1YLEA

The structure of arginine/ornithine succinyltransferase subunit ai from pseudomonas aeruginosa.
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
342
structure length
330
Chain Sequence
GHMLVMRPAQAADLPQVQRLAADSPVGVTSLPDDAERLRDKILASEASFAAEVSYNGEESYFFVLEDSASGELVGCSAIVASAGFSEPFYSFRNETFVHASRSLSIHNKIHVLSLCHDLTGNSLLTSFYVQRDLVQSVYAELNSRGRLLFMASHPERFADAVVVEIVGYSDEQGESPFWNAVGRNFFDLNYIEAEKLSGLKHYPIYVPLLPDAAQESMGQVHPRAQITFDILMREGFETDNYIDIFDGGPTLHARTSGIRSIAQSRVVPVKIGEKSGRPYLVTNGQLQDFRAVVLDLDWAPGKPVALSVEAAEALGVGEGASVRLVAVGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of arginine/ornithine succinyltransferase subunit AI from Pseudomonas aeruginosa.
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
molecule keywords Arginine N-succinyltransferase, alpha chain
total genus 93
structure length 330
sequence length 342
ec nomenclature ec 2.3.1.109: Arginine N-succinyltransferase.
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04958 AstA Arginine N-succinyltransferase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1yleA02
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1yleA01
1GHEA 4NSQA 1BOBA 3R95A 4CS0A 1P4NA 1K4JA 1E32A 4KOUA 2H5MA 3CXQA 1PYQA 4C2MA 4U9YA 2JLMA 2PR8A 2Q04A 1TWAA 5IV0A 4R3KA 2VEZA 2PMZA 4L89A 5IX3A 2G0BA 4L8AA 4PV6A 3CQZA 1E61A 4UWJA 2Y0SA 1UHDA 1ON0A 1XE4A 3GTKA 1U6MA 3S6FA 1M44A 1XEBA 1M4DA 1S7LA 3TOBA 1TMOA 2D4PA 2IL4A 1PPYA 2VZZA 4KVME 4NXYA 4ONUA 4AB7A 5EPPA 5FTNA 3SXNA 3DDDA 2J8RA 4GA5A 3B8GA 1Z4EA 3SHPA 2PSWA 1PT1A 3GTLA 1I3QA 4ZBGA 5F46A 3GTPA 4HKFA 3WR7A 4AVAA 2PJHB 2ZW4A 2V45A 3D2MA 4H6ZA 3QWZA 4II9A 1E60A 2V3VA 1Y9WA 1PT0A 4XNHB 2R93A 1YGHA 2CY2A 5H86A 1NE9A 3VWDA 2JEVA 4AVCA 4NF1A 1B6BA 5C88A 1YREA 2Z10A 3S6GA 1I50A 3DSBA 1PUAA 3HU2A 4JLYA 4NEXA 3F0AA 3GTQA 1QSRA 2C27A 2ZXVA 5CNPA 4B5PB 4CAWA 2FCKA 3NE7A 2B4DB 3FB3A 1R27A 4I49A 1AW8B 2JIRA 5C82A 5I0CA 5ISVA 4AVBA 1G8JA 4J3GA 3QC8A 2FSRA 1QSOA 1TIQA 3TE4A 4CRZA 1YLEA 1VHSA 1XF8A 4K30A 4QC6A 3ZZIA 3P2FA 2NAPA 1Y1WA 3PLXB 5DYGA 3TO7A 3S6KA 3FNCA 2ZW7A 4D7ZB 1Y1VA 2WB1A 1J4JA 2D4OA 5DWMA 4FD6A 4JWPA 1FY7A 4PSWA 3TTHA 2J8NA 3R96A 3ML1A 2ZPAA 5T5ID 3UY5A 1AA6A 3E0KA 2KCWA 2O28A 1TWHA 1FDOA 4HNYB 3F5BA 4E2AA 3HKZA 4PSXA 2QIRA 2QECA 2WPXA 4YFJA 3CF2A 1I12A 2OB0A 2B4BA 5GCNA 3R9FA 4ORFA 4UA3A 5FVJA 4Y49C 2NVXA 3S6HA 2WAQA 1IYLA 1S60A 3MGDA 3BJ8A 4DMRA 2WPWA 1IYKA 2E2IA 1P0HA 5T5MD 1WWZA 3QQ8A 2VBQA 2R98A 1TWGA 1PQEA 2P0WA 1SIWA 1PQFA 3DMRA 4M85A 2BUEA 3T9YA 4B5OA 1I21A 1VKCA 1YX0A 1IB1E 1OZPA 4KVOE 3TT2A 2IV2X 4QBJA 2PC1A 4XPKA 3T90A 4AOKB 3FIXA 4NCZA 1Q2DA 3OWCA 4E0AA 3PP9A 3G3SA 1E18A 1QSTA 4JXQA 2Y0MA 5F48A 5DYIA 4CRYG 3P2HA 2AE6A 3IGRA 2HV2A 2REFA 4B5PA 2JA5A 1Y7RA 2ATRA 1I1DA 5H84A 2B4DA 2B63A 1NMTA 5KTCA 1PQHA 4YRHA 4KZTA 4AG9A 2OU2A 3W91A 1N71A 2PQ8A 3D3SA 4CRZB 3CXPA 3EO4A 3HU1A 2AJ6A 1DMRA 4GS4A 1WLFA 1WCMA 1CZ5A 1XMTA 1QSNA 4R3LA 5B6CA 5F47A 2JIPA 4QVTA 3QB8A 4R57A 2ZW5A 2VPYA 3GTMA 3H4QA 1EU1A 2REEA 2CNSA 2FT0A 1YR0A 4QIWA 2OH1A 2JDDA 4KLVA 2P6GA 1FDIA 1CZ4A 4PK2A 4F0YA 5JQ4A 1TWFA 3TCVA 1M1DA 4XNHC 5FTMA 3TM7B 2B3UA 3QQ7A 5JPHA 2FIWA 3R1KA 4H89A 4JXRA 5C18A 4KOTA 2JIOA 3KKWA 1KUVA 2B3VA 2EVNA 1NSLA 4UBRA 3IR6A 4F6AA 2VXKA 2JDCA 4EVYA 2Q44A 2JA7A 4IF5A 2GIVA 2ARHA 4OADA 1OGYA 4KOWA 1Y4ZA 1V0CA 5F49A 1IW7D 2P6FA 4KOYA 2KI8A 4YGOA 1CJWA 2Q7BA 1S3ZA 1LRZA 1KQGA 3W6SA 1Q2YA 1H5NA 1S3SA 1RO5A 4MJ8A 3K9UA 1WK4A 3C26A 3PZJA 3TFYA 4U5YA 5J8FA 4DNCA 5DWNA 5HH1A 4R9MA 2R8VA 1CM0A 4OAEA 4XPLA 3BJ7A 3I3GA 2ZW6A 1KUXA 3LD2A 1S7NA 3IR7A 4KOVA 3RYOA 4GA6A 1KZFA 3V8IA 4HNWB 3DR6A 3GY9A 1Q2CA 3I9SA 2VPWA 2VPXA 1XIXA 1E5VA 2FL4A 5E96A 2RC4A 2G3AA 2R7HA 4JJXA 5J8CA 2JIMA 4AZDA 2P6EA 4IUSA 3EFAA 3EY5A 4OLLA 2JA6A 5FTJA 4FD4A 4CRYB 1MJ9A 3GTOA 2OZGA 1MJAA 2VI7A 2PDOA 1Q16A 4FD5A 3LODA 4XPDC 4AONB 4FD7A 4KUBA 2FIAA 4HNXB 4JD6A 5HMNA 2Q0YA 4U9ZA 2OZUA 3GYAA 2Z0ZA 2DXQA 2B5GB 3QAHA 2BSWA 3JVNA 3PGPA 5FTLA 1IICA 1MJBA 2B58A 3CXSA 2X7BA 3DR8A 2Z11A 1Z4RA 3GTJA 2CNTA 3JUWA 4RV0A 3FBUA 3D2PA 1B87A 3OUGA 5GLFA 1Z9UA 2NVYA 2VQYA 2Q4VA 1M4GA 2FXFA 2G3TA 4KUAA 4XPDB 3G8WA 4E8OA 1MK4A 2J8MA 4KDIA 1S7KA 1M4IA 2GANA 4LUAA 1IIDA 5IB0A 2E7ZA 4MI4A 2CNMA 4UWIA 3R9GA 1G8KA 3IR5A 2A4NA 3FYNA 4CAXA 2EEOB 4MY0A 1CR5A 4BMHA 2B5GA 1SFOA 3IWGA 1R9TA 2C45A 2BEIA 4AG7A 4H6UA 1R7RA 3F8KA 2HUZA 3GKRA 4AAYA 1PYUB 3D8PA 1BO4A 2JIQA 3TIWA 4KDLA 1YVOA 3FKIA 1S7FA 4MY3A 2PR1A 1VC3B 3GTGA 1UHEA 4CAVA 1YVKA 3SXOA 2VUMA 1UFHA 4QB9A 1K83A 2NMTA 5EBVA 5EC4A 1QSMA 2VZYA 3TOAA 4KLNA 1KUYA 1Y9KA 4KO8A 2PRBA 5C1BA 1KQFA 4KOSA 4KORA 2EUIA 2K5TA 1YK3A 3EC4A 2I79A 2BL1A 4R87A 2E2HA 1TWCA 3R9EA 1R57A 1DMSA 3ZJ0A 4QUSA 3HU3A 3DNSA 2R7ZA 1PU9A 2Q4YA 3FRMA 4CS0B 1QDNA 5KTDA 4MHDA 2NYAA 2DMRA 1RXTA 2GE3A 4KVXA 4M3SA 4LX9A 5FTKA 3TO9A 1QCSA 4RS2A 4X5KA 2R1IA 4AYBA 4RI1A 3EXNA 2OZHA 2VPZA 3N7ZA 3W6XA 4KODA 2FS5A 2FE7A 2I00A 4MBUA 3TO6A 2R92A 1Y5IA 2F5IA 1S5KA 3FXTA 2QMLA 1H0HA 4KLWA 4PK3A 2HQYA 3BLNA 4KOXA 4Y49B 3H0GA 5KTAA 1L0CA 3O5AA 1SQHA 3VWEA 2YU9A
chains in the Genus database with same CATH superfamily
1GHEA 2C6CA 1BOBA 4NSQA 2GREA 1IOIA 4CS0A 1P4NA 4MHYA 3R95A 3VARA 1K4JA 1E32A 4KOUA 4O23A 2H5MA 3CXQA 4MXUA 1CX8A 2GU2A 2HB6A 1PYQA 4C2MA 1YSJA 3JRUA 2Q51A 4U9YA 2JLMA 2PR8A 1BW3A 2Q04A 1TWAA 2XEIA 4ZYQA 5IV0A 4JZ0A 4OMEA 3WABA 1JQGA 4FFTA 4R3KA 2KQAA 5JGFA 4PQAA 2VEZA 2PMZA 4L89A 4PXBA 2YUJA 3X2HA 2CTBA 2G0BA 4L8AA 3PB6X 4B5OA 5IX3A 4ENGA 4ONWA 3PBBA 2EWBA 4PV6A 3CQZA 5G1ZA 3IO1A 5G20A 4X3RA 1E61A 2IJZA 4KSAA 1YW6A 4UWJA 2Y0SA 1LOKA 1UWYA 4EMEA 1ZO0A 1UHDA 2IMOA 1ON0A 4OC0A 1XE4A 3GTKA 1LAPA 1U6MA 1EE3P 2Z3PA 3S6FA 3VH9A 4B12A 1M44A 4JP7A 1XEBA 4MFLA 1M4DA 1S7LA 3L2NA 1TMOA 2D4PA 2IL4A 2Z3OA 4MFPA 4FG2A 3PBEA 1PPYA 2VZZA 4KVME 4NXYA 4F8ZA 4BD9A 3X2IA 2AFWA 4ONUA 3IIBA 4AB7A 5EPPA 5FTNA 1YQEA 3SXNA 3NH4A 3DDDA 4FG4A 2J8RA 4GA5A 2F8HA 1Z4EA 3B8GA 4MFJA 4NJRA 3SHPA 2PSWA 1PT1A 3GTLA 1I3QA 4ZBGA 5F46A 3GTPA 2PIZA 4HKFA 3WR7A 4AVAA 2PJHB 1ELLP 2C6PA 2V45A 2ZW4A 3D2MA 4G1PA 4CAEA 4H6ZA 3QWZA 4II9A 1E60A 5A27A 5CBMA 3RZAA 1TKFA 2V3VA 1BW4A 1IY7A 1Y9WA 4P4DA 3TOBA 4DUKA 1PT0A 4XNHB 2R93A 7CPAA 4MCQA 1YGHA 2CY2A 4C2XA 3X2JA 3IU2A 3KQXA 2AE0X 1NE9A 3B7IA 2JEVA 2GLFA 3N5FA 5G21A 3VWDA 2PJBA 4AVCA 4NF1A 1B6BA 2PJAA 4P4JA 5C88A 1YREA 1XRYA 2Z10A 2C6GA 3S6GA 1I50A 1LAMA 3DSBA 4A37A 1PUAA 3HU2A 1HDUA 2AFOA 1TKHA 4JLYA 4NEXA 5LYIA 3F0AA 2PVWA 3GTQA 1F2OA 1QSRA 2C27A 2ZXVA 5CNPA 3X2PA 3DLJA 4B5PB 4UEEA 5THWA 1AMPA 1BPNA 2JBJA 2FCKA 1OA9A 3NE7A 2B4DB 3FB3A 4ZGYB 1R27A 2NYQA 2Q7SA 3H5ZA 1OA7A 3D68A 1AW8B 3K2KA 2JIRA 3GB0A 4I49A 5C82A 5I0CA 5K8PA 4AVBA 1G8JA 4J3GA 3QC8A 2FSRA 2ZEFA 4UEZA 5ISVA 4B10A 1QSOA 1XBUA 2ZOFA 1TIQA 3KZWA 3TE4A 2AFUA 1IU8A 4CRZA 1YLEA 1R43A 1VHSA 1XF8A 4K30A 4K3NA 1VHEA 3BI0A 4QC6A 3ZZIA 3P2FA 2BH0A 1SMYD 1WC2A 3SI1A 2NAPA 1Y1WA 3PLXB 5DYGA 4UEFA 5DS0A 3SJEA 3BI1A 4R8FA 3TO7A 4MCPA 1ZYRD 4JP6A 3S6KA 1FNOA 3FNCA 2ZW7A 1ZLHA 2PJ9A 4D7ZB 1Y1VA 2WB1A 2QVPA 1J4JA 2D4OA 5DWMA 3X2GA 4FD6A 4MFQA 4JWPA 4A38A 4BINA 3S9LA 2AFXA 1FY7A 1F2PA 2ZEGA 4PSWA 1YNJD 1TXRA 3TTHA 4FBEA 2J8NA 1TKJA 3R96A 3FX6A 4UCMA 3ML1A 2BOAA 5T5ID 2ZPAA 2ZEPA 3UY5A 1AA6A 1ZLIA 3E0KA 4Q7AA 2KCWA 2O28A 1TWHA 1FDOA 4HNYB 3F5BA 4RN7A 4YWYA 3HKZA 4E2AA 4PSXA 2QIRA 4UCNA 4IHMA 1Z8WA 2QECA 2ABZA 2DPSA 1Z8XA 1Q7LA 2AFMA 2WPXA 4IK2A 5CPAA 2ANPA 4YFJA 3CF2A 3PB4X 1I12A 2OB0A 2B4BA 4OC3A 3PFEA 3H8GA 1A2ZA 2EK8A 3IWEA 3D30A 4LQ6A 4CYPA 2A6ED 3D7FA 5GCNA 3R9FA 2RFHA 3S9NA 4ORFA 4UA3A 1HDQA 1X12A 4KSIA 5FVJA 1YMEA 2NVXA 2J9AA 3BXMA 4Y49C 3S6HA 2WAQA 1X10A 3WC5A 1IYLA 1S60A 2G6GA 3MGDA 3BJ8A 4A94A 4C7HA 3CZBA 4DMRA 4C2ZA 4B13A 2Z3LA 2WPWA 3H8EA 1IYKA 2E2IA 2DEAA 1P0HA 5T5MD 4HPSA 1WWZA 4MRIA 4OIDA 3QQ8A 4A32A 1YLOA 2VBQA 2Z3KA 2R98A 1TWGA 4H2KA 3KHZA 2PE3A 2WSAA 1PQEA 3VWEA 2P0WA 3D66A 1SIWA 1PQFA 3DMRA 4M85A 1YNND 3SULA 2BUEA 3IWWA 3FECA 1LCPA 4MCSA 4LQGA 1I21A 4OP4A 5D29A 3T9YA 4A39A 1VKCA 1YX0A 3NH8A 1IB1E 1OZPA 4KVOE 3QAYA 3TT2A 2IV2X 4NGRA 1M4LA 4UCPA 4CGLA 4QBJA 2Z3MA 2PC1A 2ZOGA 4XPKA 3JTKA 1CP6A 4MHZA 3T90A 3MRUA 4AOKB 3FIXA 4M6GA 3KL9A 4NCZA 4CGMA 4CYNA 3KGQA 3KR4A 1XOVA 1Q2DA 3OWCA 4E0AA 5JM6A 3V7ZA 3PP9A 3G3SA 2V77A 5ELYA 4F9VA 1E18A 1QSTA 4MMOA 4OC5A 4JXQA 5GLYA 4R7MA 2Y0MA 2YNCA 5F48A 3IJ3A 5DYIA 4CRYG 4FWUA 3P2HA 3NA6A 3RNZA 2AE6A 3IGRA 1CPXA 4A30A 2HV2A 2REFA 4B5PA 2F7VA 3PRTA 2JA5A 2O5JD 1Y7RA 2ATRA 2PCUA 5H4UA 3HLPA 1I1DA 3NE8A 1Y0RA 2B4DA 5H84A 4FAIA 2B63A 4P4FA 5LYLA 3K9TA 1NMTA 4GXHA 5KTCA 5LRJA 1PQHA 4UFWA 2PJ4A 4NGNA 3QNVA 2VL1A 3D7GA 4YRHA 4KZTA 4AG9A 2OU2A 3FEEA 4A31A 2O4HA 5AG6A 3W91A 1N71A 2PQ8A 2YGWA 3D3SA 4CRZB 1AYEA 2Z3NA 3CXPA 4KS9A 1Y7EA 3EO4A 3HU1A 2YNEA 2AJ6A 1ARMA 1DMRA 3X2KA 4GS4A 3WC7A 1WLFA 1WCMA 5AG7A 1CZ5A 1XMTA 2HCZX 1QSNA 2ZENA 5HVFA 1ZG7A 1LFWA 2WZNA 5B6CA 3BHXA 4R3LA 5F47A 2JIPA 4QVTA 2PVVA 2A68D 3QB8A 4R57A 1PYTB 5EMIA 5AG4A 2ENGA 2ZW5A 4TWEA 5HVGA 3PB7X 2VPYA 3GTMA 2QJ8A 2V8HA 3H4QA 2AFSA 2FVGA 3CZXA 3SI2A 1EU1A 2REEA 4B14A 2G5DA 2CNSA 2FT0A 1ELMP 1YR0A 3RAMA 4QIWA 5LYFA 2OH1A 2JDDA 4MHPA 4FUUA 2P6GA 1FDIA 4KLVA 1CZ4A 2BO9A 2YNDA 4A33A 4PK2A 5J1QA 4OKOA 4F0YA 5JQ4A 1TWFA 4CAFA 4DYOA 4F0XA 3FMCA 3TCVA 1M1DA 3D7HA 4XNHC 1CBXA 2ZEDA 4R76A 5FTMA 3TM7B 2B3UA 3QQ7A 5JPHA 2FIWA 2JBKA 2PJ6A 3R1KA 4H89A 4JXRA 5C18A 1Z8TA 2WUUA 4JCWA 4KOTA 1N10A 2JIOA 3HUVA 3KKWA 1KUVA 2B3VA 2EVNA 4WWVA 5LYDA 2Q43A 1NSLA 4UBRA 3IR6A 3VATA 4F6AA 1ZC1A 3X2NA 2VXKA 2JDCA 3A9LA 2OOTA 2Q44A 4EVYA 5K8NA 3S9MA 2JA7A 4IF5A 4C2YA 2GIVA 2ARHA 3X2MA 2CIJA 4OADA 1OGYA 3SJFA 4KOWA 3WC6A 4B11A 1Y4ZA 4UFXA 3NH5A 1V0CA 3I1UA 4JS7A 2PJJA 1FT7A 2PJ3A 5F49A 1IW7D 4PXDA 2P6FA 3B3WA 4KOYA 2KI8A 3LACA 3SUMA 2ZEOA 1CJWA 4YGOA 2Q7BA 4NOHA 1S3ZA 3IC1A 5GM9A 1NSAA 1LRZA 1KQGA 1XFOA 3W6SA 6CPAA 1Q2YA 1H5NA 1S3SA 1RO5A 4MJ8A 4PPZA 4P45A 4PXEA 3K9UA 1WK4A 3C26A 3PZJA 4P6YA 3TFYA 4U5YA 2ZELA 5J8FA 4DNCA 3H8FA 5DWNA 5HH1A 4BBHA 3FJUA 4R9MA 5LRKA 2R8VA 1CM0A 4OAEA 4XPLA 2POKA 2O53A 3BJ7A 2XEGA 3I3GA 3WT4A 3X2LA 2ZW6A 1KUXA 4CGOA 4R6TA 2EBJA 3LD2A 1XMBA 4UIBA 1HD5A 1S7NA 5F09A 3IR7A 4KOVA 2CXAA 4OIWA 3PFOA 3RYOA 4GA6A 1KZFA 1H8LA 3V8IA 5HVHA 1Z5RA 4HNWB 4PXCA 3IEHA 3DR6A 1Z2LA 3GY9A 1Q2CA 3PB9X 5K8MA 3I9SA 2VPWA 2VPXA 1XIXA 1E5VA 2FL4A 2PJ8A 1JWQA 2RC4A 3FH4A 5E96A 1VHOA 2G3AA 2R7HA 4JJXA 2OR4A 2JIMA 4AZDA 4MHNA 4P4BA 3RBUA 4RUHA 2P6EA 4WJBA 4IUSA 3EFAA 3D67A 3EY5A 4OLLA 2JA6A 3B3CA 4W9YA 3LMSA 5FTJA 1ARLA 4FD4A 2PJ1A 4CRYB 2GAEA 3B3VA 1MJ9A 3DGVA 4ZX8A 3T8WA 3GTOA 2OZGA 1MJAA 2PJ2A 5IB9A 2VI7A 5GLXA 1LANA 4IAVA 1VIXA 1TF8A 2PDOA 4OC1A 2BCOA 1RTQA 2G9DA 5JH9A 1CP7A 1Q16A 3KI9A 3LODA 4FD5A 4TNUA 4YU9A 3KASA 4B6ZA 2IQ6A 4XPDC 4AONB 4Q38A 4FD7A 1Z8LA 4MCRA 1KWMA 3SJXA 2GLJA 3LWUA 4KUBA 4M6HA 1CPSA 2FIAA 4HNXB 4JD6A 5HMNA 1YW4A 2Q0YA 2A6HD 4U9ZA 2OZUA 3GYAA 2XEFA 2Z0ZA 3D4UA 4EWTA 2DXQA 3B35A 2C1CA 1IOFA 2B5GB 3QAHA 2BSWA 3JVNA 3PGPA 5FTLA 1IICA 5A28A 1MJBA 1ZG9A 2B58A 3CXSA 2X7BA 3DR8A 2PI8A 1TF9A 2Z11A 4DJLA 1Z4RA 3GTJA 2GFQA 4CAWA 1L8FA 3B3TA 2EK9A 2CNTA 2A69D 5G22A 3FEDA 3JUWA 4CGNA 2CW0D 4RV0A 3D2PA 3FBUA 1DTDA 1B87A 3OUGA 5GLFA 1Z9UA 2NVYA 2XEJA 2PJCA 2VQYA 3PB8X 4UF4A 2Q4VA 1M4GA 2FXFA 2G3TA 2ODFA 2PJ7A 2Q4ZA 2V8DA 2PJ0A 3B2YA 4KUAA 4UIAA 3KQZA 4XPDB 4CPAA 2AFZA 4KSFA 3G8WA 3NFZA 4E8OA 1MK4A 2J8MA 4KDIA 1S7KA 1M4IA 2GANA 4LUAA 4UFVA 1IIDA 2PJ5A 5IB0A 2E7ZA 4MI4A 1QQ9A 2CNMA 2CTCA 4MFZA 5I4MA 4UWIA 3R9GA 2EO8A 1BAVA 1G8KA 1BLLE 3IR5A 2A4NA 3FYNA 4NGQA 4CAXA 4ZI6A 2EEOB 4MY0A 4C68A 4JYWA 1BPMA 4NFRA 4EFDA 1CR5A 4BMHA 2B5GA 1SFOA 3IWGA 1R9TA 2C45A 2BEIA 1OBRA 3MN8A 4H6UA 5D8NA 5H86A 4AG7A 5K8OA 1AUGA 1R7RA 3F8KA 2HUZA 3GKRA 4AAYA 1PYUB 4Z65A 2DPTA 1BO4A 3D8PA 2JIQA 3TIWA 4CGPA 3TC8A 4KDLA 1YVOA 3GLJA 1IGBA 4P4IA 3RO0A 2PNWA 3FKIA 2RB7A 3CPXA 1S7FA 2HC9A 4GM5A 2PR1A 1VC3B 3GTGA 4JJOA 1UHEA 3PEIA 1VGYA 4MY3A 4CAVA 2YNCC 1YVKA 4P4EA 4OC2A 3B3SA 4MFKA 3CT9A 3SXOA 2VUMA 4NGPA 3GIUA 1UFHA 4QB9A 1K83A 2NMTA 2PIYA 5EC4A 5EBVA 2NSMA 1QSMA 2VZYA 3D7DA 4KLNA 1KUYA 1ZG8A 2ZEHA 3IU1A 4Q36A 3TOAA 4NGTA 5HXDA 1Y9KA 4KO8A 2PRBA 5C1BA 1KQFA 4KOSA 4CYOA 4M6IA 4NJQA 4KORA 3V38A 2EUIA 2K5TA 1YK3A 1PCAA 4P10A 3EC4A 4P44A 3SUKA 4ZY0A 4CYQA 2I79A 1GYTA 2I3CA 2V8VA 4OC4A 4A95A 4F9UA 2BL1A 4R87A 2E2HA 1TWCA 3R9EA 1R57A 8CPAA 1Y0YA 3ISXA 1DMSA 3ZJ0A 1QMUA 4A2ZA 2CF4A 3FF3A 4QUSA 1R3NA 3GUXA 4ZY1A 3HU3A 4ZX9A 3DNSA 3TX8A 2R7ZA 1PU9A 2Q4YA 3FRMA 2PICA 4FERA 1XJOA 2BE5D 3SJGA 4CS0B 2PRQA 1QDNA 5KTDA 4MHDA 2WYRA 3ENGA 4X8IA 2DMRA 2NYAA 1RXTA 2GE3A 4KVXA 3FVLA 3M3GA 4C7IA 5J8CA 4M3SA 2DF5A 5FTKA 3SUJA 3X2OA 1QCSA 2V8GA 4LX9A 3CDXA 2R1IA 4RS2A 4X5KA 3TO9A 4AXVA 4AYBA 4ZM7A 2ZEMA 4RI1A 3EXNA 4L48A 2VPZA 2OZHA 3N7ZA 3W6XA 4KODA 4NGMA 2FS5A 4NGSA 2FE7A 2I00A 4MBUA 3TO6A 3CPAA 3KR5A 5AG5A 2R92A 1Y5IA 2JEWA 4X2TA 5AGEA 4ZY2A 5LRGA 5BWAB 3IFEA 2F5IA 1HEEA 4AVRA 1S5KA 2QMLA 3FXTA 1H0HA 4KLWA 2QYVA 4PK3A 2HQYA 3BLNA 3ISZA 4KOXA 3H0GA 4Y49B 5KTAA 1L0CA 1DE4C 1CG2A 3O5AA 1F57A 1SQHA 3KHXA 2ZEEA 3SI0A 2YU9A
chains in the Genus database with same CATH topology
1GHEA 4NSQA 1BOBA 3R95A 4CS0A 1P4NA 1K4JA 1E32A 4KOUA 2H5MA 3CXQA 1PYQA 4C2MA 4U9YA 2JLMA 2PR8A 2Q04A 1TWAA 5IV0A 4R3KA 2VEZA 2PMZA 4L89A 5IX3A 2YUJA 2G0BA 4L8AA 4PV6A 3CQZA 5G1ZA 5G20A 1E61A 4KSAA 4UWJA 2Y0SA 1ZO0A 1UHDA 1ON0A 1XE4A 3GTKA 1U6MA 2Z3PA 3S6FA 4B12A 1XEBA 1M44A 4MFLA 1M4DA 1S7LA 3TOBA 1TMOA 2D4PA 2IL4A 2Z3OA 4MFPA 1PPYA 2VZZA 4KVME 4NXYA 4ONUA 4AB7A 5EPPA 5FTNA 3SXNA 3DDDA 2J8RA 4GA5A 3B8GA 1Z4EA 4MFJA 3SHPA 2PSWA 1PT1A 3GTLA 1I3QA 4ZBGA 5F46A 3GTPA 4HKFA 3WR7A 4AVAA 2PJHB 2ZW4A 2V45A 3D2MA 4CAEA 4H6ZA 3QWZA 4II9A 1E60A 5A27A 2V3VA 1Y9WA 1PT0A 4XNHB 2R93A 1YGHA 2CY2A 4C2XA 5H86A 3IU2A 2AE0X 1NE9A 3VWDA 2JEVA 5G21A 4AVCA 4NF1A 1B6BA 5C88A 1YREA 2Z10A 3S6GA 1I50A 3DSBA 1PUAA 3HU2A 4JLYA 4NEXA 3F0AA 3GTQA 1QSRA 2C27A 2ZXVA 5CNPA 4B5PB 4C2ZA 4CAWA 2FCKA 3NE7A 2B4DB 3FB3A 4ZGYB 1R27A 3H5ZA 4I49A 1AW8B 2JIRA 5C82A 5I0CA 5ISVA 4AVBA 1G8JA 4J3GA 3QC8A 2FSRA 4B10A 1QSOA 1TIQA 3TE4A 4CRZA 1YLEA 1VHSA 1XF8A 4K30A 4QC6A 3ZZIA 3P2FA 1SMYD 2NAPA 1Y1WA 3PLXB 5DYGA 3TO7A 1ZYRD 3S6KA 3FNCA 2ZW7A 4D7ZB 1Y1VA 2WB1A 1J4JA 2D4OA 5DWMA 4MFQA 4FD6A 4JWPA 1FY7A 4PSWA 1YNJD 3TTHA 2J8NA 3R96A 4UCMA 3ML1A 2ZPAA 5T5ID 3UY5A 1AA6A 3E0KA 2KCWA 2O28A 1TWHA 1FDOA 4HNYB 3F5BA 4E2AA 3HKZA 4PSXA 2QIRA 4UCNA 2QECA 2WPXA 2DPSA 4YFJA 3CF2A 1I12A 2OB0A 2B4BA 3IWEA 4CYPA 2A6ED 5GCNA 3R9FA 4ORFA 4UA3A 5FVJA 4Y49C 2NVXA 3S6HA 2WAQA 1IYLA 1S60A 2G6GA 3MGDA 3BJ8A 4C7HA 3CZBA 4DMRA 4B13A 2Z3LA 2WPWA 1IYKA 2E2IA 1P0HA 5T5MD 1WWZA 3QQ8A 4A32A 2VBQA 2Z3KA 2R98A 1TWGA 2WSAA 1PQEA 2P0WA 1SIWA 1PQFA 3DMRA 4M85A 1YNND 2BUEA 3T9YA 4B5OA 1I21A 1VKCA 1YX0A 1IB1E 1OZPA 4KVOE 3TT2A 2IV2X 4UCPA 4CGLA 4QBJA 2Z3MA 2PC1A 4XPKA 3JTKA 3T90A 4AOKB 3FIXA 4NCZA 4CGMA 4CYNA 1Q2DA 3OWCA 4E0AA 3PP9A 3G3SA 1E18A 1QSTA 4JXQA 2Y0MA 2YNCA 5F48A 5DYIA 4CRYG 3P2HA 2AE6A 3IGRA 2HV2A 2REFA 4B5PA 2JA5A 2O5JD 1Y7RA 2ATRA 1I1DA 5H84A 2B4DA 2B63A 1NMTA 5KTCA 1PQHA 4UFWA 4YRHA 4KZTA 4AG9A 2OU2A 4A31A 5AG6A 3W91A 1N71A 2PQ8A 2YGWA 3D3SA 4CRZB 2Z3NA 3CXPA 4KS9A 3EO4A 3HU1A 2YNEA 2AJ6A 1DMRA 4GS4A 1WLFA 1WCMA 5AG7A 1CZ5A 1XMTA 1QSNA 4R3LA 5B6CA 5F47A 2JIPA 4QVTA 3QB8A 2A68D 5AG4A 4R57A 2ZW5A 2VPYA 3GTMA 3H4QA 1EU1A 2REEA 4B14A 2G5DA 2CNSA 2FT0A 1YR0A 4QIWA 2OH1A 2JDDA 4KLVA 2P6GA 1FDIA 4A33A 1CZ4A 2YNDA 4PK2A 4F0YA 5JQ4A 1TWFA 4CAFA 4F0XA 3TCVA 1M1DA 4XNHC 5FTMA 3TM7B 2B3UA 3QQ7A 5JPHA 2FIWA 3R1KA 4H89A 4JXRA 5C18A 2WUUA 4KOTA 2JIOA 3KKWA 1KUVA 2B3VA 2EVNA 1NSLA 4UBRA 3IR6A 4F6AA 1ZC1A 2VXKA 2JDCA 3A9LA 4EVYA 2Q44A 2JA7A 4IF5A 4C2YA 2GIVA 2ARHA 4OADA 1OGYA 4KOWA 4B11A 1Y4ZA 4UFXA 1V0CA 5F49A 2PJJA 1IW7D 2P6FA 4KOYA 2KI8A 4YGOA 1CJWA 2Q7BA 4NOHA 1S3ZA 1LRZA 1KQGA 3W6SA 1Q2YA 1H5NA 1S3SA 1RO5A 4MJ8A 3K9UA 1WK4A 3C26A 3PZJA 3TFYA 4U5YA 5J8FA 4DNCA 5DWNA 5HH1A 4BBHA 4R9MA 2R8VA 1CM0A 4OAEA 4XPLA 3BJ7A 3I3GA 2ZW6A 1KUXA 4CGOA 3LD2A 1S7NA 3IR7A 4KOVA 2CXAA 3RYOA 4GA6A 1KZFA 3V8IA 4HNWB 3DR6A 3GY9A 1Q2CA 3I9SA 2VPWA 2VPXA 1XIXA 1E5VA 2FL4A 5E96A 2RC4A 4A30A 2G3AA 2R7HA 4JJXA 5J8CA 2JIMA 4AZDA 2P6EA 4IUSA 3EFAA 3EY5A 4OLLA 2JA6A 5FTJA 4FD4A 4CRYB 2GAEA 1MJ9A 3GTOA 2OZGA 1MJAA 2VI7A 2PDOA 1Q16A 4FD5A 3LODA 4XPDC 4AONB 4Q38A 4FD7A 4KUBA 2FIAA 4HNXB 4JD6A 5HMNA 2Q0YA 2A6HD 4U9ZA 2OZUA 3GYAA 2Z0ZA 2DXQA 2B5GB 3QAHA 2BSWA 3JVNA 3PGPA 5FTLA 1IICA 5A28A 1MJBA 2B58A 3CXSA 2X7BA 3DR8A 2PI8A 2Z11A 1Z4RA 3GTJA 5G22A 2CNTA 2A69D 3JUWA 4CGNA 2CW0D 4RV0A 3D2PA 3FBUA 1B87A 3OUGA 5GLFA 1Z9UA 2NVYA 2VQYA 2Q4VA 1M4GA 2FXFA 2G3TA 4KUAA 4XPDB 4KSFA 3G8WA 4E8OA 1MK4A 2J8MA 4KDIA 1S7KA 1M4IA 2GANA 4LUAA 4UFVA 1IIDA 5IB0A 2E7ZA 4MI4A 2CNMA 4MFZA 4UWIA 3R9GA 1G8KA 3IR5A 2A4NA 3FYNA 4CAXA 2EEOB 4MY0A 4C68A 1CR5A 4BMHA 2B5GA 1SFOA 3IWGA 1R9TA 2C45A 2BEIA 4AG7A 4H6UA 1R7RA 3F8KA 2HUZA 3GKRA 4AAYA 1PYUB 2DPTA 1BO4A 3D8PA 2JIQA 3TIWA 4CGPA 4KDLA 1YVOA 2PNWA 3FKIA 1S7FA 4MY3A 2PR1A 1VC3B 3GTGA 1UHEA 4CAVA 2YNCC 1YVKA 4MFKA 3SXOA 2VUMA 1UFHA 4QB9A 1K83A 2NMTA 5EBVA 5EC4A 1QSMA 2VZYA 3IU1A 4KLNA 1KUYA 4Q36A 3TOAA 1Y9KA 4KO8A 2PRBA 5C1BA 1KQFA 4KOSA 4CYOA 4KORA 2EUIA 2K5TA 1YK3A 3EC4A 4CYQA 2I79A 4A95A 2BL1A 4R87A 2E2HA 1TWCA 3R9EA 1R57A 1DMSA 3ZJ0A 4A2ZA 4QUSA 3HU3A 3DNSA 2R7ZA 1PU9A 2Q4YA 3FRMA 2PICA 2BE5D 4CS0B 1QDNA 5KTDA 4MHDA 2NYAA 2DMRA 1RXTA 2GE3A 4KVXA 4C7IA 4M3SA 4LX9A 5FTKA 3TO9A 1QCSA 4RS2A 4X5KA 2R1IA 4AYBA 4RI1A 3EXNA 2OZHA 2VPZA 3N7ZA 3W6XA 4KODA 2FS5A 2FE7A 2I00A 4MBUA 3TO6A 5AGEA 5AG5A 2R92A 1Y5IA 5BWAB 2F5IA 1S5KA 3FXTA 2QMLA 1H0HA 4KLWA 4PK3A 2HQYA 3BLNA 4KOXA 4Y49B 3H0GA 5KTAA 1L0CA 3O5AA 1SQHA 3VWEA 2YU9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GHE A;  4NSQ A;  1BOB A;  3R95 A;  4CS0 A;  1P4N A;  1K4J A;  1E32 A;  4KOU A;  2H5M A;  3CXQ A;  1PYQ A;  4C2M A;  4U9Y A;  2JLM A;  2PR8 A;  2Q04 A;  1TWA A;  5IV0 A;  4R3K A;  2VEZ A;  2PMZ A;  4L89 A;  5IX3 A;  2G0B A;  4L8A A;  4PV6 A;  3CQZ A;  1E61 A;  4UWJ A;  2Y0S A;  1UHD A;  1ON0 A;  1XE4 A;  3GTK A;  1U6M A;  3S6F A;  1M44 A;  1XEB A;  1M4D A;  1S7L A;  3TOB A;  1TMO A;  2D4P A;  2IL4 A;  1PPY A;  2VZZ A;  4KVM E;  4NXY A;  4ONU A;  4AB7 A;  5EPP A;  5FTN A;  3SXN A;  3DDD A;  2J8R A;  4GA5 A;  3B8G A;  1Z4E A;  3SHP A;  2PSW A;  1PT1 A;  3GTL A;  1I3Q A;  4ZBG A;  5F46 A;  3GTP A;  4HKF A;  3WR7 A;  4AVA A;  2PJH B;  2ZW4 A;  2V45 A;  3D2M A;  4H6Z A;  3QWZ A;  4II9 A;  1E60 A;  2V3V A;  1Y9W A;  1PT0 A;  4XNH B;  2R93 A;  1YGH A;  2CY2 A;  5H86 A;  1NE9 A;  3VWD A;  2JEV A;  4AVC A;  4NF1 A;  1B6B A;  5C88 A;  1YRE A;  2Z10 A;  3S6G A;  1I50 A;  3DSB A;  1PUA A;  3HU2 A;  4JLY A;  4NEX A;  3F0A A;  3GTQ A;  1QSR A;  2C27 A;  2ZXV A;  5CNP A;  4B5P B;  4CAW A;  2FCK A;  3NE7 A;  2B4D B;  3FB3 A;  1R27 A;  4I49 A;  1AW8 B;  2JIR A;  5C82 A;  5I0C A;  5ISV A;  4AVB A;  1G8J A;  4J3G A;  3QC8 A;  2FSR A;  1QSO A;  1TIQ A;  3TE4 A;  4CRZ A;  1YLE A;  1VHS A;  1XF8 A;  4K30 A;  4QC6 A;  3ZZI A;  3P2F A;  2NAP A;  1Y1W A;  3PLX B;  5DYG A;  3TO7 A;  3S6K A;  3FNC A;  2ZW7 A;  4D7Z B;  1Y1V A;  2WB1 A;  1J4J A;  2D4O A;  5DWM A;  4FD6 A;  4JWP A;  1FY7 A;  4PSW A;  3TTH A;  2J8N A;  3R96 A;  3ML1 A;  2ZPA A;  5T5I D;  3UY5 A;  1AA6 A;  3E0K A;  2KCW A;  2O28 A;  1TWH A;  1FDO A;  4HNY B;  3F5B A;  4E2A A;  3HKZ A;  4PSX A;  2QIR A;  2QEC A;  2WPX A;  4YFJ A;  3CF2 A;  1I12 A;  2OB0 A;  2B4B A;  5GCN A;  3R9F A;  4ORF A;  4UA3 A;  5FVJ A;  4Y49 C;  2NVX A;  3S6H A;  2WAQ A;  1IYL A;  1S60 A;  3MGD A;  3BJ8 A;  4DMR A;  2WPW A;  1IYK A;  2E2I A;  1P0H A;  5T5M D;  1WWZ A;  3QQ8 A;  2VBQ A;  2R98 A;  1TWG A;  1PQE A;  2P0W A;  1SIW A;  1PQF A;  3DMR A;  4M85 A;  2BUE A;  3T9Y A;  4B5O A;  1I21 A;  1VKC A;  1YX0 A;  1IB1 E;  1OZP A;  4KVO E;  3TT2 A;  2IV2 X;  4QBJ A;  2PC1 A;  4XPK A;  3T90 A;  4AOK B;  3FIX A;  4NCZ A;  1Q2D A;  3OWC A;  4E0A A;  3PP9 A;  3G3S A;  1E18 A;  1QST A;  4JXQ A;  2Y0M A;  5F48 A;  5DYI A;  4CRY G;  3P2H A;  2AE6 A;  3IGR A;  2HV2 A;  2REF A;  4B5P A;  2JA5 A;  1Y7R A;  2ATR A;  1I1D A;  5H84 A;  2B4D A;  2B63 A;  1NMT A;  5KTC A;  1PQH A;  4YRH A;  4KZT A;  4AG9 A;  2OU2 A;  3W91 A;  1N71 A;  2PQ8 A;  3D3S A;  4CRZ B;  3CXP A;  3EO4 A;  3HU1 A;  2AJ6 A;  1DMR A;  4GS4 A;  1WLF A;  1WCM A;  1CZ5 A;  1XMT A;  1QSN A;  4R3L A;  5B6C A;  5F47 A;  2JIP A;  4QVT A;  3QB8 A;  4R57 A;  2ZW5 A;  2VPY A;  3GTM A;  3H4Q A;  1EU1 A;  2REE A;  2CNS A;  2FT0 A;  1YR0 A;  4QIW A;  2OH1 A;  2JDD A;  4KLV A;  2P6G A;  1FDI A;  1CZ4 A;  4PK2 A;  4F0Y A;  5JQ4 A;  1TWF A;  3TCV A;  1M1D A;  4XNH C;  5FTM A;  3TM7 B;  2B3U A;  3QQ7 A;  5JPH A;  2FIW A;  3R1K A;  4H89 A;  4JXR A;  5C18 A;  4KOT A;  2JIO A;  3KKW A;  1KUV A;  2B3V A;  2EVN A;  1NSL A;  4UBR A;  3IR6 A;  4F6A A;  2VXK A;  2JDC A;  4EVY A;  2Q44 A;  2JA7 A;  4IF5 A;  2GIV A;  2ARH A;  4OAD A;  1OGY A;  4KOW A;  1Y4Z A;  1V0C A;  5F49 A;  1IW7 D;  2P6F A;  4KOY A;  2KI8 A;  4YGO A;  1CJW A;  2Q7B A;  1S3Z A;  1LRZ A;  1KQG A;  3W6S A;  1Q2Y A;  1H5N A;  1S3S A;  1RO5 A;  4MJ8 A;  3K9U A;  1WK4 A;  3C26 A;  3PZJ A;  3TFY A;  4U5Y A;  5J8F A;  4DNC A;  5DWN A;  5HH1 A;  4R9M A;  2R8V A;  1CM0 A;  4OAE A;  4XPL A;  3BJ7 A;  3I3G A;  2ZW6 A;  1KUX A;  3LD2 A;  1S7N A;  3IR7 A;  4KOV A;  3RYO A;  4GA6 A;  1KZF A;  3V8I A;  4HNW B;  3DR6 A;  3GY9 A;  1Q2C A;  3I9S A;  2VPW A;  2VPX A;  1XIX A;  1E5V A;  2FL4 A;  5E96 A;  2RC4 A;  2G3A A;  2R7H A;  4JJX A;  5J8C A;  2JIM A;  4AZD A;  2P6E A;  4IUS A;  3EFA A;  3EY5 A;  4OLL A;  2JA6 A;  5FTJ A;  4FD4 A;  4CRY B;  1MJ9 A;  3GTO A;  2OZG A;  1MJA A;  2VI7 A;  2PDO A;  1Q16 A;  4FD5 A;  3LOD A;  4XPD C;  4AON B;  4FD7 A;  4KUB A;  2FIA A;  4HNX B;  4JD6 A;  5HMN A;  2Q0Y A;  4U9Z A;  2OZU A;  3GYA A;  2Z0Z A;  2DXQ A;  2B5G B;  3QAH A;  2BSW A;  3JVN A;  3PGP A;  5FTL A;  1IIC A;  1MJB A;  2B58 A;  3CXS A;  2X7B A;  3DR8 A;  2Z11 A;  1Z4R A;  3GTJ A;  2CNT A;  3JUW A;  4RV0 A;  3FBU A;  3D2P A;  1B87 A;  3OUG A;  5GLF A;  1Z9U A;  2NVY A;  2VQY A;  2Q4V A;  1M4G A;  2FXF A;  2G3T A;  4KUA A;  4XPD B;  3G8W A;  4E8O A;  1MK4 A;  2J8M A;  4KDI A;  1S7K A;  1M4I A;  2GAN A;  4LUA A;  1IID A;  5IB0 A;  2E7Z A;  4MI4 A;  2CNM A;  4UWI A;  3R9G A;  1G8K A;  3IR5 A;  2A4N A;  3FYN A;  4CAX A;  2EEO B;  4MY0 A;  1CR5 A;  4BMH A;  2B5G A;  1SFO A;  3IWG A;  1R9T A;  2C45 A;  2BEI A;  4AG7 A;  4H6U A;  1R7R A;  3F8K A;  2HUZ A;  3GKR A;  4AAY A;  1PYU B;  3D8P A;  1BO4 A;  2JIQ A;  3TIW A;  4KDL A;  1YVO A;  3FKI A;  1S7F A;  4MY3 A;  2PR1 A;  1VC3 B;  3GTG A;  1UHE A;  4CAV A;  1YVK A;  3SXO A;  2VUM A;  1UFH A;  4QB9 A;  1K83 A;  2NMT A;  5EBV A;  5EC4 A;  1QSM A;  2VZY A;  3TOA A;  4KLN A;  1KUY A;  1Y9K A;  4KO8 A;  2PRB A;  5C1B A;  1KQF A;  4KOS A;  4KOR A;  2EUI A;  2K5T A;  1YK3 A;  3EC4 A;  2I79 A;  2BL1 A;  4R87 A;  2E2H A;  1TWC A;  3R9E A;  1R57 A;  1DMS A;  3ZJ0 A;  4QUS A;  3HU3 A;  3DNS A;  2R7Z A;  1PU9 A;  2Q4Y A;  3FRM A;  4CS0 B;  1QDN A;  5KTD A;  4MHD A;  2NYA A;  2DMR A;  1RXT A;  2GE3 A;  4KVX A;  4M3S A;  4LX9 A;  5FTK A;  3TO9 A;  1QCS A;  4RS2 A;  4X5K A;  2R1I A;  4AYB A;  4RI1 A;  3EXN A;  2OZH A;  2VPZ A;  3N7Z A;  3W6X A;  4KOD A;  2FS5 A;  2FE7 A;  2I00 A;  4MBU A;  3TO6 A;  2R92 A;  1Y5I A;  2F5I A;  1S5K A;  3FXT A;  2QML A;  1H0H A;  4KLW A;  4PK3 A;  2HQY A;  3BLN A;  4KOX A;  4Y49 B;  3H0G A;  5KTA A;  1L0C A;  3O5A A;  1SQH A;  3VWE A;  2YU9 A; 
#chains in the Genus database with same CATH topology
 1GHE A;  2C6C A;  1BOB A;  4NSQ A;  2GRE A;  1IOI A;  4CS0 A;  1P4N A;  4MHY A;  3R95 A;  3VAR A;  1K4J A;  1E32 A;  4KOU A;  4O23 A;  2H5M A;  3CXQ A;  4MXU A;  1CX8 A;  2GU2 A;  2HB6 A;  1PYQ A;  4C2M A;  1YSJ A;  3JRU A;  2Q51 A;  4U9Y A;  2JLM A;  2PR8 A;  1BW3 A;  2Q04 A;  1TWA A;  2XEI A;  4ZYQ A;  5IV0 A;  4JZ0 A;  4OME A;  3WAB A;  1JQG A;  4FFT A;  4R3K A;  2KQA A;  5JGF A;  4PQA A;  2VEZ A;  2PMZ A;  4L89 A;  4PXB A;  2YUJ A;  3X2H A;  2CTB A;  2G0B A;  4L8A A;  3PB6 X;  4B5O A;  5IX3 A;  4ENG A;  4ONW A;  3PBB A;  2EWB A;  4PV6 A;  3CQZ A;  5G1Z A;  3IO1 A;  5G20 A;  4X3R A;  1E61 A;  2IJZ A;  4KSA A;  1YW6 A;  4UWJ A;  2Y0S A;  1LOK A;  1UWY A;  4EME A;  1ZO0 A;  1UHD A;  2IMO A;  1ON0 A;  4OC0 A;  1XE4 A;  3GTK A;  1LAP A;  1U6M A;  1EE3 P;  2Z3P A;  3S6F A;  3VH9 A;  4B12 A;  1M44 A;  4JP7 A;  1XEB A;  4MFL A;  1M4D A;  1S7L A;  3L2N A;  1TMO A;  2D4P A;  2IL4 A;  2Z3O A;  4MFP A;  4FG2 A;  3PBE A;  1PPY A;  2VZZ A;  4KVM E;  4NXY A;  4F8Z A;  4BD9 A;  3X2I A;  2AFW A;  4ONU A;  3IIB A;  4AB7 A;  5EPP A;  5FTN A;  1YQE A;  3SXN A;  3NH4 A;  3DDD A;  4FG4 A;  2J8R A;  4GA5 A;  2F8H A;  1Z4E A;  3B8G A;  4MFJ A;  4NJR A;  3SHP A;  2PSW A;  1PT1 A;  3GTL A;  1I3Q A;  4ZBG A;  5F46 A;  3GTP A;  2PIZ A;  4HKF A;  3WR7 A;  4AVA A;  2PJH B;  1ELL P;  2C6P A;  2V45 A;  2ZW4 A;  3D2M A;  4G1P A;  4CAE A;  4H6Z A;  3QWZ A;  4II9 A;  1E60 A;  5A27 A;  5CBM A;  3RZA A;  1TKF A;  2V3V A;  1BW4 A;  1IY7 A;  1Y9W A;  4P4D A;  3TOB A;  4DUK A;  1PT0 A;  4XNH B;  2R93 A;  7CPA A;  4MCQ A;  1YGH A;  2CY2 A;  4C2X A;  3X2J A;  3IU2 A;  3KQX A;  2AE0 X;  1NE9 A;  3B7I A;  2JEV A;  2GLF A;  3N5F A;  5G21 A;  3VWD A;  2PJB A;  4AVC A;  4NF1 A;  1B6B A;  2PJA A;  4P4J A;  5C88 A;  1YRE A;  1XRY A;  2Z10 A;  2C6G A;  3S6G A;  1I50 A;  1LAM A;  3DSB A;  4A37 A;  1PUA A;  3HU2 A;  1HDU A;  2AFO A;  1TKH A;  4JLY A;  4NEX A;  5LYI A;  3F0A A;  2PVW A;  3GTQ A;  1F2O A;  1QSR A;  2C27 A;  2ZXV A;  5CNP A;  3X2P A;  3DLJ A;  4B5P B;  4UEE A;  5THW A;  1AMP A;  1BPN A;  2JBJ A;  2FCK A;  1OA9 A;  3NE7 A;  2B4D B;  3FB3 A;  4ZGY B;  1R27 A;  2NYQ A;  2Q7S A;  3H5Z A;  1OA7 A;  3D68 A;  1AW8 B;  3K2K A;  2JIR A;  3GB0 A;  4I49 A;  5C82 A;  5I0C A;  5K8P A;  4AVB A;  1G8J A;  4J3G A;  3QC8 A;  2FSR A;  2ZEF A;  4UEZ A;  5ISV A;  4B10 A;  1QSO A;  1XBU A;  2ZOF A;  1TIQ A;  3KZW A;  3TE4 A;  2AFU A;  1IU8 A;  4CRZ A;  1YLE A;  1R43 A;  1VHS A;  1XF8 A;  4K30 A;  4K3N A;  1VHE A;  3BI0 A;  4QC6 A;  3ZZI A;  3P2F A;  2BH0 A;  1SMY D;  1WC2 A;  3SI1 A;  2NAP A;  1Y1W A;  3PLX B;  5DYG A;  4UEF A;  5DS0 A;  3SJE A;  3BI1 A;  4R8F A;  3TO7 A;  4MCP A;  1ZYR D;  4JP6 A;  3S6K A;  1FNO A;  3FNC A;  2ZW7 A;  1ZLH A;  2PJ9 A;  4D7Z B;  1Y1V A;  2WB1 A;  2QVP A;  1J4J A;  2D4O A;  5DWM A;  3X2G A;  4FD6 A;  4MFQ A;  4JWP A;  4A38 A;  4BIN A;  3S9L A;  2AFX A;  1FY7 A;  1F2P A;  2ZEG A;  4PSW A;  1YNJ D;  1TXR A;  3TTH A;  4FBE A;  2J8N A;  1TKJ A;  3R96 A;  3FX6 A;  4UCM A;  3ML1 A;  2BOA A;  5T5I D;  2ZPA A;  2ZEP A;  3UY5 A;  1AA6 A;  1ZLI A;  3E0K A;  4Q7A A;  2KCW A;  2O28 A;  1TWH A;  1FDO A;  4HNY B;  3F5B A;  4RN7 A;  4YWY A;  3HKZ A;  4E2A A;  4PSX A;  2QIR A;  4UCN A;  4IHM A;  1Z8W A;  2QEC A;  2ABZ A;  2DPS A;  1Z8X A;  1Q7L A;  2AFM A;  2WPX A;  4IK2 A;  5CPA A;  2ANP A;  4YFJ A;  3CF2 A;  3PB4 X;  1I12 A;  2OB0 A;  2B4B A;  4OC3 A;  3PFE A;  3H8G A;  1A2Z A;  2EK8 A;  3IWE A;  3D30 A;  4LQ6 A;  4CYP A;  2A6E D;  3D7F A;  5GCN A;  3R9F A;  2RFH A;  3S9N A;  4ORF A;  4UA3 A;  1HDQ A;  1X12 A;  4KSI A;  5FVJ A;  1YME A;  2NVX A;  2J9A A;  3BXM A;  4Y49 C;  3S6H A;  2WAQ A;  1X10 A;  3WC5 A;  1IYL A;  1S60 A;  2G6G A;  3MGD A;  3BJ8 A;  4A94 A;  4C7H A;  3CZB A;  4DMR A;  4C2Z A;  4B13 A;  2Z3L A;  2WPW A;  3H8E A;  1IYK A;  2E2I A;  2DEA A;  1P0H A;  5T5M D;  4HPS A;  1WWZ A;  4MRI A;  4OID A;  3QQ8 A;  4A32 A;  1YLO A;  2VBQ A;  2Z3K A;  2R98 A;  1TWG A;  4H2K A;  3KHZ A;  2PE3 A;  2WSA A;  1PQE A;  3VWE A;  2P0W A;  3D66 A;  1SIW A;  1PQF A;  3DMR A;  4M85 A;  1YNN D;  3SUL A;  2BUE A;  3IWW A;  3FEC A;  1LCP A;  4MCS A;  4LQG A;  1I21 A;  4OP4 A;  5D29 A;  3T9Y A;  4A39 A;  1VKC A;  1YX0 A;  3NH8 A;  1IB1 E;  1OZP A;  4KVO E;  3QAY A;  3TT2 A;  2IV2 X;  4NGR A;  1M4L A;  4UCP A;  4CGL A;  4QBJ A;  2Z3M A;  2PC1 A;  2ZOG A;  4XPK A;  3JTK A;  1CP6 A;  4MHZ A;  3T90 A;  3MRU A;  4AOK B;  3FIX A;  4M6G A;  3KL9 A;  4NCZ A;  4CGM A;  4CYN A;  3KGQ A;  3KR4 A;  1XOV A;  1Q2D A;  3OWC A;  4E0A A;  5JM6 A;  3V7Z A;  3PP9 A;  3G3S A;  2V77 A;  5ELY A;  4F9V A;  1E18 A;  1QST A;  4MMO A;  4OC5 A;  4JXQ A;  5GLY A;  4R7M A;  2Y0M A;  2YNC A;  5F48 A;  3IJ3 A;  5DYI A;  4CRY G;  4FWU A;  3P2H A;  3NA6 A;  3RNZ A;  2AE6 A;  3IGR A;  1CPX A;  4A30 A;  2HV2 A;  2REF A;  4B5P A;  2F7V A;  3PRT A;  2JA5 A;  2O5J D;  1Y7R A;  2ATR A;  2PCU A;  5H4U A;  3HLP A;  1I1D A;  3NE8 A;  1Y0R A;  2B4D A;  5H84 A;  4FAI A;  2B63 A;  4P4F A;  5LYL A;  3K9T A;  1NMT A;  4GXH A;  5KTC A;  5LRJ A;  1PQH A;  4UFW A;  2PJ4 A;  4NGN A;  3QNV A;  2VL1 A;  3D7G A;  4YRH A;  4KZT A;  4AG9 A;  2OU2 A;  3FEE A;  4A31 A;  2O4H A;  5AG6 A;  3W91 A;  1N71 A;  2PQ8 A;  2YGW A;  3D3S A;  4CRZ B;  1AYE A;  2Z3N A;  3CXP A;  4KS9 A;  1Y7E A;  3EO4 A;  3HU1 A;  2YNE A;  2AJ6 A;  1ARM A;  1DMR A;  3X2K A;  4GS4 A;  3WC7 A;  1WLF A;  1WCM A;  5AG7 A;  1CZ5 A;  1XMT A;  2HCZ X;  1QSN A;  2ZEN A;  5HVF A;  1ZG7 A;  1LFW A;  2WZN A;  5B6C A;  3BHX A;  4R3L A;  5F47 A;  2JIP A;  4QVT A;  2PVV A;  2A68 D;  3QB8 A;  4R57 A;  1PYT B;  5EMI A;  5AG4 A;  2ENG A;  2ZW5 A;  4TWE A;  5HVG A;  3PB7 X;  2VPY A;  3GTM A;  2QJ8 A;  2V8H A;  3H4Q A;  2AFS A;  2FVG A;  3CZX A;  3SI2 A;  1EU1 A;  2REE A;  4B14 A;  2G5D A;  2CNS A;  2FT0 A;  1ELM P;  1YR0 A;  3RAM A;  4QIW A;  5LYF A;  2OH1 A;  2JDD A;  4MHP A;  4FUU A;  2P6G A;  1FDI A;  4KLV A;  1CZ4 A;  2BO9 A;  2YND A;  4A33 A;  4PK2 A;  5J1Q A;  4OKO A;  4F0Y A;  5JQ4 A;  1TWF A;  4CAF A;  4DYO A;  4F0X A;  3FMC A;  3TCV A;  1M1D A;  3D7H A;  4XNH C;  1CBX A;  2ZED A;  4R76 A;  5FTM A;  3TM7 B;  2B3U A;  3QQ7 A;  5JPH A;  2FIW A;  2JBK A;  2PJ6 A;  3R1K A;  4H89 A;  4JXR A;  5C18 A;  1Z8T A;  2WUU A;  4JCW A;  4KOT A;  1N10 A;  2JIO A;  3HUV A;  3KKW A;  1KUV A;  2B3V A;  2EVN A;  4WWV A;  5LYD A;  2Q43 A;  1NSL A;  4UBR A;  3IR6 A;  3VAT A;  4F6A A;  1ZC1 A;  3X2N A;  2VXK A;  2JDC A;  3A9L A;  2OOT A;  2Q44 A;  4EVY A;  5K8N A;  3S9M A;  2JA7 A;  4IF5 A;  4C2Y A;  2GIV A;  2ARH A;  3X2M A;  2CIJ A;  4OAD A;  1OGY A;  3SJF A;  4KOW A;  3WC6 A;  4B11 A;  1Y4Z A;  4UFX A;  3NH5 A;  1V0C A;  3I1U A;  4JS7 A;  2PJJ A;  1FT7 A;  2PJ3 A;  5F49 A;  1IW7 D;  4PXD A;  2P6F A;  3B3W A;  4KOY A;  2KI8 A;  3LAC A;  3SUM A;  2ZEO A;  1CJW A;  4YGO A;  2Q7B A;  4NOH A;  1S3Z A;  3IC1 A;  5GM9 A;  1NSA A;  1LRZ A;  1KQG A;  1XFO A;  3W6S A;  6CPA A;  1Q2Y A;  1H5N A;  1S3S A;  1RO5 A;  4MJ8 A;  4PPZ A;  4P45 A;  4PXE A;  3K9U A;  1WK4 A;  3C26 A;  3PZJ A;  4P6Y A;  3TFY A;  4U5Y A;  2ZEL A;  5J8F A;  4DNC A;  3H8F A;  5DWN A;  5HH1 A;  4BBH A;  3FJU A;  4R9M A;  5LRK A;  2R8V A;  1CM0 A;  4OAE A;  4XPL A;  2POK A;  2O53 A;  3BJ7 A;  2XEG A;  3I3G A;  3WT4 A;  3X2L A;  2ZW6 A;  1KUX A;  4CGO A;  4R6T A;  2EBJ A;  3LD2 A;  1XMB A;  4UIB A;  1HD5 A;  1S7N A;  5F09 A;  3IR7 A;  4KOV A;  2CXA A;  4OIW A;  3PFO A;  3RYO A;  4GA6 A;  1KZF A;  1H8L A;  3V8I A;  5HVH A;  1Z5R A;  4HNW B;  4PXC A;  3IEH A;  3DR6 A;  1Z2L A;  3GY9 A;  1Q2C A;  3PB9 X;  5K8M A;  3I9S A;  2VPW A;  2VPX A;  1XIX A;  1E5V A;  2FL4 A;  2PJ8 A;  1JWQ A;  2RC4 A;  3FH4 A;  5E96 A;  1VHO A;  2G3A A;  2R7H A;  4JJX A;  2OR4 A;  2JIM A;  4AZD A;  4MHN A;  4P4B A;  3RBU A;  4RUH A;  2P6E A;  4WJB A;  4IUS A;  3EFA A;  3D67 A;  3EY5 A;  4OLL A;  2JA6 A;  3B3C A;  4W9Y A;  3LMS A;  5FTJ A;  1ARL A;  4FD4 A;  2PJ1 A;  4CRY B;  2GAE A;  3B3V A;  1MJ9 A;  3DGV A;  4ZX8 A;  3T8W A;  3GTO A;  2OZG A;  1MJA A;  2PJ2 A;  5IB9 A;  2VI7 A;  5GLX A;  1LAN A;  4IAV A;  1VIX A;  1TF8 A;  2PDO A;  4OC1 A;  2BCO A;  1RTQ A;  2G9D A;  5JH9 A;  1CP7 A;  1Q16 A;  3KI9 A;  3LOD A;  4FD5 A;  4TNU A;  4YU9 A;  3KAS A;  4B6Z A;  2IQ6 A;  4XPD C;  4AON B;  4Q38 A;  4FD7 A;  1Z8L A;  4MCR A;  1KWM A;  3SJX A;  2GLJ A;  3LWU A;  4KUB A;  4M6H A;  1CPS A;  2FIA A;  4HNX B;  4JD6 A;  5HMN A;  1YW4 A;  2Q0Y A;  2A6H D;  4U9Z A;  2OZU A;  3GYA A;  2XEF A;  2Z0Z A;  3D4U A;  4EWT A;  2DXQ A;  3B35 A;  2C1C A;  1IOF A;  2B5G B;  3QAH A;  2BSW A;  3JVN A;  3PGP A;  5FTL A;  1IIC A;  5A28 A;  1MJB A;  1ZG9 A;  2B58 A;  3CXS A;  2X7B A;  3DR8 A;  2PI8 A;  1TF9 A;  2Z11 A;  4DJL A;  1Z4R A;  3GTJ A;  2GFQ A;  4CAW A;  1L8F A;  3B3T A;  2EK9 A;  2CNT A;  2A69 D;  5G22 A;  3FED A;  3JUW A;  4CGN A;  2CW0 D;  4RV0 A;  3D2P A;  3FBU A;  1DTD A;  1B87 A;  3OUG A;  5GLF A;  1Z9U A;  2NVY A;  2XEJ A;  2PJC A;  2VQY A;  3PB8 X;  4UF4 A;  2Q4V A;  1M4G A;  2FXF A;  2G3T A;  2ODF A;  2PJ7 A;  2Q4Z A;  2V8D A;  2PJ0 A;  3B2Y A;  4KUA A;  4UIA A;  3KQZ A;  4XPD B;  4CPA A;  2AFZ A;  4KSF A;  3G8W A;  3NFZ A;  4E8O A;  1MK4 A;  2J8M A;  4KDI A;  1S7K A;  1M4I A;  2GAN A;  4LUA A;  4UFV A;  1IID A;  2PJ5 A;  5IB0 A;  2E7Z A;  4MI4 A;  1QQ9 A;  2CNM A;  2CTC A;  4MFZ A;  5I4M A;  4UWI A;  3R9G A;  2EO8 A;  1BAV A;  1G8K A;  1BLL E;  3IR5 A;  2A4N A;  3FYN A;  4NGQ A;  4CAX A;  4ZI6 A;  2EEO B;  4MY0 A;  4C68 A;  4JYW A;  1BPM A;  4NFR A;  4EFD A;  1CR5 A;  4BMH A;  2B5G A;  1SFO A;  3IWG A;  1R9T A;  2C45 A;  2BEI A;  1OBR A;  3MN8 A;  4H6U A;  5D8N A;  5H86 A;  4AG7 A;  5K8O A;  1AUG A;  1R7R A;  3F8K A;  2HUZ A;  3GKR A;  4AAY A;  1PYU B;  4Z65 A;  2DPT A;  1BO4 A;  3D8P A;  2JIQ A;  3TIW A;  4CGP A;  3TC8 A;  4KDL A;  1YVO A;  3GLJ A;  1IGB A;  4P4I A;  3RO0 A;  2PNW A;  3FKI A;  2RB7 A;  3CPX A;  1S7F A;  2HC9 A;  4GM5 A;  2PR1 A;  1VC3 B;  3GTG A;  4JJO A;  1UHE A;  3PEI A;  1VGY A;  4MY3 A;  4CAV A;  2YNC C;  1YVK A;  4P4E A;  4OC2 A;  3B3S A;  4MFK A;  3CT9 A;  3SXO A;  2VUM A;  4NGP A;  3GIU A;  1UFH A;  4QB9 A;  1K83 A;  2NMT A;  2PIY A;  5EC4 A;  5EBV A;  2NSM A;  1QSM A;  2VZY A;  3D7D A;  4KLN A;  1KUY A;  1ZG8 A;  2ZEH A;  3IU1 A;  4Q36 A;  3TOA A;  4NGT A;  5HXD A;  1Y9K A;  4KO8 A;  2PRB A;  5C1B A;  1KQF A;  4KOS A;  4CYO A;  4M6I A;  4NJQ A;  4KOR A;  3V38 A;  2EUI A;  2K5T A;  1YK3 A;  1PCA A;  4P10 A;  3EC4 A;  4P44 A;  3SUK A;  4ZY0 A;  4CYQ A;  2I79 A;  1GYT A;  2I3C A;  2V8V A;  4OC4 A;  4A95 A;  4F9U A;  2BL1 A;  4R87 A;  2E2H A;  1TWC A;  3R9E A;  1R57 A;  8CPA A;  1Y0Y A;  3ISX A;  1DMS A;  3ZJ0 A;  1QMU A;  4A2Z A;  2CF4 A;  3FF3 A;  4QUS A;  1R3N A;  3GUX A;  4ZY1 A;  3HU3 A;  4ZX9 A;  3DNS A;  3TX8 A;  2R7Z A;  1PU9 A;  2Q4Y A;  3FRM A;  2PIC A;  4FER A;  1XJO A;  2BE5 D;  3SJG A;  4CS0 B;  2PRQ A;  1QDN A;  5KTD A;  4MHD A;  2WYR A;  3ENG A;  4X8I A;  2DMR A;  2NYA A;  1RXT A;  2GE3 A;  4KVX A;  3FVL A;  3M3G A;  4C7I A;  5J8C A;  4M3S A;  2DF5 A;  5FTK A;  3SUJ A;  3X2O A;  1QCS A;  2V8G A;  4LX9 A;  3CDX A;  2R1I A;  4RS2 A;  4X5K A;  3TO9 A;  4AXV A;  4AYB A;  4ZM7 A;  2ZEM A;  4RI1 A;  3EXN A;  4L48 A;  2VPZ A;  2OZH A;  3N7Z A;  3W6X A;  4KOD A;  4NGM A;  2FS5 A;  4NGS A;  2FE7 A;  2I00 A;  4MBU A;  3TO6 A;  3CPA A;  3KR5 A;  5AG5 A;  2R92 A;  1Y5I A;  2JEW A;  4X2T A;  5AGE A;  4ZY2 A;  5LRG A;  5BWA B;  3IFE A;  2F5I A;  1HEE A;  4AVR A;  1S5K A;  2QML A;  3FXT A;  1H0H A;  4KLW A;  2QYV A;  4PK3 A;  2HQY A;  3BLN A;  3ISZ A;  4KOX A;  3H0G A;  4Y49 B;  5KTA A;  1L0C A;  1DE4 C;  1CG2 A;  3O5A A;  1F57 A;  1SQH A;  3KHX A;  2ZEE A;  3SI0 A;  2YU9 A; 
#chains in the Genus database with same CATH homology
 1GHE A;  4NSQ A;  1BOB A;  3R95 A;  4CS0 A;  1P4N A;  1K4J A;  1E32 A;  4KOU A;  2H5M A;  3CXQ A;  1PYQ A;  4C2M A;  4U9Y A;  2JLM A;  2PR8 A;  2Q04 A;  1TWA A;  5IV0 A;  4R3K A;  2VEZ A;  2PMZ A;  4L89 A;  5IX3 A;  2YUJ A;  2G0B A;  4L8A A;  4PV6 A;  3CQZ A;  5G1Z A;  5G20 A;  1E61 A;  4KSA A;  4UWJ A;  2Y0S A;  1ZO0 A;  1UHD A;  1ON0 A;  1XE4 A;  3GTK A;  1U6M A;  2Z3P A;  3S6F A;  4B12 A;  1XEB A;  1M44 A;  4MFL A;  1M4D A;  1S7L A;  3TOB A;  1TMO A;  2D4P A;  2IL4 A;  2Z3O A;  4MFP A;  1PPY A;  2VZZ A;  4KVM E;  4NXY A;  4ONU A;  4AB7 A;  5EPP A;  5FTN A;  3SXN A;  3DDD A;  2J8R A;  4GA5 A;  3B8G A;  1Z4E A;  4MFJ A;  3SHP A;  2PSW A;  1PT1 A;  3GTL A;  1I3Q A;  4ZBG A;  5F46 A;  3GTP A;  4HKF A;  3WR7 A;  4AVA A;  2PJH B;  2ZW4 A;  2V45 A;  3D2M A;  4CAE A;  4H6Z A;  3QWZ A;  4II9 A;  1E60 A;  5A27 A;  2V3V A;  1Y9W A;  1PT0 A;  4XNH B;  2R93 A;  1YGH A;  2CY2 A;  4C2X A;  5H86 A;  3IU2 A;  2AE0 X;  1NE9 A;  3VWD A;  2JEV A;  5G21 A;  4AVC A;  4NF1 A;  1B6B A;  5C88 A;  1YRE A;  2Z10 A;  3S6G A;  1I50 A;  3DSB A;  1PUA A;  3HU2 A;  4JLY A;  4NEX A;  3F0A A;  3GTQ A;  1QSR A;  2C27 A;  2ZXV A;  5CNP A;  4B5P B;  4C2Z A;  4CAW A;  2FCK A;  3NE7 A;  2B4D B;  3FB3 A;  4ZGY B;  1R27 A;  3H5Z A;  4I49 A;  1AW8 B;  2JIR A;  5C82 A;  5I0C A;  5ISV A;  4AVB A;  1G8J A;  4J3G A;  3QC8 A;  2FSR A;  4B10 A;  1QSO A;  1TIQ A;  3TE4 A;  4CRZ A;  1YLE A;  1VHS A;  1XF8 A;  4K30 A;  4QC6 A;  3ZZI A;  3P2F A;  1SMY D;  2NAP A;  1Y1W A;  3PLX B;  5DYG A;  3TO7 A;  1ZYR D;  3S6K A;  3FNC A;  2ZW7 A;  4D7Z B;  1Y1V A;  2WB1 A;  1J4J A;  2D4O A;  5DWM A;  4MFQ A;  4FD6 A;  4JWP A;  1FY7 A;  4PSW A;  1YNJ D;  3TTH A;  2J8N A;  3R96 A;  4UCM A;  3ML1 A;  2ZPA A;  5T5I D;  3UY5 A;  1AA6 A;  3E0K A;  2KCW A;  2O28 A;  1TWH A;  1FDO A;  4HNY B;  3F5B A;  4E2A A;  3HKZ A;  4PSX A;  2QIR A;  4UCN A;  2QEC A;  2WPX A;  2DPS A;  4YFJ A;  3CF2 A;  1I12 A;  2OB0 A;  2B4B A;  3IWE A;  4CYP A;  2A6E D;  5GCN A;  3R9F A;  4ORF A;  4UA3 A;  5FVJ A;  4Y49 C;  2NVX A;  3S6H A;  2WAQ A;  1IYL A;  1S60 A;  2G6G A;  3MGD A;  3BJ8 A;  4C7H A;  3CZB A;  4DMR A;  4B13 A;  2Z3L A;  2WPW A;  1IYK A;  2E2I A;  1P0H A;  5T5M D;  1WWZ A;  3QQ8 A;  4A32 A;  2VBQ A;  2Z3K A;  2R98 A;  1TWG A;  2WSA A;  1PQE A;  2P0W A;  1SIW A;  1PQF A;  3DMR A;  4M85 A;  1YNN D;  2BUE A;  3T9Y A;  4B5O A;  1I21 A;  1VKC A;  1YX0 A;  1IB1 E;  1OZP A;  4KVO E;  3TT2 A;  2IV2 X;  4UCP A;  4CGL A;  4QBJ A;  2Z3M A;  2PC1 A;  4XPK A;  3JTK A;  3T90 A;  4AOK B;  3FIX A;  4NCZ A;  4CGM A;  4CYN A;  1Q2D A;  3OWC A;  4E0A A;  3PP9 A;  3G3S A;  1E18 A;  1QST A;  4JXQ A;  2Y0M A;  2YNC A;  5F48 A;  5DYI A;  4CRY G;  3P2H A;  2AE6 A;  3IGR A;  2HV2 A;  2REF A;  4B5P A;  2JA5 A;  2O5J D;  1Y7R A;  2ATR A;  1I1D A;  5H84 A;  2B4D A;  2B63 A;  1NMT A;  5KTC A;  1PQH A;  4UFW A;  4YRH A;  4KZT A;  4AG9 A;  2OU2 A;  4A31 A;  5AG6 A;  3W91 A;  1N71 A;  2PQ8 A;  2YGW A;  3D3S A;  4CRZ B;  2Z3N A;  3CXP A;  4KS9 A;  3EO4 A;  3HU1 A;  2YNE A;  2AJ6 A;  1DMR A;  4GS4 A;  1WLF A;  1WCM A;  5AG7 A;  1CZ5 A;  1XMT A;  1QSN A;  4R3L A;  5B6C A;  5F47 A;  2JIP A;  4QVT A;  3QB8 A;  2A68 D;  5AG4 A;  4R57 A;  2ZW5 A;  2VPY A;  3GTM A;  3H4Q A;  1EU1 A;  2REE A;  4B14 A;  2G5D A;  2CNS A;  2FT0 A;  1YR0 A;  4QIW A;  2OH1 A;  2JDD A;  4KLV A;  2P6G A;  1FDI A;  4A33 A;  1CZ4 A;  2YND A;  4PK2 A;  4F0Y A;  5JQ4 A;  1TWF A;  4CAF A;  4F0X A;  3TCV A;  1M1D A;  4XNH C;  5FTM A;  3TM7 B;  2B3U A;  3QQ7 A;  5JPH A;  2FIW A;  3R1K A;  4H89 A;  4JXR A;  5C18 A;  2WUU A;  4KOT A;  2JIO A;  3KKW A;  1KUV A;  2B3V A;  2EVN A;  1NSL A;  4UBR A;  3IR6 A;  4F6A A;  1ZC1 A;  2VXK A;  2JDC A;  3A9L A;  4EVY A;  2Q44 A;  2JA7 A;  4IF5 A;  4C2Y A;  2GIV A;  2ARH A;  4OAD A;  1OGY A;  4KOW A;  4B11 A;  1Y4Z A;  4UFX A;  1V0C A;  5F49 A;  2PJJ A;  1IW7 D;  2P6F A;  4KOY A;  2KI8 A;  4YGO A;  1CJW A;  2Q7B A;  4NOH A;  1S3Z A;  1LRZ A;  1KQG A;  3W6S A;  1Q2Y A;  1H5N A;  1S3S A;  1RO5 A;  4MJ8 A;  3K9U A;  1WK4 A;  3C26 A;  3PZJ A;  3TFY A;  4U5Y A;  5J8F A;  4DNC A;  5DWN A;  5HH1 A;  4BBH A;  4R9M A;  2R8V A;  1CM0 A;  4OAE A;  4XPL A;  3BJ7 A;  3I3G A;  2ZW6 A;  1KUX A;  4CGO A;  3LD2 A;  1S7N A;  3IR7 A;  4KOV A;  2CXA A;  3RYO A;  4GA6 A;  1KZF A;  3V8I A;  4HNW B;  3DR6 A;  3GY9 A;  1Q2C A;  3I9S A;  2VPW A;  2VPX A;  1XIX A;  1E5V A;  2FL4 A;  5E96 A;  2RC4 A;  4A30 A;  2G3A A;  2R7H A;  4JJX A;  5J8C A;  2JIM A;  4AZD A;  2P6E A;  4IUS A;  3EFA A;  3EY5 A;  4OLL A;  2JA6 A;  5FTJ A;  4FD4 A;  4CRY B;  2GAE A;  1MJ9 A;  3GTO A;  2OZG A;  1MJA A;  2VI7 A;  2PDO A;  1Q16 A;  4FD5 A;  3LOD A;  4XPD C;  4AON B;  4Q38 A;  4FD7 A;  4KUB A;  2FIA A;  4HNX B;  4JD6 A;  5HMN A;  2Q0Y A;  2A6H D;  4U9Z A;  2OZU A;  3GYA A;  2Z0Z A;  2DXQ A;  2B5G B;  3QAH A;  2BSW A;  3JVN A;  3PGP A;  5FTL A;  1IIC A;  5A28 A;  1MJB A;  2B58 A;  3CXS A;  2X7B A;  3DR8 A;  2PI8 A;  2Z11 A;  1Z4R A;  3GTJ A;  5G22 A;  2CNT A;  2A69 D;  3JUW A;  4CGN A;  2CW0 D;  4RV0 A;  3D2P A;  3FBU A;  1B87 A;  3OUG A;  5GLF A;  1Z9U A;  2NVY A;  2VQY A;  2Q4V A;  1M4G A;  2FXF A;  2G3T A;  4KUA A;  4XPD B;  4KSF A;  3G8W A;  4E8O A;  1MK4 A;  2J8M A;  4KDI A;  1S7K A;  1M4I A;  2GAN A;  4LUA A;  4UFV A;  1IID A;  5IB0 A;  2E7Z A;  4MI4 A;  2CNM A;  4MFZ A;  4UWI A;  3R9G A;  1G8K A;  3IR5 A;  2A4N A;  3FYN A;  4CAX A;  2EEO B;  4MY0 A;  4C68 A;  1CR5 A;  4BMH A;  2B5G A;  1SFO A;  3IWG A;  1R9T A;  2C45 A;  2BEI A;  4AG7 A;  4H6U A;  1R7R A;  3F8K A;  2HUZ A;  3GKR A;  4AAY A;  1PYU B;  2DPT A;  1BO4 A;  3D8P A;  2JIQ A;  3TIW A;  4CGP A;  4KDL A;  1YVO A;  2PNW A;  3FKI A;  1S7F A;  4MY3 A;  2PR1 A;  1VC3 B;  3GTG A;  1UHE A;  4CAV A;  2YNC C;  1YVK A;  4MFK A;  3SXO A;  2VUM A;  1UFH A;  4QB9 A;  1K83 A;  2NMT A;  5EBV A;  5EC4 A;  1QSM A;  2VZY A;  3IU1 A;  4KLN A;  1KUY A;  4Q36 A;  3TOA A;  1Y9K A;  4KO8 A;  2PRB A;  5C1B A;  1KQF A;  4KOS A;  4CYO A;  4KOR A;  2EUI A;  2K5T A;  1YK3 A;  3EC4 A;  4CYQ A;  2I79 A;  4A95 A;  2BL1 A;  4R87 A;  2E2H A;  1TWC A;  3R9E A;  1R57 A;  1DMS A;  3ZJ0 A;  4A2Z A;  4QUS A;  3HU3 A;  3DNS A;  2R7Z A;  1PU9 A;  2Q4Y A;  3FRM A;  2PIC A;  2BE5 D;  4CS0 B;  1QDN A;  5KTD A;  4MHD A;  2NYA A;  2DMR A;  1RXT A;  2GE3 A;  4KVX A;  4C7I A;  4M3S A;  4LX9 A;  5FTK A;  3TO9 A;  1QCS A;  4RS2 A;  4X5K A;  2R1I A;  4AYB A;  4RI1 A;  3EXN A;  2OZH A;  2VPZ A;  3N7Z A;  3W6X A;  4KOD A;  2FS5 A;  2FE7 A;  2I00 A;  4MBU A;  3TO6 A;  5AGE A;  5AG5 A;  2R92 A;  1Y5I A;  5BWA B;  2F5I A;  1S5K A;  3FXT A;  2QML A;  1H0H A;  4KLW A;  4PK3 A;  2HQY A;  3BLN A;  4KOX A;  4Y49 B;  3H0G A;  5KTA A;  1L0C A;  3O5A A;  1SQH A;  3VWE A;  2YU9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...