1YM5A

Crystal structure of yhi9, the yeast member of the phenazine biosynthesis phzf enzyme superfamily.
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
294
structure length
294
Chain Sequence
TLMVPFKQVDVFTEKPFMGNPVAVINFLEIDENEVSQEELQAIANWTNLSETTFLFKPSDKKYDYKLRIFTPRSELPFAGHPTIGSCKAFLEFTKNTTATSLVQECKIGAVPITINEGLISFKAPMADYESISSEMIADYEKAIGLKFIKPPALLHTGPEWIVALVEDAETCFNANPNFAMLAHQTKQNDHVGIILAGPKKEAAIKNSYEMRAFAPVINVYEDPVCGSGSVALARYLQEVYKFEKTTDITISEGGRLKRNGLMLASIKKEADNSTSYYIAGHATTVIDGKIKVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of YHI9, the yeast member of the phenazine biosynthesis PhzF enzyme superfamily
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
molecule keywords Hypothetical 32.6 kDa protein in DAP2-SLT2 intergenic region
total genus 83
structure length 294
sequence length 294
ec nomenclature
pdb deposition date 2005-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02567 PhzC-PhzF Phenazine biosynthesis-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 1ym5A02
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 1ym5A01
4K7XA 2AZPA 3EKMA 3FVEA 3G7KA 5IWEA 2Q9HA 1U1VA 1U0KA 2OTNA 4K7GB 5H2GA 1YM5A 2Q9JA 2H9FA 4Q2HA 1QYAA 4LB0A 5HA4A 4Q60A 4IK0A 2PW0A 5H2YA 1BWZA 1U1WA 4IJZA 1QY9A 4DUNA 4JBDA 1W61A 1XUAA 1SDJA 4J9XA 1GQZA 1S7JA 1XUBA 2GKEA 4JCIA 2GKJA 1W62A 3EJXA 1T6KA 2PVZA 4JUUA 1U1XA 3EDNA 4J9WA 4K8LA 5M47A 1TM0A 4JD7A
chains in the Genus database with same CATH superfamily
2MPBA 3PW9A 4LB0A 5HA4A 3W5WA 5H2YA 2PW0A 1W61A 1K20A 1S7JA 1XUBA 2GKEA 3EJXA 1U1XA 4RPAA 4OA3A 1IR6A 4K7XA 2AZPA 3FVEA 3G7KA 2KPTA 3PVHA 2ZXRA 1YM5A 1WPPA 2Q9JA 3ICJA 4Q2HA 4Q60A 2ZVFA 1BWZA 5ANPA 1QY9A 4DUNA 4JBDA 1GQZA 3WQZA 2QB6A 1T6KA 2PVZA 1WPMA 4J9WA 3G98A 1TM0A 2YMAA 2ZXOA 2LT2A 2Q9HA 2QB8A 1U0KA 2ZXPA 1QYAA 2EB0A 3IGHX 4IK0A 1U1WA 1XUAA 1I74A 2GKJA 1W62A 4JUUA 3EDNA 4GL6A 3EKMA 2KW7A 5IWEA 3DEVA 1U1VA 2QB7A 2IW4A 2OTNA 4PY9A 4K7GB 5H2GA 3PTJA 2H9FA 2HAWA 4IJZA 4LS9A 1SDJA 4J9XA 4JCIA 1K23A 4LG3A 4K8LA 5M47A 2ENXA 4JD7A
chains in the Genus database with same CATH topology
2MPBA 3PW9A 4LB0A 5HA4A 3W5WA 5H2YA 2PW0A 1W61A 1K20A 1S7JA 1XUBA 2GKEA 3EJXA 1U1XA 4RPAA 4OA3A 1IR6A 4K7XA 2AZPA 3FVEA 3G7KA 2KPTA 3PVHA 2ZXRA 1YM5A 1WPPA 2Q9JA 3ICJA 4Q2HA 4Q60A 2ZVFA 1BWZA 5ANPA 1QY9A 4DUNA 4JBDA 1GQZA 3WQZA 2QB6A 1T6KA 2PVZA 1WPMA 4J9WA 3G98A 1TM0A 2YMAA 2ZXOA 2LT2A 2Q9HA 2QB8A 1U0KA 2ZXPA 1QYAA 2EB0A 3IGHX 4IK0A 1U1WA 1XUAA 1I74A 2GKJA 1W62A 4JUUA 3EDNA 4GL6A 3EKMA 2KW7A 5IWEA 3DEVA 1U1VA 2QB7A 2IW4A 2OTNA 4PY9A 4K7GB 5H2GA 3PTJA 2H9FA 2HAWA 4IJZA 4LS9A 1SDJA 4J9XA 4JCIA 1K23A 4LG3A 4K8LA 5M47A 2ENXA 4JD7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K7X A;  2AZP A;  3EKM A;  3FVE A;  3G7K A;  5IWE A;  2Q9H A;  1U1V A;  1U0K A;  2OTN A;  4K7G B;  5H2G A;  1YM5 A;  2Q9J A;  2H9F A;  4Q2H A;  1QYA A;  4LB0 A;  5HA4 A;  4Q60 A;  4IK0 A;  2PW0 A;  5H2Y A;  1BWZ A;  1U1W A;  4IJZ A;  1QY9 A;  4DUN A;  4JBD A;  1W61 A;  1XUA A;  1SDJ A;  4J9X A;  1GQZ A;  1S7J A;  1XUB A;  2GKE A;  4JCI A;  2GKJ A;  1W62 A;  3EJX A;  1T6K A;  2PVZ A;  4JUU A;  1U1X A;  3EDN A;  4J9W A;  4K8L A;  5M47 A;  1TM0 A;  4JD7 A; 
#chains in the Genus database with same CATH topology
 2MPB A;  3PW9 A;  4LB0 A;  5HA4 A;  3W5W A;  5H2Y A;  2PW0 A;  1W61 A;  1K20 A;  1S7J A;  1XUB A;  2GKE A;  3EJX A;  1U1X A;  4RPA A;  4OA3 A;  1IR6 A;  4K7X A;  2AZP A;  3FVE A;  3G7K A;  2KPT A;  3PVH A;  2ZXR A;  1YM5 A;  1WPP A;  2Q9J A;  3ICJ A;  4Q2H A;  4Q60 A;  2ZVF A;  1BWZ A;  5ANP A;  1QY9 A;  4DUN A;  4JBD A;  1GQZ A;  3WQZ A;  2QB6 A;  1T6K A;  2PVZ A;  1WPM A;  4J9W A;  3G98 A;  1TM0 A;  2YMA A;  2ZXO A;  2LT2 A;  2Q9H A;  2QB8 A;  1U0K A;  2ZXP A;  1QYA A;  2EB0 A;  3IGH X;  4IK0 A;  1U1W A;  1XUA A;  1I74 A;  2GKJ A;  1W62 A;  4JUU A;  3EDN A;  4GL6 A;  3EKM A;  2KW7 A;  5IWE A;  3DEV A;  1U1V A;  2QB7 A;  2IW4 A;  2OTN A;  4PY9 A;  4K7G B;  5H2G A;  3PTJ A;  2H9F A;  2HAW A;  4IJZ A;  4LS9 A;  1SDJ A;  4J9X A;  4JCI A;  1K23 A;  4LG3 A;  4K8L A;  5M47 A;  2ENX A;  4JD7 A; 
#chains in the Genus database with same CATH homology
 2MPB A;  3PW9 A;  4LB0 A;  5HA4 A;  3W5W A;  5H2Y A;  2PW0 A;  1W61 A;  1K20 A;  1S7J A;  1XUB A;  2GKE A;  3EJX A;  1U1X A;  4RPA A;  4OA3 A;  1IR6 A;  4K7X A;  2AZP A;  3FVE A;  3G7K A;  2KPT A;  3PVH A;  2ZXR A;  1YM5 A;  1WPP A;  2Q9J A;  3ICJ A;  4Q2H A;  4Q60 A;  2ZVF A;  1BWZ A;  5ANP A;  1QY9 A;  4DUN A;  4JBD A;  1GQZ A;  3WQZ A;  2QB6 A;  1T6K A;  2PVZ A;  1WPM A;  4J9W A;  3G98 A;  1TM0 A;  2YMA A;  2ZXO A;  2LT2 A;  2Q9H A;  2QB8 A;  1U0K A;  2ZXP A;  1QYA A;  2EB0 A;  3IGH X;  4IK0 A;  1U1W A;  1XUA A;  1I74 A;  2GKJ A;  1W62 A;  4JUU A;  3EDN A;  4GL6 A;  3EKM A;  2KW7 A;  5IWE A;  3DEV A;  1U1V A;  2QB7 A;  2IW4 A;  2OTN A;  4PY9 A;  4K7G B;  5H2G A;  3PTJ A;  2H9F A;  2HAW A;  4IJZ A;  4LS9 A;  1SDJ A;  4J9X A;  4JCI A;  1K23 A;  4LG3 A;  4K8L A;  5M47 A;  2ENX A;  4JD7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...