1YM5A

Crystal structure of yhi9, the yeast member of the phenazine biosynthesis phzf enzyme superfamily.
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
294
structure length
294
Chain Sequence
TLMVPFKQVDVFTEKPFMGNPVAVINFLEIDENEVSQEELQAIANWTNLSETTFLFKPSDKKYDYKLRIFTPRSELPFAGHPTIGSCKAFLEFTKNTTATSLVQECKIGAVPITINEGLISFKAPMADYESISSEMIADYEKAIGLKFIKPPALLHTGPEWIVALVEDAETCFNANPNFAMLAHQTKQNDHVGIILAGPKKEAAIKNSYEMRAFAPVINVYEDPVCGSGSVALARYLQEVYKFEKTTDITISEGGRLKRNGLMLASIKKEADNSTSYYIAGHATTVIDGKIKVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of YHI9, the yeast member of the phenazine biosynthesis PhzF enzyme superfamily
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
molecule keywords Hypothetical 32.6 kDa protein in DAP2-SLT2 intergenic region
total genus 83
structure length 294
sequence length 294
ec nomenclature
pdb deposition date 2005-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02567 PhzC-PhzF Phenazine biosynthesis-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 1ym5A02
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 1ym5A01
1S7JA 4JD7A 2PW0A 4K8LA 4IJZA 1QY9A 1GQZA 4JBDA 2H9FA 1SDJA 4Q60A 1U0KA 4K7GB 2Q9JA 4JCIA 5HA4A 1YM5A 5H2YA 3FVEA 3EKMA 5H2GA 4K7XA 4J9WA 1T6KA 1XUBA 2GKEA 5IWEA 3EDNA 1QYAA 4Q2HA 1TM0A 2Q9HA 3EJXA 1BWZA 2PVZA 2OTNA 4JUUA 4J9XA 4DUNA 4LB0A 1W62A 1XUAA 2GKJA 1W61A 5M47A 1U1XA 4IK0A 3G7KA 2AZPA 1U1VA 1U1WA
chains in the Genus database with same CATH superfamily
1WPMA 4JD7A 3PTJA 4K8LA 3WQZA 1K20A 4JCIA 5H2YA 3EKMA 4K7XA 4LG3A 2IW4A 2KW7A 2QB7A 2YMAA 2GKJA 4PY9A 2AZPA 2QB6A 4IJZA 1QY9A 1U0KA 4K7GB 2ZXOA 5H2GA 1XUBA 2GKEA 2EB0A 4RPAA 1TM0A 2Q9HA 2ZVFA 2PVZA 2KPTA 4DUNA 2HAWA 1XUAA 5M47A 1U1XA 1I74A 1YM5A 4JBDA 3ICJA 1SDJA 3FVEA 3PVHA 2ZXPA 2MPBA 3EDNA 1K23A 4Q2HA 4LS9A 1BWZA 4JUUA 2OTNA 2ENXA 3W5WA 4J9XA 3PW9A 3G98A 4LB0A 1W61A 3G7KA 1U1WA 1S7JA 2PW0A 4GL6A 1GQZA 2LT2A 2H9FA 4Q60A 3IGHX 2Q9JA 5HA4A 2QB8A 4J9WA 1T6KA 5IWEA 1QYAA 3EJXA 1IR6A 1WPPA 4OA3A 2ZXRA 1W62A 3DEVA 4IK0A 5ANPA 1U1VA
chains in the Genus database with same CATH topology
1WPMA 4JD7A 3PTJA 4K8LA 3WQZA 1K20A 4JCIA 5H2YA 3EKMA 4K7XA 4LG3A 2IW4A 2KW7A 2QB7A 2YMAA 2GKJA 4PY9A 2AZPA 2QB6A 4IJZA 1QY9A 1U0KA 4K7GB 2ZXOA 5H2GA 1XUBA 2GKEA 2EB0A 4RPAA 1TM0A 2Q9HA 2ZVFA 2PVZA 2KPTA 4DUNA 2HAWA 1XUAA 5M47A 1U1XA 1I74A 1YM5A 4JBDA 3ICJA 1SDJA 3FVEA 3PVHA 2ZXPA 2MPBA 3EDNA 1K23A 4Q2HA 4LS9A 1BWZA 4JUUA 2OTNA 2ENXA 3W5WA 4J9XA 3PW9A 3G98A 4LB0A 1W61A 3G7KA 1U1WA 1S7JA 2PW0A 4GL6A 1GQZA 2LT2A 2H9FA 4Q60A 3IGHX 2Q9JA 5HA4A 2QB8A 4J9WA 1T6KA 5IWEA 1QYAA 3EJXA 1IR6A 1WPPA 4OA3A 2ZXRA 1W62A 3DEVA 4IK0A 5ANPA 1U1VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S7J A;  4JD7 A;  2PW0 A;  4K8L A;  4IJZ A;  1QY9 A;  1GQZ A;  4JBD A;  2H9F A;  1SDJ A;  4Q60 A;  1U0K A;  4K7G B;  2Q9J A;  4JCI A;  5HA4 A;  1YM5 A;  5H2Y A;  3FVE A;  3EKM A;  5H2G A;  4K7X A;  4J9W A;  1T6K A;  1XUB A;  2GKE A;  5IWE A;  3EDN A;  1QYA A;  4Q2H A;  1TM0 A;  2Q9H A;  3EJX A;  1BWZ A;  2PVZ A;  2OTN A;  4JUU A;  4J9X A;  4DUN A;  4LB0 A;  1W62 A;  1XUA A;  2GKJ A;  1W61 A;  5M47 A;  1U1X A;  4IK0 A;  3G7K A;  2AZP A;  1U1V A;  1U1W A; 
#chains in the Genus database with same CATH topology
 1WPM A;  4JD7 A;  3PTJ A;  4K8L A;  3WQZ A;  1K20 A;  4JCI A;  5H2Y A;  3EKM A;  4K7X A;  4LG3 A;  2IW4 A;  2KW7 A;  2QB7 A;  2YMA A;  2GKJ A;  4PY9 A;  2AZP A;  2QB6 A;  4IJZ A;  1QY9 A;  1U0K A;  4K7G B;  2ZXO A;  5H2G A;  1XUB A;  2GKE A;  2EB0 A;  4RPA A;  1TM0 A;  2Q9H A;  2ZVF A;  2PVZ A;  2KPT A;  4DUN A;  2HAW A;  1XUA A;  5M47 A;  1U1X A;  1I74 A;  1YM5 A;  4JBD A;  3ICJ A;  1SDJ A;  3FVE A;  3PVH A;  2ZXP A;  2MPB A;  3EDN A;  1K23 A;  4Q2H A;  4LS9 A;  1BWZ A;  4JUU A;  2OTN A;  2ENX A;  3W5W A;  4J9X A;  3PW9 A;  3G98 A;  4LB0 A;  1W61 A;  3G7K A;  1U1W A;  1S7J A;  2PW0 A;  4GL6 A;  1GQZ A;  2LT2 A;  2H9F A;  4Q60 A;  3IGH X;  2Q9J A;  5HA4 A;  2QB8 A;  4J9W A;  1T6K A;  5IWE A;  1QYA A;  3EJX A;  1IR6 A;  1WPP A;  4OA3 A;  2ZXR A;  1W62 A;  3DEV A;  4IK0 A;  5ANP A;  1U1V A; 
#chains in the Genus database with same CATH homology
 1WPM A;  4JD7 A;  3PTJ A;  4K8L A;  3WQZ A;  1K20 A;  4JCI A;  5H2Y A;  3EKM A;  4K7X A;  4LG3 A;  2IW4 A;  2KW7 A;  2QB7 A;  2YMA A;  2GKJ A;  4PY9 A;  2AZP A;  2QB6 A;  4IJZ A;  1QY9 A;  1U0K A;  4K7G B;  2ZXO A;  5H2G A;  1XUB A;  2GKE A;  2EB0 A;  4RPA A;  1TM0 A;  2Q9H A;  2ZVF A;  2PVZ A;  2KPT A;  4DUN A;  2HAW A;  1XUA A;  5M47 A;  1U1X A;  1I74 A;  1YM5 A;  4JBD A;  3ICJ A;  1SDJ A;  3FVE A;  3PVH A;  2ZXP A;  2MPB A;  3EDN A;  1K23 A;  4Q2H A;  4LS9 A;  1BWZ A;  4JUU A;  2OTN A;  2ENX A;  3W5W A;  4J9X A;  3PW9 A;  3G98 A;  4LB0 A;  1W61 A;  3G7K A;  1U1W A;  1S7J A;  2PW0 A;  4GL6 A;  1GQZ A;  2LT2 A;  2H9F A;  4Q60 A;  3IGH X;  2Q9J A;  5HA4 A;  2QB8 A;  4J9W A;  1T6K A;  5IWE A;  1QYA A;  3EJX A;  1IR6 A;  1WPP A;  4OA3 A;  2ZXR A;  1W62 A;  3DEV A;  4IK0 A;  5ANP A;  1U1V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...