1YLEA

The structure of arginine/ornithine succinyltransferase subunit ai from pseudomonas aeruginosa.
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
342
structure length
330
Chain Sequence
b'GHMLVMRPAQAADLPQVQRLAADSPVGVTSLPDDAERLRDKILASEASFAAEVSYNGEESYFFVLEDSASGELVGCSAIVASAGFSEPFYSFRNETFVHASRSLSIHNKIHVLSLCHDLTGNSLLTSFYVQRDLVQSVYAELNSRGRLLFMASHPERFADAVVVEIVGYSDEQGESPFWNAVGRNFFDLNYIEAEKLSGLKHYPIYVPLLPDAAQESMGQVHPRAQITFDILMREGFETDNYIDIFDGGPTLHARTSGIRSIAQSRVVPVKIGEKSGRPYLVTNGQLQDFRAVVLDLDWAPGKPVALSVEAAEALGVGEGASVRLVAVGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginine N-succinyltransferase, alpha chain
publication title The structure of arginine/ornithine succinyltransferase subunit AI from Pseudomonas aeruginosa.
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 93
structure length 330
sequence length 342
ec nomenclature ec 2.3.1.109: Arginine N-succinyltransferase.
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04958 AstA Arginine N-succinyltransferase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1yleA02
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1yleA01
3S6HA 3RYOA 2KI8A 1MJAA 2B5GB 5FVJA 2GE3A 4YFJA 2VPYA 4PV6A 3DDDA 2NAPA 1E18A 3GTMA 3LODA 4JWPA 3H0GA 5DYGA 1PT1A 2ZW7A 4M85A 2VZZA 3P2FA 3DR8A 2PR1A 2FXFA 1TIQA 1XF8A 3D3SA 4XPDB 1P4NA 4KOWA 2HUZA 5F49A 4UA3A 4UBRA 5KTDA 1E60A 2G3TA 3OUGA 4CS0A 1M1DA 4R87A 4AG9A 1SFOA 4C2MA 2VPZA 5HMNA 4HNXB 4KVXA 4X5KA 2PMZA 4B5PA 3R96A 1V0CA 1YX0A 4RV0A 2JA5A 1FDIA 4DMRA 3FYNA 4JD6A 4NF1A 2GIVA 4NXYA 1DMSA 1QDNA 3G3SA 1R57A 2JDDA 4QVTA 2R1IA 2IL4A 4R57A 4CRZA 5FTKA 2NVYA 5I0CA 1R27A 5J8FA 2Y0SA 1QSMA 4AB7A 3KKWA 1SIWA 1XIXA 2JEVA 2VPWA 2REEA 3F8KA 3T9YA 3TCVA 4RS2A 2JIRA 2PJHB 3TTHA 3H4QA 4HKFA 4E8OA 4HNWB 4KOVA 1LRZA 1VKCA 3HU2A 4IUSA 4KORA 2B4DB 4KO8A 2V45A 4I49A 5HH1A 4CRYG 2PQ8A 1NMTA 4IF5A 3CXSA 3MGDA 1G8JA 3LD2A 4AG7A 2REFA 4L8AA 5DWMA 3TOAA 2PR8A 1CZ4A 1YVKA 2FIWA 1H5NA 2HQYA 3SXNA 5J8CA 3TM7B 3TT2A 4E2AA 3W6XA 1KQGA 3CXQA 2RC4A 4MJ8A 4KLNA 2OH1A 1I21A 1NE9A 3QAHA 3P2HA 1Y5IA 3IWGA 1TWHA 1UHDA 2JIQA 2BL1A 4U5YA 4KOUA 4M3SA 2Q44A 1G8KA 3TO7A 5F47A 1YVOA 2CNSA 4AVAA 4YRHA 3IR5A 1PUAA 4FD6A 5IB0A 3GY9A 1IB1E 4XNHC 3VWDA 3S6KA 1S5KA 1L0CA 5E96A 4H89A 2R8VA 2PDOA 5GLFA 4Y49B 1S3SA 1YK3A 4OADA 2B3VA 4HNYB 1CZ5A 2G0BA 2P6EA 3GTLA 4AONB 1PPYA 3D8PA 3R1KA 1TWGA 3W91A 4CAWA 2Q04A 5C18A 5FTNA 1KUVA 1WCMA 2E7ZA 3SXOA 2YU9A 3BJ7A 3I3GA 2JIPA 4RI1A 1R7RA 2JIOA 1PQEA 1KUYA 4DNCA 2B3UA 1Q2CA 3D2MA 5DWNA 2R98A 4CAXA 4ZBGA 1IICA 2CNTA 4KLWA 1QCSA 2FIAA 2FS5A 1I1DA 4E0AA 5F46A 3F5BA 2G3AA 1Y1VA 3SHPA 3GKRA 1M4GA 3EY5A 4OAEA 2NVXA 1R9TA 1ON0A 3PGPA 4LX9A 2KCWA 4KZTA 4EVYA 3K9UA 3GTGA 4B5OA 4H6ZA 4KVOE 5B6CA 1Q2YA 2AE6A 1I50A 4FD4A 2VEZA 4CRYB 1B6BA 2OZHA 3W6SA 1P0HA 2B63A 1UFHA 2P6FA 4AVCA 4CS0B 1WLFA 3FRMA 1Y7RA 4QB9A 1WWZA 2I79A 3ML1A 1M44A 1Z4EA 4PSXA 4JJXA 4R3LA 2JA7A 2PSWA 1VHSA 2EUIA 1MJ9A 1TWCA 3F0AA 2JDCA 4UWJA 4AAYA 4B5PB 4JXQA 1UHEA 2E2IA 4AVBA 2VZYA 2WPXA 2A4NA 2BUEA 2IV2X 4PK3A 3TOBA 3CQZA 5T5ID 2R7HA 1YREA 4KVME 3C26A 3ZJ0A 4CRZB 2DXQA 1EU1A 1Y9KA 5FTLA 4KLVA 2CNMA 4KDIA 2E2HA 2VBQA 5EPPA 3TE4A 1S3ZA 4AYBA 2GANA 4GA5A 3FNCA 4AZDA 2Z10A 1QSTA 2FCKA 2O28A 1MK4A 2Q0YA 2H5MA 4MY0A 4NCZA 3DSBA 1AA6A 2ZW6A 1IYKA 2C27A 1E32A 1S7KA 3JVNA 4K30A 4F0YA 3OWCA 3QQ7A 4MY3A 5IV0A 2QIRA 3S6FA 1E5VA 1PQHA 5C88A 1PU9A 1TWFA 2J8MA 2NYAA 5H84A 2Q4VA 2DMRA 1DMRA 2Z11A 4KOTA 2ARHA 3IGRA 2WB1A 2R92A 2VUMA 4D7ZB 3R95A 3NE7A 2P6GA 5ISVA 1TWAA 3GYAA 3PZJA 4UWIA 2FL4A 3IR6A 2JLMA 1SQHA 4KUBA 1I12A 1RO5A 3B8GA 5KTCA 1XEBA 3ZZIA 3R9EA 2QMLA 2FE7A 3VWEA 1S7LA 4II9A 3TO6A 4BMHA 1RXTA 2EVNA 3TO9A 1FDOA 2B5GA 4KOXA 3TFYA 1BO4A 3BJ8A 2WPWA 3FBUA 4KOYA 3EXNA 1CJWA 2X7BA 1Y1WA 3BLNA 3EO4A 3CF2A 2V3VA 5CNPA 2WAQA 3WR7A 3V8IA 5IX3A 4R3KA 1TMOA 1QSOA 4MBUA 1QSNA 4XPKA 4QUSA 5H86A 3PLXB 3D2PA 1KZFA 3HKZA 1GHEA 1KQFA 1IIDA 3R9GA 2P0WA 3I9SA 4H6UA 4MI4A 2ZPAA 1YLEA 4OLLA 2R7ZA 1QSRA 5C1BA 3FXTA 3N7ZA 4JLYA 3GTOA 3QC8A 3DR6A 4ORFA 4FD7A 2OZUA 1Y4ZA 1Y9WA 5EBVA 1N71A 2FT0A 1PT0A 3CXPA 2VXKA 2I00A 1E61A 1IYLA 1J4JA 3TIWA 2JA6A 1VC3B 2VQYA 3QQ8A 1H0HA 5JQ4A 4F6AA 4QIWA 1YGHA 1OZPA 3QWZA 3FB3A 4Y49C 5DYIA 3FIXA 5FTJA 1M4DA 4U9YA 1PYUB 1K83A 1PQFA 5FTMA 2B4DA 4XNHB 4PSWA 1XMTA 3IR7A 2Q4YA 4XPLA 2AJ6A 1XE4A 2K5TA 5F48A 4KDLA 2J8NA 2Z0ZA 1NSLA 2QECA 2ZXVA 3G8WA 3EFAA 3DNSA 2B4BA 3DMRA 5C82A 3JUWA 3HU3A 2BSWA 3GTKA 1S7FA 2ATRA 1BOBA 4FD5A 4XPDC 2PC1A 2FSRA 4ONUA 4R9MA 2R93A 1OGYA 5EC4A 3R9FA 3GTQA 1YR0A 2OU2A 3T90A 5KTAA 2Q7BA 1AW8B 1S7NA 5GCNA 2CY2A 1KUXA 2OZGA 4PK2A 2J8RA 1CM0A 1K4JA 3QB8A 4J3GA 5T5MD 2NMTA 2B58A 4U9ZA 3E0KA 3PP9A 1IW7D 1M4IA 2D4OA 4QBJA 1PYQA 4NEXA 1CR5A 1Q2DA 5JPHA 3O5AA 4GA6A 1FY7A 4AOKB 1S60A 2EEOB 1B87A 2BEIA 1WK4A 1Q16A 4YGOA 2ZW5A 2JIMA 1I3QA 2VI7A 2F5IA 3EC4A 3GTJA 4JXRA 4L89A 4QC6A 2Y0MA 3FKIA 1U6MA 2C45A 2D4PA 4LUAA 1Z4RA 4KODA 2HV2A 4CAVA 2VPXA 2PRBA 4MHDA 4NSQA 2OB0A 3HU1A 4GS4A 4KUAA 3S6GA 3UY5A 2ZW4A 3GTPA 1MJBA 1Z9UA 4KOSA
chains in the Genus database with same CATH superfamily
5HVGA 2KI8A 5BWAB 3H8GA 5FVJA 5THWA 4NGTA 2PI8A 1LCPA 1E18A 1AYEA 3BI1A 4JWPA 3SJEA 3SJGA 5DYGA 1Z2LA 2ZW7A 1XBUA 3T8WA 3KGQA 3DR8A 2PR1A 2A6ED 4XPDB 4KOWA 3OUGA 1M1DA 2ZEGA 4AG9A 1SFOA 2VPZA 5HMNA 4HNXB 4B5PA 2BCOA 2JA5A 2CIJA 4DMRA 1Q7LA 3KQZA 4JD6A 4NF1A 1DMSA 1QDNA 1R57A 2XEJA 4QVTA 5CBMA 2R1IA 2IL4A 4IHMA 3KASA 2Z3KA 2YNCC 1R27A 1QSMA 1SIWA 2REEA 4P44A 3TCVA 4DUKA 2PJHB 4HKFA 1VHOA 1BPNA 1VKCA 1ZC1A 3NH5A 4KO8A 4CRYG 3KL9A 2PQ8A 4IF5A 3D30A 5DWMA 3RO0A 1CZ4A 1YMEA 5D29A 3TM7B 1KWMA 1KQGA 4CAFA 1NE9A 1YW4A 2IJZA 2C6PA 2JIQA 1ARMA 5LRKA 2V77A 3TO7A 4M6HA 1X12A 5F47A 2CNSA 4YRHA 4FD6A 4CYQA 1TXRA 1IB1E 4H89A 2R8VA 1S3SA 1YK3A 4OADA 4ZI6A 4HNYB 2P6EA 3R1KA 3D8PA 3GTLA 4AONB 1TWGA 2JBJA 5K8MA 4RI1A 1ELLP 2R98A 4OC3A 4CAXA 1QCSA 2FS5A 2G3AA 5EMIA 3SHPA 3X2GA 4A2ZA 2GFQA 3EY5A 1R9TA 1ON0A 3PGPA 2Z3MA 4K3NA 1IOFA 4H6ZA 5B6CA 1Q2YA 4CGNA 4FD4A 1ZG9A 4CRYB 4EWTA 1B6BA 1P0HA 4AVCA 1M44A 1CBXA 2JA7A 2PSWA 5K8NA 2RFHA 3GIUA 2E2IA 4R6TA 2EO8A 4B10A 4MHYA 3CQZA 4GXHA 3KHZA 4RUHA 1YREA 3ZJ0A 3RBUA 2DXQA 1SMYD 4MFPA 2E2HA 2VBQA 1BLLE 4AYBA 3FEEA 4GA5A 3TX8A 3KQXA 1QSTA 2H5MA 3SI0A 1JQGA 2WUUA 3BI0A 4MHZA 1S7KA 4NFRA 3OWCA 1ZYRD 1PQHA 5C88A 1TWFA 2NYAA 2NYQA 1LFWA 4B6ZA 4KOTA 3ISXA 4P4JA 4C2XA 2VUMA 3R95A 3JTKA 1TWAA 2FL4A 4A31A 4UCMA 1XEBA 3ZZIA 3R9EA 3VWEA 3TO6A 2EVNA 4KOXA 5LYFA 2A68D 1CJWA 4C2YA 2PJAA 3EO4A 3CF2A 3IC1A 7CPAA 3WR7A 5JM6A 3V8IA 3PFEA 1TMOA 4XPKA 5H86A 2AFOA 3HKZA 2V8GA 3R9GA 4F0XA 4ENGA 4OLLA 5GM9A 2R7ZA 4JP7A 3FXTA 1YLOA 3N7ZA 3GTOA 3S9NA 2ZEEA 3X2HA 1IYLA 3QQ8A 1ELMP 4CAEA 3FB3A 5DYIA 1TKJA 1M4DA 4U9YA 2WZNA 4XPLA 4PSWA 3IR7A 1PYTB 1XE4A 2Z0ZA 3DNSA 2B4BA 5C82A 2FVGA 3X2PA 2ATRA 4P45A 4ONUA 1OGYA 4MFLA 3GTQA 1YR0A 3BXMA 2CY2A 1KUXA 2J8RA 2ANPA 2B58A 2ZEPA 1A2ZA 4QBJA 2CF4A 2YUJA 1FY7A 4NGMA 1Q16A 2ZW5A 2PJ0A 2JIMA 5K8PA 4FG2A 1I3QA 2V8DA 2VI7A 3GTJA 4H2KA 4NGNA 4L89A 4QC6A 2Y0MA 5HVFA 3FKIA 1U6MA 1Z4RA 4A37A 4CAVA 2PRBA 2F8HA 3S6GA 2ZW4A 1Z9UA 3BHXA 2V8HA 4CGMA 2VPYA 4PV6A 3D68A 3WT4A 3GTMA 3LODA 1OBRA 3P2FA 4UIAA 2XEIA 3D3SA 4Q36A 4KS9A 2XEGA 2A6HD 4EFDA 2OOTA 5AG5A 3FYNA 3WC7A 4NXYA 5A28A 3G3SA 3RAMA 2KQAA 4R57A 4ZY1A 1IU8A 2Y0SA 1F2PA 3KKWA 2JEVA 3F8KA 2VPWA 4ZYQA 5AG4A 4WWVA 1LRZA 1CG2A 4KORA 6CPAA 2B4DB 4KSFA 1ZG8A 5HH1A 4P4DA 4FBEA 3CXSA 3LD2A 4AG7A 2A69D 1R43A 3TT2A 4E2AA 3CXQA 4KLNA 3P2HA 5F09A 4L48A 2BL1A 4HPSA 4U5YA 1G8KA 3IR5A 3IJ3A 2PNWA 2NSMA 2PJ7A 5E96A 3LMSA 2PJ1A 4MMOA 1CZ5A 2G0BA 5GLYA 5C18A 4JZ0A 5FTNA 1FT7A 2EK9A 3X2LA 2JIOA 1PQEA 3IU2A 3D2MA 1VGYA 1BAVA 5H4UA 1Z5RA 1H8LA 4ZX8A 4KLWA 1I1DA 2GREA 2AFSA 4OAEA 3IFEA 1L8FA 4OMEA 4KZTA 4EVYA 1LANA 2IQ6A 1I50A 1IGBA 3S9LA 1Y0YA 4MCQA 3W6SA 2B63A 1XRYA 3FRMA 4Q38A 4QB9A 3V38A 4JYWA 1WWZA 5ELYA 2I79A 4R3LA 2PVWA 3SUKA 3B2YA 4AAYA 4B5PB 3D7GA 2ZOGA 1UHEA 4AVBA 1TF9A 3HUVA 2R7HA 3ENGA 1F2OA 4C7HA 4F9VA 2PIYA 1Y9KA 4KLVA 4UCPA 1ARLA 3KHXA 1BW4A 2ABZA 3FNCA 2O28A 1MK4A 1BW3A 4R7MA 2Q0YA 4K30A 1E32A 1Z8XA 3D67A 4MY3A 4ZX9A 5IV0A 2DEAA 1E5VA 3SI2A 1PU9A 2J8MA 2QYVA 5H84A 2Q4VA 5D8NA 2WB1A 3NE7A 2P6GA 5ISVA 3B3TA 3GYAA 4P4BA 4DJLA 4GM5A 4UWIA 4CGOA 2JLMA 1SQHA 3D7DA 3B8GA 3FECA 4TNUA 5KTCA 1RXTA 1X10A 2O53A 2GLJA 4TWEA 5LRJA 2B5GA 4X3RA 1BO4A 2WPWA 2I3CA 4KOYA 2AFUA 1Y1WA 3BLNA 2V3VA 5CNPA 2PRQA 5JH9A 3VATA 4NJRA 1QSOA 1QSNA 4PXDA 4DYOA 1KQFA 4P4FA 2F7VA 2P0WA 3I9SA 1YLEA 4OC2A 2QVPA 4P4EA 3D66A 5C1BA 4A32A 3QC8A 1CP6A 4NGRA 2OZUA 1ZO0A 3CZBA 1Y9WA 2HC9A 5EBVA 1N71A 1XMBA 1J4JA 3TIWA 2JA6A 1VC3B 2ZEHA 4F6AA 1IOIA 3B3WA 1OZPA 2BOAA 2CXAA 4P10A 3FIXA 2O5JD 1ZLHA 4JCWA 1HDUA 4XNHB 4UEEA 2AFXA 1XMTA 5F48A 4KDLA 4Q7AA 1TKFA 2ZXVA 3G8WA 3EFAA 3DMRA 2V8VA 3S9MA 2BSWA 1BOBA 2PC1A 2FSRA 4MHNA 3R9FA 5KTAA 2Q7BA 2PJ6A 5GCNA 3X2KA 2BH0A 2OZGA 4PK2A 5LYIA 3QB8A 1CM0A 5T5MD 2EK8A 4KSAA 3E0KA 3PP9A 4UEZA 3O5AA 2AE0X 4GA6A 4AOKB 1B87A 4ONWA 3FEDA 4MHPA 4F8ZA 2F5IA 2J9AA 3EC4A 4BD9A 1VIXA 3PB9X 2XEFA 3K2KA 4LUAA 1Y7EA 3UY5A 3N5FA 1WC2A 1R3NA 3S6HA 4NJQA 3H5ZA 4YFJA 4PXBA 1CPXA 5G20A 3FVLA 5G22A 5G21A 4F9UA 1M4LA 1PT1A 1DTDA 2FXFA 1TIQA 1XF8A 2Z3NA 4MFQA 3PB6X 1CP7A 2HUZA 5F49A 4UA3A 4UBRA 1E60A 4CS0A 2G3TA 4R87A 5GLXA 3B3SA 4OC4A 4KVXA 1UWYA 4UFVA 4B13A 3R96A 4RV0A 3NE8A 4P6YA 3KZWA 1LAMA 1XJOA 2JDDA 1HDQA 3MRUA 4CRZA 5FTKA 2NVYA 5J8FA 4AB7A 3T9YA 1QQ9A 1AMPA 3TTHA 3H4QA 4MCPA 3HU2A 4IUSA 1JWQA 4ZY0A 1ZLIA 1GYTA 3M3GA 4B11A 3RZAA 3MGDA 3CPAA 4FFTA 2REFA 4UFWA 4L8AA 2PR8A 4MRIA 5J8CA 3WC5A 3H8EA 2RC4A 4MJ8A 4JS7A 2OH1A 1I21A 4B12A 3QAHA 1OA9A 1Y5IA 1AUGA 3WABA 4KOUA 3SJFA 3PBEA 4OIWA 2Q44A 2ENGA 4OC0A 3IU1A 1YVOA 5LYDA 4AVAA 3IWWA 1PUAA 5IB0A 3GY9A 2GAEA 2YNEA 4PXEA 4UCNA 3S6KA 3QAYA 1S5KA 1L0CA 4AXVA 1CX8A 4CYOA 2PDOA 2VL1A 4Y49B 3SJXA 1PPYA 4MCSA 4CAWA 1FNOA 1ZG7A 1KUVA 3NFZA 3BJ7A 3I3GA 3SULA 2O4HA 4DNCA 2B3UA 2PJ8A 4ZBGA 4A39A 4B14A 2CNTA 2FIAA 2PJ3A 1HD5A 1Y1VA 2AFZA 3GKRA 2NVXA 4NOHA 3GTGA 4B5OA 2RB7A 2VEZA 2C6CA 1Y7RA 3ML1A 4JJXA 5G1ZA 1VHSA 1MJ9A 2PJCA 5A27A 1TWCA 2JDCA 4UWJA 4CPAA 2A4NA 2BUEA 2IV2X 5T5ID 4KVME 4UEFA 1EU1A 3H8FA 2CNMA 4KDIA 2OR4A 3LWUA 2GANA 4Z65A 3GUXA 3B3VA 2FCKA 1XFOA 3MN8A 4MY0A 1AA6A 1IYKA 3QNVA 2C27A 4WJBA 3JVNA 3QQ7A 2DPSA 4CGLA 3FH4A 3SI1A 4NGSA 4MXUA 2Z11A 3IGRA 4MFJA 3L2NA 5AG7A 3X2NA 2C1CA 3PZJA 4KUBA 1I12A 1RO5A 2QMLA 2FE7A 1S7LA 2JBKA 4BMHA 3TO9A 1FDOA 3BJ8A 3FBUA 3EXNA 1DE4C 3B3CA 1YNJD 4OC5A 4UIBA 2WAQA 4R3KA 4X8IA 3CPXA 4MBUA 2CTCA 1GHEA 1IIDA 2WSAA 3X2MA 2ZPAA 2EBJA 3JRUA 4JLYA 3DR6A 4FD7A 1Y4ZA 1LOKA 1PT0A 2VXKA 2C6GA 1E61A 1PCAA 2VQYA 4C68A 4EMEA 3ISZA 5JQ4A 5CPAA 4QIWA 1Y0RA 3QWZA 4C7IA 5FTJA 4OP4A 3DLJA 1PYUB 1K83A 1Z8TA 1PQFA 5FTMA 2AJ6A 3B35A 5DS0A 1NSLA 2YNDA 2QECA 4G1PA 3JUWA 4JP6A 1TKHA 3FF3A 4XPDC 4R9MA 5EC4A 3VARA 5JGFA 3PB4X 3T90A 3HLPA 1AW8B 1K4JA 3I1UA 1YNND 4U9ZA 2CTBA 2D4OA 3LACA 4NEXA 1CR5A 1Q2DA 5JPHA 4M6IA 2PJ5A 1WK4A 4FWUA 1YQEA 2HCZX 4JXRA 4BINA 1EE3P 2C45A 1HEEA 4AVRA 2ZEOA 4YWYA 2ZEDA 3IIBA 2VPXA 2OB0A 3HU1A 4GS4A 4MFKA 4CYPA 1YW6A 3GTPA 2ZOFA 2ODFA 1MJAA 3RYOA 2B5GB 2GE3A 4R76A 4PXCA 3DDDA 2NAPA 3X2JA 2PJ4A 3H0GA 4A95A 2PVVA 2G6GA 4M85A 2VZZA 2PCUA 3FJUA 1P4NA 3FMCA 3PBBA 5KTDA 4LQ6A 4C2MA 4X5KA 2PMZA 1V0CA 1YX0A 2GLFA 1FDIA 2BO9A 2ZEMA 3A9LA 2QJ8A 2GIVA 4OKOA 2AFWA 2Z3LA 5I0CA 3PEIA 1XIXA 1RTQA 4RS2A 2JIRA 5I4MA 4C2ZA 3D7FA 2PICA 2Z3OA 4E8OA 4HNWB 4KOVA 4FAIA 4KSIA 3KR4A 2POKA 3IWEA 5J1QA 4I49A 2V45A 1NMTA 2EWBA 2GU2A 1G8JA 3TOAA 2Q43A 2Q4ZA 1YVKA 2FIWA 4OIDA 1H5NA 2DPTA 2HQYA 3SXNA 3W6XA 4W9YA 1N10A 3NH4A 3IWGA 1TWHA 1UHDA 3KI9A 4NGPA 5AG6A 4M3SA 4XNHC 3VWDA 2PIZA 2PE3A 8CPAA 4BBHA 5GLFA 2B3VA 3CZXA 4X2TA 3W91A 2WYRA 2ZELA 3WC6A 2Q04A 1WCMA 2E7ZA 3SXOA 2YU9A 2G9DA 3NH8A 2JIPA 1R7RA 1KUYA 3D7HA 1Q2CA 4FG4A 5DWNA 1BPMA 1IICA 4E0AA 4PQAA 5F46A 3F5BA 2JEWA 2Z3PA 5LRGA 1TF8A 1M4GA 4LX9A 2PJ9A 2KCWA 2PJJA 3D4UA 5LYLA 3K9UA 4KVOE 2AE6A 2DF5A 3GLJA 4MFZA 2OZHA 2P6FA 1UFHA 4CYNA 1IY7A 4CS0B 1WLFA 4RN7A 1Z4EA 4PSXA 2EUIA 3F0AA 4JXQA 1NSAA 2VZYA 2WPXA 4PK3A 3TOBA 3SUMA 3C26A 4CRZB 3X2IA 5K8OA 5FTLA 3CT9A 5EPPA 3TE4A 4JJOA 1S3ZA 4NGQA 4ZM7A 2ZEFA 4AZDA 2Z10A 4UFXA 4FERA 4NCZA 3DSBA 3SUJA 1Z8WA 2ZW6A 4F0YA 2G5DA 2QIRA 3S6FA 4A33A 3VH9A 4UF4A 5HXDA 2DMRA 1DMRA 2HB6A 2CW0D 2ARHA 2R92A 4D7ZB 2AFMA 4P4IA 3PRTA 3PB8X 3IR6A 2IMOA 4ZGYB 4II9A 1F57A 3IEHA 3DGVA 3TFYA 4LQGA 2PJ2A 1VHEA 2X7BA 5HVHA 4IK2A 3K9TA 4A30A 4O23A 5IX3A 2Q7SA 3TC8A 3NA6A 5AGEA 4QUSA 3PLXB 3D2PA 1KZFA 4A94A 4H6UA 4IAVA 4MI4A 3PFOA 3RNZA 1QSRA 2PJBA 1OA7A 4ORFA 2FT0A 3CXPA 2I00A 4MCRA 1H0HA 4CGPA 1YSJA 4OC1A 1YGHA 4ZY2A 4Y49C 1LAPA 3IO1A 2B4DA 2YGWA 2Q4YA 2K5TA 2J8NA 4YU9A 3HU3A 3GTKA 1S7FA 4FD5A 2R93A 2OU2A 3V7ZA 3X2OA 1S7NA 3GB0A 4J3GA 2ZENA 2NMTA 1IW7D 1M4IA 1PYQA 4PPZA 2BE5D 1Z8LA 1XOVA 1QMUA 1S60A 3CDXA 2EEOB 2BEIA 2Q51A 1CPSA 4YGOA 5IB9A 4M6GA 2D4PA 2YNCA 4A38A 4KODA 3PB7X 2HV2A 3B7IA 4FUUA 3FX6A 4MHDA 4NSQA 4KUAA 3KR5A 4R8FA 1MJBA 4KOSA
chains in the Genus database with same CATH topology
3S6HA 3RYOA 2KI8A 1MJAA 5BWAB 3H5ZA 2B5GB 4CGMA 5FVJA 2GE3A 4YFJA 2VPYA 4PV6A 3DDDA 2NAPA 5G20A 2PI8A 1E18A 5G22A 3GTMA 3LODA 4JWPA 3H0GA 5G21A 4A95A 5DYGA 1PT1A 2G6GA 2ZW7A 4M85A 2VZZA 3P2FA 3DR8A 2PR1A 2FXFA 2A6ED 1TIQA 1XF8A 2Z3NA 3D3SA 4XPDB 4MFQA 1P4NA 4KOWA 2HUZA 5F49A 4UA3A 4UBRA 5KTDA 1E60A 3OUGA 4CS0A 1M1DA 2G3TA 4R87A 4AG9A 4Q36A 1SFOA 4KS9A 4C2MA 2VPZA 2A6HD 5HMNA 4HNXB 4KVXA 4UFVA 4X5KA 2PMZA 4B13A 4B5PA 3R96A 1V0CA 1YX0A 4RV0A 2JA5A 1FDIA 4DMRA 5AG5A 3FYNA 3A9LA 4JD6A 4NF1A 2GIVA 4NXYA 5A28A 1DMSA 1QDNA 3G3SA 1R57A 2JDDA 2Z3LA 4QVTA 2R1IA 2IL4A 4R57A 4CRZA 5FTKA 2NVYA 2Z3KA 2YNCC 5I0CA 1R27A 5J8FA 2Y0SA 1QSMA 4AB7A 3KKWA 1SIWA 1XIXA 2JEVA 2VPWA 2REEA 3F8KA 3T9YA 5AG4A 3TCVA 4RS2A 2JIRA 2PJHB 3TTHA 4C2ZA 3H4QA 4HKFA 2PICA 2Z3OA 4E8OA 4HNWB 4KOVA 1LRZA 1VKCA 1ZC1A 3HU2A 4IUSA 4KORA 3IWEA 2B4DB 4KSFA 4KO8A 2V45A 4I49A 5HH1A 4CRYG 4B11A 2PQ8A 1NMTA 4IF5A 3CXSA 3MGDA 1G8JA 3LD2A 4AG7A 2REFA 4UFWA 4L8AA 5DWMA 3TOAA 2A69D 2PR8A 1CZ4A 1YVKA 2FIWA 1H5NA 2DPTA 2HQYA 3SXNA 5J8CA 3TM7B 3TT2A 4E2AA 3W6XA 1KQGA 3CXQA 2RC4A 4MJ8A 4KLNA 4CAFA 2OH1A 1I21A 1NE9A 4B12A 3QAHA 3P2HA 1Y5IA 3IWGA 1TWHA 1UHDA 2JIQA 2BL1A 4U5YA 4KOUA 5AG6A 4M3SA 2Q44A 1G8KA 3TO7A 5F47A 3IU1A 1YVOA 2CNSA 4AVAA 4YRHA 3IR5A 1PUAA 4FD6A 5IB0A 4CYQA 3GY9A 2GAEA 2PNWA 2YNEA 1IB1E 4XNHC 4UCNA 3VWDA 3S6KA 1S5KA 1L0CA 5E96A 4H89A 2R8VA 4CYOA 2PDOA 4BBHA 5GLFA 4Y49B 1S3SA 1YK3A 4OADA 2B3VA 4HNYB 1CZ5A 2G0BA 2P6EA 3GTLA 4AONB 1PPYA 3D8PA 3R1KA 1TWGA 3W91A 4CAWA 2Q04A 5C18A 5FTNA 1KUVA 1WCMA 2E7ZA 3SXOA 2YU9A 3BJ7A 3I3GA 2JIPA 4RI1A 1R7RA 2JIOA 1PQEA 1KUYA 4DNCA 2B3UA 3IU2A 1Q2CA 3D2MA 5DWNA 2R98A 4CAXA 4ZBGA 1IICA 4B14A 2CNTA 4KLWA 1QCSA 2FIAA 2FS5A 1I1DA 4E0AA 5F46A 3F5BA 2G3AA 1Y1VA 3SHPA 2Z3PA 4A2ZA 3GKRA 1M4GA 3EY5A 4OAEA 2NVXA 1R9TA 1ON0A 3PGPA 4LX9A 2KCWA 2PJJA 2Z3MA 4NOHA 4KZTA 4EVYA 3K9UA 3GTGA 4B5OA 4H6ZA 4KVOE 5B6CA 1Q2YA 2AE6A 1I50A 4CGNA 4FD4A 2VEZA 4CRYB 4MFZA 1B6BA 2OZHA 3W6SA 1P0HA 2B63A 1UFHA 2P6FA 4AVCA 4CYNA 4CS0B 1WLFA 3FRMA 1Y7RA 4Q38A 4QB9A 1WWZA 2I79A 3ML1A 1M44A 1Z4EA 4PSXA 4JJXA 4R3LA 2JA7A 2PSWA 5G1ZA 1VHSA 2EUIA 1MJ9A 5A27A 1TWCA 3F0AA 2JDCA 4UWJA 4AAYA 4B5PB 4JXQA 1UHEA 2E2IA 4AVBA 2VZYA 2WPXA 2A4NA 4B10A 2BUEA 2IV2X 4PK3A 3TOBA 3CQZA 5T5ID 2R7HA 1YREA 4KVME 3C26A 3ZJ0A 4C7HA 4CRZB 2DXQA 1SMYD 1EU1A 1Y9KA 4MFPA 5FTLA 4KLVA 2CNMA 4KDIA 4UCPA 2E2HA 2VBQA 5EPPA 3TE4A 1S3ZA 4AYBA 2GANA 4GA5A 3FNCA 4AZDA 2Z10A 1QSTA 2FCKA 2O28A 1MK4A 4UFXA 2Q0YA 2H5MA 4MY0A 4NCZA 2WUUA 3DSBA 1AA6A 2ZW6A 1IYKA 2C27A 1E32A 1S7KA 3JVNA 4K30A 4F0YA 3OWCA 3QQ7A 4MY3A 5IV0A 1ZYRD 2G5DA 2QIRA 3S6FA 1E5VA 4A33A 1PQHA 5C88A 1PU9A 2DPSA 4CGLA 1TWFA 2J8MA 2NYAA 5H84A 2Q4VA 2DMRA 1DMRA 2Z11A 4KOTA 2CW0D 2ARHA 3IGRA 2WB1A 4MFJA 2R92A 4C2XA 2VUMA 5AG7A 4D7ZB 3R95A 3NE7A 2P6GA 3JTKA 5ISVA 1TWAA 3GYAA 3PZJA 4UWIA 4CGOA 2FL4A 4A31A 3IR6A 2JLMA 1SQHA 4KUBA 1I12A 4UCMA 1RO5A 3B8GA 5KTCA 1XEBA 3ZZIA 3R9EA 2QMLA 2FE7A 4ZGYB 3VWEA 1S7LA 4II9A 3TO6A 4BMHA 1RXTA 2EVNA 3TO9A 1FDOA 2B5GA 4KOXA 3TFYA 1BO4A 3BJ8A 2WPWA 2A68D 3FBUA 4KOYA 3EXNA 1CJWA 4C2YA 2X7BA 1Y1WA 3BLNA 1YNJD 3EO4A 3CF2A 2V3VA 5CNPA 4A30A 2WAQA 3WR7A 3V8IA 5IX3A 4R3KA 1TMOA 5AGEA 1QSOA 4MBUA 1QSNA 4XPKA 4QUSA 5H86A 3PLXB 3D2PA 1KZFA 3HKZA 1GHEA 1KQFA 1IIDA 3R9GA 2WSAA 4F0XA 2P0WA 3I9SA 4H6UA 4MI4A 2ZPAA 1YLEA 4OLLA 2R7ZA 1QSRA 5C1BA 4A32A 3FXTA 3N7ZA 4JLYA 3GTOA 3QC8A 3DR6A 4ORFA 4FD7A 2OZUA 1ZO0A 1Y4ZA 3CZBA 1Y9WA 5EBVA 1N71A 2FT0A 1PT0A 3CXPA 2VXKA 2I00A 1E61A 1IYLA 1J4JA 3TIWA 2JA6A 1VC3B 2VQYA 3QQ8A 4C68A 1H0HA 5JQ4A 4CGPA 4F6AA 4QIWA 4CAEA 1YGHA 1OZPA 3QWZA 3FB3A 2CXAA 4Y49C 4C7IA 5DYIA 3FIXA 5FTJA 2O5JD 1M4DA 4U9YA 1PYUB 1K83A 1PQFA 5FTMA 2B4DA 2YGWA 4XNHB 4PSWA 1XMTA 3IR7A 2Q4YA 4XPLA 2AJ6A 1XE4A 2K5TA 5F48A 4KDLA 2J8NA 2Z0ZA 1NSLA 2YNDA 2QECA 2ZXVA 3G8WA 3EFAA 3DNSA 2B4BA 3DMRA 5C82A 3JUWA 3HU3A 2BSWA 3GTKA 1S7FA 2ATRA 1BOBA 4FD5A 4XPDC 2PC1A 2FSRA 4ONUA 4R9MA 2R93A 1OGYA 5EC4A 4MFLA 3R9FA 3GTQA 1YR0A 2OU2A 3T90A 5KTAA 2Q7BA 1AW8B 1S7NA 5GCNA 2CY2A 1KUXA 2OZGA 4PK2A 2J8RA 1CM0A 1K4JA 3QB8A 4J3GA 5T5MD 2NMTA 2B58A 4KSAA 1YNND 3E0KA 4U9ZA 3PP9A 1IW7D 1M4IA 2D4OA 4QBJA 1PYQA 4NEXA 1CR5A 1Q2DA 2YUJA 5JPHA 3O5AA 2BE5D 2AE0X 4GA6A 1FY7A 4AOKB 1S60A 2EEOB 1B87A 2BEIA 1WK4A 1Q16A 4YGOA 2ZW5A 2JIMA 1I3QA 2VI7A 2F5IA 3EC4A 3GTJA 4JXRA 4L89A 4QC6A 2Y0MA 3FKIA 1U6MA 2C45A 2D4PA 4LUAA 2YNCA 1Z4RA 4KODA 2HV2A 4CAVA 2VPXA 2PRBA 4MHDA 4NSQA 2OB0A 3HU1A 4GS4A 4KUAA 4MFKA 3S6GA 3UY5A 4CYPA 2ZW4A 3GTPA 1MJBA 1Z9UA 4KOSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S6H A;  3RYO A;  2KI8 A;  1MJA A;  2B5G B;  5FVJ A;  2GE3 A;  4YFJ A;  2VPY A;  4PV6 A;  3DDD A;  2NAP A;  1E18 A;  3GTM A;  3LOD A;  4JWP A;  3H0G A;  5DYG A;  1PT1 A;  2ZW7 A;  4M85 A;  2VZZ A;  3P2F A;  3DR8 A;  2PR1 A;  2FXF A;  1TIQ A;  1XF8 A;  3D3S A;  4XPD B;  1P4N A;  4KOW A;  2HUZ A;  5F49 A;  4UA3 A;  4UBR A;  5KTD A;  1E60 A;  2G3T A;  3OUG A;  4CS0 A;  1M1D A;  4R87 A;  4AG9 A;  1SFO A;  4C2M A;  2VPZ A;  5HMN A;  4HNX B;  4KVX A;  4X5K A;  2PMZ A;  4B5P A;  3R96 A;  1V0C A;  1YX0 A;  4RV0 A;  2JA5 A;  1FDI A;  4DMR A;  3FYN A;  4JD6 A;  4NF1 A;  2GIV A;  4NXY A;  1DMS A;  1QDN A;  3G3S A;  1R57 A;  2JDD A;  4QVT A;  2R1I A;  2IL4 A;  4R57 A;  4CRZ A;  5FTK A;  2NVY A;  5I0C A;  1R27 A;  5J8F A;  2Y0S A;  1QSM A;  4AB7 A;  3KKW A;  1SIW A;  1XIX A;  2JEV A;  2VPW A;  2REE A;  3F8K A;  3T9Y A;  3TCV A;  4RS2 A;  2JIR A;  2PJH B;  3TTH A;  3H4Q A;  4HKF A;  4E8O A;  4HNW B;  4KOV A;  1LRZ A;  1VKC A;  3HU2 A;  4IUS A;  4KOR A;  2B4D B;  4KO8 A;  2V45 A;  4I49 A;  5HH1 A;  4CRY G;  2PQ8 A;  1NMT A;  4IF5 A;  3CXS A;  3MGD A;  1G8J A;  3LD2 A;  4AG7 A;  2REF A;  4L8A A;  5DWM A;  3TOA A;  2PR8 A;  1CZ4 A;  1YVK A;  2FIW A;  1H5N A;  2HQY A;  3SXN A;  5J8C A;  3TM7 B;  3TT2 A;  4E2A A;  3W6X A;  1KQG A;  3CXQ A;  2RC4 A;  4MJ8 A;  4KLN A;  2OH1 A;  1I21 A;  1NE9 A;  3QAH A;  3P2H A;  1Y5I A;  3IWG A;  1TWH A;  1UHD A;  2JIQ A;  2BL1 A;  4U5Y A;  4KOU A;  4M3S A;  2Q44 A;  1G8K A;  3TO7 A;  5F47 A;  1YVO A;  2CNS A;  4AVA A;  4YRH A;  3IR5 A;  1PUA A;  4FD6 A;  5IB0 A;  3GY9 A;  1IB1 E;  4XNH C;  3VWD A;  3S6K A;  1S5K A;  1L0C A;  5E96 A;  4H89 A;  2R8V A;  2PDO A;  5GLF A;  4Y49 B;  1S3S A;  1YK3 A;  4OAD A;  2B3V A;  4HNY B;  1CZ5 A;  2G0B A;  2P6E A;  3GTL A;  4AON B;  1PPY A;  3D8P A;  3R1K A;  1TWG A;  3W91 A;  4CAW A;  2Q04 A;  5C18 A;  5FTN A;  1KUV A;  1WCM A;  2E7Z A;  3SXO A;  2YU9 A;  3BJ7 A;  3I3G A;  2JIP A;  4RI1 A;  1R7R A;  2JIO A;  1PQE A;  1KUY A;  4DNC A;  2B3U A;  1Q2C A;  3D2M A;  5DWN A;  2R98 A;  4CAX A;  4ZBG A;  1IIC A;  2CNT A;  4KLW A;  1QCS A;  2FIA A;  2FS5 A;  1I1D A;  4E0A A;  5F46 A;  3F5B A;  2G3A A;  1Y1V A;  3SHP A;  3GKR A;  1M4G A;  3EY5 A;  4OAE A;  2NVX A;  1R9T A;  1ON0 A;  3PGP A;  4LX9 A;  2KCW A;  4KZT A;  4EVY A;  3K9U A;  3GTG A;  4B5O A;  4H6Z A;  4KVO E;  5B6C A;  1Q2Y A;  2AE6 A;  1I50 A;  4FD4 A;  2VEZ A;  4CRY B;  1B6B A;  2OZH A;  3W6S A;  1P0H A;  2B63 A;  1UFH A;  2P6F A;  4AVC A;  4CS0 B;  1WLF A;  3FRM A;  1Y7R A;  4QB9 A;  1WWZ A;  2I79 A;  3ML1 A;  1M44 A;  1Z4E A;  4PSX A;  4JJX A;  4R3L A;  2JA7 A;  2PSW A;  1VHS A;  2EUI A;  1MJ9 A;  1TWC A;  3F0A A;  2JDC A;  4UWJ A;  4AAY A;  4B5P B;  4JXQ A;  1UHE A;  2E2I A;  4AVB A;  2VZY A;  2WPX A;  2A4N A;  2BUE A;  2IV2 X;  4PK3 A;  3TOB A;  3CQZ A;  5T5I D;  2R7H A;  1YRE A;  4KVM E;  3C26 A;  3ZJ0 A;  4CRZ B;  2DXQ A;  1EU1 A;  1Y9K A;  5FTL A;  4KLV A;  2CNM A;  4KDI A;  2E2H A;  2VBQ A;  5EPP A;  3TE4 A;  1S3Z A;  4AYB A;  2GAN A;  4GA5 A;  3FNC A;  4AZD A;  2Z10 A;  1QST A;  2FCK A;  2O28 A;  1MK4 A;  2Q0Y A;  2H5M A;  4MY0 A;  4NCZ A;  3DSB A;  1AA6 A;  2ZW6 A;  1IYK A;  2C27 A;  1E32 A;  1S7K A;  3JVN A;  4K30 A;  4F0Y A;  3OWC A;  3QQ7 A;  4MY3 A;  5IV0 A;  2QIR A;  3S6F A;  1E5V A;  1PQH A;  5C88 A;  1PU9 A;  1TWF A;  2J8M A;  2NYA A;  5H84 A;  2Q4V A;  2DMR A;  1DMR A;  2Z11 A;  4KOT A;  2ARH A;  3IGR A;  2WB1 A;  2R92 A;  2VUM A;  4D7Z B;  3R95 A;  3NE7 A;  2P6G A;  5ISV A;  1TWA A;  3GYA A;  3PZJ A;  4UWI A;  2FL4 A;  3IR6 A;  2JLM A;  1SQH A;  4KUB A;  1I12 A;  1RO5 A;  3B8G A;  5KTC A;  1XEB A;  3ZZI A;  3R9E A;  2QML A;  2FE7 A;  3VWE A;  1S7L A;  4II9 A;  3TO6 A;  4BMH A;  1RXT A;  2EVN A;  3TO9 A;  1FDO A;  2B5G A;  4KOX A;  3TFY A;  1BO4 A;  3BJ8 A;  2WPW A;  3FBU A;  4KOY A;  3EXN A;  1CJW A;  2X7B A;  1Y1W A;  3BLN A;  3EO4 A;  3CF2 A;  2V3V A;  5CNP A;  2WAQ A;  3WR7 A;  3V8I A;  5IX3 A;  4R3K A;  1TMO A;  1QSO A;  4MBU A;  1QSN A;  4XPK A;  4QUS A;  5H86 A;  3PLX B;  3D2P A;  1KZF A;  3HKZ A;  1GHE A;  1KQF A;  1IID A;  3R9G A;  2P0W A;  3I9S A;  4H6U A;  4MI4 A;  2ZPA A;  1YLE A;  4OLL A;  2R7Z A;  1QSR A;  5C1B A;  3FXT A;  3N7Z A;  4JLY A;  3GTO A;  3QC8 A;  3DR6 A;  4ORF A;  4FD7 A;  2OZU A;  1Y4Z A;  1Y9W A;  5EBV A;  1N71 A;  2FT0 A;  1PT0 A;  3CXP A;  2VXK A;  2I00 A;  1E61 A;  1IYL A;  1J4J A;  3TIW A;  2JA6 A;  1VC3 B;  2VQY A;  3QQ8 A;  1H0H A;  5JQ4 A;  4F6A A;  4QIW A;  1YGH A;  1OZP A;  3QWZ A;  3FB3 A;  4Y49 C;  5DYI A;  3FIX A;  5FTJ A;  1M4D A;  4U9Y A;  1PYU B;  1K83 A;  1PQF A;  5FTM A;  2B4D A;  4XNH B;  4PSW A;  1XMT A;  3IR7 A;  2Q4Y A;  4XPL A;  2AJ6 A;  1XE4 A;  2K5T A;  5F48 A;  4KDL A;  2J8N A;  2Z0Z A;  1NSL A;  2QEC A;  2ZXV A;  3G8W A;  3EFA A;  3DNS A;  2B4B A;  3DMR A;  5C82 A;  3JUW A;  3HU3 A;  2BSW A;  3GTK A;  1S7F A;  2ATR A;  1BOB A;  4FD5 A;  4XPD C;  2PC1 A;  2FSR A;  4ONU A;  4R9M A;  2R93 A;  1OGY A;  5EC4 A;  3R9F A;  3GTQ A;  1YR0 A;  2OU2 A;  3T90 A;  5KTA A;  2Q7B A;  1AW8 B;  1S7N A;  5GCN A;  2CY2 A;  1KUX A;  2OZG A;  4PK2 A;  2J8R A;  1CM0 A;  1K4J A;  3QB8 A;  4J3G A;  5T5M D;  2NMT A;  2B58 A;  4U9Z A;  3E0K A;  3PP9 A;  1IW7 D;  1M4I A;  2D4O A;  4QBJ A;  1PYQ A;  4NEX A;  1CR5 A;  1Q2D A;  5JPH A;  3O5A A;  4GA6 A;  1FY7 A;  4AOK B;  1S60 A;  2EEO B;  1B87 A;  2BEI A;  1WK4 A;  1Q16 A;  4YGO A;  2ZW5 A;  2JIM A;  1I3Q A;  2VI7 A;  2F5I A;  3EC4 A;  3GTJ A;  4JXR A;  4L89 A;  4QC6 A;  2Y0M A;  3FKI A;  1U6M A;  2C45 A;  2D4P A;  4LUA A;  1Z4R A;  4KOD A;  2HV2 A;  4CAV A;  2VPX A;  2PRB A;  4MHD A;  4NSQ A;  2OB0 A;  3HU1 A;  4GS4 A;  4KUA A;  3S6G A;  3UY5 A;  2ZW4 A;  3GTP A;  1MJB A;  1Z9U A;  4KOS A; 
#chains in the Genus database with same CATH topology
 5HVG A;  2KI8 A;  5BWA B;  3H8G A;  5FVJ A;  5THW A;  4NGT A;  2PI8 A;  1LCP A;  1E18 A;  1AYE A;  3BI1 A;  4JWP A;  3SJE A;  3SJG A;  5DYG A;  1Z2L A;  2ZW7 A;  1XBU A;  3T8W A;  3KGQ A;  3DR8 A;  2PR1 A;  2A6E D;  4XPD B;  4KOW A;  3OUG A;  1M1D A;  2ZEG A;  4AG9 A;  1SFO A;  2VPZ A;  5HMN A;  4HNX B;  4B5P A;  2BCO A;  2JA5 A;  2CIJ A;  4DMR A;  1Q7L A;  3KQZ A;  4JD6 A;  4NF1 A;  1DMS A;  1QDN A;  1R57 A;  2XEJ A;  4QVT A;  5CBM A;  2R1I A;  2IL4 A;  4IHM A;  3KAS A;  2Z3K A;  2YNC C;  1R27 A;  1QSM A;  1SIW A;  2REE A;  4P44 A;  3TCV A;  4DUK A;  2PJH B;  4HKF A;  1VHO A;  1BPN A;  1VKC A;  1ZC1 A;  3NH5 A;  4KO8 A;  4CRY G;  3KL9 A;  2PQ8 A;  4IF5 A;  3D30 A;  5DWM A;  3RO0 A;  1CZ4 A;  1YME A;  5D29 A;  3TM7 B;  1KWM A;  1KQG A;  4CAF A;  1NE9 A;  1YW4 A;  2IJZ A;  2C6P A;  2JIQ A;  1ARM A;  5LRK A;  2V77 A;  3TO7 A;  4M6H A;  1X12 A;  5F47 A;  2CNS A;  4YRH A;  4FD6 A;  4CYQ A;  1TXR A;  1IB1 E;  4H89 A;  2R8V A;  1S3S A;  1YK3 A;  4OAD A;  4ZI6 A;  4HNY B;  2P6E A;  3R1K A;  3D8P A;  3GTL A;  4AON B;  1TWG A;  2JBJ A;  5K8M A;  4RI1 A;  1ELL P;  2R98 A;  4OC3 A;  4CAX A;  1QCS A;  2FS5 A;  2G3A A;  5EMI A;  3SHP A;  3X2G A;  4A2Z A;  2GFQ A;  3EY5 A;  1R9T A;  1ON0 A;  3PGP A;  2Z3M A;  4K3N A;  1IOF A;  4H6Z A;  5B6C A;  1Q2Y A;  4CGN A;  4FD4 A;  1ZG9 A;  4CRY B;  4EWT A;  1B6B A;  1P0H A;  4AVC A;  1M44 A;  1CBX A;  2JA7 A;  2PSW A;  5K8N A;  2RFH A;  3GIU A;  2E2I A;  4R6T A;  2EO8 A;  4B10 A;  4MHY A;  3CQZ A;  4GXH A;  3KHZ A;  4RUH A;  1YRE A;  3ZJ0 A;  3RBU A;  2DXQ A;  1SMY D;  4MFP A;  2E2H A;  2VBQ A;  1BLL E;  4AYB A;  3FEE A;  4GA5 A;  3TX8 A;  3KQX A;  1QST A;  2H5M A;  3SI0 A;  1JQG A;  2WUU A;  3BI0 A;  4MHZ A;  1S7K A;  4NFR A;  3OWC A;  1ZYR D;  1PQH A;  5C88 A;  1TWF A;  2NYA A;  2NYQ A;  1LFW A;  4B6Z A;  4KOT A;  3ISX A;  4P4J A;  4C2X A;  2VUM A;  3R95 A;  3JTK A;  1TWA A;  2FL4 A;  4A31 A;  4UCM A;  1XEB A;  3ZZI A;  3R9E A;  3VWE A;  3TO6 A;  2EVN A;  4KOX A;  5LYF A;  2A68 D;  1CJW A;  4C2Y A;  2PJA A;  3EO4 A;  3CF2 A;  3IC1 A;  7CPA A;  3WR7 A;  5JM6 A;  3V8I A;  3PFE A;  1TMO A;  4XPK A;  5H86 A;  2AFO A;  3HKZ A;  2V8G A;  3R9G A;  4F0X A;  4ENG A;  4OLL A;  5GM9 A;  2R7Z A;  4JP7 A;  3FXT A;  1YLO A;  3N7Z A;  3GTO A;  3S9N A;  2ZEE A;  3X2H A;  1IYL A;  3QQ8 A;  1ELM P;  4CAE A;  3FB3 A;  5DYI A;  1TKJ A;  1M4D A;  4U9Y A;  2WZN A;  4XPL A;  4PSW A;  3IR7 A;  1PYT B;  1XE4 A;  2Z0Z A;  3DNS A;  2B4B A;  5C82 A;  2FVG A;  3X2P A;  2ATR A;  4P45 A;  4ONU A;  1OGY A;  4MFL A;  3GTQ A;  1YR0 A;  3BXM A;  2CY2 A;  1KUX A;  2J8R A;  2ANP A;  2B58 A;  2ZEP A;  1A2Z A;  4QBJ A;  2CF4 A;  2YUJ A;  1FY7 A;  4NGM A;  1Q16 A;  2ZW5 A;  2PJ0 A;  2JIM A;  5K8P A;  4FG2 A;  1I3Q A;  2V8D A;  2VI7 A;  3GTJ A;  4H2K A;  4NGN A;  4L89 A;  4QC6 A;  2Y0M A;  5HVF A;  3FKI A;  1U6M A;  1Z4R A;  4A37 A;  4CAV A;  2PRB A;  2F8H A;  3S6G A;  2ZW4 A;  1Z9U A;  3BHX A;  2V8H A;  4CGM A;  2VPY A;  4PV6 A;  3D68 A;  3WT4 A;  3GTM A;  3LOD A;  1OBR A;  3P2F A;  4UIA A;  2XEI A;  3D3S A;  4Q36 A;  4KS9 A;  2XEG A;  2A6H D;  4EFD A;  2OOT A;  5AG5 A;  3FYN A;  3WC7 A;  4NXY A;  5A28 A;  3G3S A;  3RAM A;  2KQA A;  4R57 A;  4ZY1 A;  1IU8 A;  2Y0S A;  1F2P A;  3KKW A;  2JEV A;  3F8K A;  2VPW A;  4ZYQ A;  5AG4 A;  4WWV A;  1LRZ A;  1CG2 A;  4KOR A;  6CPA A;  2B4D B;  4KSF A;  1ZG8 A;  5HH1 A;  4P4D A;  4FBE A;  3CXS A;  3LD2 A;  4AG7 A;  2A69 D;  1R43 A;  3TT2 A;  4E2A A;  3CXQ A;  4KLN A;  3P2H A;  5F09 A;  4L48 A;  2BL1 A;  4HPS A;  4U5Y A;  1G8K A;  3IR5 A;  3IJ3 A;  2PNW A;  2NSM A;  2PJ7 A;  5E96 A;  3LMS A;  2PJ1 A;  4MMO A;  1CZ5 A;  2G0B A;  5GLY A;  5C18 A;  4JZ0 A;  5FTN A;  1FT7 A;  2EK9 A;  3X2L A;  2JIO A;  1PQE A;  3IU2 A;  3D2M A;  1VGY A;  1BAV A;  5H4U A;  1Z5R A;  1H8L A;  4ZX8 A;  4KLW A;  1I1D A;  2GRE A;  2AFS A;  4OAE A;  3IFE A;  1L8F A;  4OME A;  4KZT A;  4EVY A;  1LAN A;  2IQ6 A;  1I50 A;  1IGB A;  3S9L A;  1Y0Y A;  4MCQ A;  3W6S A;  2B63 A;  1XRY A;  3FRM A;  4Q38 A;  4QB9 A;  3V38 A;  4JYW A;  1WWZ A;  5ELY A;  2I79 A;  4R3L A;  2PVW A;  3SUK A;  3B2Y A;  4AAY A;  4B5P B;  3D7G A;  2ZOG A;  1UHE A;  4AVB A;  1TF9 A;  3HUV A;  2R7H A;  3ENG A;  1F2O A;  4C7H A;  4F9V A;  2PIY A;  1Y9K A;  4KLV A;  4UCP A;  1ARL A;  3KHX A;  1BW4 A;  2ABZ A;  3FNC A;  2O28 A;  1MK4 A;  1BW3 A;  4R7M A;  2Q0Y A;  4K30 A;  1E32 A;  1Z8X A;  3D67 A;  4MY3 A;  4ZX9 A;  5IV0 A;  2DEA A;  1E5V A;  3SI2 A;  1PU9 A;  2J8M A;  2QYV A;  5H84 A;  2Q4V A;  5D8N A;  2WB1 A;  3NE7 A;  2P6G A;  5ISV A;  3B3T A;  3GYA A;  4P4B A;  4DJL A;  4GM5 A;  4UWI A;  4CGO A;  2JLM A;  1SQH A;  3D7D A;  3B8G A;  3FEC A;  4TNU A;  5KTC A;  1RXT A;  1X10 A;  2O53 A;  2GLJ A;  4TWE A;  5LRJ A;  2B5G A;  4X3R A;  1BO4 A;  2WPW A;  2I3C A;  4KOY A;  2AFU A;  1Y1W A;  3BLN A;  2V3V A;  5CNP A;  2PRQ A;  5JH9 A;  3VAT A;  4NJR A;  1QSO A;  1QSN A;  4PXD A;  4DYO A;  1KQF A;  4P4F A;  2F7V A;  2P0W A;  3I9S A;  1YLE A;  4OC2 A;  2QVP A;  4P4E A;  3D66 A;  5C1B A;  4A32 A;  3QC8 A;  1CP6 A;  4NGR A;  2OZU A;  1ZO0 A;  3CZB A;  1Y9W A;  2HC9 A;  5EBV A;  1N71 A;  1XMB A;  1J4J A;  3TIW A;  2JA6 A;  1VC3 B;  2ZEH A;  4F6A A;  1IOI A;  3B3W A;  1OZP A;  2BOA A;  2CXA A;  4P10 A;  3FIX A;  2O5J D;  1ZLH A;  4JCW A;  1HDU A;  4XNH B;  4UEE A;  2AFX A;  1XMT A;  5F48 A;  4KDL A;  4Q7A A;  1TKF A;  2ZXV A;  3G8W A;  3EFA A;  3DMR A;  2V8V A;  3S9M A;  2BSW A;  1BOB A;  2PC1 A;  2FSR A;  4MHN A;  3R9F A;  5KTA A;  2Q7B A;  2PJ6 A;  5GCN A;  3X2K A;  2BH0 A;  2OZG A;  4PK2 A;  5LYI A;  3QB8 A;  1CM0 A;  5T5M D;  2EK8 A;  4KSA A;  3E0K A;  3PP9 A;  4UEZ A;  3O5A A;  2AE0 X;  4GA6 A;  4AOK B;  1B87 A;  4ONW A;  3FED A;  4MHP A;  4F8Z A;  2F5I A;  2J9A A;  3EC4 A;  4BD9 A;  1VIX A;  3PB9 X;  2XEF A;  3K2K A;  4LUA A;  1Y7E A;  3UY5 A;  3N5F A;  1WC2 A;  1R3N A;  3S6H A;  4NJQ A;  3H5Z A;  4YFJ A;  4PXB A;  1CPX A;  5G20 A;  3FVL A;  5G22 A;  5G21 A;  4F9U A;  1M4L A;  1PT1 A;  1DTD A;  2FXF A;  1TIQ A;  1XF8 A;  2Z3N A;  4MFQ A;  3PB6 X;  1CP7 A;  2HUZ A;  5F49 A;  4UA3 A;  4UBR A;  1E60 A;  4CS0 A;  2G3T A;  4R87 A;  5GLX A;  3B3S A;  4OC4 A;  4KVX A;  1UWY A;  4UFV A;  4B13 A;  3R96 A;  4RV0 A;  3NE8 A;  4P6Y A;  3KZW A;  1LAM A;  1XJO A;  2JDD A;  1HDQ A;  3MRU A;  4CRZ A;  5FTK A;  2NVY A;  5J8F A;  4AB7 A;  3T9Y A;  1QQ9 A;  1AMP A;  3TTH A;  3H4Q A;  4MCP A;  3HU2 A;  4IUS A;  1JWQ A;  4ZY0 A;  1ZLI A;  1GYT A;  3M3G A;  4B11 A;  3RZA A;  3MGD A;  3CPA A;  4FFT A;  2REF A;  4UFW A;  4L8A A;  2PR8 A;  4MRI A;  5J8C A;  3WC5 A;  3H8E A;  2RC4 A;  4MJ8 A;  4JS7 A;  2OH1 A;  1I21 A;  4B12 A;  3QAH A;  1OA9 A;  1Y5I A;  1AUG A;  3WAB A;  4KOU A;  3SJF A;  3PBE A;  4OIW A;  2Q44 A;  2ENG A;  4OC0 A;  3IU1 A;  1YVO A;  5LYD A;  4AVA A;  3IWW A;  1PUA A;  5IB0 A;  3GY9 A;  2GAE A;  2YNE A;  4PXE A;  4UCN A;  3S6K A;  3QAY A;  1S5K A;  1L0C A;  4AXV A;  1CX8 A;  4CYO A;  2PDO A;  2VL1 A;  4Y49 B;  3SJX A;  1PPY A;  4MCS A;  4CAW A;  1FNO A;  1ZG7 A;  1KUV A;  3NFZ A;  3BJ7 A;  3I3G A;  3SUL A;  2O4H A;  4DNC A;  2B3U A;  2PJ8 A;  4ZBG A;  4A39 A;  4B14 A;  2CNT A;  2FIA A;  2PJ3 A;  1HD5 A;  1Y1V A;  2AFZ A;  3GKR A;  2NVX A;  4NOH A;  3GTG A;  4B5O A;  2RB7 A;  2VEZ A;  2C6C A;  1Y7R A;  3ML1 A;  4JJX A;  5G1Z A;  1VHS A;  1MJ9 A;  2PJC A;  5A27 A;  1TWC A;  2JDC A;  4UWJ A;  4CPA A;  2A4N A;  2BUE A;  2IV2 X;  5T5I D;  4KVM E;  4UEF A;  1EU1 A;  3H8F A;  2CNM A;  4KDI A;  2OR4 A;  3LWU A;  2GAN A;  4Z65 A;  3GUX A;  3B3V A;  2FCK A;  1XFO A;  3MN8 A;  4MY0 A;  1AA6 A;  1IYK A;  3QNV A;  2C27 A;  4WJB A;  3JVN A;  3QQ7 A;  2DPS A;  4CGL A;  3FH4 A;  3SI1 A;  4NGS A;  4MXU A;  2Z11 A;  3IGR A;  4MFJ A;  3L2N A;  5AG7 A;  3X2N A;  2C1C A;  3PZJ A;  4KUB A;  1I12 A;  1RO5 A;  2QML A;  2FE7 A;  1S7L A;  2JBK A;  4BMH A;  3TO9 A;  1FDO A;  3BJ8 A;  3FBU A;  3EXN A;  1DE4 C;  3B3C A;  1YNJ D;  4OC5 A;  4UIB A;  2WAQ A;  4R3K A;  4X8I A;  3CPX A;  4MBU A;  2CTC A;  1GHE A;  1IID A;  2WSA A;  3X2M A;  2ZPA A;  2EBJ A;  3JRU A;  4JLY A;  3DR6 A;  4FD7 A;  1Y4Z A;  1LOK A;  1PT0 A;  2VXK A;  2C6G A;  1E61 A;  1PCA A;  2VQY A;  4C68 A;  4EME A;  3ISZ A;  5JQ4 A;  5CPA A;  4QIW A;  1Y0R A;  3QWZ A;  4C7I A;  5FTJ A;  4OP4 A;  3DLJ A;  1PYU B;  1K83 A;  1Z8T A;  1PQF A;  5FTM A;  2AJ6 A;  3B35 A;  5DS0 A;  1NSL A;  2YND A;  2QEC A;  4G1P A;  3JUW A;  4JP6 A;  1TKH A;  3FF3 A;  4XPD C;  4R9M A;  5EC4 A;  3VAR A;  5JGF A;  3PB4 X;  3T90 A;  3HLP A;  1AW8 B;  1K4J A;  3I1U A;  1YNN D;  4U9Z A;  2CTB A;  2D4O A;  3LAC A;  4NEX A;  1CR5 A;  1Q2D A;  5JPH A;  4M6I A;  2PJ5 A;  1WK4 A;  4FWU A;  1YQE A;  2HCZ X;  4JXR A;  4BIN A;  1EE3 P;  2C45 A;  1HEE A;  4AVR A;  2ZEO A;  4YWY A;  2ZED A;  3IIB A;  2VPX A;  2OB0 A;  3HU1 A;  4GS4 A;  4MFK A;  4CYP A;  1YW6 A;  3GTP A;  2ZOF A;  2ODF A;  1MJA A;  3RYO A;  2B5G B;  2GE3 A;  4R76 A;  4PXC A;  3DDD A;  2NAP A;  3X2J A;  2PJ4 A;  3H0G A;  4A95 A;  2PVV A;  2G6G A;  4M85 A;  2VZZ A;  2PCU A;  3FJU A;  1P4N A;  3FMC A;  3PBB A;  5KTD A;  4LQ6 A;  4C2M A;  4X5K A;  2PMZ A;  1V0C A;  1YX0 A;  2GLF A;  1FDI A;  2BO9 A;  2ZEM A;  3A9L A;  2QJ8 A;  2GIV A;  4OKO A;  2AFW A;  2Z3L A;  5I0C A;  3PEI A;  1XIX A;  1RTQ A;  4RS2 A;  2JIR A;  5I4M A;  4C2Z A;  3D7F A;  2PIC A;  2Z3O A;  4E8O A;  4HNW B;  4KOV A;  4FAI A;  4KSI A;  3KR4 A;  2POK A;  3IWE A;  5J1Q A;  4I49 A;  2V45 A;  1NMT A;  2EWB A;  2GU2 A;  1G8J A;  3TOA A;  2Q43 A;  2Q4Z A;  1YVK A;  2FIW A;  4OID A;  1H5N A;  2DPT A;  2HQY A;  3SXN A;  3W6X A;  4W9Y A;  1N10 A;  3NH4 A;  3IWG A;  1TWH A;  1UHD A;  3KI9 A;  4NGP A;  5AG6 A;  4M3S A;  4XNH C;  3VWD A;  2PIZ A;  2PE3 A;  8CPA A;  4BBH A;  5GLF A;  2B3V A;  3CZX A;  4X2T A;  3W91 A;  2WYR A;  2ZEL A;  3WC6 A;  2Q04 A;  1WCM A;  2E7Z A;  3SXO A;  2YU9 A;  2G9D A;  3NH8 A;  2JIP A;  1R7R A;  1KUY A;  3D7H A;  1Q2C A;  4FG4 A;  5DWN A;  1BPM A;  1IIC A;  4E0A A;  4PQA A;  5F46 A;  3F5B A;  2JEW A;  2Z3P A;  5LRG A;  1TF8 A;  1M4G A;  4LX9 A;  2PJ9 A;  2KCW A;  2PJJ A;  3D4U A;  5LYL A;  3K9U A;  4KVO E;  2AE6 A;  2DF5 A;  3GLJ A;  4MFZ A;  2OZH A;  2P6F A;  1UFH A;  4CYN A;  1IY7 A;  4CS0 B;  1WLF A;  4RN7 A;  1Z4E A;  4PSX A;  2EUI A;  3F0A A;  4JXQ A;  1NSA A;  2VZY A;  2WPX A;  4PK3 A;  3TOB A;  3SUM A;  3C26 A;  4CRZ B;  3X2I A;  5K8O A;  5FTL A;  3CT9 A;  5EPP A;  3TE4 A;  4JJO A;  1S3Z A;  4NGQ A;  4ZM7 A;  2ZEF A;  4AZD A;  2Z10 A;  4UFX A;  4FER A;  4NCZ A;  3DSB A;  3SUJ A;  1Z8W A;  2ZW6 A;  4F0Y A;  2G5D A;  2QIR A;  3S6F A;  4A33 A;  3VH9 A;  4UF4 A;  5HXD A;  2DMR A;  1DMR A;  2HB6 A;  2CW0 D;  2ARH A;  2R92 A;  4D7Z B;  2AFM A;  4P4I A;  3PRT A;  3PB8 X;  3IR6 A;  2IMO A;  4ZGY B;  4II9 A;  1F57 A;  3IEH A;  3DGV A;  3TFY A;  4LQG A;  2PJ2 A;  1VHE A;  2X7B A;  5HVH A;  4IK2 A;  3K9T A;  4A30 A;  4O23 A;  5IX3 A;  2Q7S A;  3TC8 A;  3NA6 A;  5AGE A;  4QUS A;  3PLX B;  3D2P A;  1KZF A;  4A94 A;  4H6U A;  4IAV A;  4MI4 A;  3PFO A;  3RNZ A;  1QSR A;  2PJB A;  1OA7 A;  4ORF A;  2FT0 A;  3CXP A;  2I00 A;  4MCR A;  1H0H A;  4CGP A;  1YSJ A;  4OC1 A;  1YGH A;  4ZY2 A;  4Y49 C;  1LAP A;  3IO1 A;  2B4D A;  2YGW A;  2Q4Y A;  2K5T A;  2J8N A;  4YU9 A;  3HU3 A;  3GTK A;  1S7F A;  4FD5 A;  2R93 A;  2OU2 A;  3V7Z A;  3X2O A;  1S7N A;  3GB0 A;  4J3G A;  2ZEN A;  2NMT A;  1IW7 D;  1M4I A;  1PYQ A;  4PPZ A;  2BE5 D;  1Z8L A;  1XOV A;  1QMU A;  1S60 A;  3CDX A;  2EEO B;  2BEI A;  2Q51 A;  1CPS A;  4YGO A;  5IB9 A;  4M6G A;  2D4P A;  2YNC A;  4A38 A;  4KOD A;  3PB7 X;  2HV2 A;  3B7I A;  4FUU A;  3FX6 A;  4MHD A;  4NSQ A;  4KUA A;  3KR5 A;  4R8F A;  1MJB A;  4KOS A; 
#chains in the Genus database with same CATH homology
 3S6H A;  3RYO A;  2KI8 A;  1MJA A;  5BWA B;  3H5Z A;  2B5G B;  4CGM A;  5FVJ A;  2GE3 A;  4YFJ A;  2VPY A;  4PV6 A;  3DDD A;  2NAP A;  5G20 A;  2PI8 A;  1E18 A;  5G22 A;  3GTM A;  3LOD A;  4JWP A;  3H0G A;  5G21 A;  4A95 A;  5DYG A;  1PT1 A;  2G6G A;  2ZW7 A;  4M85 A;  2VZZ A;  3P2F A;  3DR8 A;  2PR1 A;  2FXF A;  2A6E D;  1TIQ A;  1XF8 A;  2Z3N A;  3D3S A;  4XPD B;  4MFQ A;  1P4N A;  4KOW A;  2HUZ A;  5F49 A;  4UA3 A;  4UBR A;  5KTD A;  1E60 A;  3OUG A;  4CS0 A;  1M1D A;  2G3T A;  4R87 A;  4AG9 A;  4Q36 A;  1SFO A;  4KS9 A;  4C2M A;  2VPZ A;  2A6H D;  5HMN A;  4HNX B;  4KVX A;  4UFV A;  4X5K A;  2PMZ A;  4B13 A;  4B5P A;  3R96 A;  1V0C A;  1YX0 A;  4RV0 A;  2JA5 A;  1FDI A;  4DMR A;  5AG5 A;  3FYN A;  3A9L A;  4JD6 A;  4NF1 A;  2GIV A;  4NXY A;  5A28 A;  1DMS A;  1QDN A;  3G3S A;  1R57 A;  2JDD A;  2Z3L A;  4QVT A;  2R1I A;  2IL4 A;  4R57 A;  4CRZ A;  5FTK A;  2NVY A;  2Z3K A;  2YNC C;  5I0C A;  1R27 A;  5J8F A;  2Y0S A;  1QSM A;  4AB7 A;  3KKW A;  1SIW A;  1XIX A;  2JEV A;  2VPW A;  2REE A;  3F8K A;  3T9Y A;  5AG4 A;  3TCV A;  4RS2 A;  2JIR A;  2PJH B;  3TTH A;  4C2Z A;  3H4Q A;  4HKF A;  2PIC A;  2Z3O A;  4E8O A;  4HNW B;  4KOV A;  1LRZ A;  1VKC A;  1ZC1 A;  3HU2 A;  4IUS A;  4KOR A;  3IWE A;  2B4D B;  4KSF A;  4KO8 A;  2V45 A;  4I49 A;  5HH1 A;  4CRY G;  4B11 A;  2PQ8 A;  1NMT A;  4IF5 A;  3CXS A;  3MGD A;  1G8J A;  3LD2 A;  4AG7 A;  2REF A;  4UFW A;  4L8A A;  5DWM A;  3TOA A;  2A69 D;  2PR8 A;  1CZ4 A;  1YVK A;  2FIW A;  1H5N A;  2DPT A;  2HQY A;  3SXN A;  5J8C A;  3TM7 B;  3TT2 A;  4E2A A;  3W6X A;  1KQG A;  3CXQ A;  2RC4 A;  4MJ8 A;  4KLN A;  4CAF A;  2OH1 A;  1I21 A;  1NE9 A;  4B12 A;  3QAH A;  3P2H A;  1Y5I A;  3IWG A;  1TWH A;  1UHD A;  2JIQ A;  2BL1 A;  4U5Y A;  4KOU A;  5AG6 A;  4M3S A;  2Q44 A;  1G8K A;  3TO7 A;  5F47 A;  3IU1 A;  1YVO A;  2CNS A;  4AVA A;  4YRH A;  3IR5 A;  1PUA A;  4FD6 A;  5IB0 A;  4CYQ A;  3GY9 A;  2GAE A;  2PNW A;  2YNE A;  1IB1 E;  4XNH C;  4UCN A;  3VWD A;  3S6K A;  1S5K A;  1L0C A;  5E96 A;  4H89 A;  2R8V A;  4CYO A;  2PDO A;  4BBH A;  5GLF A;  4Y49 B;  1S3S A;  1YK3 A;  4OAD A;  2B3V A;  4HNY B;  1CZ5 A;  2G0B A;  2P6E A;  3GTL A;  4AON B;  1PPY A;  3D8P A;  3R1K A;  1TWG A;  3W91 A;  4CAW A;  2Q04 A;  5C18 A;  5FTN A;  1KUV A;  1WCM A;  2E7Z A;  3SXO A;  2YU9 A;  3BJ7 A;  3I3G A;  2JIP A;  4RI1 A;  1R7R A;  2JIO A;  1PQE A;  1KUY A;  4DNC A;  2B3U A;  3IU2 A;  1Q2C A;  3D2M A;  5DWN A;  2R98 A;  4CAX A;  4ZBG A;  1IIC A;  4B14 A;  2CNT A;  4KLW A;  1QCS A;  2FIA A;  2FS5 A;  1I1D A;  4E0A A;  5F46 A;  3F5B A;  2G3A A;  1Y1V A;  3SHP A;  2Z3P A;  4A2Z A;  3GKR A;  1M4G A;  3EY5 A;  4OAE A;  2NVX A;  1R9T A;  1ON0 A;  3PGP A;  4LX9 A;  2KCW A;  2PJJ A;  2Z3M A;  4NOH A;  4KZT A;  4EVY A;  3K9U A;  3GTG A;  4B5O A;  4H6Z A;  4KVO E;  5B6C A;  1Q2Y A;  2AE6 A;  1I50 A;  4CGN A;  4FD4 A;  2VEZ A;  4CRY B;  4MFZ A;  1B6B A;  2OZH A;  3W6S A;  1P0H A;  2B63 A;  1UFH A;  2P6F A;  4AVC A;  4CYN A;  4CS0 B;  1WLF A;  3FRM A;  1Y7R A;  4Q38 A;  4QB9 A;  1WWZ A;  2I79 A;  3ML1 A;  1M44 A;  1Z4E A;  4PSX A;  4JJX A;  4R3L A;  2JA7 A;  2PSW A;  5G1Z A;  1VHS A;  2EUI A;  1MJ9 A;  5A27 A;  1TWC A;  3F0A A;  2JDC A;  4UWJ A;  4AAY A;  4B5P B;  4JXQ A;  1UHE A;  2E2I A;  4AVB A;  2VZY A;  2WPX A;  2A4N A;  4B10 A;  2BUE A;  2IV2 X;  4PK3 A;  3TOB A;  3CQZ A;  5T5I D;  2R7H A;  1YRE A;  4KVM E;  3C26 A;  3ZJ0 A;  4C7H A;  4CRZ B;  2DXQ A;  1SMY D;  1EU1 A;  1Y9K A;  4MFP A;  5FTL A;  4KLV A;  2CNM A;  4KDI A;  4UCP A;  2E2H A;  2VBQ A;  5EPP A;  3TE4 A;  1S3Z A;  4AYB A;  2GAN A;  4GA5 A;  3FNC A;  4AZD A;  2Z10 A;  1QST A;  2FCK A;  2O28 A;  1MK4 A;  4UFX A;  2Q0Y A;  2H5M A;  4MY0 A;  4NCZ A;  2WUU A;  3DSB A;  1AA6 A;  2ZW6 A;  1IYK A;  2C27 A;  1E32 A;  1S7K A;  3JVN A;  4K30 A;  4F0Y A;  3OWC A;  3QQ7 A;  4MY3 A;  5IV0 A;  1ZYR D;  2G5D A;  2QIR A;  3S6F A;  1E5V A;  4A33 A;  1PQH A;  5C88 A;  1PU9 A;  2DPS A;  4CGL A;  1TWF A;  2J8M A;  2NYA A;  5H84 A;  2Q4V A;  2DMR A;  1DMR A;  2Z11 A;  4KOT A;  2CW0 D;  2ARH A;  3IGR A;  2WB1 A;  4MFJ A;  2R92 A;  4C2X A;  2VUM A;  5AG7 A;  4D7Z B;  3R95 A;  3NE7 A;  2P6G A;  3JTK A;  5ISV A;  1TWA A;  3GYA A;  3PZJ A;  4UWI A;  4CGO A;  2FL4 A;  4A31 A;  3IR6 A;  2JLM A;  1SQH A;  4KUB A;  1I12 A;  4UCM A;  1RO5 A;  3B8G A;  5KTC A;  1XEB A;  3ZZI A;  3R9E A;  2QML A;  2FE7 A;  4ZGY B;  3VWE A;  1S7L A;  4II9 A;  3TO6 A;  4BMH A;  1RXT A;  2EVN A;  3TO9 A;  1FDO A;  2B5G A;  4KOX A;  3TFY A;  1BO4 A;  3BJ8 A;  2WPW A;  2A68 D;  3FBU A;  4KOY A;  3EXN A;  1CJW A;  4C2Y A;  2X7B A;  1Y1W A;  3BLN A;  1YNJ D;  3EO4 A;  3CF2 A;  2V3V A;  5CNP A;  4A30 A;  2WAQ A;  3WR7 A;  3V8I A;  5IX3 A;  4R3K A;  1TMO A;  5AGE A;  1QSO A;  4MBU A;  1QSN A;  4XPK A;  4QUS A;  5H86 A;  3PLX B;  3D2P A;  1KZF A;  3HKZ A;  1GHE A;  1KQF A;  1IID A;  3R9G A;  2WSA A;  4F0X A;  2P0W A;  3I9S A;  4H6U A;  4MI4 A;  2ZPA A;  1YLE A;  4OLL A;  2R7Z A;  1QSR A;  5C1B A;  4A32 A;  3FXT A;  3N7Z A;  4JLY A;  3GTO A;  3QC8 A;  3DR6 A;  4ORF A;  4FD7 A;  2OZU A;  1ZO0 A;  1Y4Z A;  3CZB A;  1Y9W A;  5EBV A;  1N71 A;  2FT0 A;  1PT0 A;  3CXP A;  2VXK A;  2I00 A;  1E61 A;  1IYL A;  1J4J A;  3TIW A;  2JA6 A;  1VC3 B;  2VQY A;  3QQ8 A;  4C68 A;  1H0H A;  5JQ4 A;  4CGP A;  4F6A A;  4QIW A;  4CAE A;  1YGH A;  1OZP A;  3QWZ A;  3FB3 A;  2CXA A;  4Y49 C;  4C7I A;  5DYI A;  3FIX A;  5FTJ A;  2O5J D;  1M4D A;  4U9Y A;  1PYU B;  1K83 A;  1PQF A;  5FTM A;  2B4D A;  2YGW A;  4XNH B;  4PSW A;  1XMT A;  3IR7 A;  2Q4Y A;  4XPL A;  2AJ6 A;  1XE4 A;  2K5T A;  5F48 A;  4KDL A;  2J8N A;  2Z0Z A;  1NSL A;  2YND A;  2QEC A;  2ZXV A;  3G8W A;  3EFA A;  3DNS A;  2B4B A;  3DMR A;  5C82 A;  3JUW A;  3HU3 A;  2BSW A;  3GTK A;  1S7F A;  2ATR A;  1BOB A;  4FD5 A;  4XPD C;  2PC1 A;  2FSR A;  4ONU A;  4R9M A;  2R93 A;  1OGY A;  5EC4 A;  4MFL A;  3R9F A;  3GTQ A;  1YR0 A;  2OU2 A;  3T90 A;  5KTA A;  2Q7B A;  1AW8 B;  1S7N A;  5GCN A;  2CY2 A;  1KUX A;  2OZG A;  4PK2 A;  2J8R A;  1CM0 A;  1K4J A;  3QB8 A;  4J3G A;  5T5M D;  2NMT A;  2B58 A;  4KSA A;  1YNN D;  3E0K A;  4U9Z A;  3PP9 A;  1IW7 D;  1M4I A;  2D4O A;  4QBJ A;  1PYQ A;  4NEX A;  1CR5 A;  1Q2D A;  2YUJ A;  5JPH A;  3O5A A;  2BE5 D;  2AE0 X;  4GA6 A;  1FY7 A;  4AOK B;  1S60 A;  2EEO B;  1B87 A;  2BEI A;  1WK4 A;  1Q16 A;  4YGO A;  2ZW5 A;  2JIM A;  1I3Q A;  2VI7 A;  2F5I A;  3EC4 A;  3GTJ A;  4JXR A;  4L89 A;  4QC6 A;  2Y0M A;  3FKI A;  1U6M A;  2C45 A;  2D4P A;  4LUA A;  2YNC A;  1Z4R A;  4KOD A;  2HV2 A;  4CAV A;  2VPX A;  2PRB A;  4MHD A;  4NSQ A;  2OB0 A;  3HU1 A;  4GS4 A;  4KUA A;  4MFK A;  3S6G A;  3UY5 A;  4CYP A;  2ZW4 A;  3GTP A;  1MJB A;  1Z9U A;  4KOS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...