1YLEA

The structure of arginine/ornithine succinyltransferase subunit ai from pseudomonas aeruginosa.
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
342
structure length
330
Chain Sequence
GHMLVMRPAQAADLPQVQRLAADSPVGVTSLPDDAERLRDKILASEASFAAEVSYNGEESYFFVLEDSASGELVGCSAIVASAGFSEPFYSFRNETFVHASRSLSIHNKIHVLSLCHDLTGNSLLTSFYVQRDLVQSVYAELNSRGRLLFMASHPERFADAVVVEIVGYSDEQGESPFWNAVGRNFFDLNYIEAEKLSGLKHYPIYVPLLPDAAQESMGQVHPRAQITFDILMREGFETDNYIDIFDGGPTLHARTSGIRSIAQSRVVPVKIGEKSGRPYLVTNGQLQDFRAVVLDLDWAPGKPVALSVEAAEALGVGEGASVRLVAVGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of arginine/ornithine succinyltransferase subunit AI from Pseudomonas aeruginosa.
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
molecule keywords Arginine N-succinyltransferase, alpha chain
total genus 93
structure length 330
sequence length 342
ec nomenclature ec 2.3.1.109: Arginine N-succinyltransferase.
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04958 AstA Arginine N-succinyltransferase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1yleA02
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1yleA01
1GHEA 1RO5A 2CNSA 2BL1A 4FD4A 4MY0A 5J8FA 3OWCA 1LRZA 2F5IA 3GTPA 3JUWA 1L0CA 2ARHA 2AE6A 4JXRA 3T90A 2VZZA 5FVJA 1QSNA 2CNMA 3HU3A 4JD6A 5F49A 3B8GA 4R87A 1CJWA 3R9GA 1AA6A 2WB1A 1PYQA 5FTKA 2FCKA 1G8JA 4MI4A 2B5GA 3TFYA 5IX3A 1VC3B 1R7RA 3S6HA 1UFHA 3E0KA 1MJAA 4GA5A 5FTJA 1M4IA 4ZBGA 5C18A 5FTNA 3GYAA 1KUVA 4KOUA 4OAEA 2JDCA 4B5PB 3FKIA 1OGYA 2PMZA 2PDOA 2Z11A 1XE4A 2B58A 4U5YA 1PQFA 4R3KA 3IGRA 2PSWA 3DSBA 3GTOA 4NSQA 2QECA 2GIVA 4KODA 2JIRA 4DNCA 2D4PA 1PT0A 2VXKA 4QUSA 3VWEA 2R1IA 2QMLA 4RI1A 2ZW5A 5JQ4A 1H0HA 2OH1A 3F5BA 3FRMA 3D2MA 4MHDA 2ZXVA 3DR6A 4M85A 4UWIA 4XPLA 2VPXA 2B5GB 2QIRA 3BJ7A 2P0WA 1KZFA 5H84A 2B4DA 2J8NA 1IYKA 1S3ZA 2IV2X 2FIAA 4Y49B 3O5AA 1Q2DA 4QB9A 1S60A 3QWZA 4HNXB 1IYLA 1Y1WA 4AONB 1KUXA 3GKRA 1P0HA 4CRYG 3I9SA 5C88A 1XEBA 2VUMA 5GLFA 1TWGA 4XNHB 3F8KA 4CAXA 2OU2A 1BO4A 1ON0A 4JXQA 1WLFA 3SXOA 3QQ8A 4XPKA 3OUGA 4KLNA 2EUIA 4C2MA 4ONUA 2ZW7A 4RS2A 1MJ9A 5H86A 2V45A 3TOBA 5DYGA 2Y0SA 2PRBA 2I00A 2PQ8A 1Y4ZA 4AAYA 2JIMA 5KTCA 1NMTA 3R1KA 4QC6A 3CXPA 4HNWB 4CS0B 4U9YA 3EFAA 5DYIA 1V0CA 4CRYB 2EVNA 1KQGA 3FBUA 2B3UA 2R7HA 3TIWA 2R7ZA 4AB7A 4CAVA 4FD6A 2REEA 2BEIA 3TM7B 4KLVA 4KO8A 2X7BA 1PT1A 2DMRA 1EU1A 5IV0A 2AJ6A 1M4DA 1UHDA 1I50A 3GTLA 4B5OA 2FXFA 4KOTA 1TWCA 5C1BA 4AVAA 1YX0A 2Z10A 2JA6A 2VI7A 1R57A 2NYAA 4AZDA 1FY7A 4B5PA 1S7FA 3LODA 4R57A 4OLLA 3IR6A 4F0YA 2E2HA 1PQEA 3MGDA 3TTHA 4GS4A 1K83A 4KOVA 5JPHA 2J8MA 3GTMA 2NMTA 5EC4A 5C82A 2Q4VA 5GCNA 4AOKB 1M44A 5HH1A 2NAPA 4KZTA 4L89A 2OZUA 4D7ZB 2Q4YA 2REFA 1TWHA 4E2AA 2VPZA 1M1DA 4IUSA 1IIDA 5DWNA 4K30A 2J8RA 1YGHA 3S6GA 3R95A 4JLYA 4HKFA 2D4OA 5EBVA 2G0BA 4II9A 1G8KA 1XF8A 3D8PA 3RYOA 4AG9A 4CRZA 1Y9WA 1S5KA 3BLNA 1PUAA 2ZW6A 3W6XA 1I12A 3K9UA 3UY5A 2V3VA 2VQYA 4FD5A 2C27A 2WAQA 4U9ZA 2P6FA 3BJ8A 2ZPAA 1IB1E 4KVOE 1MJBA 3TO7A 4CAWA 1YLEA 3S6KA 1QCSA 1CZ4A 4KVME 2JDDA 3EO4A 5J8CA 5KTDA 3FIXA 4F6AA 2VPYA 1KUYA 1I3QA 2FE7A 1RXTA 2FSRA 1KQFA 1NSLA 3PLXB 3CQZA 3TO9A 2NVXA 3PGPA 2PC1A 4KORA 1PYUB 3FNCA 4KOXA 2KI8A 3TE4A 4KLWA 3W91A 4NF1A 3TT2A 3ML1A 4NXYA 4MY3A 3FXTA 2WPXA 5FTLA 4H6ZA 3QAHA 2Q04A 1QSOA 2C45A 2G3AA 3EXNA 2H5MA 4CS0A 2BSWA 3DR8A 4GA6A 4X5KA 2VEZA 1S7KA 4KOWA 1OZPA 3P2HA 3FB3A 4YGOA 5IB0A 2JIOA 4DMRA 2FIWA 4PK2A 3T9YA 1TIQA 2OZHA 1SQHA 4QIWA 4H6UA 4H89A 4XPDB 3TOAA 2CNTA 2B4BA 2GE3A 2PR8A 2B3VA 4AVBA 3CF2A 4QBJA 4IF5A 4CRZB 3NE7A 2R93A 1Y5IA 5F46A 2YU9A 3G3SA 2PJHB 3W6SA 1CM0A 1YREA 3QQ7A 1WWZA 1Y1VA 4R9MA 4BMHA 1PPYA 3KKWA 1E18A 3P2FA 2A4NA 5EPPA 1FDOA 3IR5A 1XIXA 4MBUA 3TO6A 4JWPA 4J3GA 4PV6A 1E5VA 2IL4A 2HV2A 3CXQA 3PZJA 5FTMA 1Q2YA 5HMNA 3GTQA 2Q44A 4PSXA 3VWDA 3HKZA 5E96A 1S3SA 2B63A 2FS5A 2JEVA 4L8AA 2ATRA 2R92A 1YVKA 1DMRA 3SHPA 5B6CA 1SFOA 3EC4A 3TCVA 2G3TA 5KTAA 2KCWA 1FDIA 5CNPA 4MJ8A 3IR7A 2JIQA 1B87A 1U6MA 3DMRA 5T5MD 5F48A 3H4QA 1SIWA 3EY5A 1TWAA 4QVTA 4R3LA 3R96A 4KUAA 3QC8A 1VHSA 3C26A 1CR5A 4AYBA 2R8VA 4RV0A 4KOYA 2Y0MA 4E8OA 3F0AA 3QB8A 2CY2A 1Z9UA 4PSWA 1YR0A 5F47A 3HU1A 4YFJA 3GY9A 4FD7A 1R9TA 1NE9A 1YVOA 2OZGA 2VPWA 1H5NA 4YRHA 1I21A 2FT0A 3WR7A 1M4GA 2JLMA 2WPWA 1QSRA 4XPDC 1R27A 1Q16A 4AG7A 3HU2A 1MK4A 3N7ZA 3SXNA 3GTKA 4UBRA 2FL4A 5DWMA 2Q7BA 3D3SA 4KVXA 2B4DB 4KUBA 2HUZA 1WK4A 5ISVA 2NVYA 2R98A 4XNHC 1QSTA 2E2IA 4KDLA 4AVCA 3G8WA 3CXSA 2BUEA 2E7ZA 3GTJA 3V8IA 3R9FA 2K5TA 1QDNA 1Y7RA 2Q0YA 3D2PA 1Y9KA 1YK3A 1I1DA 1K4JA 4KOSA 4E0AA 4I49A 4JJXA 1P4NA 4UA3A 4ORFA 1E60A 2ZW4A 1E32A 4NEXA 2VZYA 3DDDA 1S7NA 1WCMA 4HNYB 2I79A 2EEOB 2RC4A 4LUAA 1N71A 1VKCA 1PU9A 5I0CA 1J4JA 1XMTA 3R9EA 3IWGA 2JA5A 2O28A 3FYNA 1PQHA 2JIPA 4OADA 1UHEA 2HQYA 3DNSA 1IICA 2P6EA 3ZZIA 2Z0ZA 1S7LA 2PR1A 1QSMA 4PK3A 2GANA 1CZ5A 1DMSA 1Z4RA 1B6BA 3PP9A 2VBQA 4UWJA 4KDIA 1Z4EA 3LD2A 1E61A 4LX9A 4M3SA 4EVYA 2DXQA 1TWFA 3ZJ0A 2P6GA 4NCZA 3S6FA 1BOBA 3JVNA 3GTGA 3H0GA 3I3GA 4Y49C 1IW7D 1TMOA 2OB0A 2JA7A 1AW8B 5T5ID 1Q2CA
chains in the Genus database with same CATH superfamily
1GHEA 1RO5A 1XMBA 2BL1A 2CNSA 4FD4A 4A39A 4MY0A 6CPAA 1N10A 1Q7LA 5J8FA 3FEEA 2V8GA 3OWCA 1LRZA 2F5IA 1Z8LA 1ZG9A 3GTPA 3JUWA 3MRUA 1L0CA 2ARHA 2AE6A 3PB6X 4JXRA 2VZZA 3T90A 5FVJA 4C2ZA 2YUJA 1QSNA 3IC1A 4A31A 2Z3MA 1AUGA 2CNMA 3HU3A 4JD6A 4NFRA 4A38A 3GLJA 3H8GA 4KSAA 4MHPA 1EE3P 5F49A 3B8GA 4R87A 3TC8A 3V7ZA 1CJWA 3R9GA 2AFOA 1AA6A 2WB1A 1PYQA 1PYTB 2V77A 3CZXA 2PJCA 4OC2A 2XEGA 3RO0A 2YGWA 5FTKA 3IFEA 1YSJA 2FCKA 1G8JA 4MI4A 5AG4A 3IO1A 5HVHA 2B5GA 2PJJA 2YNDA 3TFYA 2OOTA 1SMYD 4OP4A 5IX3A 4L48A 4JS7A 2G6GA 2HC9A 3X2HA 1VC3B 4C68A 1R7RA 3S6HA 1UFHA 3E0KA 1OA9A 1MJAA 4CYPA 4GA5A 4FWUA 1ARMA 1LOKA 4MXUA 5FTJA 1M4IA 4OKOA 4ZBGA 5C18A 5FTNA 4FUUA 3GYAA 1KUVA 4KOUA 3B2YA 4OAEA 3B3TA 2C6CA 2JDCA 4B5PB 3FKIA 1OGYA 2PMZA 2PDOA 2Z11A 3CPAA 1XE4A 4BINA 2PJ1A 4C2YA 2F8HA 4CGLA 4W9YA 5D8NA 2JBJA 3H8FA 2Z3LA 2B58A 3X2OA 2A68D 4U5YA 1PQFA 4O23A 3S9NA 4R3KA 4P4EA 1Z8XA 3IGRA 1VGYA 2PSWA 3DSBA 4Z65A 3GTOA 2POKA 4NSQA 2QECA 2GIVA 3L2NA 1IU8A 2ZENA 3X2JA 4KODA 1Z2LA 4PPZA 2JIRA 3RZAA 3NH5A 4DNCA 3GUXA 1CX8A 2D4PA 1PT0A 2OR4A 2VXKA 4P10A 4QUSA 3VWEA 2AFMA 4ZGYB 2R1IA 2QMLA 4LQ6A 3H5ZA 4RI1A 2ZW5A 5JQ4A 2CF4A 1H0HA 2OH1A 2BOAA 3B3SA 2VL1A 1BPNA 2BH0A 3D2MA 3SUJA 3F5BA 3FRMA 4MHDA 2ZXVA 3DR6A 4M85A 4UWIA 4WWVA 5H86A 5HVFA 4XPLA 2VPXA 3IJ3A 1TXRA 1Y0RA 2B5GB 2QIRA 3BJ7A 1Z8TA 2P0WA 3QNVA 3RBUA 1LCPA 1KZFA 5H84A 1BW3A 2B4DA 2J8NA 1IYKA 3WC5A 4P6YA 5AG5A 2WZNA 3PB9X 2V8VA 1S3ZA 2IV2X 2FIAA 4Y49B 3O5AA 1Q2DA 1YMEA 4QB9A 1S60A 2QYVA 3QWZA 1DE4C 4HNXB 1IYLA 4B11A 1Y1WA 2DPTA 4AONB 2ZEDA 1KUXA 3GKRA 1P0HA 3DGVA 4CRYG 2ZELA 3I9SA 5C88A 1XEBA 2VUMA 2BE5D 1A2ZA 2GLJA 4MMOA 3B7IA 5THWA 2NYQA 5GLFA 1TWGA 3CPXA 4XNHB 3F8KA 1AYEA 3VARA 4CAXA 2OU2A 1BO4A 2PJ3A 3PBEA 5ELYA 5JM6A 1ON0A 4MFPA 4P44A 4BD9A 4JXQA 3D66A 1WLFA 3SXOA 3BHXA 3QQ8A 4XPKA 3OUGA 4OC0A 4KLNA 2EUIA 3X2NA 4C2MA 3WABA 4ONUA 2ZW7A 4RS2A 1MJ9A 3KR4A 4YU9A 2V45A 1YNND 2PNWA 2Y0SA 5DYGA 1X10A 2PRBA 3TOBA 2KQAA 2I00A 3ISZA 2PQ8A 1Y4ZA 4AAYA 1F2PA 2JIMA 2CTCA 5KTCA 4OC3A 4FG4A 1NMTA 2YNCA 3R1KA 4GM5A 4QC6A 3CXPA 4HNWB 4DYOA 4EMEA 2J9AA 4CS0B 1JQGA 4U9YA 3EFAA 4IAVA 5DYIA 1V0CA 4CRYB 2EVNA 5J1QA 1LAMA 4MHYA 1KQGA 3FBUA 4R8FA 1OBRA 2B3UA 5AG6A 1F2OA 4RN7A 2R7HA 3TIWA 4ZX9A 2R7ZA 3LMSA 1GYTA 2GFQA 4NGSA 4AB7A 4CAVA 4FD6A 2EWBA 2REEA 4CGMA 2BEIA 3TM7B 4PQAA 4KLVA 5GLYA 4UCNA 4KO8A 2X7BA 1PT1A 2DMRA 1L8FA 1EU1A 1CP6A 1VHEA 4NGNA 1CG2A 4A30A 5IV0A 4KVME 2AE0X 2AJ6A 1M4DA 2ZEMA 3B35A 4CYQA 1UHDA 3X2KA 4M6HA 4F8ZA 1I50A 2CIJA 4MCSA 3GTLA 4B5OA 2FXFA 4KOTA 1TWCA 5C1BA 2DEAA 3SULA 4AVAA 4X8IA 1PCAA 4UIAA 3B3WA 5C82A 1YX0A 4ZX8A 5LRKA 2Z10A 2JA6A 1AMPA 2VI7A 3SJGA 1R57A 2NYAA 4AZDA 1FY7A 2Q51A 4B5PA 4P4JA 4JYWA 1S7FA 3LODA 4R57A 3FVLA 2Q7SA 4OLLA 3IR6A 2Z3OA 2FVGA 4F0YA 3BXMA 5LRGA 4CAEA 4CPAA 2E2HA 1PQEA 4FBEA 3MGDA 4RUHA 4MHNA 1X12A 2GREA 4GS4A 4MFZA 3TTHA 2I3CA 1K83A 1YW4A 4A33A 2BO9A 1ZG7A 4KOVA 4UFXA 1ZC1A 5LRJA 5F09A 5JPHA 1DTDA 2J8MA 3GTMA 3IWWA 2NMTA 1TKJA 5EC4A 3VH9A 3NH8A 4ZM7A 2Q4VA 2PJAA 3FH4A 3PB4X 3PFEA 5GCNA 4AOKB 2PI8A 2PICA 1M44A 1R43A 5HH1A 2NAPA 3X2PA 1BW4A 1YQEA 2PJ9A 3B3VA 4KZTA 4NGMA 4OC5A 1ZG8A 4B14A 4FFTA 4L89A 5LYLA 2OZUA 1IGBA 1TF8A 4OIDA 4D7ZB 4AVRA 4H2KA 2Q4YA 2REFA 4KSFA 1TWHA 4E2AA 2VPZA 1M1DA 2O4HA 4IHMA 4IUSA 1IIDA 3SJFA 5DWNA 4OC1A 4K30A 2J8RA 1YGHA 3S6GA 1Z5RA 3R95A 3IU1A 4JLYA 3KASA 2HCZX 4B13A 4HKFA 5G20A 3KHZA 2D4OA 4UFVA 5EBVA 2G0BA 5AGEA 4ZY0A 1HDQA 7CPAA 3KQXA 4II9A 1G8KA 1XF8A 3D8PA 3KQZA 4ONWA 3PRTA 2ZEHA 4B10A 4K3NA 5A28A 2G9DA 3RYOA 4AG9A 4CRZA 1HDUA 1Y9WA 3WC6A 1S5KA 3GB0A 3BLNA 4BBHA 1PUAA 4CGNA 3X2IA 1CPXA 1LFWA 2ZW6A 1I12A 3K9UA 3W6XA 5CPAA 3UY5A 2V3VA 5LYFA 2VQYA 2EK9A 3BI1A 2QVPA 4FD5A 2C27A 4ZI6A 2WAQA 1F57A 3S9LA 4U9ZA 2P6FA 3BJ8A 2ZPAA 1IB1E 4KVOE 1MJBA 1ZLHA 3TO7A 1YLEA 3FF3A 3K9TA 4CAWA 3S6KA 5I4MA 2PJ4A 1QCSA 1CZ4A 4JJOA 2F7VA 3D7FA 2JDDA 2PIZA 3EO4A 3IIBA 3SUMA 3FIXA 3CZBA 2XEFA 3HLPA 2VPYA 3ISXA 4LQGA 5AG7A 1KUYA 1I3QA 4B12A 4F6AA 2FE7A 1RXTA 2FSRA 1KQFA 1NSLA 5LYDA 4A37A 3PLXB 5GLXA 3CQZA 2PJ6A 3TO9A 5KTDA 2C1CA 2NVXA 3PGPA 2PJ5A 2PC1A 4Q38A 1Y7EA 4KORA 4UEFA 1FT7A 1PYUB 3FNCA 4KOXA 2KI8A 3TE4A 2IMOA 4KLWA 3FJUA 4G1PA 4NF1A 3TT2A 3W91A 3ML1A 2DPSA 2EK8A 4NXYA 4MY3A 3FXTA 2WPXA 4P4IA 2ZEPA 5FTLA 4H6ZA 2JBKA 4WJBA 1CBXA 2ZOFA 3RNZA 4PXDA 3QAHA 2PVWA 3JRUA 2Q04A 1QSOA 4CYNA 3X2MA 2Z3PA 4MCPA 2C45A 3KL9A 4C7IA 2YNCC 5H4UA 2G3AA 3EXNA 2H5MA 3D67A 1BLLE 1LANA 1OA7A 4X3RA 4CS0A 2BSWA 2AFWA 3DR8A 4YWYA 5D29A 4GA6A 1ARLA 4X5KA 4P4FA 2VEZA 2EBJA 3D30A 1S7KA 4KOWA 1IY7A 1OZPA 1KWMA 3P2HA 3FB3A 3KI9A 4A95A 3BI0A 4YGOA 5IB0A 2JIOA 4DMRA 1CPSA 2FIWA 4NGRA 4PK2A 3T9YA 4ENGA 1TIQA 3LACA 4CGOA 3FEDA 2OZHA 3NH4A 3KZWA 3SI0A 1SQHA 2ANPA 4QIWA 1BPMA 1FNOA 2ZEEA 4H89A 4H6UA 4XPDB 2PJBA 2CNTA 4MFLA 3TOAA 5K8MA 5GM9A 2B4BA 2GE3A 2PR8A 2B3VA 4AVBA 3CF2A 4ZY2A 4NGQA 1HD5A 4QBJA 4IF5A 1VIXA 2C6GA 4CRZB 2V8HA 3NE7A 2A6ED 2R93A 3LWUA 1XRYA 1Y5IA 2DF5A 5F46A 5K8OA 2YU9A 3NE8A 1H8LA 3G3SA 2BCOA 2PJHB 3W6SA 1CM0A 1YREA 3QQ7A 1WWZA 1Y1VA 4R9MA 4BMHA 1PPYA 1QMUA 5BWAB 3KKWA 1E18A 3KGQA 3P2FA 2A4NA 5EPPA 3CT9A 2ZEFA 5K8PA 1FDOA 3IR5A 1XIXA 1TKHA 4MBUA 1JWQA 2O5JD 3GIUA 2IQ6A 3K2KA 4JWPA 4J3GA 3TO6A 1M4LA 4PV6A 1E5VA 1Y0YA 2IL4A 2HV2A 3CXQA 3PZJA 3CDXA 5K8NA 5FTMA 4NGTA 4UIBA 1Q2YA 4MFJA 4OIWA 5LYIA 3GTQA 1TKFA 5HMNA 2Q44A 4PSXA 2WSAA 4PXBA 3VWDA 4C2XA 3HKZA 5E96A 1S3SA 2B63A 2FS5A 1ZO0A 2JEVA 4IK2A 4L8AA 2ATRA 2IJZA 2R92A 1YVKA 1DMRA 2O53A 4OMEA 4UFWA 3SHPA 5B6CA 1SFOA 3EC4A 3TCVA 2G3TA 3D7DA 4EFDA 2KCWA 5KTAA 1FDIA 5CNPA 4MJ8A 5HVGA 3IR7A 2JIQA 1IOFA 1ELLP 3PB8X 2AFSA 3NFZA 3HUVA 1B87A 2PRQA 2XEIA 1U6MA 3DMRA 5T5MD 2Q43A 3D68A 1HEEA 3H4QA 4Q36A 5F48A 1SIWA 3EY5A 1TWAA 3FX6A 3I1UA 4QVTA 3DLJA 4MRIA 4R3LA 5G21A 3R96A 4NJQA 3V38A 3WC7A 4KUAA 3QC8A 1VHSA 3C26A 4UCPA 4DUKA 1CR5A 4FERA 4AYBA 2R8VA 4MFKA 3VATA 3RAMA 4M6IA 4RV0A 4F9UA 3X2GA 1ZLIA 4KOYA 2Y0MA 4E8OA 3F0AA 3QB8A 2CY2A 1R3NA 1Z9UA 1YR0A 4PSWA 4B6ZA 5A27A 5F47A 4CAFA 3HU1A 4YFJA 3GY9A 4P4BA 4FD7A 4UF4A 5JH9A 4A32A 2A69D 1R9TA 1NE9A 1YVOA 2AFUA 2OZGA 2ZEGA 3QAYA 2VPWA 3ENGA 4R6TA 5G22A 1H5NA 4YRHA 1I21A 4AXVA 4ZY1A 2FT0A 4ZYQA 3PFOA 3WR7A 4DJLA 2Z3NA 4NOHA 1M4GA 8CPAA 3KR5A 2JLMA 2WPWA 5DS0A 1QSRA 4XPDC 3SUKA 5IB9A 4JZ0A 1CP7A 1R27A 2CTBA 4R7MA 1Q16A 4AG7A 3HU2A 4KSIA 4F0XA 1MK4A 4TWEA 2ZOGA 3N7ZA 2JEWA 3GTKA 1XBUA 4UBRA 3SJXA 3SXNA 4CGPA 4M6GA 2FL4A 5DWMA 2Q7BA 1WC2A 3D3SA 4KVXA 2B4DB 4MCRA 3M3GA 2HUZA 1WK4A 3JTKA 4KUBA 2YNEA 2NVYA 2R98A 1IOIA 2HB6A 5ISVA 2NSMA 4XNHC 1QSTA 4PXCA 4A2ZA 2E2IA 4KDLA 4AVCA 3G8WA 2PJ0A 4UCMA 3D7GA 3CXSA 4JP6A 4GXHA 3WT4A 4MFQA 2BUEA 2E7ZA 4JCWA 3GTJA 3V8IA 4OC4A 2QJ8A 2GAEA 2RFHA 3MN8A 3R9FA 2K5TA 1XFOA 1QDNA 2EO8A 1Y7RA 2Q0YA 3D2PA 1Y9KA 1YK3A 4JP7A 1I1DA 3B3CA 2AFXA 2XEJA 1K4JA 2PJ7A 3D7HA 4KOSA 4E0AA 4I49A 4JJXA 1P4NA 3A9LA 4UA3A 3S9MA 5J8CA 4UEEA 4NJRA 1UWYA 1ELMP 4ORFA 1E60A 2CXAA 1E32A 2CW0D 2ZW4A 4NEXA 2VZYA 3IWEA 2WYRA 3DDDA 1S7NA 3FECA 3FMCA 1WCMA 4C7HA 4HNYB 2I79A 2EEOB 2GU2A 2G5DA 1XJOA 4PXEA 2PVVA 2RC4A 5EMIA 4LUAA 1N71A 1VKCA 1PU9A 1ZYRD 2ABZA 5I0CA 2PIYA 4A94A 1J4JA 1XMTA 3R9EA 2ODFA 3IU2A 3KHXA 1YNJD 3IWGA 1YLOA 2JA5A 2O28A 3FYNA 3IEHA 2WUUA 1PQHA 4X2TA 2JIPA 4OADA 4NGPA 2Q4ZA 2PJ8A 2ENGA 1UHEA 4FG2A 2HQYA 3DNSA 1IICA 2P6EA 3ZZIA 2Z0ZA 2A6HD 1S7LA 1QQ9A 2PR1A 3N5FA 4FAIA 1QSMA 4KS9A 4PK3A 2GANA 1CZ5A 1DMSA 1NSAA 1B6BA 1Z4RA 2VBQA 3PP9A 5G1ZA 3H8EA 2AFZA 4UWJA 4P4DA 4P45A 2RB7A 2V8DA 2Z3KA 4KDIA 1Z4EA 5HXDA 3LD2A 1E61A 4LX9A 4M3SA 4MHZA 1YW6A 4TNUA 4EVYA 2DXQA 1TWFA 3ZJ0A 4UEZA 2P6GA 3SJEA 1XOVA 4NCZA 4F9VA 3S6FA 1VHOA 4CYOA 5CBMA 1RTQA 1BOBA 1Z8WA 3D4UA 4R76A 3JVNA 3SI2A 1LAPA 3TX8A 3NA6A 3PEIA 3SI1A 3GTGA 1TF9A 3H0GA 4MCQA 5JGFA 4HPSA 3I3GA 4Y49C 1IW7D 1TMOA 3PB7X 1BAVA 2PJ2A 2PCUA 3X2LA 3T8WA 2OB0A 2JA7A 4Q7AA 2ZEOA 2GLFA 4EWTA 1AW8B 3PBBA 5T5ID 2C6PA 1Q2CA 2PE3A
chains in the Genus database with same CATH topology
1GHEA 1RO5A 2CNSA 2BL1A 4FD4A 4MY0A 5J8FA 3OWCA 1LRZA 2F5IA 3GTPA 3JUWA 1L0CA 2ARHA 2AE6A 4JXRA 3T90A 2VZZA 5FVJA 4C2ZA 2YUJA 1QSNA 4A31A 2Z3MA 2CNMA 3HU3A 4JD6A 4KSAA 5F49A 3B8GA 4R87A 1CJWA 3R9GA 1AA6A 2WB1A 1PYQA 2YGWA 5FTKA 2FCKA 1G8JA 4MI4A 5AG4A 2B5GA 2PJJA 2YNDA 3TFYA 1SMYD 5IX3A 2G6GA 1VC3B 1R7RA 3S6HA 1UFHA 3E0KA 4CYPA 1MJAA 4GA5A 5FTJA 1M4IA 4ZBGA 5C18A 5FTNA 3GYAA 1KUVA 4KOUA 4OAEA 2JDCA 4B5PB 3FKIA 1OGYA 2PMZA 2PDOA 2Z11A 1XE4A 4CGLA 2Z3LA 2B58A 2A68D 4U5YA 1PQFA 4R3KA 3IGRA 2PSWA 3DSBA 3GTOA 4NSQA 2QECA 2GIVA 4KODA 2JIRA 4DNCA 2D4PA 1PT0A 2VXKA 4QUSA 3VWEA 4ZGYB 2R1IA 2QMLA 3H5ZA 4RI1A 2ZW5A 5JQ4A 1H0HA 2OH1A 3F5BA 3FRMA 3D2MA 4MHDA 2ZXVA 3DR6A 4M85A 4UWIA 4XPLA 2VPXA 2B5GB 2QIRA 3BJ7A 2P0WA 1KZFA 5H84A 2B4DA 2J8NA 1IYKA 5AG5A 1S3ZA 2IV2X 2FIAA 4Y49B 3O5AA 1Q2DA 4QB9A 1S60A 3QWZA 4HNXB 1IYLA 4B11A 1Y1WA 2DPTA 4AONB 1KUXA 3GKRA 1P0HA 4CRYG 3I9SA 5C88A 1XEBA 2VUMA 2BE5D 5GLFA 1TWGA 4XNHB 3F8KA 4CAXA 2OU2A 1BO4A 1ON0A 4MFPA 4JXQA 1WLFA 3SXOA 3QQ8A 4XPKA 3OUGA 4KLNA 2EUIA 4C2MA 4ONUA 2ZW7A 4RS2A 1MJ9A 5H86A 2V45A 1YNND 2PNWA 2Y0SA 5DYGA 2PRBA 3TOBA 2I00A 2PQ8A 1Y4ZA 4AAYA 2JIMA 5KTCA 1NMTA 3R1KA 2YNCA 4QC6A 3CXPA 4HNWB 4CS0B 4U9YA 3EFAA 5DYIA 1V0CA 4CRYB 2EVNA 1KQGA 3FBUA 2B3UA 5AG6A 2R7HA 3TIWA 2R7ZA 4AB7A 4CAVA 4FD6A 2REEA 4CGMA 2BEIA 3TM7B 4KLVA 4UCNA 4KO8A 2X7BA 1PT1A 2DMRA 1EU1A 4A30A 5IV0A 2AE0X 2AJ6A 1M4DA 4CYQA 1UHDA 1I50A 3GTLA 4B5OA 2FXFA 4KOTA 1TWCA 5C1BA 4AVAA 1YX0A 2Z10A 2JA6A 2VI7A 1R57A 2NYAA 4AZDA 1FY7A 4B5PA 1S7FA 3LODA 4R57A 4OLLA 3IR6A 2Z3OA 4F0YA 4CAEA 2E2HA 1PQEA 3MGDA 4MFZA 4GS4A 3TTHA 1K83A 4A33A 4KOVA 4UFXA 1ZC1A 5JPHA 2J8MA 3GTMA 2NMTA 5EC4A 5C82A 2Q4VA 5GCNA 4AOKB 2PI8A 2PICA 1M44A 5HH1A 2NAPA 4KZTA 4B14A 4L89A 2OZUA 4D7ZB 2Q4YA 2REFA 4KSFA 1TWHA 4E2AA 2VPZA 1M1DA 4IUSA 1IIDA 5DWNA 4K30A 2J8RA 1YGHA 3S6GA 3R95A 3IU1A 4JLYA 4B13A 4HKFA 5G20A 4UFVA 2D4OA 5EBVA 2G0BA 5AGEA 4II9A 1G8KA 1XF8A 3D8PA 4B10A 5A28A 3RYOA 4AG9A 4CRZA 1Y9WA 1S5KA 4BBHA 3BLNA 4CGNA 1PUAA 2ZW6A 3W6XA 1I12A 3K9UA 3UY5A 2V3VA 2VQYA 4FD5A 2C27A 2WAQA 4U9ZA 2P6FA 3BJ8A 2ZPAA 1IB1E 4KVOE 1MJBA 3TO7A 4CAWA 1YLEA 3S6KA 1QCSA 1CZ4A 4KVME 2JDDA 3EO4A 5J8CA 5KTDA 3FIXA 3CZBA 4F6AA 2VPYA 5AG7A 1KUYA 1I3QA 4B12A 2FE7A 1RXTA 2FSRA 1KQFA 1NSLA 3PLXB 3CQZA 3TO9A 2NVXA 3PGPA 4Q38A 2PC1A 4KORA 1PYUB 3FNCA 4KOXA 2KI8A 3TE4A 4KLWA 3W91A 4NF1A 3TT2A 3ML1A 2DPSA 4NXYA 4MY3A 3FXTA 2WPXA 5FTLA 4H6ZA 3QAHA 2Q04A 1QSOA 4CYNA 2Z3PA 2C45A 4C7IA 2YNCC 2G3AA 3EXNA 2H5MA 4C2YA 4CS0A 2BSWA 3DR8A 4GA6A 4X5KA 2VEZA 1S7KA 4KOWA 1OZPA 3P2HA 3FB3A 4A95A 4YGOA 5IB0A 2JIOA 4DMRA 2FIWA 4PK2A 3T9YA 1TIQA 4CGOA 2OZHA 1SQHA 4QIWA 4H6UA 4H89A 4XPDB 4MFLA 2CNTA 3TOAA 2B4BA 2GE3A 2PR8A 2B3VA 4AVBA 3CF2A 4QBJA 4IF5A 4CRZB 3NE7A 2A6ED 2R93A 1Y5IA 5F46A 2YU9A 3G3SA 2PJHB 3W6SA 1CM0A 1YREA 3QQ7A 1WWZA 1Y1VA 4R9MA 4BMHA 1PPYA 5BWAB 3KKWA 1E18A 3P2FA 2A4NA 5EPPA 1FDOA 3IR5A 1XIXA 4MBUA 3TO6A 2O5JD 4JWPA 4J3GA 4PV6A 1E5VA 2IL4A 2HV2A 3CXQA 3PZJA 5FTMA 1Q2YA 4MFJA 5HMNA 3GTQA 2Q44A 4PSXA 2WSAA 3VWDA 4C2XA 3HKZA 5E96A 1S3SA 2B63A 2FS5A 1ZO0A 2JEVA 4L8AA 2ATRA 2R92A 1YVKA 1DMRA 4UFWA 3SHPA 5B6CA 1SFOA 3EC4A 3TCVA 2G3TA 5KTAA 2KCWA 1FDIA 5CNPA 4MJ8A 3IR7A 2JIQA 1B87A 4C68A 1U6MA 3DMRA 5T5MD 5F48A 3H4QA 4Q36A 1SIWA 3EY5A 1TWAA 4QVTA 4R3LA 5G21A 3R96A 4KUAA 3QC8A 1VHSA 3C26A 4UCPA 1CR5A 4AYBA 2R8VA 4MFKA 4RV0A 4KOYA 2Y0MA 4E8OA 3F0AA 3QB8A 2CY2A 1Z9UA 4PSWA 1YR0A 5A27A 5F47A 4CAFA 3HU1A 4YFJA 3GY9A 4FD7A 4A32A 2A69D 1R9TA 1NE9A 1YVOA 2OZGA 5G22A 2VPWA 1H5NA 4YRHA 1I21A 2FT0A 3WR7A 2Z3NA 4NOHA 1M4GA 2JLMA 2WPWA 1QSRA 4XPDC 1R27A 1Q16A 4AG7A 3HU2A 4F0XA 1MK4A 3N7ZA 3SXNA 3GTKA 4CGPA 4UBRA 2FL4A 5DWMA 2Q7BA 3D3SA 4KVXA 2B4DB 3JTKA 2HUZA 1WK4A 4KUBA 5ISVA 2YNEA 2NVYA 2R98A 4XNHC 1QSTA 4A2ZA 2E2IA 4KDLA 4AVCA 3G8WA 4UCMA 3CXSA 4MFQA 2BUEA 2E7ZA 3GTJA 3V8IA 2GAEA 3R9FA 2K5TA 1QDNA 1Y7RA 2Q0YA 3D2PA 1Y9KA 1YK3A 1I1DA 1K4JA 4KOSA 4E0AA 4I49A 4JJXA 1P4NA 3A9LA 4UA3A 4ORFA 1E60A 2CXAA 1E32A 2CW0D 2ZW4A 4NEXA 2VZYA 3IWEA 3DDDA 1S7NA 1WCMA 4C7HA 4HNYB 2I79A 2EEOB 2G5DA 2RC4A 4LUAA 1N71A 1VKCA 1PU9A 1ZYRD 5I0CA 1J4JA 1XMTA 3R9EA 3IU2A 1YNJD 3IWGA 2JA5A 2O28A 3FYNA 2WUUA 1PQHA 2JIPA 4OADA 1UHEA 2HQYA 3DNSA 1IICA 2P6EA 3ZZIA 2Z0ZA 2A6HD 1S7LA 2PR1A 1QSMA 4KS9A 4PK3A 2GANA 1CZ5A 1DMSA 1Z4RA 1B6BA 3PP9A 2VBQA 5G1ZA 4UWJA 2Z3KA 4KDIA 1Z4EA 3LD2A 1E61A 4LX9A 4M3SA 4EVYA 2DXQA 1TWFA 3ZJ0A 2P6GA 4NCZA 3S6FA 4CYOA 1BOBA 3JVNA 3GTGA 3H0GA 3I3GA 4Y49C 1IW7D 1TMOA 2OB0A 2JA7A 1AW8B 5T5ID 1Q2CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GHE A;  1RO5 A;  2CNS A;  2BL1 A;  4FD4 A;  4MY0 A;  5J8F A;  3OWC A;  1LRZ A;  2F5I A;  3GTP A;  3JUW A;  1L0C A;  2ARH A;  2AE6 A;  4JXR A;  3T90 A;  2VZZ A;  5FVJ A;  1QSN A;  2CNM A;  3HU3 A;  4JD6 A;  5F49 A;  3B8G A;  4R87 A;  1CJW A;  3R9G A;  1AA6 A;  2WB1 A;  1PYQ A;  5FTK A;  2FCK A;  1G8J A;  4MI4 A;  2B5G A;  3TFY A;  5IX3 A;  1VC3 B;  1R7R A;  3S6H A;  1UFH A;  3E0K A;  1MJA A;  4GA5 A;  5FTJ A;  1M4I A;  4ZBG A;  5C18 A;  5FTN A;  3GYA A;  1KUV A;  4KOU A;  4OAE A;  2JDC A;  4B5P B;  3FKI A;  1OGY A;  2PMZ A;  2PDO A;  2Z11 A;  1XE4 A;  2B58 A;  4U5Y A;  1PQF A;  4R3K A;  3IGR A;  2PSW A;  3DSB A;  3GTO A;  4NSQ A;  2QEC A;  2GIV A;  4KOD A;  2JIR A;  4DNC A;  2D4P A;  1PT0 A;  2VXK A;  4QUS A;  3VWE A;  2R1I A;  2QML A;  4RI1 A;  2ZW5 A;  5JQ4 A;  1H0H A;  2OH1 A;  3F5B A;  3FRM A;  3D2M A;  4MHD A;  2ZXV A;  3DR6 A;  4M85 A;  4UWI A;  4XPL A;  2VPX A;  2B5G B;  2QIR A;  3BJ7 A;  2P0W A;  1KZF A;  5H84 A;  2B4D A;  2J8N A;  1IYK A;  1S3Z A;  2IV2 X;  2FIA A;  4Y49 B;  3O5A A;  1Q2D A;  4QB9 A;  1S60 A;  3QWZ A;  4HNX B;  1IYL A;  1Y1W A;  4AON B;  1KUX A;  3GKR A;  1P0H A;  4CRY G;  3I9S A;  5C88 A;  1XEB A;  2VUM A;  5GLF A;  1TWG A;  4XNH B;  3F8K A;  4CAX A;  2OU2 A;  1BO4 A;  1ON0 A;  4JXQ A;  1WLF A;  3SXO A;  3QQ8 A;  4XPK A;  3OUG A;  4KLN A;  2EUI A;  4C2M A;  4ONU A;  2ZW7 A;  4RS2 A;  1MJ9 A;  5H86 A;  2V45 A;  3TOB A;  5DYG A;  2Y0S A;  2PRB A;  2I00 A;  2PQ8 A;  1Y4Z A;  4AAY A;  2JIM A;  5KTC A;  1NMT A;  3R1K A;  4QC6 A;  3CXP A;  4HNW B;  4CS0 B;  4U9Y A;  3EFA A;  5DYI A;  1V0C A;  4CRY B;  2EVN A;  1KQG A;  3FBU A;  2B3U A;  2R7H A;  3TIW A;  2R7Z A;  4AB7 A;  4CAV A;  4FD6 A;  2REE A;  2BEI A;  3TM7 B;  4KLV A;  4KO8 A;  2X7B A;  1PT1 A;  2DMR A;  1EU1 A;  5IV0 A;  2AJ6 A;  1M4D A;  1UHD A;  1I50 A;  3GTL A;  4B5O A;  2FXF A;  4KOT A;  1TWC A;  5C1B A;  4AVA A;  1YX0 A;  2Z10 A;  2JA6 A;  2VI7 A;  1R57 A;  2NYA A;  4AZD A;  1FY7 A;  4B5P A;  1S7F A;  3LOD A;  4R57 A;  4OLL A;  3IR6 A;  4F0Y A;  2E2H A;  1PQE A;  3MGD A;  3TTH A;  4GS4 A;  1K83 A;  4KOV A;  5JPH A;  2J8M A;  3GTM A;  2NMT A;  5EC4 A;  5C82 A;  2Q4V A;  5GCN A;  4AOK B;  1M44 A;  5HH1 A;  2NAP A;  4KZT A;  4L89 A;  2OZU A;  4D7Z B;  2Q4Y A;  2REF A;  1TWH A;  4E2A A;  2VPZ A;  1M1D A;  4IUS A;  1IID A;  5DWN A;  4K30 A;  2J8R A;  1YGH A;  3S6G A;  3R95 A;  4JLY A;  4HKF A;  2D4O A;  5EBV A;  2G0B A;  4II9 A;  1G8K A;  1XF8 A;  3D8P A;  3RYO A;  4AG9 A;  4CRZ A;  1Y9W A;  1S5K A;  3BLN A;  1PUA A;  2ZW6 A;  3W6X A;  1I12 A;  3K9U A;  3UY5 A;  2V3V A;  2VQY A;  4FD5 A;  2C27 A;  2WAQ A;  4U9Z A;  2P6F A;  3BJ8 A;  2ZPA A;  1IB1 E;  4KVO E;  1MJB A;  3TO7 A;  4CAW A;  1YLE A;  3S6K A;  1QCS A;  1CZ4 A;  4KVM E;  2JDD A;  3EO4 A;  5J8C A;  5KTD A;  3FIX A;  4F6A A;  2VPY A;  1KUY A;  1I3Q A;  2FE7 A;  1RXT A;  2FSR A;  1KQF A;  1NSL A;  3PLX B;  3CQZ A;  3TO9 A;  2NVX A;  3PGP A;  2PC1 A;  4KOR A;  1PYU B;  3FNC A;  4KOX A;  2KI8 A;  3TE4 A;  4KLW A;  3W91 A;  4NF1 A;  3TT2 A;  3ML1 A;  4NXY A;  4MY3 A;  3FXT A;  2WPX A;  5FTL A;  4H6Z A;  3QAH A;  2Q04 A;  1QSO A;  2C45 A;  2G3A A;  3EXN A;  2H5M A;  4CS0 A;  2BSW A;  3DR8 A;  4GA6 A;  4X5K A;  2VEZ A;  1S7K A;  4KOW A;  1OZP A;  3P2H A;  3FB3 A;  4YGO A;  5IB0 A;  2JIO A;  4DMR A;  2FIW A;  4PK2 A;  3T9Y A;  1TIQ A;  2OZH A;  1SQH A;  4QIW A;  4H6U A;  4H89 A;  4XPD B;  3TOA A;  2CNT A;  2B4B A;  2GE3 A;  2PR8 A;  2B3V A;  4AVB A;  3CF2 A;  4QBJ A;  4IF5 A;  4CRZ B;  3NE7 A;  2R93 A;  1Y5I A;  5F46 A;  2YU9 A;  3G3S A;  2PJH B;  3W6S A;  1CM0 A;  1YRE A;  3QQ7 A;  1WWZ A;  1Y1V A;  4R9M A;  4BMH A;  1PPY A;  3KKW A;  1E18 A;  3P2F A;  2A4N A;  5EPP A;  1FDO A;  3IR5 A;  1XIX A;  4MBU A;  3TO6 A;  4JWP A;  4J3G A;  4PV6 A;  1E5V A;  2IL4 A;  2HV2 A;  3CXQ A;  3PZJ A;  5FTM A;  1Q2Y A;  5HMN A;  3GTQ A;  2Q44 A;  4PSX A;  3VWD A;  3HKZ A;  5E96 A;  1S3S A;  2B63 A;  2FS5 A;  2JEV A;  4L8A A;  2ATR A;  2R92 A;  1YVK A;  1DMR A;  3SHP A;  5B6C A;  1SFO A;  3EC4 A;  3TCV A;  2G3T A;  5KTA A;  2KCW A;  1FDI A;  5CNP A;  4MJ8 A;  3IR7 A;  2JIQ A;  1B87 A;  1U6M A;  3DMR A;  5T5M D;  5F48 A;  3H4Q A;  1SIW A;  3EY5 A;  1TWA A;  4QVT A;  4R3L A;  3R96 A;  4KUA A;  3QC8 A;  1VHS A;  3C26 A;  1CR5 A;  4AYB A;  2R8V A;  4RV0 A;  4KOY A;  2Y0M A;  4E8O A;  3F0A A;  3QB8 A;  2CY2 A;  1Z9U A;  4PSW A;  1YR0 A;  5F47 A;  3HU1 A;  4YFJ A;  3GY9 A;  4FD7 A;  1R9T A;  1NE9 A;  1YVO A;  2OZG A;  2VPW A;  1H5N A;  4YRH A;  1I21 A;  2FT0 A;  3WR7 A;  1M4G A;  2JLM A;  2WPW A;  1QSR A;  4XPD C;  1R27 A;  1Q16 A;  4AG7 A;  3HU2 A;  1MK4 A;  3N7Z A;  3SXN A;  3GTK A;  4UBR A;  2FL4 A;  5DWM A;  2Q7B A;  3D3S A;  4KVX A;  2B4D B;  4KUB A;  2HUZ A;  1WK4 A;  5ISV A;  2NVY A;  2R98 A;  4XNH C;  1QST A;  2E2I A;  4KDL A;  4AVC A;  3G8W A;  3CXS A;  2BUE A;  2E7Z A;  3GTJ A;  3V8I A;  3R9F A;  2K5T A;  1QDN A;  1Y7R A;  2Q0Y A;  3D2P A;  1Y9K A;  1YK3 A;  1I1D A;  1K4J A;  4KOS A;  4E0A A;  4I49 A;  4JJX A;  1P4N A;  4UA3 A;  4ORF A;  1E60 A;  2ZW4 A;  1E32 A;  4NEX A;  2VZY A;  3DDD A;  1S7N A;  1WCM A;  4HNY B;  2I79 A;  2EEO B;  2RC4 A;  4LUA A;  1N71 A;  1VKC A;  1PU9 A;  5I0C A;  1J4J A;  1XMT A;  3R9E A;  3IWG A;  2JA5 A;  2O28 A;  3FYN A;  1PQH A;  2JIP A;  4OAD A;  1UHE A;  2HQY A;  3DNS A;  1IIC A;  2P6E A;  3ZZI A;  2Z0Z A;  1S7L A;  2PR1 A;  1QSM A;  4PK3 A;  2GAN A;  1CZ5 A;  1DMS A;  1Z4R A;  1B6B A;  3PP9 A;  2VBQ A;  4UWJ A;  4KDI A;  1Z4E A;  3LD2 A;  1E61 A;  4LX9 A;  4M3S A;  4EVY A;  2DXQ A;  1TWF A;  3ZJ0 A;  2P6G A;  4NCZ A;  3S6F A;  1BOB A;  3JVN A;  3GTG A;  3H0G A;  3I3G A;  4Y49 C;  1IW7 D;  1TMO A;  2OB0 A;  2JA7 A;  1AW8 B;  5T5I D;  1Q2C A; 
#chains in the Genus database with same CATH topology
 1GHE A;  1RO5 A;  1XMB A;  2BL1 A;  2CNS A;  4FD4 A;  4A39 A;  4MY0 A;  6CPA A;  1N10 A;  1Q7L A;  5J8F A;  3FEE A;  2V8G A;  3OWC A;  1LRZ A;  2F5I A;  1Z8L A;  1ZG9 A;  3GTP A;  3JUW A;  3MRU A;  1L0C A;  2ARH A;  2AE6 A;  3PB6 X;  4JXR A;  2VZZ A;  3T90 A;  5FVJ A;  4C2Z A;  2YUJ A;  1QSN A;  3IC1 A;  4A31 A;  2Z3M A;  1AUG A;  2CNM A;  3HU3 A;  4JD6 A;  4NFR A;  4A38 A;  3GLJ A;  3H8G A;  4KSA A;  4MHP A;  1EE3 P;  5F49 A;  3B8G A;  4R87 A;  3TC8 A;  3V7Z A;  1CJW A;  3R9G A;  2AFO A;  1AA6 A;  2WB1 A;  1PYQ A;  1PYT B;  2V77 A;  3CZX A;  2PJC A;  4OC2 A;  2XEG A;  3RO0 A;  2YGW A;  5FTK A;  3IFE A;  1YSJ A;  2FCK A;  1G8J A;  4MI4 A;  5AG4 A;  3IO1 A;  5HVH A;  2B5G A;  2PJJ A;  2YND A;  3TFY A;  2OOT A;  1SMY D;  4OP4 A;  5IX3 A;  4L48 A;  4JS7 A;  2G6G A;  2HC9 A;  3X2H A;  1VC3 B;  4C68 A;  1R7R A;  3S6H A;  1UFH A;  3E0K A;  1OA9 A;  1MJA A;  4CYP A;  4GA5 A;  4FWU A;  1ARM A;  1LOK A;  4MXU A;  5FTJ A;  1M4I A;  4OKO A;  4ZBG A;  5C18 A;  5FTN A;  4FUU A;  3GYA A;  1KUV A;  4KOU A;  3B2Y A;  4OAE A;  3B3T A;  2C6C A;  2JDC A;  4B5P B;  3FKI A;  1OGY A;  2PMZ A;  2PDO A;  2Z11 A;  3CPA A;  1XE4 A;  4BIN A;  2PJ1 A;  4C2Y A;  2F8H A;  4CGL A;  4W9Y A;  5D8N A;  2JBJ A;  3H8F A;  2Z3L A;  2B58 A;  3X2O A;  2A68 D;  4U5Y A;  1PQF A;  4O23 A;  3S9N A;  4R3K A;  4P4E A;  1Z8X A;  3IGR A;  1VGY A;  2PSW A;  3DSB A;  4Z65 A;  3GTO A;  2POK A;  4NSQ A;  2QEC A;  2GIV A;  3L2N A;  1IU8 A;  2ZEN A;  3X2J A;  4KOD A;  1Z2L A;  4PPZ A;  2JIR A;  3RZA A;  3NH5 A;  4DNC A;  3GUX A;  1CX8 A;  2D4P A;  1PT0 A;  2OR4 A;  2VXK A;  4P10 A;  4QUS A;  3VWE A;  2AFM A;  4ZGY B;  2R1I A;  2QML A;  4LQ6 A;  3H5Z A;  4RI1 A;  2ZW5 A;  5JQ4 A;  2CF4 A;  1H0H A;  2OH1 A;  2BOA A;  3B3S A;  2VL1 A;  1BPN A;  2BH0 A;  3D2M A;  3SUJ A;  3F5B A;  3FRM A;  4MHD A;  2ZXV A;  3DR6 A;  4M85 A;  4UWI A;  4WWV A;  5H86 A;  5HVF A;  4XPL A;  2VPX A;  3IJ3 A;  1TXR A;  1Y0R A;  2B5G B;  2QIR A;  3BJ7 A;  1Z8T A;  2P0W A;  3QNV A;  3RBU A;  1LCP A;  1KZF A;  5H84 A;  1BW3 A;  2B4D A;  2J8N A;  1IYK A;  3WC5 A;  4P6Y A;  5AG5 A;  2WZN A;  3PB9 X;  2V8V A;  1S3Z A;  2IV2 X;  2FIA A;  4Y49 B;  3O5A A;  1Q2D A;  1YME A;  4QB9 A;  1S60 A;  2QYV A;  3QWZ A;  1DE4 C;  4HNX B;  1IYL A;  4B11 A;  1Y1W A;  2DPT A;  4AON B;  2ZED A;  1KUX A;  3GKR A;  1P0H A;  3DGV A;  4CRY G;  2ZEL A;  3I9S A;  5C88 A;  1XEB A;  2VUM A;  2BE5 D;  1A2Z A;  2GLJ A;  4MMO A;  3B7I A;  5THW A;  2NYQ A;  5GLF A;  1TWG A;  3CPX A;  4XNH B;  3F8K A;  1AYE A;  3VAR A;  4CAX A;  2OU2 A;  1BO4 A;  2PJ3 A;  3PBE A;  5ELY A;  5JM6 A;  1ON0 A;  4MFP A;  4P44 A;  4BD9 A;  4JXQ A;  3D66 A;  1WLF A;  3SXO A;  3BHX A;  3QQ8 A;  4XPK A;  3OUG A;  4OC0 A;  4KLN A;  2EUI A;  3X2N A;  4C2M A;  3WAB A;  4ONU A;  2ZW7 A;  4RS2 A;  1MJ9 A;  3KR4 A;  4YU9 A;  2V45 A;  1YNN D;  2PNW A;  2Y0S A;  5DYG A;  1X10 A;  2PRB A;  3TOB A;  2KQA A;  2I00 A;  3ISZ A;  2PQ8 A;  1Y4Z A;  4AAY A;  1F2P A;  2JIM A;  2CTC A;  5KTC A;  4OC3 A;  4FG4 A;  1NMT A;  2YNC A;  3R1K A;  4GM5 A;  4QC6 A;  3CXP A;  4HNW B;  4DYO A;  4EME A;  2J9A A;  4CS0 B;  1JQG A;  4U9Y A;  3EFA A;  4IAV A;  5DYI A;  1V0C A;  4CRY B;  2EVN A;  5J1Q A;  1LAM A;  4MHY A;  1KQG A;  3FBU A;  4R8F A;  1OBR A;  2B3U A;  5AG6 A;  1F2O A;  4RN7 A;  2R7H A;  3TIW A;  4ZX9 A;  2R7Z A;  3LMS A;  1GYT A;  2GFQ A;  4NGS A;  4AB7 A;  4CAV A;  4FD6 A;  2EWB A;  2REE A;  4CGM A;  2BEI A;  3TM7 B;  4PQA A;  4KLV A;  5GLY A;  4UCN A;  4KO8 A;  2X7B A;  1PT1 A;  2DMR A;  1L8F A;  1EU1 A;  1CP6 A;  1VHE A;  4NGN A;  1CG2 A;  4A30 A;  5IV0 A;  4KVM E;  2AE0 X;  2AJ6 A;  1M4D A;  2ZEM A;  3B35 A;  4CYQ A;  1UHD A;  3X2K A;  4M6H A;  4F8Z A;  1I50 A;  2CIJ A;  4MCS A;  3GTL A;  4B5O A;  2FXF A;  4KOT A;  1TWC A;  5C1B A;  2DEA A;  3SUL A;  4AVA A;  4X8I A;  1PCA A;  4UIA A;  3B3W A;  5C82 A;  1YX0 A;  4ZX8 A;  5LRK A;  2Z10 A;  2JA6 A;  1AMP A;  2VI7 A;  3SJG A;  1R57 A;  2NYA A;  4AZD A;  1FY7 A;  2Q51 A;  4B5P A;  4P4J A;  4JYW A;  1S7F A;  3LOD A;  4R57 A;  3FVL A;  2Q7S A;  4OLL A;  3IR6 A;  2Z3O A;  2FVG A;  4F0Y A;  3BXM A;  5LRG A;  4CAE A;  4CPA A;  2E2H A;  1PQE A;  4FBE A;  3MGD A;  4RUH A;  4MHN A;  1X12 A;  2GRE A;  4GS4 A;  4MFZ A;  3TTH A;  2I3C A;  1K83 A;  1YW4 A;  4A33 A;  2BO9 A;  1ZG7 A;  4KOV A;  4UFX A;  1ZC1 A;  5LRJ A;  5F09 A;  5JPH A;  1DTD A;  2J8M A;  3GTM A;  3IWW A;  2NMT A;  1TKJ A;  5EC4 A;  3VH9 A;  3NH8 A;  4ZM7 A;  2Q4V A;  2PJA A;  3FH4 A;  3PB4 X;  3PFE A;  5GCN A;  4AOK B;  2PI8 A;  2PIC A;  1M44 A;  1R43 A;  5HH1 A;  2NAP A;  3X2P A;  1BW4 A;  1YQE A;  2PJ9 A;  3B3V A;  4KZT A;  4NGM A;  4OC5 A;  1ZG8 A;  4B14 A;  4FFT A;  4L89 A;  5LYL A;  2OZU A;  1IGB A;  1TF8 A;  4OID A;  4D7Z B;  4AVR A;  4H2K A;  2Q4Y A;  2REF A;  4KSF A;  1TWH A;  4E2A A;  2VPZ A;  1M1D A;  2O4H A;  4IHM A;  4IUS A;  1IID A;  3SJF A;  5DWN A;  4OC1 A;  4K30 A;  2J8R A;  1YGH A;  3S6G A;  1Z5R A;  3R95 A;  3IU1 A;  4JLY A;  3KAS A;  2HCZ X;  4B13 A;  4HKF A;  5G20 A;  3KHZ A;  2D4O A;  4UFV A;  5EBV A;  2G0B A;  5AGE A;  4ZY0 A;  1HDQ A;  7CPA A;  3KQX A;  4II9 A;  1G8K A;  1XF8 A;  3D8P A;  3KQZ A;  4ONW A;  3PRT A;  2ZEH A;  4B10 A;  4K3N A;  5A28 A;  2G9D A;  3RYO A;  4AG9 A;  4CRZ A;  1HDU A;  1Y9W A;  3WC6 A;  1S5K A;  3GB0 A;  3BLN A;  4BBH A;  1PUA A;  4CGN A;  3X2I A;  1CPX A;  1LFW A;  2ZW6 A;  1I12 A;  3K9U A;  3W6X A;  5CPA A;  3UY5 A;  2V3V A;  5LYF A;  2VQY A;  2EK9 A;  3BI1 A;  2QVP A;  4FD5 A;  2C27 A;  4ZI6 A;  2WAQ A;  1F57 A;  3S9L A;  4U9Z A;  2P6F A;  3BJ8 A;  2ZPA A;  1IB1 E;  4KVO E;  1MJB A;  1ZLH A;  3TO7 A;  1YLE A;  3FF3 A;  3K9T A;  4CAW A;  3S6K A;  5I4M A;  2PJ4 A;  1QCS A;  1CZ4 A;  4JJO A;  2F7V A;  3D7F A;  2JDD A;  2PIZ A;  3EO4 A;  3IIB A;  3SUM A;  3FIX A;  3CZB A;  2XEF A;  3HLP A;  2VPY A;  3ISX A;  4LQG A;  5AG7 A;  1KUY A;  1I3Q A;  4B12 A;  4F6A A;  2FE7 A;  1RXT A;  2FSR A;  1KQF A;  1NSL A;  5LYD A;  4A37 A;  3PLX B;  5GLX A;  3CQZ A;  2PJ6 A;  3TO9 A;  5KTD A;  2C1C A;  2NVX A;  3PGP A;  2PJ5 A;  2PC1 A;  4Q38 A;  1Y7E A;  4KOR A;  4UEF A;  1FT7 A;  1PYU B;  3FNC A;  4KOX A;  2KI8 A;  3TE4 A;  2IMO A;  4KLW A;  3FJU A;  4G1P A;  4NF1 A;  3TT2 A;  3W91 A;  3ML1 A;  2DPS A;  2EK8 A;  4NXY A;  4MY3 A;  3FXT A;  2WPX A;  4P4I A;  2ZEP A;  5FTL A;  4H6Z A;  2JBK A;  4WJB A;  1CBX A;  2ZOF A;  3RNZ A;  4PXD A;  3QAH A;  2PVW A;  3JRU A;  2Q04 A;  1QSO A;  4CYN A;  3X2M A;  2Z3P A;  4MCP A;  2C45 A;  3KL9 A;  4C7I A;  2YNC C;  5H4U A;  2G3A A;  3EXN A;  2H5M A;  3D67 A;  1BLL E;  1LAN A;  1OA7 A;  4X3R A;  4CS0 A;  2BSW A;  2AFW A;  3DR8 A;  4YWY A;  5D29 A;  4GA6 A;  1ARL A;  4X5K A;  4P4F A;  2VEZ A;  2EBJ A;  3D30 A;  1S7K A;  4KOW A;  1IY7 A;  1OZP A;  1KWM A;  3P2H A;  3FB3 A;  3KI9 A;  4A95 A;  3BI0 A;  4YGO A;  5IB0 A;  2JIO A;  4DMR A;  1CPS A;  2FIW A;  4NGR A;  4PK2 A;  3T9Y A;  4ENG A;  1TIQ A;  3LAC A;  4CGO A;  3FED A;  2OZH A;  3NH4 A;  3KZW A;  3SI0 A;  1SQH A;  2ANP A;  4QIW A;  1BPM A;  1FNO A;  2ZEE A;  4H89 A;  4H6U A;  4XPD B;  2PJB A;  2CNT A;  4MFL A;  3TOA A;  5K8M A;  5GM9 A;  2B4B A;  2GE3 A;  2PR8 A;  2B3V A;  4AVB A;  3CF2 A;  4ZY2 A;  4NGQ A;  1HD5 A;  4QBJ A;  4IF5 A;  1VIX A;  2C6G A;  4CRZ B;  2V8H A;  3NE7 A;  2A6E D;  2R93 A;  3LWU A;  1XRY A;  1Y5I A;  2DF5 A;  5F46 A;  5K8O A;  2YU9 A;  3NE8 A;  1H8L A;  3G3S A;  2BCO A;  2PJH B;  3W6S A;  1CM0 A;  1YRE A;  3QQ7 A;  1WWZ A;  1Y1V A;  4R9M A;  4BMH A;  1PPY A;  1QMU A;  5BWA B;  3KKW A;  1E18 A;  3KGQ A;  3P2F A;  2A4N A;  5EPP A;  3CT9 A;  2ZEF A;  5K8P A;  1FDO A;  3IR5 A;  1XIX A;  1TKH A;  4MBU A;  1JWQ A;  2O5J D;  3GIU A;  2IQ6 A;  3K2K A;  4JWP A;  4J3G A;  3TO6 A;  1M4L A;  4PV6 A;  1E5V A;  1Y0Y A;  2IL4 A;  2HV2 A;  3CXQ A;  3PZJ A;  3CDX A;  5K8N A;  5FTM A;  4NGT A;  4UIB A;  1Q2Y A;  4MFJ A;  4OIW A;  5LYI A;  3GTQ A;  1TKF A;  5HMN A;  2Q44 A;  4PSX A;  2WSA A;  4PXB A;  3VWD A;  4C2X A;  3HKZ A;  5E96 A;  1S3S A;  2B63 A;  2FS5 A;  1ZO0 A;  2JEV A;  4IK2 A;  4L8A A;  2ATR A;  2IJZ A;  2R92 A;  1YVK A;  1DMR A;  2O53 A;  4OME A;  4UFW A;  3SHP A;  5B6C A;  1SFO A;  3EC4 A;  3TCV A;  2G3T A;  3D7D A;  4EFD A;  2KCW A;  5KTA A;  1FDI A;  5CNP A;  4MJ8 A;  5HVG A;  3IR7 A;  2JIQ A;  1IOF A;  1ELL P;  3PB8 X;  2AFS A;  3NFZ A;  3HUV A;  1B87 A;  2PRQ A;  2XEI A;  1U6M A;  3DMR A;  5T5M D;  2Q43 A;  3D68 A;  1HEE A;  3H4Q A;  4Q36 A;  5F48 A;  1SIW A;  3EY5 A;  1TWA A;  3FX6 A;  3I1U A;  4QVT A;  3DLJ A;  4MRI A;  4R3L A;  5G21 A;  3R96 A;  4NJQ A;  3V38 A;  3WC7 A;  4KUA A;  3QC8 A;  1VHS A;  3C26 A;  4UCP A;  4DUK A;  1CR5 A;  4FER A;  4AYB A;  2R8V A;  4MFK A;  3VAT A;  3RAM A;  4M6I A;  4RV0 A;  4F9U A;  3X2G A;  1ZLI A;  4KOY A;  2Y0M A;  4E8O A;  3F0A A;  3QB8 A;  2CY2 A;  1R3N A;  1Z9U A;  1YR0 A;  4PSW A;  4B6Z A;  5A27 A;  5F47 A;  4CAF A;  3HU1 A;  4YFJ A;  3GY9 A;  4P4B A;  4FD7 A;  4UF4 A;  5JH9 A;  4A32 A;  2A69 D;  1R9T A;  1NE9 A;  1YVO A;  2AFU A;  2OZG A;  2ZEG A;  3QAY A;  2VPW A;  3ENG A;  4R6T A;  5G22 A;  1H5N A;  4YRH A;  1I21 A;  4AXV A;  4ZY1 A;  2FT0 A;  4ZYQ A;  3PFO A;  3WR7 A;  4DJL A;  2Z3N A;  4NOH A;  1M4G A;  8CPA A;  3KR5 A;  2JLM A;  2WPW A;  5DS0 A;  1QSR A;  4XPD C;  3SUK A;  5IB9 A;  4JZ0 A;  1CP7 A;  1R27 A;  2CTB A;  4R7M A;  1Q16 A;  4AG7 A;  3HU2 A;  4KSI A;  4F0X A;  1MK4 A;  4TWE A;  2ZOG A;  3N7Z A;  2JEW A;  3GTK A;  1XBU A;  4UBR A;  3SJX A;  3SXN A;  4CGP A;  4M6G A;  2FL4 A;  5DWM A;  2Q7B A;  1WC2 A;  3D3S A;  4KVX A;  2B4D B;  4MCR A;  3M3G A;  2HUZ A;  1WK4 A;  3JTK A;  4KUB A;  2YNE A;  2NVY A;  2R98 A;  1IOI A;  2HB6 A;  5ISV A;  2NSM A;  4XNH C;  1QST A;  4PXC A;  4A2Z A;  2E2I A;  4KDL A;  4AVC A;  3G8W A;  2PJ0 A;  4UCM A;  3D7G A;  3CXS A;  4JP6 A;  4GXH A;  3WT4 A;  4MFQ A;  2BUE A;  2E7Z A;  4JCW A;  3GTJ A;  3V8I A;  4OC4 A;  2QJ8 A;  2GAE A;  2RFH A;  3MN8 A;  3R9F A;  2K5T A;  1XFO A;  1QDN A;  2EO8 A;  1Y7R A;  2Q0Y A;  3D2P A;  1Y9K A;  1YK3 A;  4JP7 A;  1I1D A;  3B3C A;  2AFX A;  2XEJ A;  1K4J A;  2PJ7 A;  3D7H A;  4KOS A;  4E0A A;  4I49 A;  4JJX A;  1P4N A;  3A9L A;  4UA3 A;  3S9M A;  5J8C A;  4UEE A;  4NJR A;  1UWY A;  1ELM P;  4ORF A;  1E60 A;  2CXA A;  1E32 A;  2CW0 D;  2ZW4 A;  4NEX A;  2VZY A;  3IWE A;  2WYR A;  3DDD A;  1S7N A;  3FEC A;  3FMC A;  1WCM A;  4C7H A;  4HNY B;  2I79 A;  2EEO B;  2GU2 A;  2G5D A;  1XJO A;  4PXE A;  2PVV A;  2RC4 A;  5EMI A;  4LUA A;  1N71 A;  1VKC A;  1PU9 A;  1ZYR D;  2ABZ A;  5I0C A;  2PIY A;  4A94 A;  1J4J A;  1XMT A;  3R9E A;  2ODF A;  3IU2 A;  3KHX A;  1YNJ D;  3IWG A;  1YLO A;  2JA5 A;  2O28 A;  3FYN A;  3IEH A;  2WUU A;  1PQH A;  4X2T A;  2JIP A;  4OAD A;  4NGP A;  2Q4Z A;  2PJ8 A;  2ENG A;  1UHE A;  4FG2 A;  2HQY A;  3DNS A;  1IIC A;  2P6E A;  3ZZI A;  2Z0Z A;  2A6H D;  1S7L A;  1QQ9 A;  2PR1 A;  3N5F A;  4FAI A;  1QSM A;  4KS9 A;  4PK3 A;  2GAN A;  1CZ5 A;  1DMS A;  1NSA A;  1B6B A;  1Z4R A;  2VBQ A;  3PP9 A;  5G1Z A;  3H8E A;  2AFZ A;  4UWJ A;  4P4D A;  4P45 A;  2RB7 A;  2V8D A;  2Z3K A;  4KDI A;  1Z4E A;  5HXD A;  3LD2 A;  1E61 A;  4LX9 A;  4M3S A;  4MHZ A;  1YW6 A;  4TNU A;  4EVY A;  2DXQ A;  1TWF A;  3ZJ0 A;  4UEZ A;  2P6G A;  3SJE A;  1XOV A;  4NCZ A;  4F9V A;  3S6F A;  1VHO A;  4CYO A;  5CBM A;  1RTQ A;  1BOB A;  1Z8W A;  3D4U A;  4R76 A;  3JVN A;  3SI2 A;  1LAP A;  3TX8 A;  3NA6 A;  3PEI A;  3SI1 A;  3GTG A;  1TF9 A;  3H0G A;  4MCQ A;  5JGF A;  4HPS A;  3I3G A;  4Y49 C;  1IW7 D;  1TMO A;  3PB7 X;  1BAV A;  2PJ2 A;  2PCU A;  3X2L A;  3T8W A;  2OB0 A;  2JA7 A;  4Q7A A;  2ZEO A;  2GLF A;  4EWT A;  1AW8 B;  3PBB A;  5T5I D;  2C6P A;  1Q2C A;  2PE3 A; 
#chains in the Genus database with same CATH homology
 1GHE A;  1RO5 A;  2CNS A;  2BL1 A;  4FD4 A;  4MY0 A;  5J8F A;  3OWC A;  1LRZ A;  2F5I A;  3GTP A;  3JUW A;  1L0C A;  2ARH A;  2AE6 A;  4JXR A;  3T90 A;  2VZZ A;  5FVJ A;  4C2Z A;  2YUJ A;  1QSN A;  4A31 A;  2Z3M A;  2CNM A;  3HU3 A;  4JD6 A;  4KSA A;  5F49 A;  3B8G A;  4R87 A;  1CJW A;  3R9G A;  1AA6 A;  2WB1 A;  1PYQ A;  2YGW A;  5FTK A;  2FCK A;  1G8J A;  4MI4 A;  5AG4 A;  2B5G A;  2PJJ A;  2YND A;  3TFY A;  1SMY D;  5IX3 A;  2G6G A;  1VC3 B;  1R7R A;  3S6H A;  1UFH A;  3E0K A;  4CYP A;  1MJA A;  4GA5 A;  5FTJ A;  1M4I A;  4ZBG A;  5C18 A;  5FTN A;  3GYA A;  1KUV A;  4KOU A;  4OAE A;  2JDC A;  4B5P B;  3FKI A;  1OGY A;  2PMZ A;  2PDO A;  2Z11 A;  1XE4 A;  4CGL A;  2Z3L A;  2B58 A;  2A68 D;  4U5Y A;  1PQF A;  4R3K A;  3IGR A;  2PSW A;  3DSB A;  3GTO A;  4NSQ A;  2QEC A;  2GIV A;  4KOD A;  2JIR A;  4DNC A;  2D4P A;  1PT0 A;  2VXK A;  4QUS A;  3VWE A;  4ZGY B;  2R1I A;  2QML A;  3H5Z A;  4RI1 A;  2ZW5 A;  5JQ4 A;  1H0H A;  2OH1 A;  3F5B A;  3FRM A;  3D2M A;  4MHD A;  2ZXV A;  3DR6 A;  4M85 A;  4UWI A;  4XPL A;  2VPX A;  2B5G B;  2QIR A;  3BJ7 A;  2P0W A;  1KZF A;  5H84 A;  2B4D A;  2J8N A;  1IYK A;  5AG5 A;  1S3Z A;  2IV2 X;  2FIA A;  4Y49 B;  3O5A A;  1Q2D A;  4QB9 A;  1S60 A;  3QWZ A;  4HNX B;  1IYL A;  4B11 A;  1Y1W A;  2DPT A;  4AON B;  1KUX A;  3GKR A;  1P0H A;  4CRY G;  3I9S A;  5C88 A;  1XEB A;  2VUM A;  2BE5 D;  5GLF A;  1TWG A;  4XNH B;  3F8K A;  4CAX A;  2OU2 A;  1BO4 A;  1ON0 A;  4MFP A;  4JXQ A;  1WLF A;  3SXO A;  3QQ8 A;  4XPK A;  3OUG A;  4KLN A;  2EUI A;  4C2M A;  4ONU A;  2ZW7 A;  4RS2 A;  1MJ9 A;  5H86 A;  2V45 A;  1YNN D;  2PNW A;  2Y0S A;  5DYG A;  2PRB A;  3TOB A;  2I00 A;  2PQ8 A;  1Y4Z A;  4AAY A;  2JIM A;  5KTC A;  1NMT A;  3R1K A;  2YNC A;  4QC6 A;  3CXP A;  4HNW B;  4CS0 B;  4U9Y A;  3EFA A;  5DYI A;  1V0C A;  4CRY B;  2EVN A;  1KQG A;  3FBU A;  2B3U A;  5AG6 A;  2R7H A;  3TIW A;  2R7Z A;  4AB7 A;  4CAV A;  4FD6 A;  2REE A;  4CGM A;  2BEI A;  3TM7 B;  4KLV A;  4UCN A;  4KO8 A;  2X7B A;  1PT1 A;  2DMR A;  1EU1 A;  4A30 A;  5IV0 A;  2AE0 X;  2AJ6 A;  1M4D A;  4CYQ A;  1UHD A;  1I50 A;  3GTL A;  4B5O A;  2FXF A;  4KOT A;  1TWC A;  5C1B A;  4AVA A;  1YX0 A;  2Z10 A;  2JA6 A;  2VI7 A;  1R57 A;  2NYA A;  4AZD A;  1FY7 A;  4B5P A;  1S7F A;  3LOD A;  4R57 A;  4OLL A;  3IR6 A;  2Z3O A;  4F0Y A;  4CAE A;  2E2H A;  1PQE A;  3MGD A;  4MFZ A;  4GS4 A;  3TTH A;  1K83 A;  4A33 A;  4KOV A;  4UFX A;  1ZC1 A;  5JPH A;  2J8M A;  3GTM A;  2NMT A;  5EC4 A;  5C82 A;  2Q4V A;  5GCN A;  4AOK B;  2PI8 A;  2PIC A;  1M44 A;  5HH1 A;  2NAP A;  4KZT A;  4B14 A;  4L89 A;  2OZU A;  4D7Z B;  2Q4Y A;  2REF A;  4KSF A;  1TWH A;  4E2A A;  2VPZ A;  1M1D A;  4IUS A;  1IID A;  5DWN A;  4K30 A;  2J8R A;  1YGH A;  3S6G A;  3R95 A;  3IU1 A;  4JLY A;  4B13 A;  4HKF A;  5G20 A;  4UFV A;  2D4O A;  5EBV A;  2G0B A;  5AGE A;  4II9 A;  1G8K A;  1XF8 A;  3D8P A;  4B10 A;  5A28 A;  3RYO A;  4AG9 A;  4CRZ A;  1Y9W A;  1S5K A;  4BBH A;  3BLN A;  4CGN A;  1PUA A;  2ZW6 A;  3W6X A;  1I12 A;  3K9U A;  3UY5 A;  2V3V A;  2VQY A;  4FD5 A;  2C27 A;  2WAQ A;  4U9Z A;  2P6F A;  3BJ8 A;  2ZPA A;  1IB1 E;  4KVO E;  1MJB A;  3TO7 A;  4CAW A;  1YLE A;  3S6K A;  1QCS A;  1CZ4 A;  4KVM E;  2JDD A;  3EO4 A;  5J8C A;  5KTD A;  3FIX A;  3CZB A;  4F6A A;  2VPY A;  5AG7 A;  1KUY A;  1I3Q A;  4B12 A;  2FE7 A;  1RXT A;  2FSR A;  1KQF A;  1NSL A;  3PLX B;  3CQZ A;  3TO9 A;  2NVX A;  3PGP A;  4Q38 A;  2PC1 A;  4KOR A;  1PYU B;  3FNC A;  4KOX A;  2KI8 A;  3TE4 A;  4KLW A;  3W91 A;  4NF1 A;  3TT2 A;  3ML1 A;  2DPS A;  4NXY A;  4MY3 A;  3FXT A;  2WPX A;  5FTL A;  4H6Z A;  3QAH A;  2Q04 A;  1QSO A;  4CYN A;  2Z3P A;  2C45 A;  4C7I A;  2YNC C;  2G3A A;  3EXN A;  2H5M A;  4C2Y A;  4CS0 A;  2BSW A;  3DR8 A;  4GA6 A;  4X5K A;  2VEZ A;  1S7K A;  4KOW A;  1OZP A;  3P2H A;  3FB3 A;  4A95 A;  4YGO A;  5IB0 A;  2JIO A;  4DMR A;  2FIW A;  4PK2 A;  3T9Y A;  1TIQ A;  4CGO A;  2OZH A;  1SQH A;  4QIW A;  4H6U A;  4H89 A;  4XPD B;  4MFL A;  2CNT A;  3TOA A;  2B4B A;  2GE3 A;  2PR8 A;  2B3V A;  4AVB A;  3CF2 A;  4QBJ A;  4IF5 A;  4CRZ B;  3NE7 A;  2A6E D;  2R93 A;  1Y5I A;  5F46 A;  2YU9 A;  3G3S A;  2PJH B;  3W6S A;  1CM0 A;  1YRE A;  3QQ7 A;  1WWZ A;  1Y1V A;  4R9M A;  4BMH A;  1PPY A;  5BWA B;  3KKW A;  1E18 A;  3P2F A;  2A4N A;  5EPP A;  1FDO A;  3IR5 A;  1XIX A;  4MBU A;  3TO6 A;  2O5J D;  4JWP A;  4J3G A;  4PV6 A;  1E5V A;  2IL4 A;  2HV2 A;  3CXQ A;  3PZJ A;  5FTM A;  1Q2Y A;  4MFJ A;  5HMN A;  3GTQ A;  2Q44 A;  4PSX A;  2WSA A;  3VWD A;  4C2X A;  3HKZ A;  5E96 A;  1S3S A;  2B63 A;  2FS5 A;  1ZO0 A;  2JEV A;  4L8A A;  2ATR A;  2R92 A;  1YVK A;  1DMR A;  4UFW A;  3SHP A;  5B6C A;  1SFO A;  3EC4 A;  3TCV A;  2G3T A;  5KTA A;  2KCW A;  1FDI A;  5CNP A;  4MJ8 A;  3IR7 A;  2JIQ A;  1B87 A;  4C68 A;  1U6M A;  3DMR A;  5T5M D;  5F48 A;  3H4Q A;  4Q36 A;  1SIW A;  3EY5 A;  1TWA A;  4QVT A;  4R3L A;  5G21 A;  3R96 A;  4KUA A;  3QC8 A;  1VHS A;  3C26 A;  4UCP A;  1CR5 A;  4AYB A;  2R8V A;  4MFK A;  4RV0 A;  4KOY A;  2Y0M A;  4E8O A;  3F0A A;  3QB8 A;  2CY2 A;  1Z9U A;  4PSW A;  1YR0 A;  5A27 A;  5F47 A;  4CAF A;  3HU1 A;  4YFJ A;  3GY9 A;  4FD7 A;  4A32 A;  2A69 D;  1R9T A;  1NE9 A;  1YVO A;  2OZG A;  5G22 A;  2VPW A;  1H5N A;  4YRH A;  1I21 A;  2FT0 A;  3WR7 A;  2Z3N A;  4NOH A;  1M4G A;  2JLM A;  2WPW A;  1QSR A;  4XPD C;  1R27 A;  1Q16 A;  4AG7 A;  3HU2 A;  4F0X A;  1MK4 A;  3N7Z A;  3SXN A;  3GTK A;  4CGP A;  4UBR A;  2FL4 A;  5DWM A;  2Q7B A;  3D3S A;  4KVX A;  2B4D B;  3JTK A;  2HUZ A;  1WK4 A;  4KUB A;  5ISV A;  2YNE A;  2NVY A;  2R98 A;  4XNH C;  1QST A;  4A2Z A;  2E2I A;  4KDL A;  4AVC A;  3G8W A;  4UCM A;  3CXS A;  4MFQ A;  2BUE A;  2E7Z A;  3GTJ A;  3V8I A;  2GAE A;  3R9F A;  2K5T A;  1QDN A;  1Y7R A;  2Q0Y A;  3D2P A;  1Y9K A;  1YK3 A;  1I1D A;  1K4J A;  4KOS A;  4E0A A;  4I49 A;  4JJX A;  1P4N A;  3A9L A;  4UA3 A;  4ORF A;  1E60 A;  2CXA A;  1E32 A;  2CW0 D;  2ZW4 A;  4NEX A;  2VZY A;  3IWE A;  3DDD A;  1S7N A;  1WCM A;  4C7H A;  4HNY B;  2I79 A;  2EEO B;  2G5D A;  2RC4 A;  4LUA A;  1N71 A;  1VKC A;  1PU9 A;  1ZYR D;  5I0C A;  1J4J A;  1XMT A;  3R9E A;  3IU2 A;  1YNJ D;  3IWG A;  2JA5 A;  2O28 A;  3FYN A;  2WUU A;  1PQH A;  2JIP A;  4OAD A;  1UHE A;  2HQY A;  3DNS A;  1IIC A;  2P6E A;  3ZZI A;  2Z0Z A;  2A6H D;  1S7L A;  2PR1 A;  1QSM A;  4KS9 A;  4PK3 A;  2GAN A;  1CZ5 A;  1DMS A;  1Z4R A;  1B6B A;  3PP9 A;  2VBQ A;  5G1Z A;  4UWJ A;  2Z3K A;  4KDI A;  1Z4E A;  3LD2 A;  1E61 A;  4LX9 A;  4M3S A;  4EVY A;  2DXQ A;  1TWF A;  3ZJ0 A;  2P6G A;  4NCZ A;  3S6F A;  4CYO A;  1BOB A;  3JVN A;  3GTG A;  3H0G A;  3I3G A;  4Y49 C;  1IW7 D;  1TMO A;  2OB0 A;  2JA7 A;  1AW8 B;  5T5I D;  1Q2C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...