1YM5A

Crystal structure of yhi9, the yeast member of the phenazine biosynthesis phzf enzyme superfamily.
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
294
structure length
294
Chain Sequence
b'TLMVPFKQVDVFTEKPFMGNPVAVINFLEIDENEVSQEELQAIANWTNLSETTFLFKPSDKKYDYKLRIFTPRSELPFAGHPTIGSCKAFLEFTKNTTATSLVQECKIGAVPITINEGLISFKAPMADYESISSEMIADYEKAIGLKFIKPPALLHTGPEWIVALVEDAETCFNANPNFAMLAHQTKQNDHVGIILAGPKKEAAIKNSYEMRAFAPVINVYEDPVCGSGSVALARYLQEVYKFEKTTDITISEGGRLKRNGLMLASIKKEADNSTSYYIAGHATTVIDGKIKVH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical 32.6 kDa protein in DAP2-SLT2 intergenic region
molecule tags Oxidoreductase
source organism Saccharomyces cerevisiae
publication title Crystal structure of YHI9, the yeast member of the phenazine biosynthesis PhzF enzyme superfamily
pubmed doi rcsb
total genus 83
structure length 294
sequence length 294
ec nomenclature
pdb deposition date 2005-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02567 PhzC-PhzF Phenazine biosynthesis-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 1ym5A02
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 1ym5A01
5H2GA 5M47A 1QY9A 1U0KA 4J9XA 1T6KA 1U1WA 2PVZA 1S7JA 3FVEA 2AZPA 1QYAA 5IWEA 5HA4A 2GKEA 1TM0A 1U1XA 4JD7A 3EKMA 2Q9JA 1U1VA 2OTNA 3EDNA 4J9WA 4K7XA 2H9FA 4LB0A 1YM5A 1GQZA 1XUAA 1XUBA 4K7GB 4IJZA 4JUUA 3EJXA 1W61A 4K8LA 4IK0A 1SDJA 2PW0A 4JCIA 1W62A 4Q60A 4Q2HA 2GKJA 1BWZA 4DUNA 3G7KA 4JBDA 5H2YA 2Q9HA
chains in the Genus database with same CATH superfamily
5H2GA 2ENXA 1U0KA 2YMAA 2AZPA 1QYAA 2QB6A 2GKEA 2Q9JA 1U1VA 3G98A 4K7XA 4RPAA 1IR6A 1XUBA 4K7GB 2KPTA 4K8LA 4JCIA 1W62A 1BWZA 1I74A 4OA3A 2ZVFA 4JBDA 5ANPA 2Q9HA 3IGHX 4PY9A 3W5WA 1S7JA 5HA4A 1U1XA 2QB8A 2H9FA 1W61A 2ZXRA 1SDJA 3PVHA 2PW0A 4LG3A 4Q60A 2GKJA 2ZXOA 4LS9A 4GL6A 5M47A 2EB0A 2PVZA 1U1WA 2MPBA 3DEVA 5IWEA 4JD7A 3EKMA 3ICJA 2OTNA 2QB7A 2LT2A 1K23A 4IJZA 4JUUA 2HAWA 1WPPA 1K20A 2IW4A 4DUNA 3G7KA 1QY9A 4J9XA 1T6KA 3FVEA 1WPMA 1TM0A 3EDNA 4J9WA 4LB0A 1YM5A 1GQZA 1XUAA 3PW9A 3EJXA 4IK0A 4Q2HA 2KW7A 3WQZA 3PTJA 5H2YA 2ZXPA
chains in the Genus database with same CATH topology
5H2GA 2ENXA 1U0KA 2YMAA 2AZPA 1QYAA 2QB6A 2GKEA 2Q9JA 1U1VA 3G98A 4K7XA 4RPAA 1IR6A 1XUBA 4K7GB 2KPTA 4K8LA 4JCIA 1W62A 1BWZA 1I74A 4OA3A 2ZVFA 4JBDA 5ANPA 2Q9HA 3IGHX 4PY9A 3W5WA 1S7JA 5HA4A 1U1XA 2QB8A 2H9FA 1W61A 2ZXRA 1SDJA 3PVHA 2PW0A 4LG3A 4Q60A 2GKJA 2ZXOA 4LS9A 4GL6A 5M47A 2EB0A 2PVZA 1U1WA 2MPBA 3DEVA 5IWEA 4JD7A 3EKMA 3ICJA 2OTNA 2QB7A 2LT2A 1K23A 4IJZA 4JUUA 2HAWA 1WPPA 1K20A 2IW4A 4DUNA 3G7KA 1QY9A 4J9XA 1T6KA 3FVEA 1WPMA 1TM0A 3EDNA 4J9WA 4LB0A 1YM5A 1GQZA 1XUAA 3PW9A 3EJXA 4IK0A 4Q2HA 2KW7A 3WQZA 3PTJA 5H2YA 2ZXPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H2G A;  5M47 A;  1QY9 A;  1U0K A;  4J9X A;  1T6K A;  1U1W A;  2PVZ A;  1S7J A;  3FVE A;  2AZP A;  1QYA A;  5IWE A;  5HA4 A;  2GKE A;  1TM0 A;  1U1X A;  4JD7 A;  3EKM A;  2Q9J A;  1U1V A;  2OTN A;  3EDN A;  4J9W A;  4K7X A;  2H9F A;  4LB0 A;  1YM5 A;  1GQZ A;  1XUA A;  1XUB A;  4K7G B;  4IJZ A;  4JUU A;  3EJX A;  1W61 A;  4K8L A;  4IK0 A;  1SDJ A;  2PW0 A;  4JCI A;  1W62 A;  4Q60 A;  4Q2H A;  2GKJ A;  1BWZ A;  4DUN A;  3G7K A;  4JBD A;  5H2Y A;  2Q9H A; 
#chains in the Genus database with same CATH topology
 5H2G A;  2ENX A;  1U0K A;  2YMA A;  2AZP A;  1QYA A;  2QB6 A;  2GKE A;  2Q9J A;  1U1V A;  3G98 A;  4K7X A;  4RPA A;  1IR6 A;  1XUB A;  4K7G B;  2KPT A;  4K8L A;  4JCI A;  1W62 A;  1BWZ A;  1I74 A;  4OA3 A;  2ZVF A;  4JBD A;  5ANP A;  2Q9H A;  3IGH X;  4PY9 A;  3W5W A;  1S7J A;  5HA4 A;  1U1X A;  2QB8 A;  2H9F A;  1W61 A;  2ZXR A;  1SDJ A;  3PVH A;  2PW0 A;  4LG3 A;  4Q60 A;  2GKJ A;  2ZXO A;  4LS9 A;  4GL6 A;  5M47 A;  2EB0 A;  2PVZ A;  1U1W A;  2MPB A;  3DEV A;  5IWE A;  4JD7 A;  3EKM A;  3ICJ A;  2OTN A;  2QB7 A;  2LT2 A;  1K23 A;  4IJZ A;  4JUU A;  2HAW A;  1WPP A;  1K20 A;  2IW4 A;  4DUN A;  3G7K A;  1QY9 A;  4J9X A;  1T6K A;  3FVE A;  1WPM A;  1TM0 A;  3EDN A;  4J9W A;  4LB0 A;  1YM5 A;  1GQZ A;  1XUA A;  3PW9 A;  3EJX A;  4IK0 A;  4Q2H A;  2KW7 A;  3WQZ A;  3PTJ A;  5H2Y A;  2ZXP A; 
#chains in the Genus database with same CATH homology
 5H2G A;  2ENX A;  1U0K A;  2YMA A;  2AZP A;  1QYA A;  2QB6 A;  2GKE A;  2Q9J A;  1U1V A;  3G98 A;  4K7X A;  4RPA A;  1IR6 A;  1XUB A;  4K7G B;  2KPT A;  4K8L A;  4JCI A;  1W62 A;  1BWZ A;  1I74 A;  4OA3 A;  2ZVF A;  4JBD A;  5ANP A;  2Q9H A;  3IGH X;  4PY9 A;  3W5W A;  1S7J A;  5HA4 A;  1U1X A;  2QB8 A;  2H9F A;  1W61 A;  2ZXR A;  1SDJ A;  3PVH A;  2PW0 A;  4LG3 A;  4Q60 A;  2GKJ A;  2ZXO A;  4LS9 A;  4GL6 A;  5M47 A;  2EB0 A;  2PVZ A;  1U1W A;  2MPB A;  3DEV A;  5IWE A;  4JD7 A;  3EKM A;  3ICJ A;  2OTN A;  2QB7 A;  2LT2 A;  1K23 A;  4IJZ A;  4JUU A;  2HAW A;  1WPP A;  1K20 A;  2IW4 A;  4DUN A;  3G7K A;  1QY9 A;  4J9X A;  1T6K A;  3FVE A;  1WPM A;  1TM0 A;  3EDN A;  4J9W A;  4LB0 A;  1YM5 A;  1GQZ A;  1XUA A;  3PW9 A;  3EJX A;  4IK0 A;  4Q2H A;  2KW7 A;  3WQZ A;  3PTJ A;  5H2Y A;  2ZXP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...