1YLEA

The structure of arginine/ornithine succinyltransferase subunit ai from pseudomonas aeruginosa.
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
342
structure length
330
Chain Sequence
GHMLVMRPAQAADLPQVQRLAADSPVGVTSLPDDAERLRDKILASEASFAAEVSYNGEESYFFVLEDSASGELVGCSAIVASAGFSEPFYSFRNETFVHASRSLSIHNKIHVLSLCHDLTGNSLLTSFYVQRDLVQSVYAELNSRGRLLFMASHPERFADAVVVEIVGYSDEQGESPFWNAVGRNFFDLNYIEAEKLSGLKHYPIYVPLLPDAAQESMGQVHPRAQITFDILMREGFETDNYIDIFDGGPTLHARTSGIRSIAQSRVVPVKIGEKSGRPYLVTNGQLQDFRAVVLDLDWAPGKPVALSVEAAEALGVGEGASVRLVAVGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginine N-succinyltransferase, alpha chain
publication title The structure of arginine/ornithine succinyltransferase subunit AI from Pseudomonas aeruginosa.
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 93
structure length 330
sequence length 342
ec nomenclature ec 2.3.1.109: Arginine N-succinyltransferase.
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04958 AstA Arginine N-succinyltransferase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1yleA02
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1yleA01
4KOUA 5J8CA 2AE6A 1R7RA 1YLEA 2FIAA 2ZXVA 5H86A 5FTKA 4KOXA 4AVAA 4K30A 1KUYA 3GTLA 2R98A 2JIOA 1RXTA 2PQ8A 1IIDA 2K5TA 3GTJA 3R95A 2Y0SA 2ZW7A 1LRZA 2VI7A 3CXQA 2VEZA 3I9SA 2CNSA 5F46A 1QSMA 5HH1A 1I21A 3IR7A 4X5KA 3CF2A 2FT0A 4M3SA 1B87A 2NMTA 4GS4A 1IYLA 1PQEA 1UFHA 1QSNA 4AZDA 4CRZB 4F0YA 5FVJA 2ARHA 1BOBA 3S6GA 1NE9A 3P2HA 3F0AA 3FB3A 1I12A 2R7HA 4IF5A 3PGPA 4MY3A 1PT0A 5T5ID 3TTHA 3C26A 3IR6A 3W6XA 4Y49C 5I0CA 1S60A 1I1DA 3BJ7A 4R3KA 1N71A 3S6HA 3JUWA 4D7ZB 2HV2A 4KLNA 4PK3A 4CRZA 4KLVA 4XPLA 5H84A 2Q7BA 4LUAA 3T9YA 3QC8A 1CR5A 4B5PB 4QIWA 3GTGA 5KTCA 1CZ4A 2P6EA 5JQ4A 5FTJA 4KOYA 4AVBA 3EFAA 4YRHA 1YGHA 3W6SA 2QMLA 2GIVA 4FD6A 4II9A 2F5IA 4UA3A 5C18A 3G8WA 3TM7B 2H5MA 4DNCA 3EC4A 2VBQA 1QSTA 1TMOA 4B5PA 2VXKA 4PSWA 1TWGA 3HU1A 2BL1A 2J8RA 1U6MA 4QVTA 2B58A 2PR1A 2BUEA 2Q44A 2VZZA 3GTMA 2B63A 2R92A 5DYIA 4NXYA 4PK2A 4RI1A 3G3SA 4AONB 4QB9A 1VKCA 3H0GA 3QB8A 4I49A 3W91A 3GTQA 1M4GA 1Y1VA 2G0BA 4U9YA 4RS2A 1R27A 2QECA 4KODA 1XE4A 3CXSA 4BMHA 2CNTA 1E61A 3FXTA 1PQFA 5FTMA 4HNXB 4AOKB 2BSWA 4KDIA 4H89A 2VPYA 2JIQA 2VUMA 1MJBA 1H5NA 3F8KA 3D8PA 1VHSA 3R9EA 3O5AA 4NSQA 1DMSA 2G3TA 3ZJ0A 1Y5IA 2REEA 2A4NA 2PC1A 3RYOA 3DR8A 2R8VA 1Y9KA 2PR8A 3CQZA 4CAVA 4MBUA 2AJ6A 2JIMA 1UHDA 2OB0A 1Y7RA 3TO7A 3FNCA 3WR7A 5CNPA 4LX9A 5DWNA 4E2AA 1M4IA 1K83A 1IICA 5IB0A 3R9FA 4FD7A 1RO5A 3DMRA 2CNMA 1QSRA 4AAYA 3PLXB 2JIPA 3DSBA 4CAXA 2OU2A 1IB1E 2REFA 4KO8A 4KORA 2R93A 2Q4YA 2Q0YA 3N7ZA 1PU9A 2WPWA 5C82A 2VPZA 1ON0A 2R1IA 1PYQA 3FBUA 3D2PA 3TCVA 3ZZIA 3QAHA 2BEIA 5EPPA 2B3UA 4MHDA 4HKFA 4JWPA 4KZTA 5E96A 2C45A 2ZW4A 3GKRA 2G3AA 1MJAA 2ATRA 1Z4EA 4HNWB 1SFOA 1VC3B 2PRBA 2V45A 1KQGA 2WB1A 1TWCA 3FRMA 1QCSA 2YU9A 1S7NA 1SIWA 4AG9A 5KTDA 2JIRA 3LODA 2JDCA 4C2MA 4H6ZA 2E7ZA 2FCKA 1FDIA 5F49A 1R57A 4KOWA 4R87A 3GTPA 3DDDA 3UY5A 2DMRA 2JEVA 2OH1A 4R57A 4FD4A 1PUAA 1Y9WA 5EC4A 2WAQA 1E5VA 1S7KA 1PT1A 3QWZA 3GY9A 5J8FA 3CXPA 3HU3A 1NMTA 1MK4A 2V3VA 4NF1A 2Z0ZA 2JDDA 2HUZA 3JVNA 1KZFA 3S6KA 1IYKA 1S5KA 1K4JA 4ZBGA 4CRYG 2P0WA 4ORFA 2QIRA 3R1KA 3TIWA 4AVCA 1P0HA 1FDOA 1M44A 1XEBA 3TOAA 2PSWA 1PYUB 1YVKA 1S7FA 4RV0A 4E0AA 4IUSA 4R9MA 1NSLA 4KUBA 2KCWA 3OWCA 3OUGA 1WLFA 2B4DA 4PV6A 1CZ5A 2JLMA 2GANA 2E2HA 1Q16A 3HKZA 1IW7D 5C88A 4KDLA 2OZHA 4MI4A 2E2IA 3IWGA 1DMRA 2R7ZA 1MJ9A 4KVOE 1G8JA 2RC4A 3GYAA 3BLNA 4HNYB 3DNSA 1OGYA 1CJWA 1TWFA 3BJ8A 3QQ7A 1L0CA 4JXRA 4F6AA 2GE3A 5B6CA 1S7LA 5IX3A 2X7BA 2B4BA 3T90A 1I50A 3FKIA 3FYNA 2B5GB 4XPKA 3B8GA 5EBVA 1UHEA 1Z4RA 3VWEA 4XPDC 2Z10A 4OAEA 2VPXA 1S3SA 4UWIA 3V8IA 2ZW5A 1WK4A 4J3GA 4AG7A 2KI8A 3PZJA 3IGRA 1Y4ZA 2B5GA 2DXQA 4AYBA 5DWMA 3TOBA 2O28A 4FD5A 1P4NA 2VPWA 1E60A 4H6UA 4KVME 2JA7A 2FE7A 2NVYA 1R9TA 4KUAA 5HMNA 5C1BA 4E8OA 4OLLA 1Q2DA 1QSOA 3D2MA 1YK3A 4NEXA 4U9ZA 3IR5A 2D4OA 3SXOA 1Q2YA 4KOVA 1B6BA 4CAWA 3PP9A 1WWZA 3TO6A 2PMZA 1G8KA 4CS0B 4KVXA 2VQYA 1KUXA 3KKWA 2FSRA 3GTOA 1M4DA 2ZPAA 3MGDA 1OZPA 1QDNA 4R3LA 4NCZA 1TWAA 2JA5A 1SQHA 1E32A 2Y0MA 3F5BA 1Q2CA 2I79A 1KUVA 4XPDB 1XF8A 2IV2X 4OADA 3R9GA 2HQYA 4CS0A 2Z11A 1Z9UA 3LD2A 3NE7A 4MY0A 4M85A 4AB7A 3TT2A 2NYAA 2FS5A 5T5MD 1YREA 1CM0A 1BO4A 2EUIA 2VZYA 5GLFA 3E0KA 2B4DB 4JXQA 4XNHC 1H0HA 4GA5A 1KQFA 5F48A 2Q4VA 1GHEA 2C27A 2D4PA 3S6FA 4PSXA 3K9UA 4KOSA 1AA6A 2J8MA 3D3SA 3H4QA 3DR6A 2OZUA 4EVYA 1J4JA 2JA6A 1S3ZA 2ZW6A 3I3GA 1FY7A 1PPYA 2EVNA 4KOTA 1V0CA 1WCMA 3R96A 3GTKA 5F47A 5IV0A 4YFJA 1XIXA 4L89A 3FIXA 3SHPA 4QC6A 5KTAA 4YGOA 4GA6A 2J8NA 1E18A 4JLYA 4MJ8A 1AW8B 5ISVA 5JPHA 4L8AA 2FIWA 3EY5A 3ML1A 2IL4A 3P2FA 2PJHB 4UBRA 1EU1A 1M1DA 1YVOA 2EEOB 1XMTA 2I00A 1I3QA 4UWJA 4DMRA 2P6FA 1Y1WA 2P6GA 5GCNA 2NAPA 2OZGA 1TWHA 1TIQA 4QUSA 5FTNA 4Y49B 2NVXA 2FXFA 4JD6A 3TO9A 2PDOA 3EXNA 3SXNA 4JJXA 3TFYA 4KLWA 5FTLA 4XNHB 4CRYB 2B3VA 2CY2A 2Q04A 3TE4A 3EO4A 2WPXA 4QBJA 1YR0A 1PQHA 1YX0A 2FL4A 3VWDA 3QQ8A 4B5OA 4ONUA 3HU2A 5DYGA 4U5YA
chains in the Genus database with same CATH superfamily
4KOUA 3RAMA 4C2YA 5J8CA 2AE6A 3IFEA 3IC1A 2ZXVA 1JWQA 2C6PA 5FTKA 2RB7A 4KOXA 3KR5A 4NGQA 1YLOA 3H5ZA 1IIDA 2ZENA 2Y0SA 4BINA 2ZW7A 3D7HA 2VEZA 1ZG8A 1QSMA 1F57A 2PJ4A 3CF2A 2FT0A 4M3SA 1Z8TA 3IJ3A 1CPSA 5D8NA 4AZDA 3FJUA 4P4JA 1VGYA 1NSAA 4A32A 2DEAA 4MFJA 4F0XA 3C26A 5I0CA 1S60A 3KGQA 1ARMA 3BJ7A 3JUWA 4D7ZB 2HV2A 4PK3A 4XPLA 2Q7BA 2ZOGA 4Q36A 3EFAA 5AG5A 1ZLIA 4CYQA 3M3GA 1VHEA 2BOAA 2H5MA 4DNCA 1TMOA 2EK9A 3T8WA 1TWGA 2BL1A 1U6MA 2Q44A 2VZZA 3BI1A 4NXYA 4RI1A 4AONB 2GFQA 2AFOA 4F8ZA 4I49A 3GTQA 4MHZA 2G0BA 2ZEDA 2ENGA 1R27A 4FUUA 2ZEMA 1XE4A 2CNTA 4AOKB 3QAYA 4P6YA 4Q7AA 1H5NA 3R9EA 2A4NA 1Y9KA 2PR8A 3HUVA 3KHZA 2AJ6A 2OB0A 4KSFA 3FNCA 3WR7A 5HVGA 1XBUA 3R9FA 2BH0A 4PXCA 2KQAA 1R3NA 4CAXA 2REFA 2Z3MA 2Q4YA 3PB8X 2AE0X 3GB0A 3N7ZA 3PEIA 4Z65A 5LRJA 2VPZA 2ZOFA 1ZG7A 2CTBA 1VHOA 2CIJA 3QAHA 1ELMP 2F8HA 3QNVA 3IU1A 2PIYA 4HNWB 4MXUA 4C2XA 1TWCA 1QCSA 2JIRA 2E7ZA 2Q4ZA 4R87A 2DMRA 2JEVA 2OH1A 4EMEA 1Y0YA 5EC4A 2WAQA 1S7KA 1PT1A 5K8OA 3QWZA 1VIXA 5J8FA 2PJ6A 1MK4A 1AUGA 5BWAB 2HUZA 2PJCA 5A28A 1KZFA 3X2OA 4MFQA 1BLLE 2QIRA 3X2PA 4AVCA 1FDOA 2O4HA 1PYUB 1S7FA 3PBEA 1LAPA 3CZXA 2GREA 1CZ5A 1N10A 2E2HA 5C88A 2OZHA 3MRUA 3WABA 3IWGA 1DMRA 3BXMA 4GM5A 2FVGA 3SI2A 1G8JA 2RC4A 4CGNA 3GYAA 3PB6X 3SJXA 1L0CA 5B6CA 2B4BA 2BO9A 3SUKA 2OOTA 2BE5D 3FYNA 2A6HD 5EBVA 4OC5A 2CTCA 4LQGA 3B3WA 4OAEA 3VH9A 2WYRA 1Y4ZA 2B5GA 4UIAA 4MFLA 1P4NA 4OMEA 3LMSA 3KHXA 1YK3A 4G1PA 3PP9A 4PXBA 1Z8WA 3KKWA 2A69D 3S9MA 1M4DA 4PPZA 5AG6A 1OZPA 1TWAA 2JA5A 1E32A 3F5BA 4CGLA 1Q2CA 5HVHA 4P4DA 3RZAA 3X2GA 2ZEGA 2HQYA 2GLJA 3NH4A 4MY0A 3SI1A 2Q51A 4B12A 2FS5A 5T5MD 3SUJA 5G20A 2EUIA 3FH4A 3E0KA 2POKA 1Q7LA 1KQFA 4YWYA 5F48A 3PFEA 3NH5A 3SULA 4KOSA 4NFRA 3H4QA 4B11A 4GXHA 5JH9A 2OZUA 1J4JA 2QVPA 1PPYA 2IMOA 2EVNA 2VL1A 3FX6A 1V0CA 3GTKA 4ONWA 5J1QA 4C68A 4DUKA 2C6GA 2XEFA 4JLYA 4MJ8A 1LOKA 1BPNA 5JPHA 2V77A 2IL4A 2PJ5A 2PJHB 2EEOB 1XMTA 3JRUA 4UWJA 2P6FA 1Y1WA 4K3NA 1TIQA 2ABZA 5FTNA 3TFYA 2Q04A 3TE4A 3D67A 2WPXA 4P4FA 3SJGA 3B35A 1YX0A 3D30A 2I3CA 4ONUA 3ENGA 5DYGA 5H86A 3I1UA 3GIUA 3WC7A 4AXVA 2ZELA 4K30A 2PJAA 3GTLA 2JEWA 2CF4A 3CXQA 3IR7A 4JCWA 3H8GA 2NMTA 4GS4A 1PQEA 1QSNA 4CRZB 4F0YA 3JTKA 1NE9A 2RFHA 3F0AA 3FB3A 5CBMA 2R7HA 2AFWA 3PGPA 3TTHA 3W6XA 4Y49C 5GLXA 4KLVA 1XMBA 3BHXA 4C7IA 4LUAA 1XOVA 1WC2A 1CPXA 4B5PB 5KTCA 1CZ4A 5JQ4A 3ISZA 4YRHA 1YGHA 4B13A 4MCQA 5ELYA 5C18A 3EC4A 3SUMA 1FNOA 4PSWA 2J8RA 4QVTA 1XFOA 3K9TA 2R92A 4KSIA 4PK2A 4X8IA 4R76A 3H0GA 3B3VA 1TXRA 4NJRA 4FG2A 3NA6A 3CXSA 3FXTA 2BSWA 4H89A 2VPYA 4MHNA 2VUMA 3SJEA 1MJBA 1HD5A 2REEA 4UFVA 3RYOA 2AFMA 2R8VA 2JIMA 3KR4A 4LX9A 4ZGYB 1M4IA 1K83A 2PJ1A 2IJZA 4FD7A 1RO5A 3B3TA 4AAYA 2JIPA 2OU2A 4KO8A 1M4LA 4A30A 1LANA 1ON0A 2R1IA 5EMIA 4C2ZA 1PYQA 2G9DA 3TCVA 4MHDA 2B3UA 1TKJA 1YMEA 1Z2LA 3D66A 3FECA 1GYTA 2ZW4A 1HDUA 2G3AA 1MJAA 4L48A 4R7MA 2V45A 2A68D 2WB1A 3FRMA 1SIWA 5HXDA 4NGTA 4KOWA 2Z3LA 4A94A 3GTPA 3CDXA 5AG4A 3HU3A 1NMTA 2AFSA 3JVNA 1S5KA 2G6GA 3GUXA 1PYTB 1M44A 4DYOA 5G21A 1IOFA 4IUSA 4R9MA 4AVRA 1Q16A 3HKZA 4JP6A 2E2IA 2PJ3A 3D7GA 1BW3A 3DNSA 3BJ8A 1TWFA 3QQ7A 3PFOA 4F6AA 4RN7A 1S7LA 5IX3A 4CYPA 3T90A 1I50A 1CX8A 4UF4A 3B8GA 1UHEA 4MHYA 2Z10A 2VPXA 4UWIA 2ZW5A 1KWMA 4CGOA 3D7FA 1WK4A 2KI8A 2ANPA 5HVFA 2DXQA 4UEEA 4AYBA 1ARLA 4BD9A 2VPWA 1E60A 1ZC1A 4CGMA 5HMNA 3L2NA 3D2MA 3X2IA 2D4OA 4KOVA 4A2ZA 1B6BA 4JJOA 4CAWA 2XEGA 1YNJD 4CS0B 4KVXA 2VQYA 4R6TA 3WC6A 4H2KA 3GTOA 4UFXA 3MGDA 3TX8A 2IQ6A 1DTDA 3BI0A 1SQHA 1H8LA 2PVVA 2G5DA 1AMPA 2PJBA 2I79A 2XEIA 1KUVA 4XPDB 5G1ZA 1R43A 1XF8A 4OADA 3R9GA 3CZBA 1Z9UA 5LYFA 2Z3NA 3TT2A 2NYAA 1YREA 1X10A 4P4BA 5GLFA 4JXQA 1H0HA 2C27A 2XEJA 3B3SA 3S6FA 3D3SA 2PRQA 2J9AA 3DR6A 3KZWA 2YNEA 4A33A 2ZW6A 2YNCA 3HLPA 4KOTA 1X12A 4L89A 5JGFA 3SHPA 4GA6A 2J8NA 1AW8B 4L8AA 1QMUA 2FIWA 4ZM7A 3P2FA 1M1DA 4P4EA 1F2OA 2I00A 4JYWA 4FFTA 4Y49B 1IU8A 2FXFA 4JD6A 3EXNA 3SXNA 4JJXA 4PXEA 5FTLA 4TNUA 4XNHB 4RUHA 2GU2A 2NSMA 1LAMA 1ELLP 1YR0A 4MMOA 3VWDA 3MN8A 2ZEEA 3IWWA 2V8VA 4ZI6A 6CPAA 1YQEA 1KUYA 2R98A 1RXTA 3SI0A 2K5TA 3GTJA 4MFZA 4Q38A 4OP4A 2VI7A 4W9YA 2CNSA 5HH1A 4UFWA 3RO0A 2DPSA 2DPTA 5A27A 3B7IA 1IYLA 3VARA 3KL9A 2ARHA 1BOBA 3P2HA 2PICA 4IF5A 5I4MA 5T5ID 3IR6A 4HPSA 1N71A 3S6HA 4KLNA 4CRZA 2PVWA 3D68A 4IAVA 5IB9A 3T9YA 3GTGA 5FTJA 4AVBA 4M6GA 5CPAA 3W6SA 2QMLA 5LYDA 3X2NA 4MCPA 4II9A 2F5IA 3X2KA 4UA3A 2PJ9A 3GLJA 2VBQA 1QSTA 4B5PA 3TC8A 2HB6A 2VXKA 3HU1A 4P10A 3X2MA 2V8GA 5DYIA 3G3SA 4QB9A 1VKCA 1M4GA 4U9YA 4RS2A 2QECA 2A6ED 1E61A 1TKHA 5FTMA 4KDIA 1L8FA 1ZG9A 3F8KA 3D8PA 1VHSA 3O5AA 1DMSA 2G3TA 7CPAA 4F9UA 4MCSA 4MBUA 3PBBA 2QYVA 1UHDA 2DF5A 3TO7A 5CNPA 2Q7SA 5IB0A 1ZYRD 3DMRA 2CNMA 3DSBA 1Z5RA 1IB1E 3D4UA 5C82A 3VATA 3K2KA 3KI9A 3FBUA 3V38A 4NGNA 3D2PA 1BW4A 2C45A 1Z4EA 4MFKA 1SFOA 1VC3B 2PRBA 4FG4A 3WC5A 2YU9A 1S7NA 1QQ9A 4UCPA 5KTDA 4KSAA 3LODA 2JDCA 2OR4A 4IK2A 2FCKA 5F49A 1R57A 2Z3OA 3H8EA 1A2ZA 3FEDA 4FD4A 1PUAA 2PJ2A 1E5VA 3GY9A 3CXPA 4OC1A 2PCUA 4NF1A 2PNWA 2PJ8A 5K8MA 3S6KA 1IYKA 2O53A 1K4JA 2P0WA 4UIBA 4ORFA 3TIWA 1CG2A 1P0HA 4PXDA 2WSAA 2PSWA 1YVKA 4KUBA 2KCWA 3OWCA 3OUGA 4FWUA 1TKFA 2GANA 3IIBA 1TF9A 4UCMA 4P45A 2WZNA 4KVOE 2R7ZA 2CW0D 1MJ9A 3BLNA 4HNYB 4CAFA 3X2LA 4JXRA 2GE3A 3FKIA 3S9LA 2QJ8A 4XPKA 1Z4RA 1EE3P 4A39A 2V8DA 3V8IA 2EBJA 2JBKA 4M6HA 4AG7A 3PZJA 3IGRA 2ZEOA 3D7DA 5DWMA 4FD5A 3A9LA 4KVME 2JA7A 4M6IA 2NVYA 4NGPA 2Z3PA 5C1BA 4E8OA 4OLLA 1IY7A 4U9ZA 1Q2YA 4BBHA 4DJLA 3TO6A 2PMZA 4B14A 1Y0RA 3NH8A 1FT7A 2C6CA 4UEZA 3KASA 4MCRA 1QDNA 4R3LA 4YU9A 3RBUA 3IEHA 4B6ZA 2GAEA 2PJ0A 4CS0A 2Z11A 3NFZA 4AB7A 4FBEA 5LRKA 1BO4A 2ZEFA 2EWBA 1XRYA 4ZYQA 4GA5A 2BCOA 3IU2A 1GHEA 2PIZA 2D4PA 2F7VA 3K9UA 1AA6A 2J8MA 4ENGA 5LRGA 1FY7A 3RNZA 4MRIA 2AFXA 4JS7A 5IV0A 1XIXA 4QC6A 4YGOA 1HDQA 5ISVA 5F09A 3EY5A 3ML1A 4UEFA 1EU1A 2P6GA 2AFUA 2NAPA 1TWHA 8CPAA 4WJBA 3CPXA 4X2TA 1LFWA 4FAIA 2C1CA 4CRYB 2CY2A 3EO4A 2PJJA 1IGBA 1PQHA 2EO8A 4B5OA 3HU2A 1YW6A 4U5YA 5LYIA 1R7RA 1YLEA 2HCZX 2FIAA 2ODFA 4A37A 1JQGA 4AVAA 2YGWA 2JIOA 2PQ8A 4NGMA 4LQ6A 3R95A 1LRZA 4A31A 1Y7EA 3KQXA 1BPMA 1BAVA 3I9SA 5F46A 1I21A 4P44A 4X5KA 5G22A 2PE3A 1B87A 3ISXA 1UFHA 4PQAA 3WT4A 1OA7A 5FVJA 2Q43A 3S6GA 1I12A 4CPAA 4MY3A 1PT0A 1I1DA 4R3KA 3X2HA 5H84A 3QC8A 1CR5A 4QIWA 3X2JA 1Z8XA 2P6EA 4KOYA 2YNDA 2GIVA 4FD6A 3CPAA 3PB4X 3FEEA 3G8WA 2O5JD 3TM7B 4CGPA 1RTQA 4IHMA 1HEEA 4KS9A 1YW4A 3LACA 2B58A 4NGRA 2PR1A 2BUEA 1ZLHA 3GTMA 4MFPA 2B63A 5LYLA 3IWEA 3QB8A 3W91A 5K8NA 4P4IA 1Y1VA 5THWA 4KODA 4BMHA 1PQFA 4HNXB 5AG7A 2JIQA 3LWUA 4NSQA 3ZJ0A 1Y5IA 1CP6A 4NJQA 2PC1A 3DR8A 2AFZA 4OKOA 4EFDA 3CQZA 1F2PA 4CAVA 1Y7RA 4CYNA 4TWEA 2HC9A 4F9VA 5DWNA 4E2AA 1IICA 4NOHA 2YUJA 5DS0A 1QSRA 2GLFA 3PLXB 3B2YA 1ZO0A 4KORA 4ZX9A 3N5FA 2R93A 2Q0YA 1XJOA 2V8HA 3DGVA 1PU9A 2WPWA 4JZ0A 1CBXA 4UCNA 3ZZIA 2BEIA 5EPPA 4NGSA 2Z3KA 4HKFA 4JWPA 4KZTA 5E96A 3GKRA 2ATRA 1KQGA 2PI8A 2ZEPA 4AG9A 4C2MA 3NE8A 4H6ZA 1FDIA 4X3RA 3S9NA 3DDDA 3UY5A 2JBJA 4R57A 4ZY0A 1Y9WA 1IOIA 2ZEHA 3FMCA 2V3VA 2Z0ZA 2JDDA 2CXAA 4ZBGA 5GM9A 4CRYG 3R1KA 2EK8A 1XEBA 3TOAA 2WUUA 4RV0A 4E0AA 3V7ZA 1DE4C 1NSLA 4PV6A 1WLFA 2B4DA 2JLMA 4OIWA 1IW7D 4KDLA 1YNND 4MI4A 2PJ7A 1OGYA 1CJWA 1OBRA 2X7BA 3DLJA 1Z8LA 2B5GB 4ZY2A 3VWEA 3B3CA 4XPDC 1SMYD 4FERA 1S3SA 4OIDA 3KQZA 4J3GA 4CAEA 5AGEA 3TOBA 5GLYA 1LCPA 2O28A 1TF8A 3CT9A 4MHPA 4EWTA 4R8FA 4H6UA 2FE7A 1R9TA 4KUAA 1AYEA 2NYQA 1UWYA 3PB9X 5K8PA 1Q2DA 1CP7A 1QSOA 4NEXA 3IR5A 3SXOA 1WWZA 4OC3A 1G8KA 3H8FA 4WWVA 1KUXA 1YSJA 3PB7X 2FSRA 5JM6A 2ZPAA 4NCZA 2Y0MA 4O23A 2IV2X 4C7HA 4ZY1A 3LD2A 3NE7A 4M85A 4OC0A 1CM0A 2VZYA 3PRTA 2B4DB 4XNHC 2Q4VA 4OC2A 4A38A 4A95A 4PSXA 4JP7A 4EVYA 2JA6A 1S3ZA 4OC4A 3SJFA 3I3GA 5D29A 4B10A 3FF3A 1WCMA 3R96A 5F47A 3IO1A 4YFJA 3FIXA 4ZX8A 1OA9A 5KTAA 1PCAA 1E18A 4CYOA 4UBRA 1YVOA 1I3QA 4DMRA 5GCNA 2OZGA 4QUSA 3FVLA 2NVXA 3TO9A 2PDOA 4KLWA 2B3VA 2YNCC 5H4UA 4QBJA 2FL4A 3QQ8A
chains in the Genus database with same CATH topology
4KOUA 4C2YA 5J8CA 2AE6A 1R7RA 1YLEA 2FIAA 2ZXVA 5H86A 5FTKA 4KOXA 4AVAA 4K30A 1KUYA 3GTLA 3H5ZA 2R98A 2YGWA 2JIOA 1RXTA 2PQ8A 1IIDA 2K5TA 3GTJA 3R95A 2Y0SA 4MFZA 4Q38A 2ZW7A 1LRZA 4A31A 2VI7A 3CXQA 2VEZA 3I9SA 2CNSA 5F46A 1QSMA 4UFWA 5HH1A 1I21A 3IR7A 2DPSA 4X5KA 3CF2A 2FT0A 5G22A 4M3SA 2DPTA 5A27A 1B87A 2NMTA 4GS4A 1IYLA 1PQEA 1UFHA 1QSNA 4AZDA 4CRZB 4F0YA 5FVJA 2ARHA 3JTKA 1BOBA 3S6GA 1NE9A 3P2HA 3F0AA 4A32A 3FB3A 4MFJA 1I12A 2R7HA 2PICA 4IF5A 3PGPA 4MY3A 1PT0A 5T5ID 3TTHA 3C26A 3IR6A 3W6XA 4F0XA 4Y49C 5I0CA 1S60A 1I1DA 3BJ7A 4R3KA 1N71A 3S6HA 3JUWA 4D7ZB 2HV2A 4KLNA 4PK3A 4CRZA 4KLVA 4XPLA 5H84A 2Q7BA 4C7IA 4LUAA 3T9YA 3QC8A 1CR5A 4B5PB 4QIWA 3GTGA 5KTCA 1CZ4A 2P6EA 5JQ4A 5FTJA 4KOYA 4AVBA 4Q36A 3EFAA 4YRHA 1YGHA 5AG5A 3W6SA 2QMLA 2YNDA 2GIVA 4B13A 4FD6A 4CYQA 4II9A 2F5IA 4UA3A 5C18A 2O5JD 3G8WA 3TM7B 4CGPA 2H5MA 4DNCA 3EC4A 2VBQA 1QSTA 1TMOA 4B5PA 2VXKA 4PSWA 1TWGA 4KS9A 3HU1A 2BL1A 2J8RA 1U6MA 4QVTA 2B58A 2PR1A 2BUEA 2Q44A 2VZZA 3GTMA 4MFPA 2B63A 2R92A 5DYIA 4NXYA 4PK2A 4RI1A 3G3SA 4AONB 4QB9A 1VKCA 3H0GA 3IWEA 3QB8A 4I49A 3W91A 3GTQA 1M4GA 1Y1VA 2G0BA 4U9YA 4RS2A 1R27A 2QECA 4KODA 1XE4A 3CXSA 4BMHA 2CNTA 2A6ED 1E61A 3FXTA 1PQFA 5FTMA 4HNXB 4AOKB 2BSWA 4KDIA 4H89A 2VPYA 5AG7A 2JIQA 2VUMA 1MJBA 1H5NA 3F8KA 3D8PA 1VHSA 3R9EA 3O5AA 4NSQA 1DMSA 2G3TA 3ZJ0A 1Y5IA 2REEA 4UFVA 2A4NA 2PC1A 3RYOA 3DR8A 2R8VA 1Y9KA 2PR8A 3CQZA 4CAVA 4MBUA 2AJ6A 2JIMA 1UHDA 2OB0A 1Y7RA 3TO7A 4KSFA 3FNCA 3WR7A 4CYNA 5CNPA 4LX9A 4ZGYB 5DWNA 4E2AA 1M4IA 1K83A 1IICA 5IB0A 3R9FA 4FD7A 4NOHA 1ZYRD 2YUJA 1RO5A 3DMRA 2CNMA 1QSRA 4AAYA 3PLXB 2JIPA 3DSBA 4CAXA 2OU2A 1IB1E 2REFA 2Z3MA 1ZO0A 4KO8A 4KORA 2R93A 2Q4YA 2Q0YA 2AE0X 3N7ZA 1PU9A 2WPWA 4A30A 5C82A 2VPZA 1ON0A 2R1IA 4C2ZA 1PYQA 3FBUA 3D2PA 4UCNA 3TCVA 3ZZIA 3QAHA 2BEIA 5EPPA 2B3UA 4MHDA 2Z3KA 4HKFA 4JWPA 4KZTA 5E96A 2C45A 2ZW4A 3GKRA 2G3AA 1MJAA 3IU1A 2ATRA 1Z4EA 4HNWB 1SFOA 1VC3B 2PRBA 2V45A 2A68D 1KQGA 2WB1A 4MFKA 1TWCA 4C2XA 3FRMA 1QCSA 2YU9A 1S7NA 4UCPA 2PI8A 1SIWA 4AG9A 4KSAA 5KTDA 2JIRA 3LODA 2JDCA 4C2MA 4H6ZA 2E7ZA 2FCKA 1FDIA 5F49A 1R57A 4KOWA 2Z3OA 4R87A 2Z3LA 3GTPA 3DDDA 3UY5A 2DMRA 2JEVA 2OH1A 4R57A 4FD4A 1PUAA 5AG4A 1Y9WA 5EC4A 2WAQA 1E5VA 1S7KA 1PT1A 3QWZA 3GY9A 5J8FA 3CXPA 3HU3A 1NMTA 1MK4A 2V3VA 4NF1A 2PNWA 2Z0ZA 5BWAB 2JDDA 2HUZA 3JVNA 5A28A 1KZFA 3S6KA 1IYKA 1S5KA 2CXAA 1K4JA 4ZBGA 4MFQA 4CRYG 2P0WA 4ORFA 2G6GA 2QIRA 3R1KA 3TIWA 4AVCA 1P0HA 1FDOA 1M44A 1XEBA 2WSAA 3TOAA 2PSWA 2WUUA 1PYUB 1YVKA 1S7FA 4RV0A 5G21A 4E0AA 4IUSA 4R9MA 1NSLA 4KUBA 2KCWA 3OWCA 3OUGA 1WLFA 2B4DA 4PV6A 1CZ5A 2JLMA 2GANA 2E2HA 1Q16A 3HKZA 1IW7D 5C88A 4KDLA 4UCMA 2OZHA 1YNND 4MI4A 2E2IA 3IWGA 1DMRA 2R7ZA 2CW0D 1MJ9A 4KVOE 1G8JA 2RC4A 4CGNA 3GYAA 3BLNA 4HNYB 3DNSA 4CAFA 1OGYA 1CJWA 1TWFA 3BJ8A 3QQ7A 1L0CA 4JXRA 4F6AA 2GE3A 5B6CA 1S7LA 5IX3A 2X7BA 4CYPA 2B4BA 3T90A 1I50A 3FKIA 2BE5D 3FYNA 2A6HD 2B5GB 4XPKA 3B8GA 5EBVA 1UHEA 1Z4RA 3VWEA 4XPDC 1SMYD 2Z10A 4OAEA 2VPXA 1S3SA 4UWIA 3V8IA 2ZW5A 4CGOA 1WK4A 4J3GA 4AG7A 2KI8A 4CAEA 3PZJA 5AGEA 3IGRA 1Y4ZA 2B5GA 2DXQA 4AYBA 5DWMA 3TOBA 2O28A 4FD5A 4MFLA 3A9LA 1P4NA 2VPWA 1E60A 4H6UA 4KVME 2JA7A 1ZC1A 4CGMA 2FE7A 2NVYA 1R9TA 4KUAA 5HMNA 2Z3PA 5C1BA 4E8OA 4OLLA 1Q2DA 1QSOA 3D2MA 1YK3A 4NEXA 4U9ZA 3IR5A 2D4OA 3SXOA 1Q2YA 4KOVA 4A2ZA 1B6BA 4BBHA 3PP9A 4CAWA 1WWZA 3TO6A 1YNJD 2PMZA 4B14A 1G8KA 4CS0B 4KVXA 2VQYA 1KUXA 3KKWA 2FSRA 2A69D 3GTOA 1M4DA 4UFXA 2ZPAA 3MGDA 5AG6A 1OZPA 1QDNA 4R3LA 4NCZA 1TWAA 2JA5A 1SQHA 1E32A 2Y0MA 3F5BA 2G5DA 4CGLA 2GAEA 1Q2CA 2I79A 1KUVA 4XPDB 5G1ZA 1XF8A 2IV2X 4OADA 3R9GA 2HQYA 3CZBA 4C7HA 4CS0A 2Z11A 1Z9UA 3LD2A 3NE7A 2Z3NA 4MY0A 4M85A 4AB7A 3TT2A 2NYAA 4B12A 2FS5A 5T5MD 1YREA 5G20A 1CM0A 1BO4A 2EUIA 2VZYA 5GLFA 3E0KA 2B4DB 4JXQA 4XNHC 1H0HA 4GA5A 1KQFA 5F48A 2Q4VA 3IU2A 1GHEA 2C27A 4A95A 2D4PA 3S6FA 4PSXA 3K9UA 4KOSA 1AA6A 2J8MA 3D3SA 3H4QA 4B11A 3DR6A 2OZUA 2YNEA 4EVYA 1J4JA 2JA6A 1S3ZA 4A33A 2ZW6A 2YNCA 3I3GA 4B10A 1FY7A 1PPYA 2EVNA 4KOTA 1V0CA 1WCMA 3R96A 3GTKA 5F47A 5IV0A 4YFJA 1XIXA 4C68A 4L89A 3FIXA 3SHPA 4QC6A 5KTAA 4YGOA 4GA6A 2J8NA 1E18A 4JLYA 4MJ8A 1AW8B 5ISVA 5JPHA 4L8AA 2FIWA 3EY5A 3ML1A 2IL4A 3P2FA 2PJHB 4CYOA 4UBRA 1EU1A 1M1DA 1YVOA 2EEOB 1XMTA 2I00A 1I3QA 4UWJA 4DMRA 2P6FA 1Y1WA 2P6GA 5GCNA 2NAPA 2OZGA 1TWHA 1TIQA 4QUSA 5FTNA 4Y49B 2NVXA 2FXFA 4JD6A 3TO9A 2PDOA 3EXNA 3SXNA 4JJXA 3TFYA 4KLWA 5FTLA 4XNHB 4CRYB 2B3VA 2CY2A 2Q04A 3TE4A 2YNCC 3EO4A 2WPXA 2PJJA 4QBJA 1YR0A 1PQHA 1YX0A 2FL4A 3VWDA 3QQ8A 4B5OA 4ONUA 3HU2A 5DYGA 4U5YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KOU A;  5J8C A;  2AE6 A;  1R7R A;  1YLE A;  2FIA A;  2ZXV A;  5H86 A;  5FTK A;  4KOX A;  4AVA A;  4K30 A;  1KUY A;  3GTL A;  2R98 A;  2JIO A;  1RXT A;  2PQ8 A;  1IID A;  2K5T A;  3GTJ A;  3R95 A;  2Y0S A;  2ZW7 A;  1LRZ A;  2VI7 A;  3CXQ A;  2VEZ A;  3I9S A;  2CNS A;  5F46 A;  1QSM A;  5HH1 A;  1I21 A;  3IR7 A;  4X5K A;  3CF2 A;  2FT0 A;  4M3S A;  1B87 A;  2NMT A;  4GS4 A;  1IYL A;  1PQE A;  1UFH A;  1QSN A;  4AZD A;  4CRZ B;  4F0Y A;  5FVJ A;  2ARH A;  1BOB A;  3S6G A;  1NE9 A;  3P2H A;  3F0A A;  3FB3 A;  1I12 A;  2R7H A;  4IF5 A;  3PGP A;  4MY3 A;  1PT0 A;  5T5I D;  3TTH A;  3C26 A;  3IR6 A;  3W6X A;  4Y49 C;  5I0C A;  1S60 A;  1I1D A;  3BJ7 A;  4R3K A;  1N71 A;  3S6H A;  3JUW A;  4D7Z B;  2HV2 A;  4KLN A;  4PK3 A;  4CRZ A;  4KLV A;  4XPL A;  5H84 A;  2Q7B A;  4LUA A;  3T9Y A;  3QC8 A;  1CR5 A;  4B5P B;  4QIW A;  3GTG A;  5KTC A;  1CZ4 A;  2P6E A;  5JQ4 A;  5FTJ A;  4KOY A;  4AVB A;  3EFA A;  4YRH A;  1YGH A;  3W6S A;  2QML A;  2GIV A;  4FD6 A;  4II9 A;  2F5I A;  4UA3 A;  5C18 A;  3G8W A;  3TM7 B;  2H5M A;  4DNC A;  3EC4 A;  2VBQ A;  1QST A;  1TMO A;  4B5P A;  2VXK A;  4PSW A;  1TWG A;  3HU1 A;  2BL1 A;  2J8R A;  1U6M A;  4QVT A;  2B58 A;  2PR1 A;  2BUE A;  2Q44 A;  2VZZ A;  3GTM A;  2B63 A;  2R92 A;  5DYI A;  4NXY A;  4PK2 A;  4RI1 A;  3G3S A;  4AON B;  4QB9 A;  1VKC A;  3H0G A;  3QB8 A;  4I49 A;  3W91 A;  3GTQ A;  1M4G A;  1Y1V A;  2G0B A;  4U9Y A;  4RS2 A;  1R27 A;  2QEC A;  4KOD A;  1XE4 A;  3CXS A;  4BMH A;  2CNT A;  1E61 A;  3FXT A;  1PQF A;  5FTM A;  4HNX B;  4AOK B;  2BSW A;  4KDI A;  4H89 A;  2VPY A;  2JIQ A;  2VUM A;  1MJB A;  1H5N A;  3F8K A;  3D8P A;  1VHS A;  3R9E A;  3O5A A;  4NSQ A;  1DMS A;  2G3T A;  3ZJ0 A;  1Y5I A;  2REE A;  2A4N A;  2PC1 A;  3RYO A;  3DR8 A;  2R8V A;  1Y9K A;  2PR8 A;  3CQZ A;  4CAV A;  4MBU A;  2AJ6 A;  2JIM A;  1UHD A;  2OB0 A;  1Y7R A;  3TO7 A;  3FNC A;  3WR7 A;  5CNP A;  4LX9 A;  5DWN A;  4E2A A;  1M4I A;  1K83 A;  1IIC A;  5IB0 A;  3R9F A;  4FD7 A;  1RO5 A;  3DMR A;  2CNM A;  1QSR A;  4AAY A;  3PLX B;  2JIP A;  3DSB A;  4CAX A;  2OU2 A;  1IB1 E;  2REF A;  4KO8 A;  4KOR A;  2R93 A;  2Q4Y A;  2Q0Y A;  3N7Z A;  1PU9 A;  2WPW A;  5C82 A;  2VPZ A;  1ON0 A;  2R1I A;  1PYQ A;  3FBU A;  3D2P A;  3TCV A;  3ZZI A;  3QAH A;  2BEI A;  5EPP A;  2B3U A;  4MHD A;  4HKF A;  4JWP A;  4KZT A;  5E96 A;  2C45 A;  2ZW4 A;  3GKR A;  2G3A A;  1MJA A;  2ATR A;  1Z4E A;  4HNW B;  1SFO A;  1VC3 B;  2PRB A;  2V45 A;  1KQG A;  2WB1 A;  1TWC A;  3FRM A;  1QCS A;  2YU9 A;  1S7N A;  1SIW A;  4AG9 A;  5KTD A;  2JIR A;  3LOD A;  2JDC A;  4C2M A;  4H6Z A;  2E7Z A;  2FCK A;  1FDI A;  5F49 A;  1R57 A;  4KOW A;  4R87 A;  3GTP A;  3DDD A;  3UY5 A;  2DMR A;  2JEV A;  2OH1 A;  4R57 A;  4FD4 A;  1PUA A;  1Y9W A;  5EC4 A;  2WAQ A;  1E5V A;  1S7K A;  1PT1 A;  3QWZ A;  3GY9 A;  5J8F A;  3CXP A;  3HU3 A;  1NMT A;  1MK4 A;  2V3V A;  4NF1 A;  2Z0Z A;  2JDD A;  2HUZ A;  3JVN A;  1KZF A;  3S6K A;  1IYK A;  1S5K A;  1K4J A;  4ZBG A;  4CRY G;  2P0W A;  4ORF A;  2QIR A;  3R1K A;  3TIW A;  4AVC A;  1P0H A;  1FDO A;  1M44 A;  1XEB A;  3TOA A;  2PSW A;  1PYU B;  1YVK A;  1S7F A;  4RV0 A;  4E0A A;  4IUS A;  4R9M A;  1NSL A;  4KUB A;  2KCW A;  3OWC A;  3OUG A;  1WLF A;  2B4D A;  4PV6 A;  1CZ5 A;  2JLM A;  2GAN A;  2E2H A;  1Q16 A;  3HKZ A;  1IW7 D;  5C88 A;  4KDL A;  2OZH A;  4MI4 A;  2E2I A;  3IWG A;  1DMR A;  2R7Z A;  1MJ9 A;  4KVO E;  1G8J A;  2RC4 A;  3GYA A;  3BLN A;  4HNY B;  3DNS A;  1OGY A;  1CJW A;  1TWF A;  3BJ8 A;  3QQ7 A;  1L0C A;  4JXR A;  4F6A A;  2GE3 A;  5B6C A;  1S7L A;  5IX3 A;  2X7B A;  2B4B A;  3T90 A;  1I50 A;  3FKI A;  3FYN A;  2B5G B;  4XPK A;  3B8G A;  5EBV A;  1UHE A;  1Z4R A;  3VWE A;  4XPD C;  2Z10 A;  4OAE A;  2VPX A;  1S3S A;  4UWI A;  3V8I A;  2ZW5 A;  1WK4 A;  4J3G A;  4AG7 A;  2KI8 A;  3PZJ A;  3IGR A;  1Y4Z A;  2B5G A;  2DXQ A;  4AYB A;  5DWM A;  3TOB A;  2O28 A;  4FD5 A;  1P4N A;  2VPW A;  1E60 A;  4H6U A;  4KVM E;  2JA7 A;  2FE7 A;  2NVY A;  1R9T A;  4KUA A;  5HMN A;  5C1B A;  4E8O A;  4OLL A;  1Q2D A;  1QSO A;  3D2M A;  1YK3 A;  4NEX A;  4U9Z A;  3IR5 A;  2D4O A;  3SXO A;  1Q2Y A;  4KOV A;  1B6B A;  4CAW A;  3PP9 A;  1WWZ A;  3TO6 A;  2PMZ A;  1G8K A;  4CS0 B;  4KVX A;  2VQY A;  1KUX A;  3KKW A;  2FSR A;  3GTO A;  1M4D A;  2ZPA A;  3MGD A;  1OZP A;  1QDN A;  4R3L A;  4NCZ A;  1TWA A;  2JA5 A;  1SQH A;  1E32 A;  2Y0M A;  3F5B A;  1Q2C A;  2I79 A;  1KUV A;  4XPD B;  1XF8 A;  2IV2 X;  4OAD A;  3R9G A;  2HQY A;  4CS0 A;  2Z11 A;  1Z9U A;  3LD2 A;  3NE7 A;  4MY0 A;  4M85 A;  4AB7 A;  3TT2 A;  2NYA A;  2FS5 A;  5T5M D;  1YRE A;  1CM0 A;  1BO4 A;  2EUI A;  2VZY A;  5GLF A;  3E0K A;  2B4D B;  4JXQ A;  4XNH C;  1H0H A;  4GA5 A;  1KQF A;  5F48 A;  2Q4V A;  1GHE A;  2C27 A;  2D4P A;  3S6F A;  4PSX A;  3K9U A;  4KOS A;  1AA6 A;  2J8M A;  3D3S A;  3H4Q A;  3DR6 A;  2OZU A;  4EVY A;  1J4J A;  2JA6 A;  1S3Z A;  2ZW6 A;  3I3G A;  1FY7 A;  1PPY A;  2EVN A;  4KOT A;  1V0C A;  1WCM A;  3R96 A;  3GTK A;  5F47 A;  5IV0 A;  4YFJ A;  1XIX A;  4L89 A;  3FIX A;  3SHP A;  4QC6 A;  5KTA A;  4YGO A;  4GA6 A;  2J8N A;  1E18 A;  4JLY A;  4MJ8 A;  1AW8 B;  5ISV A;  5JPH A;  4L8A A;  2FIW A;  3EY5 A;  3ML1 A;  2IL4 A;  3P2F A;  2PJH B;  4UBR A;  1EU1 A;  1M1D A;  1YVO A;  2EEO B;  1XMT A;  2I00 A;  1I3Q A;  4UWJ A;  4DMR A;  2P6F A;  1Y1W A;  2P6G A;  5GCN A;  2NAP A;  2OZG A;  1TWH A;  1TIQ A;  4QUS A;  5FTN A;  4Y49 B;  2NVX A;  2FXF A;  4JD6 A;  3TO9 A;  2PDO A;  3EXN A;  3SXN A;  4JJX A;  3TFY A;  4KLW A;  5FTL A;  4XNH B;  4CRY B;  2B3V A;  2CY2 A;  2Q04 A;  3TE4 A;  3EO4 A;  2WPX A;  4QBJ A;  1YR0 A;  1PQH A;  1YX0 A;  2FL4 A;  3VWD A;  3QQ8 A;  4B5O A;  4ONU A;  3HU2 A;  5DYG A;  4U5Y A; 
#chains in the Genus database with same CATH topology
 4KOU A;  3RAM A;  4C2Y A;  5J8C A;  2AE6 A;  3IFE A;  3IC1 A;  2ZXV A;  1JWQ A;  2C6P A;  5FTK A;  2RB7 A;  4KOX A;  3KR5 A;  4NGQ A;  1YLO A;  3H5Z A;  1IID A;  2ZEN A;  2Y0S A;  4BIN A;  2ZW7 A;  3D7H A;  2VEZ A;  1ZG8 A;  1QSM A;  1F57 A;  2PJ4 A;  3CF2 A;  2FT0 A;  4M3S A;  1Z8T A;  3IJ3 A;  1CPS A;  5D8N A;  4AZD A;  3FJU A;  4P4J A;  1VGY A;  1NSA A;  4A32 A;  2DEA A;  4MFJ A;  4F0X A;  3C26 A;  5I0C A;  1S60 A;  3KGQ A;  1ARM A;  3BJ7 A;  3JUW A;  4D7Z B;  2HV2 A;  4PK3 A;  4XPL A;  2Q7B A;  2ZOG A;  4Q36 A;  3EFA A;  5AG5 A;  1ZLI A;  4CYQ A;  3M3G A;  1VHE A;  2BOA A;  2H5M A;  4DNC A;  1TMO A;  2EK9 A;  3T8W A;  1TWG A;  2BL1 A;  1U6M A;  2Q44 A;  2VZZ A;  3BI1 A;  4NXY A;  4RI1 A;  4AON B;  2GFQ A;  2AFO A;  4F8Z A;  4I49 A;  3GTQ A;  4MHZ A;  2G0B A;  2ZED A;  2ENG A;  1R27 A;  4FUU A;  2ZEM A;  1XE4 A;  2CNT A;  4AOK B;  3QAY A;  4P6Y A;  4Q7A A;  1H5N A;  3R9E A;  2A4N A;  1Y9K A;  2PR8 A;  3HUV A;  3KHZ A;  2AJ6 A;  2OB0 A;  4KSF A;  3FNC A;  3WR7 A;  5HVG A;  1XBU A;  3R9F A;  2BH0 A;  4PXC A;  2KQA A;  1R3N A;  4CAX A;  2REF A;  2Z3M A;  2Q4Y A;  3PB8 X;  2AE0 X;  3GB0 A;  3N7Z A;  3PEI A;  4Z65 A;  5LRJ A;  2VPZ A;  2ZOF A;  1ZG7 A;  2CTB A;  1VHO A;  2CIJ A;  3QAH A;  1ELM P;  2F8H A;  3QNV A;  3IU1 A;  2PIY A;  4HNW B;  4MXU A;  4C2X A;  1TWC A;  1QCS A;  2JIR A;  2E7Z A;  2Q4Z A;  4R87 A;  2DMR A;  2JEV A;  2OH1 A;  4EME A;  1Y0Y A;  5EC4 A;  2WAQ A;  1S7K A;  1PT1 A;  5K8O A;  3QWZ A;  1VIX A;  5J8F A;  2PJ6 A;  1MK4 A;  1AUG A;  5BWA B;  2HUZ A;  2PJC A;  5A28 A;  1KZF A;  3X2O A;  4MFQ A;  1BLL E;  2QIR A;  3X2P A;  4AVC A;  1FDO A;  2O4H A;  1PYU B;  1S7F A;  3PBE A;  1LAP A;  3CZX A;  2GRE A;  1CZ5 A;  1N10 A;  2E2H A;  5C88 A;  2OZH A;  3MRU A;  3WAB A;  3IWG A;  1DMR A;  3BXM A;  4GM5 A;  2FVG A;  3SI2 A;  1G8J A;  2RC4 A;  4CGN A;  3GYA A;  3PB6 X;  3SJX A;  1L0C A;  5B6C A;  2B4B A;  2BO9 A;  3SUK A;  2OOT A;  2BE5 D;  3FYN A;  2A6H D;  5EBV A;  4OC5 A;  2CTC A;  4LQG A;  3B3W A;  4OAE A;  3VH9 A;  2WYR A;  1Y4Z A;  2B5G A;  4UIA A;  4MFL A;  1P4N A;  4OME A;  3LMS A;  3KHX A;  1YK3 A;  4G1P A;  3PP9 A;  4PXB A;  1Z8W A;  3KKW A;  2A69 D;  3S9M A;  1M4D A;  4PPZ A;  5AG6 A;  1OZP A;  1TWA A;  2JA5 A;  1E32 A;  3F5B A;  4CGL A;  1Q2C A;  5HVH A;  4P4D A;  3RZA A;  3X2G A;  2ZEG A;  2HQY A;  2GLJ A;  3NH4 A;  4MY0 A;  3SI1 A;  2Q51 A;  4B12 A;  2FS5 A;  5T5M D;  3SUJ A;  5G20 A;  2EUI A;  3FH4 A;  3E0K A;  2POK A;  1Q7L A;  1KQF A;  4YWY A;  5F48 A;  3PFE A;  3NH5 A;  3SUL A;  4KOS A;  4NFR A;  3H4Q A;  4B11 A;  4GXH A;  5JH9 A;  2OZU A;  1J4J A;  2QVP A;  1PPY A;  2IMO A;  2EVN A;  2VL1 A;  3FX6 A;  1V0C A;  3GTK A;  4ONW A;  5J1Q A;  4C68 A;  4DUK A;  2C6G A;  2XEF A;  4JLY A;  4MJ8 A;  1LOK A;  1BPN A;  5JPH A;  2V77 A;  2IL4 A;  2PJ5 A;  2PJH B;  2EEO B;  1XMT A;  3JRU A;  4UWJ A;  2P6F A;  1Y1W A;  4K3N A;  1TIQ A;  2ABZ A;  5FTN A;  3TFY A;  2Q04 A;  3TE4 A;  3D67 A;  2WPX A;  4P4F A;  3SJG A;  3B35 A;  1YX0 A;  3D30 A;  2I3C A;  4ONU A;  3ENG A;  5DYG A;  5H86 A;  3I1U A;  3GIU A;  3WC7 A;  4AXV A;  2ZEL A;  4K30 A;  2PJA A;  3GTL A;  2JEW A;  2CF4 A;  3CXQ A;  3IR7 A;  4JCW A;  3H8G A;  2NMT A;  4GS4 A;  1PQE A;  1QSN A;  4CRZ B;  4F0Y A;  3JTK A;  1NE9 A;  2RFH A;  3F0A A;  3FB3 A;  5CBM A;  2R7H A;  2AFW A;  3PGP A;  3TTH A;  3W6X A;  4Y49 C;  5GLX A;  4KLV A;  1XMB A;  3BHX A;  4C7I A;  4LUA A;  1XOV A;  1WC2 A;  1CPX A;  4B5P B;  5KTC A;  1CZ4 A;  5JQ4 A;  3ISZ A;  4YRH A;  1YGH A;  4B13 A;  4MCQ A;  5ELY A;  5C18 A;  3EC4 A;  3SUM A;  1FNO A;  4PSW A;  2J8R A;  4QVT A;  1XFO A;  3K9T A;  2R92 A;  4KSI A;  4PK2 A;  4X8I A;  4R76 A;  3H0G A;  3B3V A;  1TXR A;  4NJR A;  4FG2 A;  3NA6 A;  3CXS A;  3FXT A;  2BSW A;  4H89 A;  2VPY A;  4MHN A;  2VUM A;  3SJE A;  1MJB A;  1HD5 A;  2REE A;  4UFV A;  3RYO A;  2AFM A;  2R8V A;  2JIM A;  3KR4 A;  4LX9 A;  4ZGY B;  1M4I A;  1K83 A;  2PJ1 A;  2IJZ A;  4FD7 A;  1RO5 A;  3B3T A;  4AAY A;  2JIP A;  2OU2 A;  4KO8 A;  1M4L A;  4A30 A;  1LAN A;  1ON0 A;  2R1I A;  5EMI A;  4C2Z A;  1PYQ A;  2G9D A;  3TCV A;  4MHD A;  2B3U A;  1TKJ A;  1YME A;  1Z2L A;  3D66 A;  3FEC A;  1GYT A;  2ZW4 A;  1HDU A;  2G3A A;  1MJA A;  4L48 A;  4R7M A;  2V45 A;  2A68 D;  2WB1 A;  3FRM A;  1SIW A;  5HXD A;  4NGT A;  4KOW A;  2Z3L A;  4A94 A;  3GTP A;  3CDX A;  5AG4 A;  3HU3 A;  1NMT A;  2AFS A;  3JVN A;  1S5K A;  2G6G A;  3GUX A;  1PYT B;  1M44 A;  4DYO A;  5G21 A;  1IOF A;  4IUS A;  4R9M A;  4AVR A;  1Q16 A;  3HKZ A;  4JP6 A;  2E2I A;  2PJ3 A;  3D7G A;  1BW3 A;  3DNS A;  3BJ8 A;  1TWF A;  3QQ7 A;  3PFO A;  4F6A A;  4RN7 A;  1S7L A;  5IX3 A;  4CYP A;  3T90 A;  1I50 A;  1CX8 A;  4UF4 A;  3B8G A;  1UHE A;  4MHY A;  2Z10 A;  2VPX A;  4UWI A;  2ZW5 A;  1KWM A;  4CGO A;  3D7F A;  1WK4 A;  2KI8 A;  2ANP A;  5HVF A;  2DXQ A;  4UEE A;  4AYB A;  1ARL A;  4BD9 A;  2VPW A;  1E60 A;  1ZC1 A;  4CGM A;  5HMN A;  3L2N A;  3D2M A;  3X2I A;  2D4O A;  4KOV A;  4A2Z A;  1B6B A;  4JJO A;  4CAW A;  2XEG A;  1YNJ D;  4CS0 B;  4KVX A;  2VQY A;  4R6T A;  3WC6 A;  4H2K A;  3GTO A;  4UFX A;  3MGD A;  3TX8 A;  2IQ6 A;  1DTD A;  3BI0 A;  1SQH A;  1H8L A;  2PVV A;  2G5D A;  1AMP A;  2PJB A;  2I79 A;  2XEI A;  1KUV A;  4XPD B;  5G1Z A;  1R43 A;  1XF8 A;  4OAD A;  3R9G A;  3CZB A;  1Z9U A;  5LYF A;  2Z3N A;  3TT2 A;  2NYA A;  1YRE A;  1X10 A;  4P4B A;  5GLF A;  4JXQ A;  1H0H A;  2C27 A;  2XEJ A;  3B3S A;  3S6F A;  3D3S A;  2PRQ A;  2J9A A;  3DR6 A;  3KZW A;  2YNE A;  4A33 A;  2ZW6 A;  2YNC A;  3HLP A;  4KOT A;  1X12 A;  4L89 A;  5JGF A;  3SHP A;  4GA6 A;  2J8N A;  1AW8 B;  4L8A A;  1QMU A;  2FIW A;  4ZM7 A;  3P2F A;  1M1D A;  4P4E A;  1F2O A;  2I00 A;  4JYW A;  4FFT A;  4Y49 B;  1IU8 A;  2FXF A;  4JD6 A;  3EXN A;  3SXN A;  4JJX A;  4PXE A;  5FTL A;  4TNU A;  4XNH B;  4RUH A;  2GU2 A;  2NSM A;  1LAM A;  1ELL P;  1YR0 A;  4MMO A;  3VWD A;  3MN8 A;  2ZEE A;  3IWW A;  2V8V A;  4ZI6 A;  6CPA A;  1YQE A;  1KUY A;  2R98 A;  1RXT A;  3SI0 A;  2K5T A;  3GTJ A;  4MFZ A;  4Q38 A;  4OP4 A;  2VI7 A;  4W9Y A;  2CNS A;  5HH1 A;  4UFW A;  3RO0 A;  2DPS A;  2DPT A;  5A27 A;  3B7I A;  1IYL A;  3VAR A;  3KL9 A;  2ARH A;  1BOB A;  3P2H A;  2PIC A;  4IF5 A;  5I4M A;  5T5I D;  3IR6 A;  4HPS A;  1N71 A;  3S6H A;  4KLN A;  4CRZ A;  2PVW A;  3D68 A;  4IAV A;  5IB9 A;  3T9Y A;  3GTG A;  5FTJ A;  4AVB A;  4M6G A;  5CPA A;  3W6S A;  2QML A;  5LYD A;  3X2N A;  4MCP A;  4II9 A;  2F5I A;  3X2K A;  4UA3 A;  2PJ9 A;  3GLJ A;  2VBQ A;  1QST A;  4B5P A;  3TC8 A;  2HB6 A;  2VXK A;  3HU1 A;  4P10 A;  3X2M A;  2V8G A;  5DYI A;  3G3S A;  4QB9 A;  1VKC A;  1M4G A;  4U9Y A;  4RS2 A;  2QEC A;  2A6E D;  1E61 A;  1TKH A;  5FTM A;  4KDI A;  1L8F A;  1ZG9 A;  3F8K A;  3D8P A;  1VHS A;  3O5A A;  1DMS A;  2G3T A;  7CPA A;  4F9U A;  4MCS A;  4MBU A;  3PBB A;  2QYV A;  1UHD A;  2DF5 A;  3TO7 A;  5CNP A;  2Q7S A;  5IB0 A;  1ZYR D;  3DMR A;  2CNM A;  3DSB A;  1Z5R A;  1IB1 E;  3D4U A;  5C82 A;  3VAT A;  3K2K A;  3KI9 A;  3FBU A;  3V38 A;  4NGN A;  3D2P A;  1BW4 A;  2C45 A;  1Z4E A;  4MFK A;  1SFO A;  1VC3 B;  2PRB A;  4FG4 A;  3WC5 A;  2YU9 A;  1S7N A;  1QQ9 A;  4UCP A;  5KTD A;  4KSA A;  3LOD A;  2JDC A;  2OR4 A;  4IK2 A;  2FCK A;  5F49 A;  1R57 A;  2Z3O A;  3H8E A;  1A2Z A;  3FED A;  4FD4 A;  1PUA A;  2PJ2 A;  1E5V A;  3GY9 A;  3CXP A;  4OC1 A;  2PCU A;  4NF1 A;  2PNW A;  2PJ8 A;  5K8M A;  3S6K A;  1IYK A;  2O53 A;  1K4J A;  2P0W A;  4UIB A;  4ORF A;  3TIW A;  1CG2 A;  1P0H A;  4PXD A;  2WSA A;  2PSW A;  1YVK A;  4KUB A;  2KCW A;  3OWC A;  3OUG A;  4FWU A;  1TKF A;  2GAN A;  3IIB A;  1TF9 A;  4UCM A;  4P45 A;  2WZN A;  4KVO E;  2R7Z A;  2CW0 D;  1MJ9 A;  3BLN A;  4HNY B;  4CAF A;  3X2L A;  4JXR A;  2GE3 A;  3FKI A;  3S9L A;  2QJ8 A;  4XPK A;  1Z4R A;  1EE3 P;  4A39 A;  2V8D A;  3V8I A;  2EBJ A;  2JBK A;  4M6H A;  4AG7 A;  3PZJ A;  3IGR A;  2ZEO A;  3D7D A;  5DWM A;  4FD5 A;  3A9L A;  4KVM E;  2JA7 A;  4M6I A;  2NVY A;  4NGP A;  2Z3P A;  5C1B A;  4E8O A;  4OLL A;  1IY7 A;  4U9Z A;  1Q2Y A;  4BBH A;  4DJL A;  3TO6 A;  2PMZ A;  4B14 A;  1Y0R A;  3NH8 A;  1FT7 A;  2C6C A;  4UEZ A;  3KAS A;  4MCR A;  1QDN A;  4R3L A;  4YU9 A;  3RBU A;  3IEH A;  4B6Z A;  2GAE A;  2PJ0 A;  4CS0 A;  2Z11 A;  3NFZ A;  4AB7 A;  4FBE A;  5LRK A;  1BO4 A;  2ZEF A;  2EWB A;  1XRY A;  4ZYQ A;  4GA5 A;  2BCO A;  3IU2 A;  1GHE A;  2PIZ A;  2D4P A;  2F7V A;  3K9U A;  1AA6 A;  2J8M A;  4ENG A;  5LRG A;  1FY7 A;  3RNZ A;  4MRI A;  2AFX A;  4JS7 A;  5IV0 A;  1XIX A;  4QC6 A;  4YGO A;  1HDQ A;  5ISV A;  5F09 A;  3EY5 A;  3ML1 A;  4UEF A;  1EU1 A;  2P6G A;  2AFU A;  2NAP A;  1TWH A;  8CPA A;  4WJB A;  3CPX A;  4X2T A;  1LFW A;  4FAI A;  2C1C A;  4CRY B;  2CY2 A;  3EO4 A;  2PJJ A;  1IGB A;  1PQH A;  2EO8 A;  4B5O A;  3HU2 A;  1YW6 A;  4U5Y A;  5LYI A;  1R7R A;  1YLE A;  2HCZ X;  2FIA A;  2ODF A;  4A37 A;  1JQG A;  4AVA A;  2YGW A;  2JIO A;  2PQ8 A;  4NGM A;  4LQ6 A;  3R95 A;  1LRZ A;  4A31 A;  1Y7E A;  3KQX A;  1BPM A;  1BAV A;  3I9S A;  5F46 A;  1I21 A;  4P44 A;  4X5K A;  5G22 A;  2PE3 A;  1B87 A;  3ISX A;  1UFH A;  4PQA A;  3WT4 A;  1OA7 A;  5FVJ A;  2Q43 A;  3S6G A;  1I12 A;  4CPA A;  4MY3 A;  1PT0 A;  1I1D A;  4R3K A;  3X2H A;  5H84 A;  3QC8 A;  1CR5 A;  4QIW A;  3X2J A;  1Z8X A;  2P6E A;  4KOY A;  2YND A;  2GIV A;  4FD6 A;  3CPA A;  3PB4 X;  3FEE A;  3G8W A;  2O5J D;  3TM7 B;  4CGP A;  1RTQ A;  4IHM A;  1HEE A;  4KS9 A;  1YW4 A;  3LAC A;  2B58 A;  4NGR A;  2PR1 A;  2BUE A;  1ZLH A;  3GTM A;  4MFP A;  2B63 A;  5LYL A;  3IWE A;  3QB8 A;  3W91 A;  5K8N A;  4P4I A;  1Y1V A;  5THW A;  4KOD A;  4BMH A;  1PQF A;  4HNX B;  5AG7 A;  2JIQ A;  3LWU A;  4NSQ A;  3ZJ0 A;  1Y5I A;  1CP6 A;  4NJQ A;  2PC1 A;  3DR8 A;  2AFZ A;  4OKO A;  4EFD A;  3CQZ A;  1F2P A;  4CAV A;  1Y7R A;  4CYN A;  4TWE A;  2HC9 A;  4F9V A;  5DWN A;  4E2A A;  1IIC A;  4NOH A;  2YUJ A;  5DS0 A;  1QSR A;  2GLF A;  3PLX B;  3B2Y A;  1ZO0 A;  4KOR A;  4ZX9 A;  3N5F A;  2R93 A;  2Q0Y A;  1XJO A;  2V8H A;  3DGV A;  1PU9 A;  2WPW A;  4JZ0 A;  1CBX A;  4UCN A;  3ZZI A;  2BEI A;  5EPP A;  4NGS A;  2Z3K A;  4HKF A;  4JWP A;  4KZT A;  5E96 A;  3GKR A;  2ATR A;  1KQG A;  2PI8 A;  2ZEP A;  4AG9 A;  4C2M A;  3NE8 A;  4H6Z A;  1FDI A;  4X3R A;  3S9N A;  3DDD A;  3UY5 A;  2JBJ A;  4R57 A;  4ZY0 A;  1Y9W A;  1IOI A;  2ZEH A;  3FMC A;  2V3V A;  2Z0Z A;  2JDD A;  2CXA A;  4ZBG A;  5GM9 A;  4CRY G;  3R1K A;  2EK8 A;  1XEB A;  3TOA A;  2WUU A;  4RV0 A;  4E0A A;  3V7Z A;  1DE4 C;  1NSL A;  4PV6 A;  1WLF A;  2B4D A;  2JLM A;  4OIW A;  1IW7 D;  4KDL A;  1YNN D;  4MI4 A;  2PJ7 A;  1OGY A;  1CJW A;  1OBR A;  2X7B A;  3DLJ A;  1Z8L A;  2B5G B;  4ZY2 A;  3VWE A;  3B3C A;  4XPD C;  1SMY D;  4FER A;  1S3S A;  4OID A;  3KQZ A;  4J3G A;  4CAE A;  5AGE A;  3TOB A;  5GLY A;  1LCP A;  2O28 A;  1TF8 A;  3CT9 A;  4MHP A;  4EWT A;  4R8F A;  4H6U A;  2FE7 A;  1R9T A;  4KUA A;  1AYE A;  2NYQ A;  1UWY A;  3PB9 X;  5K8P A;  1Q2D A;  1CP7 A;  1QSO A;  4NEX A;  3IR5 A;  3SXO A;  1WWZ A;  4OC3 A;  1G8K A;  3H8F A;  4WWV A;  1KUX A;  1YSJ A;  3PB7 X;  2FSR A;  5JM6 A;  2ZPA A;  4NCZ A;  2Y0M A;  4O23 A;  2IV2 X;  4C7H A;  4ZY1 A;  3LD2 A;  3NE7 A;  4M85 A;  4OC0 A;  1CM0 A;  2VZY A;  3PRT A;  2B4D B;  4XNH C;  2Q4V A;  4OC2 A;  4A38 A;  4A95 A;  4PSX A;  4JP7 A;  4EVY A;  2JA6 A;  1S3Z A;  4OC4 A;  3SJF A;  3I3G A;  5D29 A;  4B10 A;  3FF3 A;  1WCM A;  3R96 A;  5F47 A;  3IO1 A;  4YFJ A;  3FIX A;  4ZX8 A;  1OA9 A;  5KTA A;  1PCA A;  1E18 A;  4CYO A;  4UBR A;  1YVO A;  1I3Q A;  4DMR A;  5GCN A;  2OZG A;  4QUS A;  3FVL A;  2NVX A;  3TO9 A;  2PDO A;  4KLW A;  2B3V A;  2YNC C;  5H4U A;  4QBJ A;  2FL4 A;  3QQ8 A; 
#chains in the Genus database with same CATH homology
 4KOU A;  4C2Y A;  5J8C A;  2AE6 A;  1R7R A;  1YLE A;  2FIA A;  2ZXV A;  5H86 A;  5FTK A;  4KOX A;  4AVA A;  4K30 A;  1KUY A;  3GTL A;  3H5Z A;  2R98 A;  2YGW A;  2JIO A;  1RXT A;  2PQ8 A;  1IID A;  2K5T A;  3GTJ A;  3R95 A;  2Y0S A;  4MFZ A;  4Q38 A;  2ZW7 A;  1LRZ A;  4A31 A;  2VI7 A;  3CXQ A;  2VEZ A;  3I9S A;  2CNS A;  5F46 A;  1QSM A;  4UFW A;  5HH1 A;  1I21 A;  3IR7 A;  2DPS A;  4X5K A;  3CF2 A;  2FT0 A;  5G22 A;  4M3S A;  2DPT A;  5A27 A;  1B87 A;  2NMT A;  4GS4 A;  1IYL A;  1PQE A;  1UFH A;  1QSN A;  4AZD A;  4CRZ B;  4F0Y A;  5FVJ A;  2ARH A;  3JTK A;  1BOB A;  3S6G A;  1NE9 A;  3P2H A;  3F0A A;  4A32 A;  3FB3 A;  4MFJ A;  1I12 A;  2R7H A;  2PIC A;  4IF5 A;  3PGP A;  4MY3 A;  1PT0 A;  5T5I D;  3TTH A;  3C26 A;  3IR6 A;  3W6X A;  4F0X A;  4Y49 C;  5I0C A;  1S60 A;  1I1D A;  3BJ7 A;  4R3K A;  1N71 A;  3S6H A;  3JUW A;  4D7Z B;  2HV2 A;  4KLN A;  4PK3 A;  4CRZ A;  4KLV A;  4XPL A;  5H84 A;  2Q7B A;  4C7I A;  4LUA A;  3T9Y A;  3QC8 A;  1CR5 A;  4B5P B;  4QIW A;  3GTG A;  5KTC A;  1CZ4 A;  2P6E A;  5JQ4 A;  5FTJ A;  4KOY A;  4AVB A;  4Q36 A;  3EFA A;  4YRH A;  1YGH A;  5AG5 A;  3W6S A;  2QML A;  2YND A;  2GIV A;  4B13 A;  4FD6 A;  4CYQ A;  4II9 A;  2F5I A;  4UA3 A;  5C18 A;  2O5J D;  3G8W A;  3TM7 B;  4CGP A;  2H5M A;  4DNC A;  3EC4 A;  2VBQ A;  1QST A;  1TMO A;  4B5P A;  2VXK A;  4PSW A;  1TWG A;  4KS9 A;  3HU1 A;  2BL1 A;  2J8R A;  1U6M A;  4QVT A;  2B58 A;  2PR1 A;  2BUE A;  2Q44 A;  2VZZ A;  3GTM A;  4MFP A;  2B63 A;  2R92 A;  5DYI A;  4NXY A;  4PK2 A;  4RI1 A;  3G3S A;  4AON B;  4QB9 A;  1VKC A;  3H0G A;  3IWE A;  3QB8 A;  4I49 A;  3W91 A;  3GTQ A;  1M4G A;  1Y1V A;  2G0B A;  4U9Y A;  4RS2 A;  1R27 A;  2QEC A;  4KOD A;  1XE4 A;  3CXS A;  4BMH A;  2CNT A;  2A6E D;  1E61 A;  3FXT A;  1PQF A;  5FTM A;  4HNX B;  4AOK B;  2BSW A;  4KDI A;  4H89 A;  2VPY A;  5AG7 A;  2JIQ A;  2VUM A;  1MJB A;  1H5N A;  3F8K A;  3D8P A;  1VHS A;  3R9E A;  3O5A A;  4NSQ A;  1DMS A;  2G3T A;  3ZJ0 A;  1Y5I A;  2REE A;  4UFV A;  2A4N A;  2PC1 A;  3RYO A;  3DR8 A;  2R8V A;  1Y9K A;  2PR8 A;  3CQZ A;  4CAV A;  4MBU A;  2AJ6 A;  2JIM A;  1UHD A;  2OB0 A;  1Y7R A;  3TO7 A;  4KSF A;  3FNC A;  3WR7 A;  4CYN A;  5CNP A;  4LX9 A;  4ZGY B;  5DWN A;  4E2A A;  1M4I A;  1K83 A;  1IIC A;  5IB0 A;  3R9F A;  4FD7 A;  4NOH A;  1ZYR D;  2YUJ A;  1RO5 A;  3DMR A;  2CNM A;  1QSR A;  4AAY A;  3PLX B;  2JIP A;  3DSB A;  4CAX A;  2OU2 A;  1IB1 E;  2REF A;  2Z3M A;  1ZO0 A;  4KO8 A;  4KOR A;  2R93 A;  2Q4Y A;  2Q0Y A;  2AE0 X;  3N7Z A;  1PU9 A;  2WPW A;  4A30 A;  5C82 A;  2VPZ A;  1ON0 A;  2R1I A;  4C2Z A;  1PYQ A;  3FBU A;  3D2P A;  4UCN A;  3TCV A;  3ZZI A;  3QAH A;  2BEI A;  5EPP A;  2B3U A;  4MHD A;  2Z3K A;  4HKF A;  4JWP A;  4KZT A;  5E96 A;  2C45 A;  2ZW4 A;  3GKR A;  2G3A A;  1MJA A;  3IU1 A;  2ATR A;  1Z4E A;  4HNW B;  1SFO A;  1VC3 B;  2PRB A;  2V45 A;  2A68 D;  1KQG A;  2WB1 A;  4MFK A;  1TWC A;  4C2X A;  3FRM A;  1QCS A;  2YU9 A;  1S7N A;  4UCP A;  2PI8 A;  1SIW A;  4AG9 A;  4KSA A;  5KTD A;  2JIR A;  3LOD A;  2JDC A;  4C2M A;  4H6Z A;  2E7Z A;  2FCK A;  1FDI A;  5F49 A;  1R57 A;  4KOW A;  2Z3O A;  4R87 A;  2Z3L A;  3GTP A;  3DDD A;  3UY5 A;  2DMR A;  2JEV A;  2OH1 A;  4R57 A;  4FD4 A;  1PUA A;  5AG4 A;  1Y9W A;  5EC4 A;  2WAQ A;  1E5V A;  1S7K A;  1PT1 A;  3QWZ A;  3GY9 A;  5J8F A;  3CXP A;  3HU3 A;  1NMT A;  1MK4 A;  2V3V A;  4NF1 A;  2PNW A;  2Z0Z A;  5BWA B;  2JDD A;  2HUZ A;  3JVN A;  5A28 A;  1KZF A;  3S6K A;  1IYK A;  1S5K A;  2CXA A;  1K4J A;  4ZBG A;  4MFQ A;  4CRY G;  2P0W A;  4ORF A;  2G6G A;  2QIR A;  3R1K A;  3TIW A;  4AVC A;  1P0H A;  1FDO A;  1M44 A;  1XEB A;  2WSA A;  3TOA A;  2PSW A;  2WUU A;  1PYU B;  1YVK A;  1S7F A;  4RV0 A;  5G21 A;  4E0A A;  4IUS A;  4R9M A;  1NSL A;  4KUB A;  2KCW A;  3OWC A;  3OUG A;  1WLF A;  2B4D A;  4PV6 A;  1CZ5 A;  2JLM A;  2GAN A;  2E2H A;  1Q16 A;  3HKZ A;  1IW7 D;  5C88 A;  4KDL A;  4UCM A;  2OZH A;  1YNN D;  4MI4 A;  2E2I A;  3IWG A;  1DMR A;  2R7Z A;  2CW0 D;  1MJ9 A;  4KVO E;  1G8J A;  2RC4 A;  4CGN A;  3GYA A;  3BLN A;  4HNY B;  3DNS A;  4CAF A;  1OGY A;  1CJW A;  1TWF A;  3BJ8 A;  3QQ7 A;  1L0C A;  4JXR A;  4F6A A;  2GE3 A;  5B6C A;  1S7L A;  5IX3 A;  2X7B A;  4CYP A;  2B4B A;  3T90 A;  1I50 A;  3FKI A;  2BE5 D;  3FYN A;  2A6H D;  2B5G B;  4XPK A;  3B8G A;  5EBV A;  1UHE A;  1Z4R A;  3VWE A;  4XPD C;  1SMY D;  2Z10 A;  4OAE A;  2VPX A;  1S3S A;  4UWI A;  3V8I A;  2ZW5 A;  4CGO A;  1WK4 A;  4J3G A;  4AG7 A;  2KI8 A;  4CAE A;  3PZJ A;  5AGE A;  3IGR A;  1Y4Z A;  2B5G A;  2DXQ A;  4AYB A;  5DWM A;  3TOB A;  2O28 A;  4FD5 A;  4MFL A;  3A9L A;  1P4N A;  2VPW A;  1E60 A;  4H6U A;  4KVM E;  2JA7 A;  1ZC1 A;  4CGM A;  2FE7 A;  2NVY A;  1R9T A;  4KUA A;  5HMN A;  2Z3P A;  5C1B A;  4E8O A;  4OLL A;  1Q2D A;  1QSO A;  3D2M A;  1YK3 A;  4NEX A;  4U9Z A;  3IR5 A;  2D4O A;  3SXO A;  1Q2Y A;  4KOV A;  4A2Z A;  1B6B A;  4BBH A;  3PP9 A;  4CAW A;  1WWZ A;  3TO6 A;  1YNJ D;  2PMZ A;  4B14 A;  1G8K A;  4CS0 B;  4KVX A;  2VQY A;  1KUX A;  3KKW A;  2FSR A;  2A69 D;  3GTO A;  1M4D A;  4UFX A;  2ZPA A;  3MGD A;  5AG6 A;  1OZP A;  1QDN A;  4R3L A;  4NCZ A;  1TWA A;  2JA5 A;  1SQH A;  1E32 A;  2Y0M A;  3F5B A;  2G5D A;  4CGL A;  2GAE A;  1Q2C A;  2I79 A;  1KUV A;  4XPD B;  5G1Z A;  1XF8 A;  2IV2 X;  4OAD A;  3R9G A;  2HQY A;  3CZB A;  4C7H A;  4CS0 A;  2Z11 A;  1Z9U A;  3LD2 A;  3NE7 A;  2Z3N A;  4MY0 A;  4M85 A;  4AB7 A;  3TT2 A;  2NYA A;  4B12 A;  2FS5 A;  5T5M D;  1YRE A;  5G20 A;  1CM0 A;  1BO4 A;  2EUI A;  2VZY A;  5GLF A;  3E0K A;  2B4D B;  4JXQ A;  4XNH C;  1H0H A;  4GA5 A;  1KQF A;  5F48 A;  2Q4V A;  3IU2 A;  1GHE A;  2C27 A;  4A95 A;  2D4P A;  3S6F A;  4PSX A;  3K9U A;  4KOS A;  1AA6 A;  2J8M A;  3D3S A;  3H4Q A;  4B11 A;  3DR6 A;  2OZU A;  2YNE A;  4EVY A;  1J4J A;  2JA6 A;  1S3Z A;  4A33 A;  2ZW6 A;  2YNC A;  3I3G A;  4B10 A;  1FY7 A;  1PPY A;  2EVN A;  4KOT A;  1V0C A;  1WCM A;  3R96 A;  3GTK A;  5F47 A;  5IV0 A;  4YFJ A;  1XIX A;  4C68 A;  4L89 A;  3FIX A;  3SHP A;  4QC6 A;  5KTA A;  4YGO A;  4GA6 A;  2J8N A;  1E18 A;  4JLY A;  4MJ8 A;  1AW8 B;  5ISV A;  5JPH A;  4L8A A;  2FIW A;  3EY5 A;  3ML1 A;  2IL4 A;  3P2F A;  2PJH B;  4CYO A;  4UBR A;  1EU1 A;  1M1D A;  1YVO A;  2EEO B;  1XMT A;  2I00 A;  1I3Q A;  4UWJ A;  4DMR A;  2P6F A;  1Y1W A;  2P6G A;  5GCN A;  2NAP A;  2OZG A;  1TWH A;  1TIQ A;  4QUS A;  5FTN A;  4Y49 B;  2NVX A;  2FXF A;  4JD6 A;  3TO9 A;  2PDO A;  3EXN A;  3SXN A;  4JJX A;  3TFY A;  4KLW A;  5FTL A;  4XNH B;  4CRY B;  2B3V A;  2CY2 A;  2Q04 A;  3TE4 A;  2YNC C;  3EO4 A;  2WPX A;  2PJJ A;  4QBJ A;  1YR0 A;  1PQH A;  1YX0 A;  2FL4 A;  3VWD A;  3QQ8 A;  4B5O A;  4ONU A;  3HU2 A;  5DYG A;  4U5Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...