1YLLA

Crystal structure of the conserved protein of unknown function pa5104 from pseudomonas aeruginosa pao1
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
195
structure length
190
Chain Sequence
b'SELRILRAVDYPRMPGSTEEIARDGGDGLDGFGWRLSIADVGESGGFSGFAGYQRIISVLEGGGMRLRVDGAESAPLRARQAFAFSGDSEVHCTLLDGAIRDFNLIYAPRRHRARLQWLRVEGELDWHGTASTLLLFAQQDGVAISLQGQPRGQLAAHDCLCAEGLQGLQHWRLTAHEPAWVCAVELDSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
publication title Crystal Structure of the Conserved Hypothetical Protein PA5104 from Pseudomonas aeruginosa PAO1
rcsb
source organism Pseudomonas aeruginosa
molecule tags Structural genomics, unknown function
total genus 38
structure length 190
sequence length 195
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05962 HutD HutD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1yllA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1yllA01
3ACLA 4HZFA 1CAXA 4LULA 4YNIA 1ZZ9A 1CAWB 1CAWA 4MGIE 2ZCWA 1RTVA 2D93A 1Y3TA 1ZVFA 4XFCA 3NJZA 3E97A 4XFAA 4OFGA 4QX5A 3ES1A 1H1MA 4H7LA 1ZZ7A 4XFBA 3UKVA 4NVPA 5FQ0B 5FQ0A 3EQEA 3E6DA 1LB2A 3BU7A 3NVCA 3JZVA 1ZZ6A 3H7JA 3S0MA 2UY9A 4QXKA 4EWAA 1Q43A 4GULA 4HLTA 5I0SA 3RNSA 4IEWA 5D1IA 3SCGA 1UD1A 5FCCA 2ZKLA 4MZUA 5I8SA 3U0ZA 3BCWA 3FFQA 3SCFA 1OMIA 3LAGA 4Z82A 5F1RA 4F7ZA 4ORFA 5C8WA 5FLJA 1NE6A 4XFIA 3N4MA 1I6XA 3TNPB 1OFNA 3KCCA 4XF0A 4AQ2A 3PNAA 4YSFA 2QJVA 4O9GA 4I0AA 2PFWA 1XRUA 1YHFA 4MGKE 4XF3A 3CJXA 4FBFA 1ZZ8A 5BV6A 1ZRCA 2GU9A 3OGJA 3D0SA 2OZJA 1HW5A 2B5HA 3CF6E 1Q5OA 4WBBA 1EY2A 1YLLA 4LEJA 4IESA 3R6SA 2PQQA 5KHIA 3MYXA 3UKNA 2CGPA 3E5XA 4X6QB 2PHLA 3KSCA 1O3QA 4BHPA 5KHGA 4MUVA 2MHFA 3TNQA 2BYVE 2PAMA 1NYWA 1VJ2A 4HVRA 3LOIA 4JTOA 5KHKA 4K8FA 1ZRFA 4D7SA 1O3SA 4B29A 4BYYA 4Z07A 4XF9A 3GBFA 3B02A 4XFHA 4KL1A 3HIFA 4XF1A 1UW8A 1X8EA 1ZX5A 1ZNPA 4HSLA 3HT2A 1J3PA 5LRRA 3IDBB 1OD5A 2EAAA 2I45A 2E9QA 1FI2A 4LLOA 3ROUA 2MNGA 4Q0QA 3I54A 3H3UA 3HQXA 1EP0A 3UKTA 4IEUA 4N9HA 1DZRA 2XKPA 2ET7A 2N7GA 1DGRA 3KGLA 1UIJA 4QMAA 4WVZA 1QXRA 4IEPA 5J3UA 1WGPA 3LA3A 1OI6A 1CGPA 1NXMA 5AVPA 2XL7A 1SEFA 2XL9A 4LUKA 1X8MA 3CL1A 4PIZA 1SQ4A 4P9GA 3RPQA 4F8AA 3DKWA 2OZ6A 1J59A 4Q0VA 2H6BA 1O3TA 3BB6A 2GC3A 3ES4A 2DCTA 3IBMA 3LWCA 1XE7A 5EZWA 1DGWA 4RD7A 1G6NA 2CAUA 4PIXA 1RC6A 5I93A 1QY4A 3LA7A 4R8HA 4YRDA 4AQ6A 5KHHA 1CAVB 3MDPA 1CAVA 1RUNA 2QDRA 2Q4SA 3E5QA 5BPXA 3G7DA 1ZRRA 3FE5A 2UYAA 2XLFA 4R52A 1FT9A 4EV0A 3NKTA 3RDIA 1YFXA 1J3QA 2V09A 3H50A 1DZTA 2PAEA 1EPZA 4QM9A 5KHJA 4QGNA 2GH2A 4QGMA 1NZCA 3H8UA 3MPBA 5FPXA 3IIAA 1UPIA 2B8MA 5KBFA 3WW4A 1ZZBA 2UY8A 3OTFA 4AVBA 1X7NA 2VECA 3MZHA 3KGZA 4N9IA 1LKNA 4FT8A 2CV6A 3U11A 3SMHA 2WFPA 4HMZA 2C0ZA 2B9UA 2BGCA 3CLPA 3C3VA 5JCTA 2FQPA 5I0TA 4META 3I59B 3I59A 3LZZA 2PYTA 4L11A 1WA4A 4AVAA 2PHDA 4IEXA 4D7TA 5HI0A 2BNMA 4CYDA 2GC2A 3ZDSA 1PMIA 2VQAA 1QXJA 4E2GA 2OPKA 2GZWA 4EROA 4I0BA 5BUVA 4I09A 4FAHA 1SFNA 3ELNA 3D82A 4HBNA 4KWKA 1YWKA 3QACA 2ET1A 3H3ZA 5I0RA 2H0VA 1RGSA 5C6CA 4JTNA 1O7FA 3RYRA 3E6CC 4HVQA 4HVOA 3IWZA 4A2UA 3E6BA 4XFGA 4IEZA 3VHRA 4EWDA 4YARA 2K9ZA 2Z2SB 3FJSA 4JVAA 5J48A 3O14A 1CAUB 1CAUA 1O3RA 2XLAA 1GQHA 2IC1A 3SHRA 4IEVA 3H7YA 1GQGA 2FMYA 3CO2A 3U10A 3M3IA 3WW1A 1U12A 4MV2A 1I5ZA 5BXXA 1CX4A 2ETEA 3CEWA 3OCPA 1PM7A 1IPKA 4I01A 4OLLA 2KXLA 4MGZE 2IXLA 4PJYA 1EYBA 2Q30A 3E5UA 3S7EA 3L2HA 3RZZA 2K0GA 1CAXB 1H1IA 5E16A 3H1YA 2Z69A 4LUMA 4UBHA 5I0UA 4O9EA 2OA2A 3WW3A 3FWEA 5I91A 3WW2A 5LEKA 1J58A 4I2OA 5JAXA 3OD0A 4ONUA 1VP6A 2BNNA 1FXZA 1V70A 1ZRDA 5CVRA 2BEOA 2XKOA 4UBGA 1J1LA 1Y9QA 5J7MA 3ST7A 4ZU4A 4Q0PA 1UIKA 2HJIA 5K8SA 1LR5A 3EO6A 1J3RA 4KU7A 2Q0AA 2CAVA 5FLIA 4IEOA 3I7DA 3EJKA 3OF1A 4AVCA 4Q29A 3BPZA 2GC0A 2PA7A 1WLTA 4TLFA 1RL3A 2OYZA 2D5FA 2IXKA 3USSA 2XLGA 5CADA 5I8YA 4MGYE 2QNKA 3NL1A 2BNOA 5JSPA 4XETA 2VPVA 3KMHA 4PIYA 2O1QA 2HKXA 3EHKA 4ZU7A 2IXCA 2IXIA 3M70A 4JV4A 5T3NA 3DN7A 4Q0SA 1YFUA 1O5LA 2PAKA 1UCXA 2D40A 4ZU5A 2GC1A 1LRHA 3DV8A 4J1WA 1JUHA 4KWJA 3LA2A 3FX3A 4LA3A 4BH9A 3DL3A 4MX3A 1L3JA 3NSTA 4MH0E 2ATFA 1X82A 4XF4A 2F4PA 3H1MA 2XHKA 3HT1A 4IETA 2XGXA 4IERA 4QM8A 3H1WA 4I3PA 1O5UA 2EVXA 4KWLA 4WZCA 4X6RB 4FAGA 4YYOA 3RYPA 1ZREA 5JSOA 4LA2A 1O4TA 4XFFA 4IEYA 3S7IA 1IPJA 1VR3A 2IXHA 2EA7A 2GAUA 2QCSB 4QGLA 4KU8A 3FHIB 4I02A 2P17A 3FZ3A 2O8QA 1Q3EA 5JSRA 2WC2A 1YFYA 3RYKA 3SCHA 5LRSA 4HN1A 1RUOA 4BIFA 4HN0A 1YFWA 1QWRA 4J1XA 4Q0UA 5I8TA 3IDCB 1TQ5A 3SXWA 2UYBA 2IXJA 1XE8A 5LEJA 3H9AA 4E2QA 5EFUA 3QOPA 2PTMA 3GYDA 4UXAA 2MPFA 5FLHA 3BALA 3ETQA 4XEZA 1NE4A 5FPZA 4EWEA 3NW4A 4LTAA 2Y0OA 4AXOA 3D0JA 2Q1ZB 3PLQA 5BY5A 2H6CA 2QVSB 5E1RA 4L2NA 4DINB 5CU1A 4HSJA 5FDBA 1YUDA 3EBRA 1ZZCA 4IEQA 3PVBB 4E2SA 2D5HA 5JR7B
chains in the Genus database with same CATH superfamily
4TZDA 1WMEA 4HZFA 5IYYA 2WZPP 3K3OA 2YC2A 3ZR6A 2QKDA 3KHBA 3VN4A 2DVBA 3ZX7A 1ZVFA 3ZYBA 4JGZB 3T08A 2AREA 3NJZA 5CFDA 1RINA 3SKJE 5F39A 2VVEA 1XOYA 2VW0A 3HN3A 4QX5A 3ES1A 4QX3A 1H1MA 1VMJA 4YFWA 4IXLA 3NJXA 5LB6A 1ZZ7A 4NJ4A 3VBFB 2R0FA 2KD7A 3NNLA 3Q8AA 4Z8BA 3EQEA 5K0UA 1H1AA 3M8LA 2D3RA 3WNXA 3JZVA 1ZZ6A 1K5MB 1LOEA 1POV1 1XNAA 3WP4A 3HN1A 2UY9A 3S0MA 1QHDA 5DAWA 1F4HA 2E33A 2RDSA 4IV3A 1R093 4EWAA 1Q43A 2FD8A 2CWSA 5LY1A 5A3UA 4YW2A 3BOWA 4GB31 4XBLA 3VZNA 3C7HA 4LQRA 5D1IA 2JDZA 3FMGA 3N7JA 4CCLA 1ND3B 1B35B 3KS7A 3CJIA 4GMP3 2LUWA 4UT5A 5FUPA 1IG3A 4NHXA 1V0AA 1OT5A 2WNVA 4TXWA 3HQUA 3WT3A 4DFSA 2VMHA 1NQJA 3MUY1 3TAYA 5F1RA 3RGBA 1YQCA 3I4IA 2VZSA 4Y22A 3P5BA 4P9IA 1OBNA 3PJYA 4M4RA 2P3JA 2CHHA 2Z42A 3AC0A 1NE6A 1I6XA 3ASIA 1AX1A 1HRI2 3KCCA 4XF0A 4MXWA 5IT6A 3A21A 2NP0A 2D6PA 1A78A 2VG9A 3N9QA 2QJVA 5FZ0A 4Q8KA 4YSFA 1WZXA 4YWAA 5EYXA 3CJXA 5A1AA 5BV6A 1OHFA 1JYTA 5E89A 5H9RA 3H3LA 1NLSA 2X05A 4EZ4A 1D4M2 2W95A 2AYHA 3OGJA 2ZTNA 2BPA2 4CXXA 1PMJX 2QQVA 4RQPA 1H2MA 2VZUA 3CF6E 4QAWA 1C5HA 5FYZA 2W3JA 1RUH2 1QDOA 1EPWA 2PQQA 4YW6A 2XVKA 1W9SA 3UNPA 3CNAA 1CPNA 3E5XA 1C5IA 2PHLA 1GFF2 1G9AA 1SLCA 3KZ4C 3WG1A 3GHMA 1POV3 2GH8A 2HWE2 1W8HA 2PHRA 1DDLA 3BUCA 1NYWA 4KH9A 4AVTA 2R061 1QJY1 3AVRA 5FWEA 1DF0A 1GNZA 4UAPA 5KHKA 5BNOC 2ZBJA 4GB33 1ND2C 5A3LA 3C7FA 3JU9A 3ZSEA 1CZSA 2EALA 2JG8C 2VTXJ 4DEQA 1QXPA 4NRMA 4ASLA 1A6CA 1FYUA 2J1AA 1W8UA 2CGNA 5FMOS 5LBBA 5KXBA 2Y6GA 4Z07A 5KC5A 1TMF1 3O5SA 1GP6A 4KL1A 2R1BA 3PDQA 4QX8A 3ZR5A 4LO4B 5E6HA 4QDSA 4GQ7A 1OOPA 2V73A 2WFF2 3PUQA 1EAH2 3GHNA 4CDXA 3NMBA 1A8DA 1J3PA 2P34A 4IV1C 3GJAA 2E9QA 4LLOA 1TNFA 2WA3A 4BU2A 5AFBA 5DAPA 3ABZA 1EP0A 3VKOA 5LBFA 2EIBA 4R9CA 4Q1PA 4N43A 4N9HA 5FY1A 2VMDA 4J6GA 3VKMA 2HEVF 1E57A 1STMA 1JZ6A 4EQVA 5TSWA 3WQ0A 3SISA 3RVHA 3KGLA 2W1WA 1UIJA 4QMAA 2D43A 4OYUA 1RUI2 1W6PB 4YZ1A 2O8OA 3ENRA 2SBAA 3TEXA 4K6BA 4GWJA 3VD9A 4WM8A 5LA2A 5A6XA 5J3UA 2YXSA 1XNDA 3RJ2X 1UXZA 3LA3A 4BLJA 4XXPA 5J96B 4A44A 4YG3A 2VUCA 1DGLA 2VCBA 1HKDA 5AVPA 1W9FA 5F3CA 3DPRC 3A0KA 5DZFA 1SEFA 2PHFA 2R063 4LUKA 1QJY3 3I3MA 3RZLA 4PIZA 1GNYA 4COUA 3RPQA 3OYWA 5B2GB 4FOQA 1VAVA 2VUJA 5A3WA 4MLOA 4QX0A 2ZGRA 3BTXA 1GLHA 1F5FA 1V00A 3DYMA 3I3QA 2GC3A 3ES4A 1TMF3 5IFTA 3IBMA 1AXZA 2CL2A 3LWCA 2W47A 5EZWA 5CNAA 4PIXA 4W6WA 4MADA 2QE3A 2G1MA 3LA7A 1UWWA 5GZCA 3ZPYA 2PHUA 4R8HA 2D3SA 4NN0A 4YRDA 4M00A 2ZAHA 4P9XA 5FR3A 1I3HA 3MDPA 1QJZA 2QDRA 1RVF2 1HB2A 2Q4SA 2VQ0A 1ZRRA 3BODA 4Y20B 1V6KA 2VZRA 5FY8A 3FL7A 1FT9A 1IS4A 2XDVA 4EV0A 4CDQC 4HONA 4YVWC 1J3QA 5G04L 3OPTA 3VBHC 3MW4A 1LGBA 1LEDA 2C4XA 3J4UH 2DVDA 2ENRA 1WCUA 3VD3A 5C3SA 3ZN5A 4A41A 2GMPA 2YPDA 4H55A 2ZOEB 4QGMA 1UY4A 3ZN6A 3SNMA 1LOGA 3MGUA 3IIAA 3HAGA 5FP3A 4GKYA 4D3WA 2LTNA 5KBFA 1AUYA 1ZZBA 3Q8CA 4CP9A 3W5MA 2HH9A 5FYIA 3OTFA 1BQPA 3LFMA 3VBSB 4R9BA 3BTZA 4FPCA 4ARYA 4N9IA 2E31A 4YG6A 5EJ1B 2DCZA 3ACGA 3OB8A 2DTYA 5IHRA 1W6MB 4UWDA 1ULDA 3WVJA 5EJ3A 5L9RA 1HQNA 2JG9B 4MO3M 3WNLA 4NRQA 2BGCA 1U5ZA 5JCTA 1ND2A 1SACA 4HPKA 3VDDC 2JG8A 3J26N 3I59A 2VAUA 3AP4A 3LZZA 1ONAA 4GWNA 1TME1 1OA2A 4FXGB 3D6EA 4IGOA 4L11A 5G05L 4BCUA 4LOSA 4BLIA 1CD3G 3U78A 5C9AB 5KWRA 5DMYA 5IK5A 1H6XA 4D7TA 2IWGB 1PGL2 2XJPA 1QNYA 2J1SA 2LROA 3PL0A 1LODA 2AZ5A 3NNMA 5C8CA 3CDZB 1OXCA 5F5AA 2L9LA 1QXJA 1DQ1A 4N7IA 4IV1A 3C7GA 3CMGA 2RHPA 1XNCA 4FO9A 4PF1A 2VZPA 4BMBA 1D2SA 2GZWA 4I0BA 3ZYGA 5BUVA 2J1TA 4GH4C 2X10A 5FZEA 1R081 2VTXA 4KWKA 4Z92B 1S1AA 2JKBA 3GCXA 4FTSA 4W6YA 4BDVB 1JXNA 5HV0A 3UJQA 5I0RA 2A70A 1U5YA 1UY1A 2H0VA 3A4UA 3ILRA 2B46X 1PX3A 2WZ8A 4QU2A 4XPVA 1ALYA 1O7FA 2Y6LA 4QQLA 5A7QA 1COV2 1OQ1A 4HVQA 3ME2A 4A2UA 4QDRA 3EXUA 5CFCB 3O1SA 1K5JA 2YGLA 1RUE1 4DUWA 3DKQA 1Y4WA 3WF4A 3I2JA 4B1MA 4BWOA 5T5PA 3N9MA 1W2UA 2UWBA 3FLRA 3MI8A 4YARA 3OG2A 1XQNA 5A7PA 3B69A 3FJSA 1GQPA 3AM2A 1CAUA 1HJFA 4YGBA 4P02B 1GQHA 5CISA 3DPRA 1EUTA 1VBB2 4IEVA 3H7YA 1IOAA 2G9FA 2GMMA 1GQGA 1REFA 3HNBM 3CO2A 5FOJB 3DGTA 2WRAA 4K9SA 2Z4FA 1WCQA 2A6YA 4I3GA 5IUQA 2RDQA 3AX4A 5A3MA 3U37A 3I49A 4GALA 5FP9A 2ZGKA 5I0DA 4ITCA 4YW3A 1TME3 2ZGLA 5FKBA 1CX4A 1UPSA 2ZEZA 4RYDA 4AEDB 4BQXA 1PM7A 3QD6A 5C33A 3GXUA 4DB5A 4AVVA 5C4WB 4MGZE 2IXLA 5JXHA 4PJYA 3AJYA 3CHXA 1HQWA 3E5UA 1S0CA 4XCAA 3L2HA 1URXA 4FPLA 1UAIA 1H9WA 2K0GA 2DU1A 4XTPA 2IZWA 2ZGOA 2RM21 3V56A 5A3TA 1MACA 4LUMA 2O0OA 4HT1T 5KR7A 4M3CF 2KM2A 2HEYF 1R083 1W8FA 1XNKA 2D98A 4O9EA 5GLTA 3W9AA 4V1PA 5FXVA 3ZFFC 5FZIA 4I2OA 2ID4A 3AMHA 1RXFA 3OD0A 4CDQA 2ZGQA 5T52A 4DXSA 2WYFA 4YVWA 2BNNA 3VBHA 2DYCA 1MS1A 3WNPA 1Y9GA 4FTEA 3N9LA 5F9TA 2BEOA 4JGZC 1Y9QA 1F5JA 3ST7A 4CCEA 1RUE3 1UIKA 4CEYB 1BEV1 2JJ6A 2R32A 3WSOA 2C1FA 4KU7A 2Q0AA 2CAVA 4K3UA 4YGEA 5AVAA 4BOWA 2CDOA 5FV3A 5HCHA 3I7DA 2DUOA 1HIXA 3OF1A 3JB4C 1W6OB 4N90A 1IPSA 1PZ7A 2X53S 5HPOA 2YU2A 3FLPA 2TNFA 3V0AA 3USSA 5JOZA 4TTGA 5FPVA 2W1QA 5CADA 5I8YA 3KD4A 5AC92 1YCIA 2CYFA 3FBYA 1EV11 1X9PA 2WLQA 1ULFA 4PIYA 3AP5A 1QMJA 4XILA 3AKQA 1ND3C 4ZU7A 4YVSB 1TZOA 1CIYA 2A1XA 4R4ZA 2BDRA 2WJSA 1SLAA 4RGKA 1JMUB 3DN7A 5KC6A 2PAKA 4PI2A 3FHAA 2WQZC 4Q4X1 3VDDA 1UCXA 2D40A 2ZMKA 1GSLA 1OF3A 4AEJA 4E27A 5LZ6A 1KITA 2F6BA 1CJDA 2NM1A 2PELA 1MQTC 1QJY2 3LA2A 3WHUA 1JZ4A 4LA3A 1WKYA 5LA9A 1SG3A 2WNUA 2ZEXA 2ZHLA 4MX3A 1FX5A 2RM23 4GIQA 1U5IA 4XF4A 5ERLA 4FPKA 3SC7X 1HRI1 1SHWB 1SMVA 2XGXA 4NROA 1BJQA 2D6NA 1VAKA 1RIRA 3H1WA 1MR5A 4EN6B 5ABJB 1O5UA 2EVXA 2HWF1 3EB7A 1TMF2 3NV3A 3WOGA 5JIUA 4YYOA 3AKRA 1VB4A 1N47A 1S4CA 2PHTA 2UWCA 4N53B 3N7LA 5DUWA 1O4TA 4O7XA 3CZJA 3UT0A 2FZ2A 1DQ5A 1VR3A 2IXHA 3RI9A 2RS31 1BEV3 1SPPB 1S2EA 1Z0HA 4F3JA 1RUH1 4XUQA 1CESA 1W8WA 2BJSA 5EQUA 3MFCA 3ITQA 4OQ8A 2X8KA 4I02A 1C8NA 2EF6A 4FP3A 1YFYA 5F3EA 3PHMA 5KXDA 3VBRB 4HXCA 4XUPA 2W39A 3I2IA 1Y9MA 4HN0A 1YFWA 2A3WA 1ST8A 2E7AA 2EXIA 3BGAA 1B09A 1TQ5A 2OQ6A 5EPAA 1EV13 3ZKUA 4LKFA 2VZVA 5FY9A 4BIOA 4UW6A 3NNGA 4OUMA 4E2QA 1NCQA 2OX0A 2PTMA 1ASJ2 2ZMNA 4Q4X3 3GYDA 1RUD1 4IE0A 4FPOB 4XEZA 3LGRA 5CIRA 5T5LA 4OI1A 2RJ2A 4A7YA 3KWVA 2A3YA 1AXYA 2JEMA 2WFF1 5FYTA 1DGWX 3D0JA 3PLQA 5GLVA 3O0VA 3LFIA 4ZONA 5A7OA 4Q4Y2 3I3EA 1HRI3 1JU4A 3SEPA 2QVSB 2PN5A 1J83A 1R1A1 2VCAA 2HWF3 1PMHX 2EAKA 3WLUA 1J1TA 3MF6A 3AYAA 1ZZCA 1XNTA 4NHKA 4XHXA 4BQ1A 1OPOA 3T09A 2D5HA 1LCLA 5JR7B 5FUIA 4XUOA 3ZFFA 4AE2A 1L7QA 1BK0A 1RUI1 3GCWA 5BNPC 2RS33 3N7MA 4YZ5A 4PHZA 4Y1VA 4YNIA 3AYDA 1SLBA 2CTVA 4V2VA 1RUH3 1CAWB 2HWC3 2D93A 5J37A 4JGZA 4CEWB 2PXJA 1SCSA 1WW5A 3HNMA 3BN6A 4RN5A 4XFAA 2QTWB 4E8CA 4D94A 2XB6C 4AFMA 3ON7A 1VBE1 1MS5A 2WZEA 4QQPA 3OGVA 5EP9A 3VBFA 1LAJA 2CNAA 2ORZA 3M3QA 4JAAA 3IPVB 3V65A 4MGSA 1W6QB 2ZGSA 3HMYA 3NVCA 1GV9A 4NUBA 4IE4A 3PURA 3H7JA 1K5MA 4CP2A 5FMBA 2RDNA 1PX4A 1YJKA 2BW8A 2QQJA 4GULA 4XJZA 3ZSMA 3VZOA 1WLDA 5K0UC 1RUD3 4FXKB 1BZWA 4OHXA 1MVEA 4FOVA 2PLV2 1WMFA 1VBC2 4YM3A 5FCCA 2X09A 2WT1A 5FK7A 1ND3A 4MZUA 4JGYB 1AZDA 1B35A 2BVBA 1PHMA 2JXAA 5IVBA 4LE4A 3HJRA 2WFF3 3HWJA 4PBOA 2J1UA 4B3NA 3SCFA 1VAMA 4IE6A 4Q1RA 3T2QA 3OD4A 3ZO0B 3O1UA 4F83A 4F7ZA 1R1A3 4ORFA 5C8WA 2IVJA 2P4EA 4ES8A 3T4HB 3A22A 5FZBA 5DG1A 2WNVC 4YZ3A 4UF0B 3IB3A 3OEAA 5EYYA 3AP7A 4QB1A 3BVCA 3P3PA 5FZOB 3WR0A 1OFNA 3KCXA 3ZSJA 1AJKA 1TME2 4AQ2A 3Q8BA 1WMXA 1RUI3 2VNRA 2ZABA 4IL7A 5IVVA 3P3NA 4BPZA 1QNWA 1W04A 4XF3A 4MGKE 1KFUL 3MIDA 1PK6B 1ZZ8A 1QDCA 1NT0A 1ZRCA 2ADDA 1WA6X 3LDBA 4M0NA 4QHBA 5A6YA 1QIQA 1YNAA 1ENRA 5IK7A 2OZJA 2A75A 1HW5A 1UKRA 2ARCA 2B5HA 2BERA 5F5IA 4IUGA 4E4DX 5A33B 1YLLA 1VBE3 2Y38A 5HV4A 1K3IA 4H7MA 2P1BA 3MYXA 3UKNA 1R082 3K77A 1UF2C 3U4SA 1Q8SA 3N9OA 4IE5A 4RQPC 1O3QA 1US2A 2A71A 3T1LA 2VOTA 1AR91 3WCSA 5IK4A 3TNQA 1A3KA 2BYVE 5DAVA 4GJYA 3SH3A 4P14A 1VJ2A 3LOIA 2YPJA 4JTOA 4LO7A 1MS8A 1RUE2 2ZS6B 4G9SB 1UYZA 5CYYA 2XPJA 2XMLA 5A7WB 4ATFA 1W8OA 2GNMA 2XBO1 1O3SA 1K45A 1RUF3 4B29A 3M2MA 2E53A 2WT0A 4TYSA 4COWA 5L7OB 3GBGA 2FDHA 1BVVA 2V5DA 3HBZA 3F95A 5C9AC 3C7OA 1H8VA 3OOXA 1PGL1 2ZZJA 1WMDA 4XF1A 1XXNA 1X8EA 4LK7A 5C3QA 1ZX5A 3W5NA 4CDUB 3O1TA 1PIV3 2QQMA 3HT2A 2V5YA 1GWKA 3IDBB 4XMIA 4AOCA 1WW6A 1E5IA 1LOCA 1OD5A 2EAAA 4QX2A 4W4ZA 2NMNA 4AW7A 1G9FA 5JZGB 3I54A 4QQOA 2DUPA 2VOVA 4E8DA 3PU3A 3UKTA 4BQ4A 1IS5A 5D2AA 3U07A 4CDXC 1DZRA 4JZRA 4CUCA 4LNVA 5JOXA 4MSVA 1SBEA 2ET7A 4EE2A 1COV1 1AR61 3H8OA 4OI4A 3OPWA 1XJAA 3PUIA 1W6PA 2B39A 5CFCC 2FDKA 1YQ2A 4CXWA 1ACCA 1ODNA 1V9U2 1RUJ1 2VMGA 3JQWA 4MYEA 1CN1A 2HLEA 1SZBA 3OGGA 4QPGB 2OUHA 2XH6A 2ARXA 1GOGA 3UGGA 4XZPA 1C1FA 2VU9A 3WDVA 4E9KA 2WSUA 3OBZA 3DYOA 1AR93 1GOHA 1VBB1 3AMPA 3CBNA 4AAPA 2JE8A 1UU5A 4QDQA 5F8PA 4WM8C 2RR11 3T2PA 2XXZA 4AEKA 5GALA 5D8AB 2DVAA 1LHWA 1SQ4A 2A6XA 4Y3OA 2KR2A 1BEV2 4WVMB 3BTAA 1GYKA 1LNSA 5FYHA 4A6SA 2XBO3 1J59A 4NPMA 4UFKA 2H6BA 3BB6A 4AEDC 4OUEA 4X8PA 3ZXFA 1W90A 1HJGA 1VRH1 4JKKA 2BU9A 3DXUA 1NCRB 1XE7A 5FBZA 4RD7A 1G6NA 4LORA 2I07B 5FUNA 5A7NA 1RC6A 1S55A 2DDUA 3ZYIB 1FV2A 2LM3A 2WN2A 1ZYBA 2GN7A 3O1PA 3E1F1 2GNTA 5FZ6A 2JIGA 1EV12 3VZMA 1O91A 3WNKA 3KVAA 5KHHA 1W06A 3KT4A 4RGGA 1CAVB 1RUNA 2R16A 4MHRA 3U4XA 3HNYM 2JECA 3ZKYA 4E4HA 4D0QA 1AR71 4Y20A 3FE5A 2UYAA 2XLFA 4FCAA 4Q4X2 4R52A 4AFCA 3AZYA 4LOTA 4PDWB 3NKTA 2R0HA 3RDIA 1COV3 1YFXA 3C2UA 4FOYA 2V09A 1AR63 4H3WA 2PHWA 5FXXA 3BYWA 2PAEA 4DRVA 1JU3A 2HYKA 2C24A 2MEV1 2AUYA 3KVBA 4QPIB 5J98B 5JVVA 5LCWL 1H8TB 4QGNA 1HV1A 4CEYC 5HCAA 1V6IA 1RUJ3 2XUMA 3H8UA 3NJYA 5FPXA 1UXXX 5JSPA 5F3GA 1YI7A 2R6QA 4QQHA 2HWF2 3VBOB 3JB8A 3VV1A 2QQWA 1VBB3 1X7NA 2OUJA 2VECA 1LECA 3VBSA 2E32A 1F9KA 5FJHA 3WZ1A 2RR13 1S0BA 5AC91 5FYBA 1LKNA 3FBMA 4FT8A 2VZTA 1F15A 4OHWA 4LBQB 1UYPA 1W8NA 1UMIA 2RS32 3N3HA 3SMHA 1N1SA 5DQ0A 5FO7B 4HMZA 1Q56A 2C0ZA 2HWC2 5CKQA 4YPJA 4Q26A 4DY3A 3AMQA 4AI1A 4UI9L 4HK8A 1W39A 4OCTA 4UW4A 1N3OA 1VRH3 4LHLA 4RS5B 2WBKA 2CDPA 4Y1ZA 1RYYA 2Y60A 2JD4A 2WQ8A 4OI0A 4NHYA 2RG4A 4AFDA 4QQ2A 1IG0A 1CQ9A 1DQ6A 5C9AA 2GMEA 4LO5B 3ZYFA 3TRSB 1AR83 5A6QA 3AMMA 3WNOA 2ZKNA 4IEXA 1DBNA 2WO3A 2BNMA 2WN3A 5HI0A 2JDPA 4MOAA 2XUEA 5FP7A 5L36A 3DXTA 1PMIA 2CSGA 3RJRA 1AR73 3M3OA 2YMZA 3ZMNA 2OPKA 1RUD2 2VOWA 3ZFGB 5ANQA 4BMEA 2W94A 4H14A 1REDA 1AJOA 4EROA 2P37A 2XJSA 5FMDA 1OSGA 2YB7A 4DO0A 5JDBA 1IQAA 2VGDA 3D82A 5C8CC 2AC1A 2MEV3 2ZX0A 2G19A 4XJ8A 3T0AA 3MHZA 3VZKA 2BFUS 4D69A 2D97A 1REEA 4YGCA 4MG2A 4CDWB 1RGSA 5C6CA 1JBCA 4GA9A 3I2OA 1R1A2 3IWZA 3E6BA 2BWAA 1BBT1 5CFCA 2JENA 4K40A 1HX6A 3VHRA 5JWPA 2A73B 2XWJB 5LBCA 4RGAA 3THTA 3RWKX 1ENQA 2K9ZA 3CIHA 5AC93 4LIUA 3DEMA 2Z2SB 2VTFA 3O14A 1YI9A 1AF9A 2XJVA 5FP8A 1RJ7A 3N35A 2ZX3A 1JS9A 4GXLA 3KT1A 2Q8EA 5JUVA 1PVXA 2FMYA 3I2HA 2VXRA 1ASJ1 4P5YA 1OFSA 3LPGA 4R4XA 4Y5SA 3U10A 3WP5A 4CXYA 2RMU1 1WCSA 4CUBA 2DBIA 1U12A 1VBE2 4EN0A 3SLIA 5JXIA 3IAPA 1JHJA 4IQPA 4KG0A 5K7PA 4AEDA 1PNGA 4LBMA 2VZ1A 5C7GA 1PGSA 1RUG1 2B7YA 5DUXA 1UOJA 2WZR2 5C4WA 3ZYJB 4Q4Y1 4E4SA 3D4KA 5E88A 3UK9A 4HK9A 1XNBA 1DLLA 4ES9A 2CGOA 2ZGPA 4EYUA 1X50A 2ZX1A 4XCBA 5E16A 3SQOA 3H1YA 2PHXA 4KMQA 3X29B 5JXGA 3IDEA 3BKZA 2CY6A 4G3YC 3NV2A 3KV5A 3BI3A 1RUF2 4S2HA 5I0UA 2HWB1 2P2KA 1JYXA 1OURA 2J7MA 1VRBA 3WW2A 5D21A 2Y34A 3TOJA 3AYEA 1HXS1 1VP6A 4XMAA 2OVUA 5FK8A 1OVSA 1FXZA 1ZRDA 2WR9A 4IE7A 4XAAA 4AGRA 2OKXA 4CTEA 4D7YA 5J7MA 2R7EB 3J9SA 4AGGA 1BBT3 1PIV2 5T50A 1M06G 4CCCA 1UYXA 4CEYA 5K8SA 3EO6A 3KQ4B 4EJRA 1OKOA 1N3QA 3UESA 1V6MA 4LE3A 4IEOA 3S30A 4DXZA 3EJKA 3F2ZA 3WF3A 2V4VA 2E7TA 4Q29A 1W9TA 1W6OA 4CCOA 3NJVA 4FFIA 2GC0A 2YFUA 3MBWA 2PA7A 3UGFA 1JOJA 5GZFA 2JKXA 4RR3B 2XOMA 2W68A 2W87A 2OYZA 3ZXEA 4C91A 4RFRB 2Y6KA 3C8XA 4FOWA 5FZMA 5JMCA 3T30A 4JDMA 1TG7A 4BQ2A 2XLGA 5C70A 4CE8A 4NHLA 3N9PA 1ASJ3 1V6JA 4LR4A 1MS3A 5BNQA 4NAMA 3KQRA 1QH7A 2RMU3 4FFFA 1NA1B 2PLV1 2DVGA 1VBC1 3KMHA 5FBJA 2EIGA 1IQDC 2XVLA 2HKXA 1QJEA 4Z2WA 2X5IB 3J7LA 4XQWA 4YVSA 3M70A 1D7PM 1YJLA 1RUG3 4Q0SA 4AR2A 1O5LA 1VBD2 3VB9A 1NLRA 1YIPA 3JXSA 1H30A 4CCDA 2YFZA 2C5DA 4Q4Y3 1AR92 3ZDVA 3WG4A 1OA3A 1LRHA 3DV8A 4J1WA 1JUHA 2FBEA 4MXVA 4KWJA 1UNBA 1W2AX 1RHI1 2YV8A 4BH9A 3BPSA 3DL3A 5JIAA 1W9YA 3B93A 3NSTA 1PZ9A 2RJLA 2XHKA 4D6SA 2XBO2 3HT1A 2YU1A 4QB2A 2HWB3 3ZPOA 4QXCA 3OBRA 5FTTC 5ABJA 1V6NA 3D5OA 3U1XA 5F2SA 2WNUC 4FAGA 3RYPA 3POBA 3DYPA 1HXS3 5JSOA 4N53A 1UY2A 1LGCA 4L8QA 4AQTA 1G86A 3W20A 3THDA 5DUUA 5FZ7A 1WLWA 3LEGA 4ET7A 5FZGA 3NV1A 2GALA 5DPNA 2GAUA 2QCSB 4NHMA 2ZJCA 1SPPA 4QGLA 3IMNA 3SKVA 3ZLIA 1DYPA 3NWKA 4CU8A 4XQ4A 1VMFA 3LQCA 3FHIB 4JHTA 2P17A 1PM4A 1OUSA 3FZ3A 1U0AA 4YG0A 4K20A 4J25A 2WC2A 4YW5A 3K48A 3WQ1A 1GOFA 3RYKA 3SCHA 4KI5M 2JX9A 1GICA 3VBRA 5LRSA 1IGOA 1W3XA 4K21A 5GZDA 5SV5A 1AR62 2DFBA 2ES3A 1C57A 5I8TA 5C71A 3GF6A 3FHQA 2QBXA 2PLV3 1GZ9A 1VBC3 2QQUA 2XVGA 1XE8A 1SCRA 1RUJ2 2BOJA 3H9AA 2ZA9A 4AF9A 3AYCA 1Q8OA 2W91A 2J22A 3OY8B 5FZ9A 5L7OC 3P1IA 3T2TA 3THCA 5FAXA 4AI9A 2Y26A 3WP3A 1JZ8A 4QPWA 1LHNA 1C4RA 2RR12 1NCQC 1YRZA 1AYM1 1RHI3 4QU1A 4NAOA 4AQSA 4URTA 5BY5A 1UU6A 3B01A 4N43B 1RUC2 4LPLA 3ACFA 3AFKA 3PUSA 3GZAA 3IAQA 1K12A 5JZGC 1GU3A 3ZFEB 5H9PA 1YUDA 1VRH2 2IFRA 3ZYPA 1ZBE2 3K75B 3PVBB 4QHOA 3TB0A 2GP5A 4E2SA 4FSJA 1QJU1 4OVEA 4S2DA 1AVBA 3ACLA 2J42A 5FWJA 1GKBA 1YEWA 1CAXA 1BK1A 2VY0A 4LKDA 4D6RA 2FDJA 1AR82 1W2OA 3ORJA 1V9U1 3K4AA 3NAPC 2QQOA 1CAWA 3K2OA 3TYJA 1RTVA 1M4WA 3ZVXA 1Y3TA 4XFCA 2BQPA 1ZBA1 2W52A 3AL5A 2JDMA 3E97A 4KG8A 3RSJA 3USUB 1VMHA 2DFCA 1AR72 4OFGA 4YM2A 4AYUA 1AHSA 4HETA 4DRRA 4XIKA 5FYVA 4DUVA 4YW4A 4UFJA 3PU8A 4XW3A 4C8DA 2WINB 2YDEA 4H7LA 1CWPA 5FO8B 4K8RB 4UFIA 1G9DA 1SFYA 3LDKA 3MW2A 2X29A 4AL9A 2MEV2 3IPVA 5FQ0B 1LU2A 3E6DA 1W6QA 3WP6A 1AL0G 1G9BA 5CKNA 3VDBA 4AWDA 2EXKA 3K46A 5F2WA 2XJUA 2XG3A 1KDKA 4PQ9A 3RRDA 3VBFC 5C3PA 2UU8A 4OMCA 3ZM8A 3QBQA 1APNA 4GD4A 4RA0A 1F8VA 4A45A 1YXWA 4BXFA 3MIEA 3J7HA 1F2NA 3SCGA 1UD1A 3VZLA 4Y24A 1K5MC 4JGYA 4PCRA 1AYM3 3U0ZA 3WX5A 4QKDA 2KA3A 2VH9A 1QEXA 5LWBA 3POJA 4Z82A 1B35C 1MZ5A 1W2NA 4U2AA 4ATEA 4M3CA 1HN1A 3I97A 2XJQA 5FFOC 3PJQA 5FLJA 4UF0A 4XFIA 2Y64A 3Q8EA 4PDWC 5EXOA 1QJU3 5FZOA 3VLBB 2UWAA 4EZHA 1GZTA 2HBTA 2RDRA 1C28A 3PNAA 4TLGA 4XDPA 2PFWA 1XRUA 2QUOA 1PK6A 1V9U3 1H8TC 5CA6A 5HXMA 3B9CA 3ZIWA 1UX7A 2TUNA 4COVA 4JCKA 3RMYA 4CRQA 5IFPA 5JMOA 5E8AA 1ZBA3 4TN7A 4Q2FA 3ACIA 1V6OA 2AENA 3M3CA 1H2KA 3POFA 3PMEA 4WBBA 1DIWA 5A33A 1TVGA 4LEJA 3VBOC 5DN2A 3OPZA 3N7KA 5CZKA 2VR4A 3POSA 5KHIA 3LIGA 1R64A 1ENXA 1UZYA 2CGPA 3W58A 5BNOB 2JIJA 1W6NB 1ULPA 4HPKB 3WDWA 2E51A 4EN9B 5FZ8A 5KHGA 4ZY9A 2ADEA 2HWC1 2BUKA 5FPUA 1DQ4A 2PAMA 1CZVA 4R9AA 3OGRA 2NYYA 4HG6B 2D6OX 4FPHA 2NQYA 3RZGA 1XPWA 1BBT2 4K8FA 1ZRFA 2VBBA 4JDNA 4QB6A 4RS5C 1EUUA 4COZA 5A7WA 1TNRA 4BXSV 2VW2A 1UX6A 2VNOA 3WINE 4LHNA 5FOBB 3GBFA 3B02A 5L7OA 3I2DA 1WW7A 1JODA 3DF0A 4IV1B 3O0XA 3WDXA 5FYSA 2HWD1 2Y33A 4L9BA 4OHYA 4QWNA 3FLTA 4JRLA 3W59A 1LHOA 5FRAA 3RI8A 3MIHA 1KEXA 1ZNPA 3AKSA 3MLLA 4HSLA 5APAA 3J7MA 4CDUA 2AGSA 1UY0A 2RMU2 5F6LB 5LRRA 4CP0A 2VBPA 3LF7A 3ZFGC 1G7YA 2I45A 2WWUA 3I2KA 2F17A 3OJBA 3ROUA 3KHCA 1L7LA 5JZGA 4PLNA 2DURA 1RUG2 4PT6A 1ULGA 5T55A 1AL21 1PO11 3PIGA 3NO8A 4TSVA 2AEZA 1Q8QA 2XKPA 4P9WA 3D3AA 4I30A 4LBQD 4UYBA 5FP4A 4AFAA 2P6HA 3VD5A 2NN8A 3QCWA 4XBNA 2Q1FA 1Q8VA 4ZZ5A 3LPFA 1S2BA 2VVDA 4FTBA 3NAPA 1UKGA 4XJWA 1JYVA 3LEIA 1LOBA 1C1LA 1UN1A 1JZ5A 2HWB2 5A3OA 1FV3A 4NIGA 1JH5A 1LTEA 4QPGA 1NAEA 5JR2A 3KV9A 4FI9A 3I2FA 1HXS2 3B5LB 3HR9A 4FPGA 4M3CE 1GZCA 4UFMA 4HKWA 4XTMA 3ZMOA 3B3QE 2Y6HA 4L97A 2P3YA 2XL9A 2K46A 3CL1A 2YY1A 4G4FA 4AHZA 2XHNA 3H8RA 5D8AA 1BKZA 3POEA 4P9GA 4F8AA 2RS11 2VZOA 2Y6JA 3ZIXA 3DKWA 4WVMA 5EJZB 2OZ6A 1W05A 5B4NA 1F35A 2XONA 3OUIA 4XYXA 3WF1A 5LY2A 2ZGUA 3RFRA 1O3TA 3OBTA 5FZ1A 3S57A 2WZR1 3MUZ1 4JX0A 1KJLA 2GNDA 2PMWB 4S2GA 1FPN1 1D2QA 4NO4A 4XE9A 5FYMA 2CAUA 2HWD3 4ASMB 3WF0A 5I93A 3UYJA 3HPNA 3J7NA 3B00A 2Q1MA 2JDYA 3IN9A 1DFQA 3HVDA 3L2YA 1CAVA 1PVC2 1RUF1 2FMDA 3E5QA 5BPXA 5IVJA 1DLCA 3G7DA 1UU4A 2BTVC 3C7EA 2WAOA 1SBFA 1AL23 2YC0A 1PO13 5DUVA 1VB2A 4PDWA 3UETA 4AHXA 3ZOIA 3RZHA 5LA1A 4FVVA 1RMU2 5DG2A 3URFA 4JKLA 4NWVA 1DZTA 1KD7A 5LK5A 3H8XA 1RHI2 2A6VA 1GZWB 1PIV1 1EPZA 4QPIA 5JOYA 5L19A 5KHJA 1H8TA 2GH2A 1YIFA 3LSEA 2YZ4A 1LEMA 3M4FA 4LKEA 3WCRA 2FCTA 2B8MA 4KNCA 5FZKA 1Y7BA 1H9PA 2C9KA 5B4XA 3VBOA 3RS6A 1VPHA 1VALA 4RR3C 1N1TA 3KGZA 2VQUA 2CV6A 4XJ9A 4LBQA 3U11A 2RS13 3MEPA 3WXPA 2AR6A 3MICA 1JYIA 3VBSC 1NG0A 2B9UA 2X5IC 2V72A 5J09A 3CLPA 1VBD1 4W8JA 2WZR3 5DAQA 2FQPA 5LASA 5I0TA 3KV6A 3OUHA 2IVIB 4A3ZA 5ISLA 4META 1PGW1 1FPN3 1F31A 4RS5A 3S6PA 1YO8A 1BLZA 5FZFA 1XB9A 2YROA 2JG9C 3FUQA 1POQA 2R071 1KS5A 1WA4A 3POGA 4CSWA 1KJRA 4IGQA 3W21A 4YZ2A 1KS4A 4GWMA 2BP6A 2VMCA 3WNMA 1WW4A 4AI3A 4MVTA 3VBUB 3SH4A 4P00B 1XYPA 2PHDA 4OHZA 2G9ZA 3ZSLA 4B4RA 4FPJA 2DV9A 4GH4B 2TBVA 1X36A 1C3HA 2RS53 4CYDA 1Y43B 2GC2A 4O61A 4A4AA 1L7RA 2VQAA 4P9LA 3VGIA 4E2GA 4TWTA 3ZFGA 1RITA 4OUSA 3A7QA 1MPXA 4I09A 4AAXA 3ELNA 4FAHA 2E63A 2ZAAA 1AYN2 2ZMLA 2VXJA 1QH6A 1BVP1 1AYM2 2BRTA 3JQXA 2R49A 5HBAA 1YWKA 2QQKA 4LIVA 3S5QA 4W6XA 2WQ4A 3AMNA 4RHV2 5EWSA 5JI9A 3BTYA 4CVUA 5C5UA 2DCYA 4CDWA 4JTNA 4LO6B 2YUEA 5FZ3A 2W08A 3RG0A 3RYRA 2LRPA 5FYUA 1UMZA 4JC1A 5H9QA 3JD71 1JOPA 4GZ9A 1LENA 2C26A 3O1VA 2YC4A 2B45X 3FUOA 4IEZA 1I5PA 3WUCA 1DHKB 1QJFA 1DYOA 1QJU2 2Q5TA 2VMIA 3KV4A 4H2AA 4HOOA 2WS91 3GJBA 2VQTA 5FPAA 3VZJA 1HLCA 3CU7A 3IZOA 4PLMA 2XLAA 2BOIA 1PO21 2D44A 2Z79A 2VNGA 3SHRA 1H6YA 2LALA 2R042 1ZBA2 4HFSA 4ZXEA 1VBD3 4A6OA 1ENSA 3UGHA 2JICA 2ZHMA 3M3IA 4LMFA 1XYNA 2VCMA 1XU1A 3AL6A 1E5RA 2WDBA 4YLZA 4Q4W2 3RZJA 2BZDA 4DXRA 2R073 4B4QA 3AVSA 4XUTA 3AP6A 3M7AA 1JW6A 3MPPG 3R0RA 1C8M1 1I9RA 5FPLA 4I01A 4AI8A 4GKXA 4OLLA 5C5TA 1RUC1 1XYOA 1ZM1A 2GSYA 3S5AA 1EYBA 4A42A 3S7EA 2BGPA 2ILMA 4X8NA 4CU7A 2H0BA 4FFHA 3M1HA 5IK8A 4GJZA 4OZXA 1ZBE1 4M0HA 3ZFEC 4DY5A 2Z69A 5C4WC 4ZXKA 5ANNA 4BA6A 1W9WA 4Q5OA 2VMEA 3V0BB 2ZPXA 3ALQA 4UBHA 4BK5A 2DWRA 2OA2A 3FWEA 3JUUA 5I91A 1XE0A 1J58A 1ULCA 3FC0A 3KB5A 5T54A 5JAXA 1AR81 3WQ7A 3ZN4A 4XBQA 2Y0IA 5CEHA 2VBDA 2QQPA 4Y5TA 3VDAA 1V70A 4ZPIA 4P9YA 1TE1B 1UZ0A 5CVRA 4C0HA 4DMIA 1SDDB 3QH7A 2J1VA 4XUNA 1J1LA 3JD73 1HV0A 3RWNA 4Q0PA 4JKMA 4ARXA 1LR5A 1NZIA 4JQRA 3IM0A 1LESA 1Z7S2 2WS93 4AVCA 3BPZA 5EIYB 1GUIA 1WLTA 3HD8B 4TLFA 1PO23 1RL3A 3PUAA 4RR3A 4CUAA 2FZ1A 1LULA 1OA4A 2D5FA 3GZEA 2IXKA 5F32A 1HDKA 4WM7B 1VLNA 3ECQA 4UW5A 3H0OA 3U14A 2F4LA 4IDZA 4QKNA 3BOPA 3NL1A 4LJHA 3SH5A 3VKLA 4M01A 2A6WA 2UURA 1NA1A 2VPVA 2YYOA 4Z1VA 2BWCA 1IS3A 3O1RA 2A7AA 1MQTB 2X5IA 2XQRA 4QKBA 2WO1A 2IXIA 4KWUA 3VHOA 3WDUA 5T3NA 2VVFA 1C8M3 3OUJA 5ACA2 1W6MA 1RUC3 3KM5A 4XDOA 4ZU5A 2NZ9A 2VC9A 2P6CA 3AKPA 2JG9A 5EV7A 3POIA 4YVSC 1D0GA 4XXAA 2VOXA 3FX3A 4LXLA 5C3RA 1AX2A 1ZBE3 4QX1A 2ATFA 2QQLA 2DVFA 2F4PA 5F5QA 4YM1A 2ZHKA 2FCVA 4Z2AA 4XAEA 1MZEA 4IERA 2VMFA 4QM8A 2GDFA 4I3PA 4LHSA 4KWLA 5A3NA 5FJKA 5IVEA 1ZREA 4L92A 2ARAA 4LA2A 2HWD2 2JDKA 3MIFA 2WO2A 4K7JA 1W8TA 3S7IA 1IPJA 4Q8LA 1NLQA 3VD7A 1DGRN 3WG2A 1MS0A 5ABJC 2WIIB 4IW3A 1N1VA 5DAXA 2W1SA 3G6JB 2JDHA 2OQ7A 4N53C 4Q27A 3TBDA 2E7QA 1S0FA 3T1MA 3U75A 3ATGA 4B7KA 1UO9A 1XU2A 1J84A 4GWIA 3ILFA 3CZUA 1AL22 3HEIA 1PO12 3LDRA 3J8F2 4BM8A 2ARBA 2B4KA 1A8MA 3A23A 3ILNA 5L9VA 4J1XA 1BMV1 2VO5A 1QQP1 2J1RA 4AHWA 2YBKA 3V64A 3IDCB 4IGPA 2AACA 5L9BA 3JBG1 3SXWA 2UYBA 2IXJA 3MO4A 4B1LA 1GWMA 2W0XA 4WVWA 3VBRC 4K1ZA 3EMRA 3AXDA 2W1UA 1US3A 1FNZA 2W46A 5CG8A 5EFUA 2QFEA 4DXTA 2R1DA 1OD3A 4P08A 1MEC1 2MPFA 4L99A 5FLHA 3OY8A 1RXGA 3LD8A 3ETQA 4CZSA 4DPNA 1NE4A 5FPZA 4EWEA 1NQDA 4Y26A 1VE0A 3NW4A 4LBJA 2VCCA 1W0OA 3AZVA 5LW9A 1E5HA 2DF7A 4URAA 4XZUG 2Y0OA 2SLIA 1SFPA 5CKMA 2Q1ZB 4AXOA 5BNNB 1WCKA 2RS12 4MGTA 3DECA 1QOTA 3PVOA 5GM0A 2H6CA 1IKQA 3LE0A 5E1RA 2V4AA 4L2NA 1H2LA 1KQRA 1GP4A 5BNPB 5J36A 4S2FA 4UFLA 2G9GA 3ZFEA 2VULA 1Z78A 4IEQA 1FPN2 2OPWA 4Q4V1 3MV01 4LO8A 3NV4A 2VZ3A 5GKAC 5GZGA 3WV6A 1HB4A 2DCKA 4LULA 3ZXKA 1U5XA 1O4YA 1ZZ9A 3PTRB 3AK0A 1LGNA 4MGIE 5JLVA 3BU0A 2ZCWA 2RS52 1HB3A 1X9TA 4FP2A 5CFDB 3WF2A 2VUAA 3USUA 1FMD2 1YQ5A 4JQTA 1KXGA 5CBLA 1OLMA 1O8PA 1ODMA 1HN0A 3AXEA 3O12A 4P5HA 3MV11 3KF5A 4XFBA 5DDJ1 1QQP3 3UKVA 4NVPA 2K2SA 2XR4A 4DS0A 4CEWC 5FQ0A 5K0UB 2PQSA 1LB2A 1W3VA 3BU7A 3GGLA 3JBG3 2D7FA 4QT6A 2QQNA 4Y4RA 5HCBA 3ZXLA 4ZHNA 4QXHA 1GANA 5F6KA 4CU9A 4IV3B 2WLPA 4QXKA 4OMDA 5A1FA 1O59A 3M3EA 1OLRA 4HLTA 5I0SA 3O7OA 4B8EA 1MZ6A 1XC6A 4KGQA 1MEC3 3N9NA 4IEWA 3RNSA 1K42A 3ZXDA 4MGQA 4LBNA 2HYXA 2JDNA 2ZKLA 2BVVA 2QZ2A 5I8SA 3CJIB 3WY6A 5A1LA 2HEWF 1QU0A 5JPNB 1IZ3A 3BCWA 2WNVB 5SV8A 3FFQA 4CCNA 1DQ2A 1UQXA 4XJUA 1OMIA 3LAGA 5FYYA 1OUXA 4OULA 2JDUA 3TEZA 4RFT0 1PVC1 5GJ6A 2JDAA 1XSQA 4JGYC 2VL4A 3VKFC 1QJX1 4QD2A 4Y22B 1S0IA 5F7UA 4KGGA 2D6LX 4CUGA 1ZA4A 4LLFA 1H0BA 4XDQA 2AEYA 2RVAA 1PGW2 1YYNA 1CPMA 3N4MA 3TNPB 3N36A 5LK7B 1RMU1 1GBGA 1OVPA 4GAZA 4MXWB 4Q4V3 4BB3A 1GMMA 4BQ3A 1G8WA 2R072 5JXJA 4W65A 4O9GA 2OS2A 4I0AA 1W0PA 1YHFA 3GBWA 4COYA 4FBFA 4LITA 5A3PA 1JTZX 1ZA7A 2WABA 4NPLA 4CCMA 4NIHA 4AEMA 2GU9A 4PQQA 4DOUA 3D0SA 4RQPB 4BQWA 4A3XA 5AFEA 3VUOA 1Q5OA 1G9CA 1EY2A 2ZHNA 2W92A 2XJRA 3LEKA 1PK6C 1LOFC 1W8ZA 5GZEA 2OXBA 3HQRA 4IESA 3R6SA 1RB8G 1QOSA 3DUIA 1WLCA 3GZUC 5DDJ3 5JOWA 1N3PA 4X6QB 3MLJA 3KSCA 4HL0A 5BNOA 4LHKA 1W6NA 2I2SA 1NUKA 1W99A 4BHPA 3D8CA 1QKQA 4LKSA 4MHUA 2MHFA 4MUVA 4D6QA 3KF3A 3ZYHA 1HB1A 1JN2P 2QZ3A 1PNFA 4HVRA 3JD72 2XJTA 5HXVA 2EIDA 4D7SA 5A70A 4YW7A 2E6VA 4UFHA 5LBEA 1JYCA 4BYYA 2O14A 1CR7A 1FOD1 1T6BX 2WS92 4XHBA 3WDYA 4CCJA 3A0NA 1R092 4XF9A 5C3OA 5FO9B 1PO22 3LSDA 4LBOA 4U36A 4XFHA 2A5ZA 3VBUC 1PVC3 3HIFA 1WBLA 1UW8A 1NY72 2RE9A 1OLME 1QJX3 2XQXA 4B7EA 1ULOA 1OOPB 2GNBA 4PLOA 5JPMB 4CDXB 2ZACA 4DEVA 1IKPA 1FNYA 2GP3A 4NR1A 3I8TA 2OIIA 1RMU3 1FI2A 2WWJA 4JHZA 1AYN1 2MNGA 4Q0QA 3TN91 3H3UA 3HQXA 3PMSA 4IEUA 4CDUC 1C8M2 2FDFA 4RHV1 3POYA 1OLQA 2EICA 2N7GA 3GM8A 2B9VA 1DGRA 4XC9A 1CX1A 1TEIA 3THPA 2Y6FA 5DZEA 3QLQA 1OH3A 2JWPA 4WVZA 1WBFA 1QXRA 1VBA1 2VW1A 4IEPA 3VHNA 4L0PA 4WM8B 1WWYA 2I74A 2LW8A 4BJ0A 1WCDJ 1DQ0A 5A6ZA 2Y8KA 1WGPA 4EN8B 1DZQA 1OI6A 3IMMA 1CGPA 1NXMA 2QQIA 1KRIA 5A32A 1W28A 1CONA 1T2XA 2XL7A 5FKCA 2BBVA 2R041 1P8JA 3MFAA 1X8MA 3DCQA 1QOOA 5BYNA 4R9DA 4QPGC 4DQAA 5F37A 3OYWB 2OT7A 1H2NA 4C0BA 2A6ZA 4Q4W1 3OSDA 3GALA 4NPRA 2JE9A 1FOD3 4Q0VA 1UZVA 2DCTA 5D8AC 3VL8A 1IHMA 3APBA 4DNYA 3HOBA 3GZTB 4NIAA 4GB32 5FZDA 1DGWA 2DTWA 1YC61 1QY4A 1HRV1 2NPIA 1GWLA 5T5JA 1NOVA 3VKNA 1JZ2A 1LHUA 1N1YA 3T2OA 4AQ6A 1H4HA 1ULEA 1NCRC 3MIGA 2VZQA 5FZLA 2HBUA 4C1WA 1AYN3 1S0GA 3TN93 1JYNA 4PF5A 5A7SA 1OH4A 3POWA 1LJ7A 4AGVA 1F4AA 4RHV3 3HBKA 5LA0A 2WT2A 4CCKA 1VIWB 4A7ZA 3K4ZA 1UOFA 3H50A 4V2WA 3IDAA 3AJZA 3LOBA 3AZWA 3GDBA 3PVNA 3WD5A 1GZWA 2WSVA 4QM9A 3UL2A 3WHTA 3ZN6B 1PZ8A 4GMP0 1NZCA 1VBA3 1Z7S1 2ERFA 2BGOA 5FMOL 1UOBA 3MPBA 4INDA 3WQBA 4D8MA 2VOKA 1UPIA 1O4ZA 4LBKA 1JOBA 3WW4A 4CP9B 3IIIA 3TEYA 2UY8A 4QPIC 4OQ9A 4AFBA 4LBLA 4AVBA 1LOFA 3R4DB 1R1ZA 2E26A 3MZHA 1QGLA 1AX0A 2R043 2ZEYA 4PI0A 5FXWA 2BFUL 3LCPA 3R05A 5FXZA 1SBDA 1JUIA 1OPMA 1UZZA 1UZWA 4SBVA 4WM7C 4AI0A 3RQ0A 5IVCA 1XSRA 2CU5A 4WV8A 2WFPA 1IS6A 4Q4W3 5GLWA 4XIOA 2R062 2W5FA 4BISA 1WD4A 2OW4A 2BBAA 4A7KA 1ND2B 3C3VA 4KBBA 4YFZA 5ACA1 1W03A 5KXEA 2JG8B 5K4LA 4XACA 4KQ7A 3I59B 2PYTA 4YW1A 1HRV3 3JCIA 1BMV2 1JZ3A 1QQP2 3ZYRA 1V6LA 4Y4YA 4AVAA 5FZ4A 1O8SA 1UMHA 2IUWA 3JBG2 3CKHA 2G4IA 3VBUA 3ZXAC 4CPBD 2Q8CA 2WWSA 4JRAA 4GH4A 5FPBA 1D4M1 5C8CB 1DU3D 5T5OA 3ZDSA 4HKOA 5FZAA 5A80A 3AZXA 5IATA 1CVNA 1MEC2 1POV0 4CEWA 5FYCA 2WUHA 4ZS2A 5FZHA 5HCFA 2ZGTA 1SFNA 3WG3A 4HBNA 4N8MA 4NWWA 2A3XA 4DZGA 3ZXGA 3R4SA 1E5SA 3QACA 3Q8FA 2ET1A 3H3ZA 3K3NA 3QH6A 2TEPA 3SITA 3L9JT 1Z7S3 2HWE1 4ISQA 3H42B 4XURA 4DUXA 3B94A 1XBFA 1SDWA 3LIHA 3E6CC 4XQDA 3ETPA 4HVOA 4OZOA 3VDCA 4SLIA 3ZXJA 1DP0A 1WUVA 2ZX2A 4XFGA 5H9SA 4K1YA 1QF3A 3J8F1 1CIWA 4ASKA 3FFZA 4CDWC 2WAAA 4NRPA 4Q4V2 3NRUA 4QPYA 5DZGA 4AZZA 4EWDA 4NE9A 2WKKA 4JVAA 4QKFA 2ZXQA 5J48A 1CAUB 1O3RA 3B9IA 3LEMA 4NIIA 2IC1A 3DPRB 5GLUA 4P9JA 4FFGA 4BQ5A 3WNNA 2QDNA 4FPEA 2FHRA 2RJKA 3VL9A 5CAZA 3INAA 1MZFA 1S0EA 4NOTA 5ACA3 1EAH1 2WA4A 4NIDA 3WW1A 2VJXA 2YGMA 1DYKA 2VNVA 4BE3A 5EHDA 5IJRA 1FAYA 1GP5A 1I5ZA 4MV2A 3NNFA 5DDJ2 5BXXA 4EN7B 2DBNA 4BQYA 2ETEA 3CEWA 3OCPA 1W2TA 2ZGNA 1IPKA 3NNJA 5BNNC 1BXHA 3O1OA 1MS9A 2KXLA 3MLKA 1S0DA 2D6KA 2Q30A 5FZCA 4HANA 3ZSKA 1D4M3 1OC1A 1W0NA 5KXCA 3AZZA 1LHVA 3RZZA 3T0DA 4BZ4A 1CAXB 1H1IA 1NCRA 2DCJA 4Y1XA 3TEWA 1CJPA 2WO7A 3T4VA 3WDTA 3V0BA 3EYPA 2ZGMA 2P3KA 1WD3A 3MW3A 5FY5A 3UJOA 1SLLA 3WEZA 3T0BA 3AFGA 4DIQA 3WW3A 1T6GC 3OBAA 1JYWA 5LEKA 1BCXA 2AH2A 2P5BA 4CDQB 2YG0A 2ZZQA 2RV9A 5FREA 4ONUA 2HWE3 3AP9A 4YVWB 1O6UA 1UOGA 3VBHB 2RS51 1QJX2 3I3BA 4QX7A 4O65A 2XKOA 2W9XA 4UBGA 4CPBA 1FMD1 5K9YA 5CFDC 4ZU4A 1OQEA 2J1EA 3RMXA 2EXHA 2HJIA 3J8F3 1LU1A 4ZKTB 3P6BA 3LB9A 4ZZ8A 1J3RA 2WNEA 1HQLA 1YQ6A 2XWBB 5FLIA 4QHZA 3TWIA 5FMCA 4XJAA 5IVFA 3ACHA 4AVSA 4JDOA 5GLZA 3V0AB 3AB0A 1X33A 4WM7A 2VE1A 2Z5WA 4IV3C 4MGYE 1JI6A 4FQ4A 4RSUA 2QNKA 4UOJA 2BNOA 1EAH3 2JB4A 5IVYA 2JE7A 4XETA 2Q8OA 4N7UA 2C6SA 5FY7A 2O1QA 3UV9A 1KGYA 2WYSA 3EHKA 1JHNA 1GNHA 2JD9A 1MQTA 1RVF1 2IXCA 2R30A 3CJIC 3PVEA 4Y1YA 3RZMA 4JV4A 1FATA 4YM0A 4FPYA 2VD7A 4M3CB 1YFUA 3VDDB 3NQHA 4CA9A 1NA1C 3O0WA 4Y33A 4XABA 2GC1A 4HKLA 3MIBA 4WVVA 1GR3A 5FIXA 4NMIA 1NXD1 5FY0A 4I0WB 4C90A 2EXJA 4AK3A 4BK4A 4E4ZA 2WNUB 2FDIA 3PIJA 1UL9A 1L3JA 4FQZA 2BV4A 3WUDA 4MH0E 1BYHA 1X82A 3H1MA 1MS4A 4B4PA 3BIEA 1A34A 4IETA 5F5CA 1FOD2 2JB8A 3SEEA 3GNEA 4X6RB 4WZCA 3VD4A 4XVHA 1KFXL 1YQ8A 2VUDA 4QXBA 2FCUA 4UW3A 3KCYA 4XFFA 4OHVA 2NMOA 1AXKA 4IEYA 1OKQA 3I2GA 3PTYA 4W50A 1S2KA 1FMD3 2EA7A 1OQDA 4AI2A 2YHJA 4Y1UA 2EIEA 4KU8A 1DCSA 3IKWA 3K4DA 5M0TA 3AKTA 3TN92 1SLTA 4YGDA 1KDMA 2VM9A 2O8QA 4ZS3A 1Q3EA 3CQOA 3K51A 4WZFA 5DXDA 5JSRA 2NLRA 2IFWA 1S0JA 2WNOA 5F3IA 4HN1A 4AG4A 3BIWE 4BIFA 1RUOA 1QWRA 2WL1A 4Q0UA 4LK6A 1CZTA 5IWFA 4Y5Z0 5CG9A 5CB7A 5IAXA 4CP1A 1VBA2 5IAVA 5LEJA 3T3YA 1JZ7A 1RVF3 1NCQB 1MVQA 3R4UA 4M4PA 5JI7A 1R091 3QOPA 1I1EA 4KBZA 2GN3A 4UXAA 3BALA 3IT8A 2FDGA 4XOGA 1H4GA 1DG6A 2ZEWA 5FY4A 1NY71 2DU0A 2B42B 3KT7A 3PUHA 2ORXA 4GMP1 4LTAA 4OI2A 4CU6A 4YZ4A 5J1XA 2ZX4A 3OEBA 1SLIA 1OOPC 3OGSA 5BNNA 2D6MA 2W2IA 4AHYA 1D0HA 4PBPA 2P3IA 5A32B 3LKJA 1NX9A 1OF4A 1Q8PA 1BHGA 1D4VB 1RJ8A 2Q8DA 2YBPA 5L73A 4C1XA 3O1MA 3RZKA 3I3DA 3VHPA 2YBSA 4DINB 5BNPA 5LATA 5DABA 5CU1A 5IW0A 4HSJA 3B7MA 5FDBA 3EBRA 4LT5A 3KLSA 1UYYA 3MF9A 3NKGA 3Q9OA 4N43C 3NAPB 2D3PA 2RM22 2LS6A 2C9AA 3FN9A 1NKGA 1UY3A 4FPFA 4ISRA 1ZRIA 2DUQA 1HRV2 2CWMA 1LOAA 3ZFFB 4RL7A
chains in the Genus database with same CATH topology
4TZDA 1WMEA 4HZFA 2WZPP 2QKDA 3VN4A 2DVBA 3ZX7A 1ZVFA 4JGZB 2AREA 3NJZA 5CFDA 1RINA 2VVEA 2VW0A 4QX5A 3ES1A 1H1MA 4YFWA 4IXLA 1ZZ7A 3VBFB 2R0FA 4Z8BA 3EQEA 5K0UA 1H1AA 3M8LA 2D3RA 3WNXA 3JZVA 1ZZ6A 1K5MB 1LOEA 1POV1 3WP4A 3HN1A 2UY9A 3S0MA 1QHDA 4IV3A 1R093 4EWAA 1Q43A 2CWSA 4YW2A 3BOWA 4GB31 4XBLA 3VZNA 5D1IA 2JDZA 3FMGA 3N7JA 1ND3B 1B35B 3KS7A 3CJIA 4GMP3 2LUWA 2WNVA 3WT3A 4DFSA 2VMHA 1NQJA 3TAYA 5F1RA 3I4IA 4Y22A 4P9IA 3PJYA 2P3JA 2Z42A 1NE6A 1I6XA 3ASIA 1AX1A 1HRI2 3KCCA 4XF0A 4MXWA 5IT6A 2NP0A 2D6PA 1A78A 2VG9A 4YSFA 2QJVA 4Q8KA 5EYXA 3CJXA 5BV6A 1OHFA 5E89A 5H9RA 1NLSA 1D4M2 3OGJA 2AYHA 2BPA2 2ZTNA 4RQPA 1H2MA 3CF6E 1C5HA 1RUH2 1QDOA 1EPWA 2PQQA 2XVKA 3CNAA 1CPNA 3E5XA 1C5IA 2PHLA 1GFF2 1G9AA 1SLCA 3KZ4C 3WG1A 3GHMA 1POV3 2GH8A 2HWE2 2PHRA 1DDLA 1NYWA 4KH9A 4AVTA 2R061 1QJY1 1DF0A 1GNZA 5KHKA 5BNOC 2ZBJA 4GB33 1ND2C 5A3LA 3JU9A 3ZSEA 2EALA 2JG8C 1QXPA 4ASLA 1A6CA 1FYUA 2CGNA 5FMOS 5KXBA 4Z07A 5KC5A 1TMF1 3O5SA 4KL1A 2R1BA 4LO4B 4GQ7A 1OOPA 2V73A 2WFF2 1EAH2 3GHNA 4CDXA 1A8DA 1J3PA 2P34A 4IV1C 2E9QA 4LLOA 1TNFA 2WA3A 5AFBA 1EP0A 3VKOA 4R9CA 4Q1PA 4N43A 4N9HA 4J6GA 3VKMA 2HEVF 1E57A 5TSWA 3WQ0A 3SISA 3KGLA 1UIJA 4QMAA 2D43A 1RUI2 1W6PB 4YZ1A 2O8OA 3ENRA 2SBAA 4K6BA 4WM8A 5J3UA 2YXSA 1XNDA 3RJ2X 3LA3A 4BLJA 4XXPA 5J96B 4YG3A 1DGLA 1HKDA 5AVPA 3DPRC 3A0KA 5DZFA 1SEFA 2PHFA 2R063 4LUKA 1QJY3 4PIZA 4COUA 3RPQA 3OYWA 5B2GB 4FOQA 1VAVA 2VUJA 4MLOA 2ZGRA 1GLHA 1F5FA 1V00A 2GC3A 3ES4A 1TMF3 3IBMA 1AXZA 2CL2A 3LWCA 5EZWA 5CNAA 4PIXA 4W6WA 2QE3A 3LA7A 5GZCA 3ZPYA 2PHUA 4R8HA 2D3SA 4NN0A 4YRDA 4M00A 2ZAHA 4P9XA 1I3HA 3MDPA 1QJZA 2QDRA 1RVF2 2Q4SA 2VQ0A 1ZRRA 3BODA 4Y20B 1V6KA 1FT9A 1IS4A 4EV0A 4CDQC 4YVWC 1J3QA 3VBHC 3MW4A 1LGBA 1LEDA 3J4UH 2DVDA 2ENRA 3ZN5A 2GMPA 4H55A 2ZOEB 4QGMA 3ZN6A 3SNMA 1LOGA 3MGUA 3IIAA 3HAGA 4GKYA 4D3WA 2LTNA 5KBFA 1AUYA 1ZZBA 3OTFA 1BQPA 3VBSB 4R9BA 4FPCA 4N9IA 4YG6A 2DCZA 2DTYA 1W6MB 1ULDA 3WVJA 5EJ3A 1HQNA 2JG9B 2BGCA 1U5ZA 5JCTA 1ND2A 1SACA 4HPKA 3VDDC 2JG8A 3J26N 3I59A 3AP4A 3LZZA 1ONAA 4GWNA 1TME1 1OA2A 4FXGB 3D6EA 4L11A 4BCUA 4BLIA 1CD3G 5C9AB 5KWRA 5IK5A 4D7TA 2IWGB 1PGL2 2XJPA 1QNYA 1LODA 2AZ5A 5C8CA 1QXJA 1DQ1A 4N7IA 4IV1A 4FO9A 2RHPA 1XNCA 4BMBA 1D2SA 2GZWA 4I0BA 3ZYGA 5BUVA 4GH4C 1R081 4Z92B 4KWKA 1S1AA 2JKBA 4FTSA 4W6YA 1JXNA 3UJQA 5I0RA 2A70A 1U5YA 3A4UA 2H0VA 3ILRA 3SH4A 2B46X 4XPVA 4QU2A 1ALYA 1O7FA 4QQLA 1COV2 1OQ1A 4HVQA 3ME2A 4A2UA 3EXUA 5CFCB 2YGLA 1RUE1 4BWOA 5T5PA 1W2UA 2UWBA 3FLRA 3MI8A 4YARA 1XQNA 3B69A 3FJSA 3AM2A 1CAUA 4YGBA 1GQHA 3DPRA 1VBB2 4IEVA 3H7YA 1IOAA 2G9FA 2GMMA 1GQGA 1REFA 3CO2A 5FOJB 3DGTA 4K9SA 2A6YA 4I3GA 5IUQA 3AX4A 5A3MA 4GALA 2ZGKA 4ITCA 4YW3A 1TME3 2ZGLA 4AEDB 1CX4A 1UPSA 1PM7A 3QD6A 5C33A 4DB5A 4AVVA 5C4WB 4MGZE 2IXLA 4PJYA 3AJYA 1HQWA 3E5UA 1S0CA 3L2HA 1URXA 4FPLA 1UAIA 1H9WA 2K0GA 2DU1A 4XTPA 2IZWA 2ZGOA 2RM21 3V56A 1MACA 4LUMA 2O0OA 4HT1T 4M3CF 2KM2A 2HEYF 1R083 1XNKA 2D98A 4O9EA 5GLTA 3W9AA 4V1PA 3ZFFC 4I2OA 3AMHA 3OD0A 4CDQA 2ZGQA 5T52A 4YVWA 2BNNA 3VBHA 2DYCA 1MS1A 4FTEA 5F9TA 2BEOA 4JGZC 1Y9QA 1F5JA 3ST7A 1RUE3 1UIKA 4CEYB 1BEV1 2JJ6A 2R32A 4BOWA 2C1FA 4KU7A 2Q0AA 2CAVA 4K3UA 4YGEA 5AVAA 3I7DA 2DUOA 1HIXA 3OF1A 3JB4C 1W6OB 4N90A 1PZ7A 2X53S 3FLPA 2TNFA 3V0AA 3USSA 5JOZA 5CADA 5I8YA 3KD4A 5AC92 1YCIA 2CYFA 3FBYA 1EV11 2WLQA 1ULFA 4PIYA 3AP5A 1QMJA 4XILA 3AKQA 1ND3C 4ZU7A 4YVSB 4R4ZA 2WJSA 1SLAA 3DN7A 5KC6A 2PAKA 4Q4X1 3VDDA 2WQZC 1UCXA 2D40A 2ZMKA 1GSLA 4AEJA 4E27A 1KITA 2F6BA 1CJDA 2NM1A 2PELA 1MQTC 1QJY2 3LA2A 3WHUA 4LA3A 2WNUA 2ZHLA 4MX3A 1FX5A 2RM23 4GIQA 1U5IA 4XF4A 4FPKA 1HRI1 1SMVA 2XGXA 1BJQA 2D6NA 1VAKA 1RIRA 3H1WA 1MR5A 4EN6B 5ABJB 1O5UA 2EVXA 2HWF1 3NV3A 1TMF2 3WOGA 5JIUA 4YYOA 3AKRA 1VB4A 1N47A 2PHTA 2UWCA 4N53B 3N7LA 5DUWA 1O4TA 2FZ2A 1DQ5A 1VR3A 2IXHA 3RI9A 2RS31 1BEV3 1Z0HA 4F3JA 1RUH1 1CESA 3MFCA 2X8KA 4I02A 1C8NA 2EF6A 4FP3A 1YFYA 3PHMA 5KXDA 3VBRB 2W39A 4HN0A 1YFWA 2A3WA 2E7AA 2EXIA 1B09A 1TQ5A 1EV13 4BIOA 4UW6A 4OUMA 4E2QA 1NCQA 2PTMA 1ASJ2 2ZMNA 4Q4X3 3GYDA 1RUD1 4FPOB 4XEZA 3LGRA 5CIRA 5T5LA 4OI1A 4A7YA 2A3YA 1AXYA 2JEMA 2WFF1 1DGWX 3D0JA 3PLQA 5GLVA 3O0VA 4Q4Y2 1HRI3 2QVSB 2PN5A 1R1A1 2HWF3 2EAKA 3WLUA 1J1TA 3MF6A 3AYAA 1ZZCA 4NHKA 4XHXA 4BQ1A 1OPOA 2D5HA 1LCLA 5JR7B 3ZFFA 4AE2A 5BNPC 1RUI1 2RS33 3N7MA 4YZ5A 4YNIA 4Y1VA 3AYDA 1SLBA 2CTVA 1RUH3 1CAWB 2HWC3 2D93A 5J37A 4JGZA 4CEWB 1SCSA 1WW5A 4XFAA 4D94A 2XB6C 4AFMA 1VBE1 1MS5A 4QQPA 3VBFA 2CNAA 4JAAA 3M3QA 3IPVB 3V65A 1W6QB 2ZGSA 3HMYA 3NVCA 1GV9A 3H7JA 1K5MA 4CP2A 1YJKA 2BW8A 4GULA 4XJZA 3ZSMA 3VZOA 1WLDA 5K0UC 1RUD3 4FXKB 1BZWA 4OHXA 1MVEA 4FOVA 2PLV2 1WMFA 1VBC2 4YM3A 5FCCA 2WT1A 3WG3A 1ND3A 4MZUA 4JGYB 1AZDA 1B35A 2BVBA 1PHMA 2JXAA 4LE4A 2WFF3 3HWJA 4PBOA 4B3NA 3SCFA 1VAMA 4Q1RA 3OD4A 3ZO0B 4F83A 4F7ZA 1R1A3 4ORFA 5C8WA 4ES8A 5DG1A 2WNVC 4YZ3A 5EYYA 3AP7A 3P3PA 3WR0A 1OFNA 3KCXA 3ZSJA 1AJKA 1TME2 4AQ2A 1RUI3 2VNRA 2ZABA 4IL7A 3P3NA 4BPZA 1QNWA 4XF3A 4MGKE 1KFUL 3MIDA 1PK6B 1ZZ8A 1QDCA 1ZRCA 4M0NA 4QHBA 1YNAA 1ENRA 5IK7A 2OZJA 2A75A 1HW5A 1UKRA 2B5HA 4E4DX 5A33B 1YLLA 1VBE3 2Y38A 4H7MA 3MYXA 3UKNA 1R082 1UF2C 1Q8SA 4RQPC 1O3QA 2A71A 3T1LA 1AR91 3WCSA 5IK4A 3TNQA 1A3KA 2BYVE 3SH3A 4P14A 1VJ2A 3LOIA 2YPJA 4JTOA 4LO7A 1MS8A 1RUE2 2ZS6B 4G9SB 2XPJA 4ATFA 2GNMA 2XBO1 1O3SA 1RUF3 4B29A 3M2MA 2E53A 2WT0A 4TYSA 4COWA 5L7OB 3GBGA 1BVVA 3HBZA 5C9AC 1H8VA 1PGL1 2ZZJA 1WMDA 4XF1A 1XXNA 1X8EA 1ZX5A 4CDUB 1PIV3 3HT2A 2V5YA 3IDBB 4XMIA 4AW7A 1WW6A 1LOCA 1OD5A 2EAAA 2NMNA 1G9FA 5JZGB 3I54A 4QQOA 2DUPA 2VOVA 3UKTA 1IS5A 3U07A 4CDXC 1DZRA 4LNVA 5JOXA 4MSVA 1SBEA 2ET7A 1COV1 1AR61 4OI4A 1W6PA 2B39A 5CFCC 1V9U2 1RUJ1 2VMGA 3JQWA 4MYEA 1CN1A 3OGGA 4QPGB 2OUHA 2XH6A 2ARXA 4XZPA 1C1FA 2VU9A 3WDVA 4E9KA 2WSUA 1AR93 1VBB1 3AMPA 1UU5A 4WM8C 2RR11 4AEKA 5GALA 5D8AB 2DVAA 1LHWA 1SQ4A 2A6XA 1BEV2 4WVMB 3BTAA 1GYKA 2XBO3 1J59A 2H6BA 3BB6A 4AEDC 4X8PA 3ZXFA 1VRH1 1NCRB 1XE7A 5FBZA 4RD7A 1G6NA 2I07B 1RC6A 1S55A 3ZYIB 1FV2A 2LM3A 1ZYBA 2GN7A 2GNTA 1EV12 3VZMA 1O91A 5KHHA 3KT4A 4RGGA 1CAVB 1RUNA 2R16A 3U4XA 2JECA 1AR71 4Y20A 3FE5A 2UYAA 2XLFA 4FCAA 4Q4X2 4R52A 4AFCA 3AZYA 4PDWB 3NKTA 2R0HA 3RDIA 1COV3 1YFXA 3C2UA 4FOYA 2V09A 1AR63 4H3WA 2PHWA 2PAEA 4DRVA 2HYKA 2MEV1 2AUYA 5JVVA 4QPIB 5J98B 1H8TB 4QGNA 1HV1A 4CEYC 5HCAA 1V6IA 1RUJ3 2XUMA 3H8UA 5FPXA 1YI7A 2R6QA 4QQHA 2HWF2 3VBOB 3JB8A 3VV1A 1VBB3 1X7NA 2OUJA 2VECA 1LECA 3VBSA 1F9KA 3WZ1A 2RR13 1S0BA 5AC91 1LKNA 3FBMA 4FT8A 4OHWA 4LBQB 2RS32 3N3HA 3SMHA 1N1SA 5FO7B 4HMZA 1Q56A 2C0ZA 2HWC2 4Q26A 4DY3A 3AMQA 4AI1A 4HK8A 1W39A 4UW4A 1N3OA 1VRH3 4LHLA 4RS5B 4Y1ZA 2JD4A 4OI0A 4AFDA 4QQ2A 1CQ9A 1DQ6A 5C9AA 2GMEA 4LO5B 3TRSB 1AR83 3AMMA 2ZKNA 4IEXA 1DBNA 5HI0A 2BNMA 5L36A 1PMIA 3RJRA 1AR73 3M3OA 2YMZA 3ZMNA 2OPKA 1RUD2 2VOWA 3ZFGB 4BMEA 4H14A 1REDA 1AJOA 4EROA 2P37A 2XJSA 1OSGA 5JDBA 1IQAA 2VGDA 3D82A 5C8CC 2MEV3 2ZX0A 4XJ8A 3VZKA 2BFUS 4D69A 2D97A 1REEA 4YGCA 4CDWB 1RGSA 5C6CA 1JBCA 4GA9A 1R1A2 3IWZA 3E6BA 2BWAA 1BBT1 5CFCA 2JENA 4K40A 1HX6A 3VHRA 5JWPA 2A73B 2XWJB 4RGAA 3THTA 1ENQA 2K9ZA 5AC93 2Z2SB 3O14A 1YI9A 1AF9A 2XJVA 1RJ7A 3N35A 2ZX3A 4GXLA 3KT1A 1PVXA 2FMYA 2VXRA 1ASJ1 4R4XA 1OFSA 3WP5A 3U10A 2RMU1 1WCSA 4EN0A 1U12A 1VBE2 3SLIA 4IQPA 4KG0A 5K7PA 4AEDA 1PNGA 4LBMA 1PGSA 1RUG1 2B7YA 5DUXA 2WZR2 5C4WA 3ZYJB 4Q4Y1 4E4SA 3D4KA 5E88A 3UK9A 4HK9A 1XNBA 1DLLA 4ES9A 2CGOA 2ZGPA 1X50A 2ZX1A 5E16A 3H1YA 2PHXA 3X29B 3IDEA 2CY6A 4G3YC 3NV2A 1RUF2 4S2HA 5I0UA 2HWB1 2P2KA 3WW2A 3TOJA 3AYEA 1HXS1 1VP6A 4XMAA 2OVUA 1FXZA 1ZRDA 4AGRA 4CTEA 4D7YA 5J7MA 3J9SA 4AGGA 1BBT3 1PIV2 5T50A 1M06G 4CEYA 5K8SA 3EO6A 4EJRA 1N3QA 4DXZA 1V6MA 4LE3A 4IEOA 3S30A 3EJKA 2E7TA 4Q29A 1W6OA 2GC0A 2PA7A 1JOJA 5GZFA 4RR3B 3ZXEA 2W68A 2OYZA 4C91A 5JMCA 4FOWA 4JDMA 2XLGA 4NHLA 1ASJ3 1V6JA 4LR4A 1MS3A 5BNQA 5JSPA 3KQRA 2RMU3 1QH7A 1NA1B 2PLV1 2DVGA 1VBC1 3KMHA 2EIGA 2XVLA 2HKXA 4Z2WA 2X5IB 4XQWA 4YVSA 3M70A 1YJLA 1RUG3 4Q0SA 1O5LA 1VBD2 1NLRA 1YIPA 1H30A 4Q4Y3 2C5DA 1AR92 3WG4A 1OA3A 1LRHA 3DV8A 4J1WA 1JUHA 2FBEA 4MXVA 4KWJA 2YV8A 1RHI1 4BH9A 3DL3A 5JIAA 3B93A 3NSTA 1PZ9A 2RJLA 2XHKA 2XBO2 3HT1A 2HWB3 3OBRA 5FTTC 5ABJA 1V6NA 3D5OA 4FAGA 2WNUC 3RYPA 1HXS3 5JSOA 4N53A 1LGCA 4L8QA 4AQTA 1G86A 5DUUA 1WLWA 3NV1A 2GALA 2GAUA 2QCSB 4NHMA 2ZJCA 4QGLA 3IMNA 1DYPA 3NWKA 4XQ4A 3FHIB 2P17A 3FZ3A 1U0AA 4YG0A 4K20A 2WC2A 4YW5A 3K48A 3WQ1A 3RYKA 3SCHA 2JX9A 1GICA 3VBRA 5LRSA 1IGOA 4K21A 5GZDA 5SV5A 1AR62 2DFBA 2ES3A 1C57A 5I8TA 3GF6A 2PLV3 1GZ9A 1VBC3 2XVGA 1XE8A 1SCRA 1RUJ2 3H9AA 2ZA9A 4AF9A 3AYCA 1Q8OA 3OY8B 5L7OC 3T2TA 5FAXA 2Y26A 3WP3A 1LHNA 1C4RA 2RR12 1NCQC 1YRZA 1AYM1 1RHI3 4AQSA 4URTA 5BY5A 1UU6A 3B01A 4N43B 1RUC2 3AFKA 3GZAA 5JZGC 3ZFEB 1YUDA 1VRH2 2IFRA 3ZYPA 1ZBE2 3PVBB 3TB0A 4E2SA 4FSJA 1QJU1 4OVEA 4S2DA 1AVBA 3ACLA 1GKBA 1CAXA 1BK1A 2VY0A 1AR82 1V9U1 3NAPC 1CAWA 3TYJA 1RTVA 1M4WA 3ZVXA 1Y3TA 4XFCA 2BQPA 1ZBA1 2W52A 3E97A 4KG8A 3RSJA 4AYUA 3USUB 4CEWA 4OFGA 2DFCA 1AR72 4YM2A 1AHSA 4HETA 4DRRA 4XIKA 4YW4A 4XW3A 2WINB 2YDEA 4H7LA 5FO8B 1G9DA 1SFYA 3MW2A 2X29A 2MEV2 3IPVA 5FQ0B 1LU2A 3E6DA 1W6QA 3WP6A 1AL0G 1G9BA 4AWDA 2EXKA 2XJUA 2XG3A 1KDKA 4PQ9A 3RRDA 3VBFC 2UU8A 3QBQA 1APNA 4RA0A 1F8VA 1YXWA 3MIEA 1F2NA 3SCGA 1UD1A 3VZLA 4Y24A 1K5MC 4JGYA 4PCRA 1AYM3 3U0ZA 3WX5A 2KA3A 2VH9A 4Z82A 1B35C 1MZ5A 4U2AA 4ATEA 4M3CA 2XJQA 5FFOC 3PJQA 5FLJA 4XFIA 4PDWC 5EXOA 1QJU3 3VLBB 2UWAA 1C28A 3PNAA 2PFWA 1XRUA 2QUOA 1PK6A 1V9U3 1H8TC 5CA6A 3B9CA 3ZIWA 4COVA 2TUNA 4CRQA 4JCKA 3RMYA 5E8AA 1ZBA3 4Q2FA 1V6OA 2AENA 3M3CA 1H2KA 3PMEA 4WBBA 1DIWA 5A33A 4LEJA 3VBOC 3OPZA 3N7KA 3POSA 5KHIA 2CGPA 1ENXA 1UZYA 3W58A 5BNOB 1W6NB 4HPKB 3WDWA 4EN9B 2E51A 5KHGA 2HWC1 2BUKA 1DQ4A 2PAMA 4R9AA 2NYYA 2D6OX 4FPHA 2NQYA 1BBT2 4K8FA 1ZRFA 4JDNA 4RS5C 4COZA 1TNRA 2VW2A 1UX6A 2VNOA 3WINE 4LHNA 5FOBB 3GBFA 3B02A 5L7OA 3I2DA 1WW7A 4IV1B 3DF0A 3WDXA 3O0XA 2HWD1 4L9BA 4OHYA 3FLTA 4JRLA 3W59A 1LHOA 5FRAA 3RI8A 3MIHA 1ZNPA 3AKSA 3MLLA 4HSLA 4CDUA 2AGSA 5F6LB 2RMU2 5LRRA 4CP0A 3ZFGC 1G7YA 2I45A 3OJBA 3ROUA 5JZGA 4PLNA 2DURA 1RUG2 1ULGA 5T55A 1AL21 1PO11 3NO8A 4TSVA 2XKPA 1Q8QA 4P9WA 4LBQD 4I30A 4AFAA 2NN8A 3QCWA 4XBNA 1Q8VA 1S2BA