;  3GTK A;  5EBV A;  4ONU A;  3S6H A;  1B87 A;  5F47 A;  2B5G B;  1SQH A;  3B8G A;  1L0C A;  3CXQ A;  1DMS A;  4YGO A;  4Y49 B;  1Z4R A;  1VHS A;  5C1B A;  4KLV A;  3TIW A;  3GTG A;  3TFY A;  2KCW A;  3TOA A;  1Y4Z A;  1Q16 A;  1XE4 A;  3P2H A;  4K30 A;  2VUM A;  2B5G A;  3R96 A;  2PC1 A;  2G0B A;  4HNY B;  5JQ4 A;  2CY2 A;  1OZP A;  2J8N A;  1TMO A;  4F6A A;  2C45 A;  4OAD A;  1WWZ A;  2GAN A;  4M3S A;  5EPP A;  2OZH A;  2JIR A;  3FXT A;  1YR0 A;  1PUA A;  2H5M A;  1S5K A;  2YU9 A;  2JDD A;  1YX0 A;  4AOK B;  1AA6 A;  2VQY A;  2F5I A;  2NMT A;  2CNM A;  1YLE A;  1PYQ A;  1Q2D A;  2Q4V A;  5CNP A;  1BOB A;  4XPD B;  4KOV A;  2R93 A;  3H0G A;  2B63 A;  5IX3 A;  1UFH A;  4AYB A;  3FBU A;  3W6S A;  2B4B A;  2VPZ A;  3W91 A;  4ZBG A;  1Z9U A;  1H0H A;  3CQZ A;  3TO6 A;  3G8W A;  2IL4 A;  3OWC A;  2ZXV A;  2Q44 A;  3VWE A;  4AON B;  2OZU A;  3TO7 A;  3R9F A;  3HU3 A;  1NSL A;  3QWZ A;  4RS2 A;  3QAH A;  1MK4 A;  5FVJ A;  2AJ6 A;  3LOD A;  4FD4 A;  4IF5 A;  5JPH A;  2REF A;  1Q2C A;  1S3Z A;  1VC3 B;  4UBR A;  2ZW7 A;  3EFA A;  4QB9 A;  4JD6 A;  1I3Q A;  5DWM A;  2VPW A;  3OUG A;  4CRZ B;  1U6M A;  4AG7 A;  5GCN A;  2DXQ A;  3GTQ A;  3K9U A;  1E61 A;  4CRY B;  3F5B A;  1PYU B;  2FL4 A;  3PGP A;  1AW8 B;  3D2M A;  1P0H A;  1SIW A;  1S7N A;  1WLF A;  2FXF A;  2Z10 A;  3R1K A;  3TE4 A;  2B58 A;  1TWH A;  2QIR A;  4CRY G;  5DWN A;  4II9 A;  2BSW A;  2K5T A;  4GA5 A;  1S3S A;  4AAY A;  2VPY A;  2HUZ A;  3RYO A;  4JXQ A;  4DNC A;  3C26 A;  4KLN A;  3FYN A;  1B6B A;  4E0A A;  4GA6 A;  4LUA A;  2ZW4 A;  3GTP A;  1M1D A;  2BUE A;  4IUS A;  4UWI A;  2PMZ A;  1MJB A;  1CZ4 A;  2E7Z A;  3CF2 A;  2PSW A;  3DNS A;  3GTL A;  3FRM A;  3CXS A;  5IB0 A;  1S7K A;  2R1I A;  4UA3 A;  4KVO E;  2PR8 A;  3HU2 A;  3SXO A;  2VPX A;  1MJA A;  2Q0Y A;  4CRZ A;  1TIQ A;  3ZZI A;  4QVT A;  2C27 A;  4YRH A;  3QQ7 A;  5F48 A;  1Y9W A;  1UHD A;  1QST A;  2NAP A;  1CR5 A;  3KKW A;  4KOS A;  1S7L A;  5C18 A;  1Y7R A;  2B4D A;  1R7R A;  1BO4 A;  4AG9 A;  1M4G A;  5B6C A;  4MI4 A;  1FY7 A;  1TWA A;  4R3K A;  2NVY A;  1KQF A;  1ON0 A;  1OGY A;  3S6F A;  4DMR A;  1IYL A;  1M4I A;  1WK4 A;  3BJ8 A;  1WCM A;  1E60 A;  2VZZ A;  2R92 A;  5GLF A;  2FT0 A;  3D2P A;  3DMR A;  4NSQ A;  2P6E A;  4CAX A;  3TTH A;  2NYA A;  3TM7 B;  2I00 A;  2R98 A;  4QIW A;  4U9Z A;  4E8O A;  1UHE A;  2FCK A;  2PDO A;  1QDN A;  2ARH A;  5ISV A;  4XPD C;  3R95 A;  5IV0 A;  5H84 A;  4FD7 A;  1QSO A;  4AVB A;  4XNH B;  1PT1 A;  2Z11 A;  4PV6 A;  3G3S A;  4JJX A;  3F0A A;  4MJ8 A;  2WPX A;  2JIP A;  3QC8 A;  2JEV A;  4B5P A;  2JIO A;  3R9G A;  1M44 A;  4C2M A;  2Q7B A;  1G8J A;  2OB0 A;  4H6Z A;  3H4Q A;  1R27 A;  1DMR A;  2G3A A;  2PQ8 A;  3DSB A;  2JIM A;  2CNT A;  4CAV A;  1EU1 A;  3PP9 A;  1XIX A;  2QML A;  1XMT A;  1TWC A;  2JA7 A;  2B3U A;  1IW7 D;  3PLX B;  1KZF A;  4R57 A;  4PK2 A;  4R3L A;  1RO5 A;  5F49 A;  4PSW A;  4CS0 A;  3QB8 A;  3P2F A;  2R8V A;  3DDD A;  3TOB A;  2Z0Z A;  3SXN A;  4OAE A;  4M85 A;  3JVN A;  2FSR A;  3ML1 A;  4UWJ A;  2B4D B;  2EVN A;  2D4O A;  5KTD A;  4NCZ A;  4KOD A;  2D4P A;  4KOY A;  4CS0 B;  4X5K A;  2O28 A;  2EUI A;  2RC4 A;  4H89 A;  1CZ5 A;  3JUW A;  5E96 A;  3LD2 A;  1Q2Y A;  2VBQ A;  3D8P A;  3E0K A;  1YVO A;  4U5Y A;  2HV2 A;  1E32 A;  5KTC A;  5I0C A;  4XPK A;  2GE3 A;  4KOR A;  3EO4 A;  3BJ7 A;  1R9T A;  1PQF A;  3EY5 A;  4L89 A;  4PK3 A;  5FTN A;  3V8I A;  2R7Z A;  3IGR A;  2BEI A;  3DR8 A;  5FTJ A;  2ZW5 A;  2JIQ A;  1GHE A;  2B3V A;  1E5V A;  3O5A A;  1CJW A;  1CM0 A;  1PT0 A;  5HH1 A;  3S6G A;  5C82 A;  3IR7 A;  2DMR A;  2P0W A;  4R9M A;  3R9E A;  2Q4Y A;  3HU1 A;  2PRB A;  3NE7 A;  4R87 A;  3WR7 A;  1IIC A;  4GS4 A;  2VI7 A;  2X7B A;  4NXY A;  4RI1 A;  5F46 A;  4MBU A;  5C88 A;  3SHP A;  4KVM E;  2A4N A;  1KUV A;  1I50 A;  3I3G A;  5FTK A;  4QC6 A;  1E18 A;  2EEO B;  4U9Y A;  1IB1 E;  1TWG A;  4NF1 A;  4JXR A;  5H86 A;  2AE6 A;  2J8M A;  1FDI A;  1Y5I A;  1R57 A;  5HMN A;  3D3S A;  3GTM A;  3UY5 A;  2FE7 A;  1H5N A;  4JWP A;  4YFJ A;  2IV2 X;  2G3T A;  3T9Y A;  4Y49 C;  4B5O A;  2ZPA A;  2P6G A;  2OH1 A;  1G8K A;  3GYA A;  1XEB A;  4KUA A;  3QQ8 A;  5FTL A;  3GTJ A;  3BLN A;  4E2A A;  1RXT A;  1QSM A;  4PSX A;  1I21 A;  2WB1 A;  4NEX A;  4XPL A;  3FKI A;  4KUB A;  2ZW6 A;  4MHD A;  1Y1W A;  1PQH A;  2REE A;  2FIW A;  1IYK A;  2KI8 A;  5J8F A;  3IR5 A;  1Y9K A;  3DR6 A;  4MY0 A;  2E2I A;  4AZD A;  1K4J A;  1N71 A;  1I12 A;  3GKR A;  1NE9 A;  3F8K A;  3FB3 A;  2J8R A;  2JA6 A;  1M4D A;  1PPY A;  3IR6 A;  3W6X A;  1PU9 A;  3TT2 A;  3EC4 A;  2NVX A;  3IWG A;  2WAQ A;  3S6K A;  2OZG A;  1I1D A;  1QSR A;  2ATR A;  4FD6 A;  4HNX B;  4B5P B;  4KDL A;  1XF8 A;  1TWF A;  1P4N A;  2VXK A;  3VWD A;  1IID A;  4MY3 A;  1YVK A;  3TCV A;  4KOT A;  2VZY A;  4KOX A;  4KVX A;  2OU2 A; 
#chains in the Genus database with same CATH topology
 4FG2 A;  2ZEF A;  2JA5 A;  4NJQ A;  2HC9 A;  2FIA A;  3KAS A;  4LQG A;  4XNH C;  4JLY A;  4KZT A;  5FTM A;  3ZJ0 A;  5K8N A;  3X2P A;  1ELM P;  1TKJ A;  4P44 A;  1NMT A;  1BW3 A;  5DYG A;  1ZC1 A;  2BO9 A;  2P6F A;  1SFO A;  4H6U A;  4Z65 A;  1Z4E A;  5T5M D;  3FNC A;  2PJH B;  2KQA A;  2Y0S A;  1YK3 A;  1KUY A;  2FVG A;  3PBB A;  7CPA A;  3KQX A;  3GTO A;  2Z3N A;  1YGH A;  1S60 A;  2I79 A;  3WAB A;  3PZJ A;  1VHO A;  2VEZ A;  2Z3K A;  4KLW A;  4OLL A;  1LRZ A;  1V0C A;  3SI2 A;  4B10 A;  5KTA A;  1K83 A;  1YRE A;  2QEC A;  1YLO A;  1KQG A;  1QCS A;  1CPX A;  1YME A;  3FED A;  3N7Z A;  4OC3 A;  4CAE A;  2G5D A;  2JLM A;  2PIY A;  4ORF A;  4NGT A;  1CG2 A;  4KDI A;  2GIV A;  3X2O A;  3TO9 A;  1FNO A;  2FS5 A;  2AE0 X;  1ARL A;  2V8G A;  3K9T A;  5DYI A;  1L8F A;  5A27 A;  2PR1 A;  2A6E D;  3HKZ A;  2Q04 A;  4FD5 A;  3X2M A;  1CPS A;  1XFO A;  2BL1 A;  4KOW A;  2I3C A;  2PJ7 A;  1PQE A;  2ZED A;  4L8A A;  1Y0R A;  2CNS A;  4CGM A;  2V45 A;  1TF8 A;  3NH8 A;  4EWT A;  4HKF A;  2G9D A;  2CTC A;  3I9S A;  5T5I D;  4D7Z B;  2EBJ A;  2JDC A;  2WPW A;  1S7F A;  3KZW A;  3GY9 A;  2V8D A;  3IJ3 A;  1Y1V A;  4HNW B;  4BMH A;  2A69 D;  4Q7A A;  1OBR A;  4AVC A;  2Y0M A;  3MGD A;  2GFQ A;  4AB7 A;  2PNW A;  3D7D A;  4A37 A;  4CAW A;  4BD9 A;  3KR5 A;  3FMC A;  2AFZ A;  5G22 A;  4FG4 A;  2PJ5 A;  5ELY A;  1VKC A;  1X12 A;  4J3G A;  1FDO A;  1CP7 A;  2BH0 A;  1J4J A;  1F57 A;  4B11 A;  3FIX A;  4F0Y A;  5CBM A;  1AMP A;  3GUX A;  4KOU A;  4LX9 A;  3VH9 A;  3RBU A;  2AFX A;  1MJ9 A;  4RN7 A;  3B3W A;  4KO8 A;  4QBJ A;  3B3T A;  4AVA A;  5GM9 A;  1TF9 A;  2CXA A;  3CXP A;  4I49 A;  3PB9 X;  2ZEN A;  5J8C A;  2R7H A;  1KUX A;  2HQY A;  5AG4 A;  4MCP A;  2E2H A;  4EVY A;  4CYP A;  1QSN A;  3FVL A;  3CZX A;  3EXN A;  3T90 A;  4RV0 A;  1NSA A;  2V3V A;  3GTK A;  4QUS A;  5EBV A;  4ONU A;  3S6H A;  2HB6 A;  1B87 A;  4Q36 A;  2B5G B;  1CBX A;  5F47 A;  1SQH A;  3B8G A;  1BLL E;  2VL1 A;  4O23 A;  2A6H D;  1L0C A;  2XEJ A;  5D29 A;  3CXQ A;  4YU9 A;  4BBH A;  1F2O A;  1DE4 C;  5K8P A;  1DMS A;  2RFH A;  3WC7 A;  2CIJ A;  4YGO A;  4OID A;  2PJ2 A;  4Y49 B;  3D7G A;  3KHZ A;  1Z4R A;  4TWE A;  1VHS A;  5C1B A;  2YNE A;  2YGW A;  4KLV A;  4MFJ A;  3TIW A;  1Z5R A;  3GTG A;  1Z8X A;  3D7F A;  4R6T A;  5K8M A;  4JZ0 A;  3TFY A;  4OIW A;  2KCW A;  4B14 A;  3TOA A;  1Y4Z A;  1Q16 A;  1XE4 A;  5I4M A;  3P2H A;  4K30 A;  2VUM A;  2B5G A;  1ZG8 A;  2PC1 A;  4X3R A;  3R96 A;  2WUU A;  2G0B A;  2Z3M A;  4HNY B;  5JQ4 A;  1XMB A;  2JBK A;  5LYF A;  1ARM A;  2J9A A;  2CY2 A;  1OZP A;  2J8N A;  1TMO A;  1SMY D;  3D30 A;  3IEH A;  3IWE A;  3L2N A;  4F6A A;  4ZYQ A;  2C45 A;  1ZLH A;  4OAD A;  1WWZ A;  1JWQ A;  4F9V A;  2GAN A;  4M3S A;  3IU2 A;  4ZGY B;  5EPP A;  2JIR A;  2OZH A;  3FXT A;  1CP6 A;  3SI0 A;  1YR0 A;  3B2Y A;  1IY7 A;  4B13 A;  3KI9 A;  1PUA A;  3PRT A;  2H5M A;  4NGR A;  1OA7 A;  2O5J D;  1S5K A;  2Q51 A;  2YU9 A;  3RO0 A;  4EFD A;  2JDD A;  4KSI A;  4UCM A;  4P6Y A;  3KQZ A;  1YX0 A;  3QAY A;  4AOK B;  4PQA A;  1TKF A;  1AA6 A;  2VQY A;  2F5I A;  3CDX A;  2DPT A;  3PB6 X;  5BWA B;  4KS9 A;  2NMT A;  4ENG A;  2YUJ A;  2CNM A;  1YLE A;  3FEC A;  3B35 A;  4OC2 A;  1GYT A;  1PYQ A;  1Q2D A;  2G6G A;  3X2G A;  2Q4V A;  5CNP A;  1BOB A;  4YWY A;  4XPD B;  4KOV A;  2R93 A;  3H0G A;  1BW4 A;  3NH4 A;  2B63 A;  5IX3 A;  1UFH A;  4AYB A;  1A2Z A;  4FUU A;  4AVR A;  3FBU A;  2NSM A;  3W6S A;  1HDU A;  2B4B A;  2VPZ A;  4AXV A;  3FH4 A;  3BHX A;  3W91 A;  4ZBG A;  1Z9U A;  1H0H A;  3CQZ A;  3TO6 A;  3G8W A;  2IL4 A;  3D67 A;  4ZY2 A;  3OWC A;  2ZXV A;  4RUH A;  2BE5 D;  1ZO0 A;  2Q44 A;  4MHP A;  3VWE A;  5K8O A;  4AON B;  2OZU A;  3TO7 A;  3H8F A;  3LWU A;  5G21 A;  1YW4 A;  4C68 A;  1VGY A;  3R9F A;  1Z8W A;  3JTK A;  3HU3 A;  1XOV A;  1NSL A;  3QWZ A;  3GB0 A;  3JRU A;  3QAH A;  1MK4 A;  4RS2 A;  5FVJ A;  2AJ6 A;  4P4F A;  1UWY A;  4UFX A;  5IB9 A;  2WZN A;  2PRQ A;  3LOD A;  4FD4 A;  4IF5 A;  1R43 A;  2REF A;  1Q2C A;  1S3Z A;  1VC3 B;  4UBR A;  5JPH A;  2ZW7 A;  3EFA A;  4QB9 A;  4JD6 A;  4A31 A;  3IIB A;  1FT7 A;  2CTB A;  1I3Q A;  4KSF A;  2VPW A;  4P4E A;  5DWM A;  3OUG A;  3RZA A;  2V8H A;  1U6M A;  3X2K A;  5AGE A;  4CRZ B;  4UEF A;  4PPZ A;  4AG7 A;  3SI1 A;  5GCN A;  2Z3P A;  1X10 A;  1XJO A;  2DXQ A;  3GTQ A;  1YW6 A;  1E61 A;  3K9U A;  3VAT A;  3F5B A;  4CRY B;  3S9L A;  1PYU B;  2FL4 A;  2BOA A;  1AW8 B;  3D2M A;  3H8G A;  3PGP A;  1P0H A;  1H8L A;  4MXU A;  3IFE A;  4UFV A;  3PB8 X;  1SIW A;  1LOK A;  2QJ8 A;  4NGN A;  1S7N A;  1WLF A;  2FXF A;  4P10 A;  2Z10 A;  3R1K A;  2Q4Z A;  3TE4 A;  2B58 A;  2C6C A;  3B3C A;  1TWH A;  2GRE A;  2QIR A;  3FF3 A;  4WJB A;  4CRY G;  5DWN A;  4II9 A;  4OP4 A;  2BSW A;  1F2P A;  4BIN A;  2K5T A;  4MFZ A;  4ONW A;  3HLP A;  4MCS A;  4GA5 A;  1S3S A;  4AAY A;  2GLF A;  2VPY A;  2HUZ A;  4LQ6 A;  3RYO A;  3WC5 A;  4JXQ A;  4CGL A;  4DNC A;  3C26 A;  4KLN A;  1QQ9 A;  3FYN A;  1B6B A;  4E0A A;  4GA6 A;  2IMO A;  3X2J A;  1XRY A;  4LUA A;  2ZW4 A;  3GTP A;  1M1D A;  2BUE A;  4HPS A;  4IUS A;  5JGF A;  4UWI A;  2PMZ A;  1MJB A;  1CZ4 A;  2PJA A;  2E7Z A;  4MCQ A;  3CF2 A;  2PSW A;  3DNS A;  3X2L A;  3GTL A;  1JQG A;  4UIB A;  5JM6 A;  3FRM A;  3CXS A;  5F09 A;  1BPN A;  5IB0 A;  4MFQ A;  5G1Z A;  4H2K A;  1S7K A;  4P4D A;  2R1I A;  4FWU A;  4KVO E;  4UA3 A;  3LAC A;  2PR8 A;  2ENG A;  4P4B A;  4CPA A;  3HU2 A;  3SXO A;  3NH5 A;  4MHN A;  2VPX A;  1MJA A;  2Q0Y A;  1M4L A;  4CRZ A;  4ZX8 A;  1TIQ A;  3HUV A;  3ZZI A;  4QVT A;  3V38 A;  2C27 A;  4P4J A;  4YRH A;  3QQ7 A;  5F48 A;  1Y9W A;  1UHD A;  1QST A;  3KL9 A;  3CZB A;  2NAP A;  4A95 A;  2Q7S A;  1CR5 A;  3GIU A;  2AFS A;  2AFU A;  3PB7 X;  3KKW A;  4KOS A;  1S7L A;  4B12 A;  5C18 A;  1Y7R A;  5LRG A;  1KWM A;  2B4D A;  1R7R A;  1BO4 A;  4C2Z A;  4AG9 A;  4CGN A;  2O53 A;  1M4G A;  5B6C A;  4MI4 A;  1FY7 A;  4OME A;  2GLJ A;  5A28 A;  3WT4 A;  2AFM A;  1TWA A;  3D4U A;  3N5F A;  4R3K A;  2AFW A;  5LRJ A;  2NVY A;  2YNC C;  1KQF A;  1AUG A;  1ON0 A;  1AYE A;  1OGY A;  4MHY A;  1LAN A;  3S6F A;  4DMR A;  1IYL A;  1M4I A;  1WK4 A;  3BJ8 A;  4MRI A;  1WCM A;  1E60 A;  2VZZ A;  3H5Z A;  2R92 A;  5GLF A;  2FT0 A;  3D2P A;  3DMR A;  4Q38 A;  5AG7 A;  4NSQ A;  2ABZ A;  1LCP A;  2P6E A;  4CAX A;  3VAR A;  4UCP A;  3TTH A;  2NYA A;  2GU2 A;  3TM7 B;  2PVW A;  4A39 A;  3KGQ A;  2I00 A;  2R98 A;  4QIW A;  4C2X A;  4CYO A;  4U9Z A;  3TC8 A;  4UF4 A;  2XEI A;  4E8O A;  1UHE A;  2FCK A;  5AG5 A;  2PDO A;  1QDN A;  2ARH A;  5EMI A;  2PJ0 A;  5ISV A;  4XPD C;  3R95 A;  3T8W A;  1Z2L A;  5IV0 A;  2PJC A;  3BI0 A;  3PFO A;  2DEA A;  4FD7 A;  5H84 A;  1BPM A;  2CW0 D;  2ZEL A;  1QSO A;  2IQ6 A;  4AVB A;  4XNH B;  3MN8 A;  2ODF A;  2WSA A;  1YNJ D;  1PT1 A;  2Z3L A;  4UEE A;  2Z11 A;  4PV6 A;  4UIA A;  4ZI6 A;  3G3S A;  1VHE A;  2POK A;  3V7Z A;  2Z3O A;  4JJX A;  4MMO A;  3F0A A;  4GXH A;  4MJ8 A;  4X2T A;  3WR7 A;  2WPX A;  2JIP A;  3QC8 A;  4YFJ A;  2JEV A;  2ZEM A;  4NFR A;  4OC5 A;  4B5P A;  3DLJ A;  3IO1 A;  2JIO A;  3R9G A;  3RAM A;  1M44 A;  4A32 A;  4C2M A;  4P4I A;  2Q7B A;  1G8J A;  2OB0 A;  2Q43 A;  3LMS A;  4H6Z A;  4ZY0 A;  3H4Q A;  1R27 A;  4L48 A;  1DMR A;  2G3A A;  2PQ8 A;  3A9L A;  3DSB A;  4MFK A;  3TX8 A;  4CYQ A;  2JIM A;  2CNT A;  4CAV A;  1EU1 A;  3B3S A;  1XBU A;  3B3V A;  3PP9 A;  1XIX A;  2QML A;  1XMT A;  4PXE A;  1TWC A;  2JA7 A;  2B3U A;  2PE3 A;  1IW7 D;  3PLX B;  1KZF A;  4NGQ A;  4OKO A;  4R57 A;  4PK2 A;  4R3L A;  1RO5 A;  4NJR A;  4M6G A;  4R7M A;  4PXB A;  1ZYR D;  2AFO A;  2A68 D;  4PXD A;  3S9M A;  3MRU A;  4UCN A;  4UEZ A;  2GAE A;  3CT9 A;  4JP6 A;  3FEE A;  4PSW A;  5F49 A;  3K2K A;  4CS0 A;  4R8F A;  4A94 A;  3QB8 A;  3P2F A;  2R8V A;  3DDD A;  2PIZ A;  3TOB A;  2Z0Z A;  3SXN A;  4ZY1 A;  4OAE A;  3IC1 A;  4M85 A;  3JVN A;  4TNU A;  2FSR A;  3ML1 A;  3CPX A;  1YQE A;  4UWJ A;  1HD5 A;  3DGV A;  5DS0 A;  3X2N A;  3SJX A;  3I1U A;  2B4D B;  2EVN A;  1IU8 A;  2EWB A;  2D4O A;  2PJ6 A;  4W9Y A;  5KTD A;  4CYN A;  1QMU A;  1RTQ A;  1TKH A;  4KOD A;  4NCZ A;  3PB4 X;  2D4P A;  4OC0 A;  3SJG A;  4KOY A;  4CS0 B;  4X5K A;  1YSJ A;  3SUJ A;  2O28 A;  4F0X A;  2DF5 A;  3KHX A;  4C7H A;  1OA9 A;  2EUI A;  2RC4 A;  4H89 A;  1CZ5 A;  3JUW A;  2QVP A;  3LD2 A;  5E96 A;  2PJ9 A;  2ZEH A;  1IGB A;  1LFW A;  5HVG A;  2WYR A;  1Q2Y A;  2VBQ A;  4B6Z A;  3SUL A;  2F8H A;  3D8P A;  3E0K A;  3QNV A;  4F9U A;  3S9N A;  1YVO A;  4U5Y A;  5GLX A;  4JYW A;  2HV2 A;  1E32 A;  4JJO A;  3ISZ A;  4DJL A;  5I0C A;  5KTC A;  4X8I A;  3SUM A;  4XPK A;  1ELL P;  2RB7 A;  2GE3 A;  2ZEP A;  4KOR A;  3EO4 A;  2QYV A;  3BJ7 A;  1R9T A;  1PQF A;  3EY5 A;  2PJ3 A;  4L89 A;  5FTN A;  2C1C A;  4PK3 A;  5LYD A;  3V8I A;  2V8V A;  2R7Z A;  4MHZ A;  3PEI A;  3IGR A;  3ENG A;  2O4H A;  2BEI A;  3M3G A;  4FFT A;  1LAM A;  5LRK A;  5J1Q A;  2PJJ A;  3DR8 A;  5FTJ A;  2ZW5 A;  4DUK A;  2JIQ A;  3FX6 A;  5G20 A;  1GHE A;  2B3V A;  1E5V A;  3O5A A;  1CJW A;  1CM0 A;  3SJF A;  5JH9 A;  1PT0 A;  1Q7L A;  5HH1 A;  2ZOF A;  2F7V A;  3S6G A;  5GLY A;  5C82 A;  1LAP A;  2NYQ A;  3PBE A;  3BXM A;  3IR7 A;  2DMR A;  2P0W A;  4R9M A;  3R9E A;  4NGS A;  2Q4Y A;  1R3N A;  4NOH A;  5D8N A;  4C2Y A;  3HU1 A;  5H4U A;  2PRB A;  4JP7 A;  3B7I A;  3NE7 A;  1DTD A;  2PJB A;  4R87 A;  1IIC A;  4GS4 A;  4ZX9 A;  2VI7 A;  2X7B A;  4NXY A;  4RI1 A;  8CPA A;  2PJ8 A;  5F46 A;  4MBU A;  1ZLI A;  5C88 A;  4MFP A;  4R76 A;  4JCW A;  3SHP A;  4A30 A;  4KVM E;  2A4N A;  1KUV A;  1I50 A;  4NGP A;  4P45 A;  3KR4 A;  2C6G A;  3I3G A;  5FTK A;  1Y7E A;  4QC6 A;  1E18 A;  2EEO B;  4IHM A;  4CAF A;  4U9Y A;  1IB1 E;  1TWG A;  1TXR A;  4NF1 A;  2JEW A;  4NGM A;  4C7I A;  6CPA A;  5HXD A;  4JXR A;  4M6I A;  4GM5 A;  4PXC A;  5H86 A;  2AE6 A;  2OOT A;  2J8M A;  1IOF A;  1FDI A;  1Y5I A;  1R57 A;  4KSA A;  5HMN A;  3D3S A;  3GTM A;  1IOI A;  3UY5 A;  2ZOG A;  2FE7 A;  3BI1 A;  1H5N A;  3SUK A;  1PYT B;  1Z8T A;  1PCA A;  2IV2 X;  2G3T A;  4JWP A;  4Y49 C;  5THW A;  3T9Y A;  2ZPA A;  2P6G A;  2OH1 A;  4B5O A;  4EME A;  1G8K A;  1Z8L A;  3IWW A;  3NFZ A;  2YND A;  4DYO A;  3GYA A;  1XEB A;  2EO8 A;  4KUA A;  3QQ8 A;  5FTL A;  3GTJ A;  3BLN A;  2BCO A;  2XEF A;  3IU1 A;  4E2A A;  1RXT A;  1QSM A;  4PSX A;  3D68 A;  2JBJ A;  2EK8 A;  1EE3 P;  4FER A;  1I21 A;  4IAV A;  2ANP A;  2WB1 A;  4NEX A;  4ZM7 A;  3FJU A;  4XPL A;  3FKI A;  4KUB A;  3PFE A;  2ZW6 A;  1YNN D;  1BAV A;  4MHD A;  1Y1W A;  4G1P A;  1PQH A;  2PJ1 A;  1CX8 A;  2REE A;  5HVH A;  4MFL A;  2FIW A;  2PI8 A;  1IYK A;  3X2H A;  2PCU A;  3D7H A;  2KI8 A;  5J8F A;  3IR5 A;  1HEE A;  1ZG9 A;  1Y9K A;  3DR6 A;  4MY0 A;  3SJE A;  2E2I A;  3ISX A;  4OC1 A;  4WWV A;  4FBE A;  4AZD A;  1K4J A;  1N71 A;  1I12 A;  5HVF A;  3GKR A;  5EC4 A;  1N10 A;  1NE9 A;  2CF4 A;  1ZG7 A;  2XEG A;  3D66 A;  3F8K A;  3FB3 A;  2J8R A;  4JS7 A;  1HDQ A;  4K3N A;  2JA6 A;  1M4D A;  2V77 A;  1PPY A;  5CPA A;  3IR6 A;  3W6X A;  5LYI A;  2YNC A;  1PU9 A;  2EK9 A;  2HCZ X;  3TT2 A;  4A33 A;  4F8Z A;  2ZEE A;  1WC2 A;  3EC4 A;  2NVX A;  3IWG A;  3NE8 A;  2WAQ A;  5AG6 A;  4A2Z A;  3X2I A;  3S6K A;  3CPA A;  2OZG A;  1I1D A;  4CGO A;  1QSR A;  2ATR A;  4FD6 A;  2C6P A;  4HNX B;  4B5P B;  4KDL A;  1XF8 A;  1TWF A;  3WC6 A;  1P4N A;  3H8E A;  4MCR A;  2DPS A;  2OR4 A;  2PIC A;  2VXK A;  4M6H A;  3VWD A;  1IID A;  4MY3 A;  4OC4 A;  1YVK A;  4A38 A;  2PVV A;  2ZEO A;  3NA6 A;  4CGP A;  4IK2 A;  3TCV A;  4FAI A;  5LYL A;  2PJ4 A;  3RNZ A;  1Y0Y A;  2VZY A;  4KOX A;  1VIX A;  4KOT A;  3GLJ A;  2IJZ A;  2ZEG A;  4KVX A;  4UFW A;  2OU2 A; 
#chains in the Genus database with same CATH homology
 2JA5 A;  2FIA A;  4XNH C;  3ZJ0 A;  4JLY A;  4KZT A;  5FTM A;  1NMT A;  5DYG A;  1ZC1 A;  2P6F A;  1SFO A;  4H6U A;  1Z4E A;  5T5M D;  3FNC A;  2PJH B;  2Y0S A;  1YK3 A;  1KUY A;  3GTO A;  2Z3N A;  1YGH A;  1S60 A;  2I79 A;  3PZJ A;  4OLL A;  2VEZ A;  2Z3K A;  4KLW A;  5KTA A;  1LRZ A;  1V0C A;  4B10 A;  1K83 A;  1YRE A;  2QEC A;  4I49 A;  1KQG A;  1QCS A;  5EC4 A;  3N7Z A;  4CAE A;  2G5D A;  2JLM A;  4ORF A;  2GIV A;  4KDI A;  3TO9 A;  2FS5 A;  2AE0 X;  5DYI A;  5A27 A;  2PR1 A;  2A6E D;  3HKZ A;  2Q04 A;  4FD5 A;  2BL1 A;  4KOW A;  1PQE A;  4L8A A;  2CNS A;  4CGM A;  2V45 A;  4HKF A;  3I9S A;  5T5I D;  4D7Z B;  2JDC A;  2WPW A;  4HNW B;  1S7F A;  3GY9 A;  1Y1V A;  4BMH A;  2A69 D;  4AVC A;  2Y0M A;  3MGD A;  4AB7 A;  2PNW A;  4CAW A;  5G22 A;  1VKC A;  4J3G A;  1FDO A;  1J4J A;  4B11 A;  3FIX A;  4F0Y A;  4LX9 A;  4KOU A;  1MJ9 A;  4QBJ A;  4KO8 A;  4AVA A;  2CXA A;  3CXP A;  5J8C A;  2R7H A;  1KUX A;  2HQY A;  5AG4 A;  4EVY A;  2E2H A;  4CYP A;  1QSN A;  3EXN A;  3T90 A;  4RV0 A;  2V3V A;  4QUS A;  3GTK A;  5EBV A;  4ONU A;  3S6H A;  4Q36 A;  1B87 A;  5F47 A;  2B5G B;  1SQH A;  3B8G A;  2A6H D;  1L0C A;  4BBH A;  3CXQ A;  1DMS A;  4YGO A;  4Y49 B;  1Z4R A;  1VHS A;  5C1B A;  2YNE A;  2YGW A;  4KLV A;  4MFJ A;  3TIW A;  3GTG A;  3TFY A;  2KCW A;  4B14 A;  3TOA A;  1Y4Z A;  1Q16 A;  1XE4 A;  3P2H A;  4K30 A;  2VUM A;  2B5G A;  3R96 A;  2PC1 A;  2WUU A;  2G0B A;  2Z3M A;  4HNY B;  5JQ4 A;  2CY2 A;  1OZP A;  2J8N A;  1TMO A;  1SMY D;  3IWE A;  4F6A A;  2C45 A;  4OAD A;  1WWZ A;  2GAN A;  4M3S A;  3IU2 A;  4ZGY B;  5EPP A;  2OZH A;  2JIR A;  3FXT A;  1YR0 A;  4B13 A;  1PUA A;  2H5M A;  2O5J D;  1S5K A;  2YU9 A;  2JDD A;  4UCM A;  1YX0 A;  4AOK B;  1AA6 A;  2VQY A;  2F5I A;  2DPT A;  5BWA B;  4KS9 A;  2NMT A;  2YUJ A;  2CNM A;  1YLE A;  1PYQ A;  1Q2D A;  2G6G A;  2Q4V A;  5CNP A;  1BOB A;  4XPD B;  4KOV A;  2R93 A;  3H0G A;  2B63 A;  5IX3 A;  1UFH A;  4AYB A;  3FBU A;  3W6S A;  2B4B A;  2VPZ A;  3W91 A;  4ZBG A;  1Z9U A;  1H0H A;  3CQZ A;  3TO6 A;  3G8W A;  2IL4 A;  3OWC A;  2ZXV A;  2BE5 D;  1ZO0 A;  2Q44 A;  3VWE A;  4AON B;  2OZU A;  3TO7 A;  5G21 A;  4C68 A;  3R9F A;  3JTK A;  3HU3 A;  1NSL A;  3QWZ A;  4RS2 A;  3QAH A;  1MK4 A;  5FVJ A;  2AJ6 A;  4UFX A;  3LOD A;  4FD4 A;  4IF5 A;  5JPH A;  2REF A;  1Q2C A;  1S3Z A;  1VC3 B;  4UBR A;  2ZW7 A;  3EFA A;  4QB9 A;  4JD6 A;  4A31 A;  1I3Q A;  4KSF A;  2VPW A;  5DWM A;  3OUG A;  4CRZ B;  1U6M A;  5AGE A;  4AG7 A;  5GCN A;  2Z3P A;  2DXQ A;  3GTQ A;  3K9U A;  1E61 A;  4CRY B;  3F5B A;  1PYU B;  2FL4 A;  3PGP A;  1AW8 B;  3D2M A;  1P0H A;  4UFV A;  1SIW A;  1S7N A;  1WLF A;  2FXF A;  2Z10 A;  3R1K A;  3TE4 A;  2B58 A;  1TWH A;  2QIR A;  4CRY G;  5DWN A;  4II9 A;  2BSW A;  2K5T A;  4MFZ A;  4GA5 A;  1S3S A;  4AAY A;  2VPY A;  2HUZ A;  3RYO A;  4JXQ A;  4CGL A;  4DNC A;  3C26 A;  4KLN A;  3FYN A;  1B6B A;  4E0A A;  4GA6 A;  4LUA A;  2ZW4 A;  3GTP A;  1M1D A;  2BUE A;  4IUS A;  4UWI A;  2PMZ A;  1MJB A;  1CZ4 A;  2E7Z A;  3CF2 A;  2PSW A;  3DNS A;  3GTL A;  3FRM A;  3CXS A;  5IB0 A;  4MFQ A;  5G1Z A;  1S7K A;  2R1I A;  4UA3 A;  4KVO E;  2PR8 A;  3HU2 A;  3SXO A;  2VPX A;  1MJA A;  2Q0Y A;  4CRZ A;  1TIQ A;  3ZZI A;  4QVT A;  2C27 A;  4YRH A;  3QQ7 A;  5F48 A;  1Y9W A;  1UHD A;  1QST A;  3CZB A;  2NAP A;  4A95 A;  1CR5 A;  3KKW A;  4KOS A;  1S7L A;  4B12 A;  5C18 A;  1Y7R A;  2B4D A;  1R7R A;  1BO4 A;  4C2Z A;  4AG9 A;  4CGN A;  1M4G A;  5B6C A;  4MI4 A;  1FY7 A;  5A28 A;  1TWA A;  4R3K A;  2NVY A;  2YNC C;  1KQF A;  1ON0 A;  1OGY A;  3S6F A;  4DMR A;  1IYL A;  1M4I A;  1WK4 A;  3BJ8 A;  1WCM A;  1E60 A;  2VZZ A;  3H5Z A;  2R92 A;  5GLF A;  2FT0 A;  3D2P A;  3DMR A;  4Q38 A;  5AG7 A;  4NSQ A;  2P6E A;  4CAX A;  4UCP A;  3TTH A;  2NYA A;  3TM7 B;  2I00 A;  2R98 A;  4QIW A;  4C2X A;  4CYO A;  4U9Z A;  4E8O A;  1UHE A;  2FCK A;  2PDO A;  1QDN A;  2ARH A;  5ISV A;  4XPD C;  3R95 A;  5IV0 A;  5H84 A;  4FD7 A;  2CW0 D;  1QSO A;  4AVB A;  4XNH B;  2WSA A;  1YNJ D;  1PT1 A;  2Z3L A;  2Z11 A;  4PV6 A;  3G3S A;  2Z3O A;  4JJX A;  3F0A A;  4MJ8 A;  2WPX A;  2JIP A;  3QC8 A;  2JEV A;  4B5P A;  2JIO A;  3R9G A;  4A32 A;  1M44 A;  4C2M A;  2Q7B A;  1G8J A;  2OB0 A;  4H6Z A;  3H4Q A;  1R27 A;  3A9L A;  1DMR A;  2G3A A;  2PQ8 A;  3DSB A;  4CYQ A;  4MFK A;  2JIM A;  2CNT A;  4CAV A;  1EU1 A;  3PP9 A;  1XIX A;  2QML A;  1XMT A;  1TWC A;  2JA7 A;  2B3U A;  1IW7 D;  3PLX B;  1KZF A;  4R57 A;  4PK2 A;  4R3L A;  1RO5 A;  1ZYR D;  2A68 D;  4UCN A;  2GAE A;  5F49 A;  4PSW A;  4CS0 A;  3QB8 A;  3P2F A;  2R8V A;  3DDD A;  3TOB A;  2Z0Z A;  3SXN A;  4OAE A;  4M85 A;  3JVN A;  2FSR A;  3ML1 A;  4UWJ A;  2B4D B;  2EVN A;  2D4O A;  5KTD A;  4CYN A;  4NCZ A;  4KOD A;  2D4P A;  4KOY A;  4CS0 B;  4X5K A;  2O28 A;  4F0X A;  4C7H A;  2EUI A;  2RC4 A;  4H89 A;  1CZ5 A;  3JUW A;  5E96 A;  3LD2 A;  1Q2Y A;  2VBQ A;  3D8P A;  3E0K A;  1YVO A;  4U5Y A;  2HV2 A;  1E32 A;  5KTC A;  5I0C A;  4XPK A;  2GE3 A;  4KOR A;  3EO4 A;  3BJ7 A;  1R9T A;  1PQF A;  3EY5 A;  4L89 A;  4PK3 A;  5FTN A;  3V8I A;  2R7Z A;  3IGR A;  2BEI A;  2PJJ A;  3DR8 A;  5FTJ A;  2ZW5 A;  2JIQ A;  5G20 A;  1GHE A;  2B3V A;  1E5V A;  3O5A A;  1CJW A;  1CM0 A;  1PT0 A;  5HH1 A;  3S6G A;  5C82 A;  3IR7 A;  2DMR A;  2P0W A;  4R9M A;  3R9E A;  2Q4Y A;  4NOH A;  4C2Y A;  3HU1 A;  2PRB A;  3NE7 A;  4R87 A;  5AG5 A;  3WR7 A;  1IIC A;  4GS4 A;  2VI7 A;  2X7B A;  4NXY A;  4RI1 A;  5F46 A;  4MBU A;  5C88 A;  4MFP A;  3SHP A;  4A30 A;  4KVM E;  2A4N A;  1KUV A;  1I50 A;  3I3G A;  5FTK A;  4QC6 A;  1E18 A;  2EEO B;  4CAF A;  4U9Y A;  1IB1 E;  1TWG A;  4NF1 A;  4C7I A;  4JXR A;  5H86 A;  2AE6 A;  2J8M A;  1FDI A;  1Y5I A;  1R57 A;  4KSA A;  5HMN A;  3D3S A;  3GTM A;  3UY5 A;  2FE7 A;  1H5N A;  4JWP A;  4YFJ A;  2IV2 X;  2G3T A;  3T9Y A;  4Y49 C;  4B5O A;  2ZPA A;  2P6G A;  2OH1 A;  1G8K A;  2YND A;  3GYA A;  1XEB A;  4KUA A;  3QQ8 A;  5FTL A;  3GTJ A;  3BLN A;  3IU1 A;  4E2A A;  1RXT A;  1QSM A;  4PSX A;  1I21 A;  2WB1 A;  4NEX A;  4XPL A;  3FKI A;  4KUB A;  2ZW6 A;  1YNN D;  4MHD A;  1Y1W A;  1PQH A;  2REE A;  4MFL A;  2FIW A;  2PI8 A;  1IYK A;  2KI8 A;  5J8F A;  3IR5 A;  1Y9K A;  3DR6 A;  4MY0 A;  2E2I A;  4AZD A;  1K4J A;  1N71 A;  1I12 A;  3GKR A;  1NE9 A;  3F8K A;  3FB3 A;  2J8R A;  2JA6 A;  1M4D A;  1PPY A;  3IR6 A;  3W6X A;  2YNC A;  1PU9 A;  3TT2 A;  4A33 A;  3EC4 A;  2NVX A;  3IWG A;  2WAQ A;  5AG6 A;  4A2Z A;  3S6K A;  4CGO A;  2OZG A;  1I1D A;  1QSR A;  2ATR A;  4FD6 A;  4HNX B;  4B5P B;  1XF8 A;  4KDL A;  1TWF A;  1P4N A;  2DPS A;  2VXK A;  2PIC A;  3VWD A;  1IID A;  4MY3 A;  1YVK A;  4CGP A;  3TCV A;  4KOT A;  2VZY A;  4KOX A;  4UFW A;  4KVX A;  2OU2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...