1YMHA

Anti-hcv fab 19d9d6 complexed with protein l (ppl) mutant a66w
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
220
structure length
220
Chain Sequence
DIVMSQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLAWYQQKPGQSPKVLIYWASTRESGVPDRFTGRGSGTDFTLTISSVQAEDQAVYYCKQAYIPPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comparison of the crystallization and crystal packing of two Fab single-site mutant protein L complexes.
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Immune system
molecule keywords Fab 16D9D6, light chain
total genus 42
structure length 220
sequence length 220
chains with identical sequence C
ec nomenclature
pdb deposition date 2005-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ymhA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ymhA01
5J12C 4ODSL 3K81A 4ONOA 3DUSA 3VFWB 4OBRA 1I8MB 1HNFA 4PRDA 3MRPA 3WD5H 4XX1E 4RCAA 5TDOB 1U3HD 3K1KC 4JRXD 4NFBA 2WINA 3MPCA 5E2JA 5F97E 5D7SH 1DBBH 4KRPD 1IGCH 4H26B 5CZXD 4OZHF 2DTML 3VXOA 4HSQA 4KTDH 3VD7A 1U9KA 4PJGF 1FNEB 3VFMB 4ZQKA 1ZK9A 3C08L 2MOVA 4GRMB 2VDOH 1D9KD 2CR3A 3CMOL 4LL9A 2YD6A 4N68A 2VXVL 3S97C 3CFDA 2ERJC 2DQUL 2AABL 1HCVA 1WIPA 4PRNB 5D7LB 3RQ3A 1KN2H 4WUKL 1OWRM 1WWCA 2E7LC 4PJGB 3OJ2C 2PW2B 4KZDL 1WBZA 3SKJH 3LQAL 3CFBA 3KWWB 1VGKA 3UDWC 1UQSA 3CVHH 4ZOBA 1CFNA 2P5EA 4U0RB 1XGTA 5C6TH 4OIIH 2VAJA 1CGYA 3QPXH 1GVIA 1AY1H 1KEMH 4B0MM 3H9HB 1N59B 3VXSE 4JREC 2X1PA 3FO1A 5K9OB 1Q0YL 4NRZB 4OZ4B 4YXHL 3WFCL 2CRYA 1FNAA 1TQBC 1MFAL 2FL5A 4R97C 3UC0H 1TITA 2W9DL 4UOW1 1UZ8B 3G5ZA 1D5MA 3AXLB 3TN0B 4R3SB 4RMRA 4JFZL 1A7NH 1BVKB 1DVFC 1J8HE 3GJFH 4YHOH 1MQKL 5I8KL 2F53A 4I3RH 3UTSE 3BO8A 1T2QH 2LU3A 2D9QB 1I85A 3K1DA 3Q1SH 3S96A 1MF2H 5LXGL 5DVOA 5I66B 3G6AB 4BZ1H 4PRBA 5IQ9A 3MV9A 1MJ8L 4FQJH 4QRRD 5DS8A 1F42A 2BXYA 3D3VE 5KG9A 1K85A 3DI2B 3W2DL 2VMFA 4XWGL 2FSEA 3O45A 5DEFB 2B1AL 1R24A 3P9LB 2PXYA 3NPZB 2J4WL 5FGBA 1UWXK 3O3EA 4P2QD 1SY6A 2ZPKL 4Z7WA 1CICC 5FXCH 2YPVH 4GAFB 3PGDB 1AXTL 3ZZ1A 3RU8L 4M00A 1HYSD 3QEHA 4PRPB 1ONQA 3W9EA 4O9HL 3H8NA 3KYKH 1KELL 3VG9B 3PGCA 3DX7B 1IGFL 4Q9CA 4R4FH 2BRQA 3ALXA 1P5UA 1CD8A 1AXIB 4J4PD 4U3CA 3C87A 2DKUA 3QNZA 5E8OA 1RHHA 2OMNA 2I24N 5K9QI 1RK1B 1W0VB 3MLWH 4DVRH 2FRGP 2X4RA 3TBWA 1IFHH 3KLAA 2ZCKH 4Z0BL 4ONFH 1QQDA 1P7QB 3R1GH 3W5MA 4JY4A 2VLJE 4PJEA 1GPOL 3VW3L 32C2B 2MKLC 1YN7B 5J1AA 4XHJD 4YWGL 3NABL 3VD3A 2HN7B 1ZHNA 2F19L 4ZFFB 1CE1H 2F5BL 3ECBB 4YBLC 3C60D 2O5XL 3BD4A 4LAQH 1IILE 2QSQA 3C6LB 1Z9OA 3ARDA 2VL4A 3IF1A 3GKWH 5EZLA 1QOKA 4MXVF 4S11A 5IQ9B 5DQJB 4TRPH 3V7AG 3FFDA 2FX8H 3WHE0 1I1YB 1YQ2A 2D31B 5IHZB 2R1YA 3D25B 5ICZA 4XHQA 1ZLWH 1ZWIA 2VKXA 1NGWB 2VAAA 3OF6A 4X7CC 2EDLA 3BW9B 1P53A 2FL5B 5IMOB 1LDSA 3B8YA 1ADQH 1FFOA 4MA3A 3HAEH 3NGBB 3TZVA 4G6AC 4GT7A 2YA0A 3WLBA 3VH8B 4JKMA 4U6XA 3B3IB 2J2ZA 3LKPA 5C0CB 4XP1H 4FRWA 5KVMC 2H6PB 1XGTB 1JWUB 4G3YL 2GY5A 4ZD3L 4OB5H 4JFXB 1UQSB 1BZ7B 3T1FB 1Y6KR 1KLFA 4Q9RH 3KLHD 3TIDB 5D1QA 2GI7A 2AJZB 4R8WH 2R8SL 2HT2D 3DVIA 2MPAH 3IJYA 2EDRA 3IKCA 3QFJA 4MDIA 4MJIA 1AGBB 3NGBC 4GMTH 4J3XA 3MRKA 3PQYB 2HFGH 4IMLB 4RMSA 5C0BB 2ZUSA 3QIWA 3T77A 3KJ6L 2RIKA 1RJLB 3NCBB 5GS1A 4FQHA 3O6KL 5I9QB 3U7YH 1F4XL 4YXKL 3U0PB 1KJVB 4ZPTB 3DSNA 1A1NB 1VADA 5ALCL 1FQ9C 4C56B 5HYEA 1U0QA 3EFFB 2XZAH 1K4DA 4PJ9A 1MCNA 2W0FA 3OR6B 5JR1L 1B6DA 2EIZB 2XXCB 4GRLD 4JPVH 2P7TB 2R0WH 5I17B 1WT5A 3DO3A 1HDMA 3F5WB 3O6LH 1UACH 2JKXA 4U1NB 5E5RB 2ICWI 3MCKB 1BAFL 5EO1A 2Q86B 3W9DB 1LD9A 4Y2DD 3OKEA 3BPLC 3D25A 5ICZB 3QXDB 5F1KC 3WS3B 3CU1A 4ELMB 2AJVH 5E4EB 5EU7C 3AC0A 3HNSH 4PGEA 4ZO6A 2PW1B 2WUBL 4YUEH 2DQDL 2FZ3A 1VFAB 3BD3A 2OZ4L 1KLGA 1ZS8A 3QI9A 4V2CB 3P9MB 3VDCA 4J4PC 3QUKB 4LSTL 4UNTA 3JWOL 1IGYB 2GSIB 2BNQA 5FV1L 1VFUA 4Z7OF 5CZVL 4PBXA 5E9DB 4KTEH 3ECBA 2BSSB 4K3DL 4YHOL 2X4OA 2WQRA 3BUTA 5DMYA 5KSAC 1T1WB 4RZCA 3RWGA 3MBXL 3OAUL 2V5TA 1HH9B 4J23A 3LKQB 1CGTA 2Y5EA 2GSGB 2EYTA 1XF5B 4DUVA 1LNUB 1HSAB 4PJEB 4WENB 2HJKA 3G04B 2Z93B 4LRNL 2EH8L 1G7HA 4GBXD 4JKWA 4UIMA 1VA9A 3MRKB 4YBQD 1IEBA 1FL6A 4ZSOE 4EQ3A 3GMNA 1NMBH 1J10A 1T6VN 5SV4A 5SX4H 1CBVH 4KZEH 1M6OB 1EO8L 5C0EA 1CICA 3B9KA 3QXTA 1HHHB 2DDQL 5A3ID 2OL3L 4XPBL 1T66D 5ESQB 1HSBA 3CSYB 5C0CA 3OJDB 4I0KA 3MMEA 4KU1A 4OZFA 3RUGE 1CDUA 5GRVK 5J6HB 4MJ4A 3RVUD 2A74B 3DPBA 4K3GA 5HDLA 2DQFB 4M1DL 5IOPA 3WFZA 1ZVYA 1HHJA 1OAYH 3AVEA 4Y4KC 2XQBL 5AYUH 1L0YA 4PB0L 1JPSL 5C0JA 1NCWL 3U0TA 1QFWI 5JLZB 2OJZH 3VXUD 1FE8L 5TFSL 4YR6B 4EI5D 1BIHA 3VI4E 3S96B 3QCVL 3EO0A 3HZYA 2NX5D 7FABH 5IHZA 3WUWB 4KJWD 1JK8B 1PGRB 4XCFL 4ZPVB 2Y9RT 4GBXC 1XIWD 4XCYA 4HUXA 1X4XA 3ARUA 4YBQC 3D2UD 1NDMB 2A9ML 4MNHA 4WGVB 5I71B 4KQ4L 1TVBA 1AD9A 3IJSA 4NO0D 1J9CT 1W72B 2BSRB 1JK8A 5DJ0B 4Q6IC 1ZHKB 3HKFA 4P59H 1QRND 2WK2A 4ZAKD 1X44A 2WBJC 1N0LA 2VE6A 1G9MH 1X3DA 1N59A 2MCPL 5CMAA 2DQJH 4Q6YA 4MAYA 4NZRH 3P4NB 3QZWB 1EEZA 1HHIA 1YJDC 4OCSL 4BA8A 3KR3L 3DECA 4HUNB 3ZSTA 5TE6H 4IJ3B 1UH2A 3FN3A 4NQDE 3D0VA 3OQ3B 2XN9D 3TH3T 3UAJC 3UDWA 4GQPH 2EIEA 3BIBX 5SWQA 2OK0L 4CN6A 4NCC2 5KTEL 2YUZA 2HRPH 3WHE1 2KPNA 4Z0XB 4U1JB 4HEPG 1RIHH 2CRMA 3SJVE 3OXSA 2YHGA 4LVHB 1IGCL 2QV2A 4JPWH 3C5SB 1YEJL 3JUYA 1K4CA 1B4JH 4G80A 1BQHB 4UIMB 3I3DA 5TDOA 3MRNB 4PRHD 2PETA 1FNSL 4OLXH 3DRTA 2UZXB 5C07A 3I84A 4PJFE 3ARDD 3KNBA 4S1DD 4TULL 2D03L 1YPZA 5FGRA 5K59E 4XCCL 3TBYB 4BM7A 2FNBA 3UYRL 1CFQB 3HR5B 2VLLA 1MRFL 4NC2B 5FYLD 1MNUH 4YHNB 1V5JA 3BEVB 5IESH 3IXTB 3Q1SL 1ITCA 3ALWA 3BDYH 1PSKH 3LS5H 1N5AA 1T22A 5HHPB 1BJMA 4EQ2A 4NJ9L 4DK6A 1PW3A 5F9JA 4NZJA 2UWEF 1YEFL 5C0BD 1XAUA 2HA1A 3OTTA 3WS3A 2GAZB 3MC0A 1G7IA 4NIKB 4GXVL 3X14A 3WEXA 5E2UH 4NRZA 4ALAL 5D2NB 4GXUN 1E6JL 2FR4A 4MA1B 4TUOB 4YDKL 1OB1A 1X5XA 3PP4H 4RGNB 5I17A 2K7QA 1U8HB 4OZHB 2VC2L 2H9GA 3PL6A 3SDDC 3ARED 4ZNCD 1XR9A 3BP7B 5B8CA 3D39B 1UWGL 1ZLWK 3CLFL 1HYRC 5JIKA 3UX9B 3N85H 4U6TA 3NA9H 3T0EB 1KB5L 4WY7L 1T7VA 4FQHB 4JDTL 3FONA 3N1FC 3INUH 2ZG2A 2R4SH 1RY7B 1B0RA 5F6IB 3PWLA 1NC2D 2E9BA 4LCYB 5CEYB 3N1GC 4UOJA 4LKCB 1L7TH 5E6IB 2ZKHH 4AMKL 5JXED 4HZLA 2D0HA 1GZPA 2YPLB 3VFPA 1JGVL 1OTTD 2FD6H 1DE4B 4HC1A 1A6VL 5C3TA 3PGFL 2AJUH 1S9YA 3SDAD 2NQCA 4M7ZB 5SWSA 3UZQA 2FO4B 4WW2B 2HTKC 3THMH 4D2NA 4LDOB 3D2UA 4NQCD 2VZOA 1KIRA 3IFLH 3SKOA 1NUNB 3P4OA 4ODVL 3UJIL 3BGFB 1AGCA 4FTVD 4TSCH 3BE1L 3KPSD 3GKWL 2GJZB 1S9VB 1AGFB 1CIUA 1KN4L 4P2OB 4YPJA 4NC1C 3MOQA 3GSVA 2A1WL 2W1NA 1E4JA 4FABH 3MO1B 2BY3A 3ZKMC 3KVQA 3FHQA 3UTOA 4F9PA 4ELKA 4R7NA 1PEWA 3S35H 3P73B 5DTFB 4N0YL 3VFOB 2VC2H 2O61A 1KUMA 3WE6A 4N0FA 5KSUB 1KCSH 1BJ1J 4LHUG 1PY9A 4K23H 4NM4H 5EU5A 2JELL 2HKHL 4BSJA 4NKMA 1J5OH 4PY8J 3WFEL 1L0XA 3TNNB 4LIQL 5MEPA 3HC4H 5AWNH 4Z18A 1G7QB 1ZA6A 2JJVA 3U0WH 3K8KA 4L8BA 2V7HA 1DP0A 1LK3L 5CLTA 4M1CD 1LK2A 4LCWA 1QBAA 3E6FB 4K3EH 1F6AB 2W9DH 3PWNA 4M7JH 5FYKU 4P4KC 1XEDA 3KYMB 4P5TC 5J6GB 1IC4L 3ARBD 2XQYK 5GGSB 4HF5L 1RJLA 3QDJD 1S7XA 1T5WA 4XNMA 5C0BA 3D3VD 4IMLA 4BELD 1QZ1A 1LEKA 3DMMC 4NZUL 1TZHA 4F7PA 4CU6A 4F57H 2JLLA 2QEJA 4X5XA 4LSUH 1LILA 5EU4A 5SX4I 5KSVA 1MY7A 4LPYA 4JKKA 1T89A 3QXVA 2DQEL 5CGTA 3B9DA 1MCCA 5DT1L 4L1HA 3RVVC 4ZO8A 3BKML 1Y18B 1NFKA 1J8HD 4KC3B 4N8VB 1QEWB 4ZAKB 5E6YA 3LMJL 3HB3D 1PZUB 2R0WL 2IH3A 3U30C 3U46B 5BW7A 2AK1L 3BQUC 4JDVB 1P4IH 1M7XA 3L3HB 4NUGL 4KVNL 4PJFF 1AFVH 1LO4H 4NWTL 5HDBF 2UZIH 5HJ3A 3VFGH 2HT3C 5CILL 5IP4A 5FHBH 3FQWA 5DHYB 2ARJA 1JZ7A 2VQ1B 3WKML 5E95B 1U36A 2X7LB 2IANB 2ZCHH 3PWPE 5MERB 1KPUA 2NXYB 3OB0K 3ULVF 2AGJH 5DUML 2CXGA 3LEYL 2YD4A 5DMIH 1YMMA 1Z9LA 3O4LA 2AERT 1CF8H 1UH3A 3B5GA 4NQCE 2DL2A 4L1DA 3MRFB 2C9AA 3MV8E 5CJ8A 2AEPH 4GW1A 4OF0A 3MOAH 3QHZL 3GSUB 4Y19A 3RZCD 1AQDB 2R9HC 2ADFL 2EE9A 1X6LA 3QJFA 5HYJB 2Q3ZA 4MA8L 5F9WB 4LLYB 4Q9BA 4XNZC 1ZXQA 3MV9E 3TN0C 3R8QA 5BMFH 3MLTB 3T0XA 4OFPA 1MELA 2CUIA 2OSLA 4IBLT 1I9IL 1MCIA 1ZT1A 4IIQA 4FMKA 5D7IA 5EH1A 3NFSH 3BQUD 3LIZL 4N8VA 2PTVA 3L3DB 1GGIL 4JLRA 5IVXA 1R5WB 4IM8A 3S36X 1Y18A 4WUUE 5JXAH 3SGJC 1KN2L 2CDFA 5CUSH 5ENWB 3QJHB 2FIKA 4HG4J 4FFZL 5IHBA 3PHQB 2RJMA 3FN0H 1C08A 3NH7H 3NZHH 2B4CC 4W70A 1RHHB 4WY7H 1MFCH 4PGZA 4KRPB 1CQYA 5INDA 4JKPL 2WV3A 1F3JB 2HJLA 2UUDH 3DO7B 3MLUL 1DBML 1NBZB 2LVCA 1NC4B 1WTLA 2RB8A 1DQQB 4M8QB 1PLGH 1NUDA 12E8L 3NTCL 1OQOA 2D7TH 2VR9A 2WP3O 4U7MA 1IAOA 2ADGB 4JFDA 2B4CL 5MEPB 5CSBA 2VQTA 1HIMH 1I3VA 1KCRL 1BOGA 1IEAB 1S9KC 2GSIA 4JPIA 1DVFB 4FQQB 2C7UA 1RZFL 1NC2A 3BP6B 4X99A 2YR3A 5DS8B 3CGTA 3VGGA 4P4KD 4LVOB 3QDAA 2CDEB 4TUJA 5HDBE 1XF3A 4UIKL 3HPLB 4GAGL 1RZ8A 1MIML 5HGHA 1I1CA 5BZDA 2B5IB 3QO0B 1UYWH 3LN4A 5CJXA 1WZMA 1NC2B 3TA3A 2WUBH 2EKSB 2W07A 1VGEH 4NNXA 3X17A 3TFKD 5E6ID 2EDNA 5EOTB 4WEBL 4X9FA 2O26U 3MLXH 2GJZA 3AREA 3NOIA 5ANMA 2J88H 4JANB 4MQTB 3MUGB 1U93B 5EBMA 1T7WA 5DJ6B 3QQ4A 3U4EB 3VDAA 3S34H 5JOPD 3HB3C 1NFDE 4QXUH 3I2CL 4LLUA 4K7FB 3V52L 3O41B 1BAFH 3T0WA 5MEQB 4L3CA 3IDGA 2JCCA 4AG4L 3QUZD 2CKBL 1DE4A 5E94B 4DOHB 1HK6A 1MFCL 1GGTA 5GGUB 2HRPL 5TQ0L 4L4VB 1GC1H 1NAKL 4Y4FC 5D1QB 5F96H 5HDQH 1EEYA 3RL2B 4PRNA 3GMPB 5DHVH 4YEFA 4PRIB 4KKLD 4P2QB 4PJBB 4S1SH 1F2XK 3WNMA 1C8PA 4GH7B 2AJYH 3ZDXF 5D93C 1EHLH 1ZTXH 5HHOE 1D7FA 4OKVB 3SOBL 2R0ZH 1OVZA 1UVQA 2P5WB 4DEPC 4EBQH 4HS3A 3M07A 5KANI 4Z7UB 3MLVH 3HNVL 5EU3A 2VISB 1DLFH 1U8NB 4H20L 3FT3B 5JW5B 1IMHC 4I0PB 4GW1B 4R2GC 4S1QH 2GJ6D 4QYOA 2MHAA 1IQDA 3LVEA 3MJ9H 1P4LA 5IB1B 1G7IB 2YSSA 5ECJE 3W0WE 5ADPL 3LHPL 4Y19D 3RZCA 1WBXA 3OKKB 1ZANH 4KZEL 1RUQL 3QIWD 1C5DA 4YQXH 4BZ2H 1HE7A 3D3VB 2X70B 5BW7C 2NW2A 5JHLL 3ARFA 2DM3A 3FN9A 5CJQH 5D5ME 4XGZB 2BVOA 5BV7C 4ONHB 1JPST 2J12B 2NYYD 3AMKA 4XC1L 4LLDB 5GJTL 4IRSB 1YJDL 3BZ4A 4GMSL 3S88H 3JTTB 1ORQB 4GKNA 5DC9B 2HH0L 3ULUF 5FO7B 4ZFGH 4XMPH 3QIBB 2CXKA 8FABB 4XMKH 1ROWA 1JPFB 1KFAL 4Q2ZA 1QFPA 1TCMA 4UMGA 1I8LA 2EIDA 2YEZA 4Y88A 3IT8D 3O3DB 3U9UA 1AHWB 5L0QC 1RD6A 3B2UC 1I1AC 5IB4A 4RGOL 1GL4B 2HAZA 5BRZE 1AO7D 2WIIA 3CXHJ 3TO4B 1DBAL 4LPUA 1OPGH 2F54D 1KIUA 1CK0H 3RVWC 4ZUVB 4FFWC 1IGJB 3WIIL 1A7OH 4HMCA 1F58L 5JOEA 3ZYOA 3LD8B 3I3EA 1JGVH 2YMXH 3HI6H 2YPKB 3GMOA 4RX4D 4X4XB 5HHMB 3T8XB 1UWXH 2GFBA 25C8H 5DMJB 3QDJA 5IR1B 2EDQA 4HKXA 1V3JA 4AQ1B 4I13B 1QSZA 2HLAB 4PFEA 3WKNA 5MEND 1FBIL 3V6OC 3QNXA 4YE4H 2IC2A 4O9HH 4NO5A 2NZ9D 5E5UB 5I1HL 2NTFA 3T08A 3K8MA 4UDUB 5EFIB 1H3XA 1AO7E 12E8H 5BRZD 5CJ5A 2DQCH 2Y07L 1E4WL 1FL3A 1NUGA 1TETH 3T0EE 2R0KH 5C09A 5AZEH 4LASL 4DW2H 3GSXB 4AEIL 2AJXH 3QCTL 3I6GB 2BY1A 2DRUA 2ENYA 3RVWD 2HMIC 1KTLB 3MRHA 1YEEL 4JFOA 1G7JB 4X4YA 3V95A 4OZ4A 3WS6C 4F58L 1QYGL 5C0JB 3SE4A 1KENH 2W0PA 4Z78B 1S7SB 5F44A 1SJHB 1PG7H 2UZYB 3H2WA 2YS4A 1QLEH 5GIRB 4Z7UA 3ARRA 5DA4A 1S5IH 2PN5A 2OI9C 4XHJC 3UPRA 1RK0A 3S4SG 5K9JL 5F1NB 1GGUA 4LBEA 5CSZB 1F4YH 1RJYA 2ADIB 1QA9A 5D1XB 1HSBB 1XZ0B 1I7ZB 4JG1H 4OCXH 1U8OB 5IBTH 3H9SA 2DQEH 5I1GL 4NKOA 4F3FB 2OCFD 1FNEA 3VFMA 3L3IA 1IC7L 3QCUH 1RUPL 3PDGA 5FDWA 3GK8H 5IIEB 4HIIA 4CVXB 4WO4D 4PV9A 4ZYKB 4M1DH 3MGOA 1U8KA 4WHDA 2MTPA 4G8GA 4JGUA 4JR9H 1EV2E 4IOFD 5KZCB 4W6WB 1IE5A 3V4PL 1S5HB 3RAJH 4MSWB 1CXHA 5I1CL 3T3ME 2VZSA 5ISZB 5L2KA 4Z5RA 3AFLA 3BGAA 2A73A 2I27N 2JTDA 3WNNA 5DF0A 2BRRL 4MQXC 3I6GA 2F74B 3GJFA 5EA0L 4PP2A 3UTZA 1EAPB 5H37H 1J1XL 2ARWA 4PRAA 4R96A 3SE8H 3MYJB 1P2CA 5C6PB 1JPTL 4UAOC 4YC2B 5D1QD 4CADB 4P9HL 4Y5VA 3MA7A 4QOKD 2L7UA 2AK4D 5DWUH 3QO0A 4J8RB 1HHGB 1XGUA 3OKMB 2P47B 4MNGE 1QP1A 4RGMB 1C5CL 3QEGL 4QXTB 3U30B 3O81A 2NTFB 3WYRA 5C0IA 4I2XA 3QT2A 1A3QA 5ICXB 3RUGF 1T20B 4X83A 4FQQA 4Z7NF 4LSQH 1OAZH 1J0JA 2E27L 4XWOD 1JV5A 1QVOA 2ADGA 4Y2DC 4PTTB 5ANME 5IJVB 1BX2A 4IJ3C 1LEIA 4YDVB 3WMSA 2ZUUA 4GMSH 2XPGB 3QQ9D 3QO1A 1MUJB 3GMOB 3VXSB 3QHFL 2CK0H 4FN0A 5T1LD 3OZ9H 5D1ZC 3QXWA 1IC7H 4X0KB 4K71B 4UNUA 4CVUA 5HGAB 2DQDH 4YEEA 5IFJA 5TQ2L 1VDGA 3QHZH 3PNWB 2XZZA 4JO1H 1A6WL 5FK9A 2QSCL 4NKIH 4H1LA 3F7QA 3E3QE 5GRUL 2DBLH 1QLRA 3DGCR 5C0ND 3CMGA 3S8WA 1OTTC 3HE6A 4Y5XA 3BIKB 5DC4B 4CVZB 1INQB 4JHAH 1JRHL 2JIXA 1A7OL 1G0YR 1M7IA 2ERJB 3NIGE 2NLJA 3GRWL 4O51B 1MCOH 3KPOA 4AM0A 3MNWA 4JVPA 4JFYA 1X6NA 3G08A 3L95B 5KW9H 2B1HH 2X4NB 4NQXB 4MQ7A 4HW6A 1FFPB 3V0VA 5ESVB 2EXYD 4PIRF 2CDGB 4MA3B 4QY8B 4IRSA 3AY4C 2DN7A 2A9NH 3HI5H 5TJWK 5C2BL 5IMOA 2FYYB 1NLBL 3P30H 2XWJA 2Y25A 5D7KE 4DN4H 5DRWB 1I3RB 2XQBH 3AS1A 3TO4D 1Q1JH 4Q58C 2OJZL 2W65B 2WM0A 2YBRA 5IFHL 4HGWB 2NW2B 4M4RA 3RTQB 3CFIC 1RZKL 1W0WB 2J5LB 1TQCC 1U3ZA 3HZYB 1I1YA 3QUXB 3UTQA 3OKNB 1BQLH 1L7IL 3M1BA 3I75B 3QEUA 3G6DL 1A14L 1K5NA 3PF2A 4DW2L 5L6YL 4HXBL 5DD3L 4WGWB 5D6DA 1BM3H 1V3LA 3SCMA 4NFDA 3MACL 5IM7A 1YNKH 4X7TA 4OLVH 5EIQA 1LO4L 3GMQA 3ZDZF 2IPKA 4NT6B 4OGXH 4K07A 3MJ6A 2EICA 4DVBA 3HUJF 4PLKD 2PNDA 4H8WH 4ZOCA 1OARH 1C1EL 3WNKA 2NR6D 4ZDHA 7FABL 5BOPA 5BJTA 4NQSA 2ATKA 2DIBA 4HK0B 3SE3A 4HWZA 2NR6C 1WFUA 4NDMB 4DUWA 3NBNA 4MA7H 1NMAL 2UVEA 3RWFA 1JHTB 3U4BL 2VUOA 2ATKB 3VMPA 1KCUH 2NCMA 2VLMD 3BJ91 1FYTD 2NY3D 3IVKA 1CG9B 4NQCA 4FXKB 1DDHA 3TBVA 4XC3L 4HMEA 3FHAA 3ULSA 5MHSE 8FABA 5DZNA 4JEGB 1DEEB 4QKXB 4HFWB 4QWWD 1TVDA 3BE1H 2YC1B 3KPNA 2X4OB 5JDJA 2V2TA 3O9WB 2BHYA 4XAKD 3MCLL 5D9SA 1KTRL 2ESVA 5FO8A 1EGJL 5B39G 1CN4A 5ITFB 2V17L 1A6ZB 3RX5A 4FFZH 4ZUSB 1BZQK 5J11C 4OI8A 2KH2B 2VQUA 1F6FB 4PGDA 2J8OA 3VWKC 3VFSB 3QG6B 4I1NB 2I9LA 5DHXB 2F8VA 2E5EA 5BVPH 4R26H 1O7SA 1CD9B 1EO7A 3BXNA 3N1PC 1QLFB 5B38A 4JQVA 4M6OL 4WO4B 5KVDH 2VL5A 1OD9A 3TYGH 4NN7B 2VB5A 4H8WL 1REIA 4XAKE 1XGPB 1OP5K 4H5SB 1QSFA 3MBEC 1OL0A 3X12B 3MRBB 2BJML 4S1RL 1OGTA 1KJ3H 5I1JH 1X4ZA 3RL1B 4MA7L 2NLJB 4AM0B 1T1XA 4ZNEE 1KTDB 1HCFX 3CD4A 5SWZD 5TPWH 2KUTA 3PHQA 5AZ2L 1MCKA 1L9NA 3G5XB 4U6VL 1GCFA 1FH5H 4O4YL 5CEYA 5ENWA 5CEZD 5CAYB 4MJ5B 1H3WM 4L4VA 3RGHA 2B0SH 2XG5A 4G9FB 1BZ7A 1IC5H 4KJQC 4P9ML 3C09B 3TT1H 2E8YA 2R4SL 2E3VA 4P9HC 4OQ1A 1X5FA 4E9LA 1XGYL 2Z92B 4Y89A 4G7YL 3O4LE 4K7FA 2APVA 4OCYH 3W39A 2BNRB 1Z9MA 3B4NA 3QQ3B 4KVNH 1FNGA 1D5BA 3T0AA 3OAZH 4A6YL 4WFGE 2CIKB 5BRZA 4G6KL 5IEHB 2EDKA 3BMWA 3LDBC 4OFYA 4N9OB 2B39A 2M1KA 4J3UA 4OJFL 5FOJA 3Q5TA 3RP1A 2V5YA 5GRYA 5IKCA 1MFDH 4WWKC 4HUWA 4KDTA 4WV1A 3O4LB 4AIXA 3KLSA 3IU3A 1TCRA 1D6VL 4OB5L 4XVSL 5D7LE 4HBQA 1BECA 5ERWB 2ZPKH 5CZXC 1XF4A 2CDEA 3LB6D 1FSKB 2I9LB 4Y4HA 1T0NA 3CDYA 5DD6A 3P40A 1LVEA 4J8RA 5D7LD 3HMXL 1D5ZB 2Y6SC 4FFYL 3QHTC 3MSPA 4LRIA 4L8SA 3WLWC 4HQQL 4NWTH 3NVQA 4R4FL 2GJJA 5I73B 4QF1A 3QA3A 4ODXB 3NPSB 1VPOL 4YHZL 4KK5D 4M7LH 3FB7B 1SHMA 3ZT6A 4G6JH 3UJJL 3QP3A 1S7WB 2R2EA 1WICA 3KXFD 4PJ5A 4J12A 1NC4A 4EUPH 4QRRA 1K9TA 5ISZA 2IAND 1SBSL 4OIBA 3EO9L 1G6RH 3O2WL 1RULH 4LIQH 3L5XH 2FCBA 3GSRB 3WN5A 4JDZA 3KLAB 5TGBA 1I9RL 4XP4L 4P5KA 3TBWB 3UBXI 2IBBA 1J18A 3LS4L 4YDIL 1J87A 4OI7A 4FABL 3QIUC 4ETYA 2CDFB 3FMGH 4Z0XA 5DDHB 4M5ZL 3G6JE 3BN9D 3MRMB 4RFEB 1F00I 3BSZL 4K2UH 4ZS6D 3KDMA 5GJTH 4X8JA 3VRIB 4WI5A 5HPOA 2VDPH 3JWOH 4ZTOL 3ZMRA 1MCQA 4LARH 1VACB 2D7TL 2CLZB 3VXPA 5AAWA 4HJ0C 4CMHB 4PRHA 1I1AD 5HYJA 5FA4B 2EDHA 2Z35B 5T3XH 1PFCA 5J8OA 3QZWA 5EOCH 3RKDD 1JNHA 5KG9B 5IT2H 1N7ML 1F3RB 3GNMH 4L4TE 3NN8A 1A6UL 4L5FL 1S8DB 2VLRE 3SE8L 4AEFA 4LVNC 1A1MA 4L8SB 5FAAA 1NFDA 5FO9B 3HMWL 5AG9A 4D94A 5JTWA 3DXAB 3B9KC 3QEUB 5GISH 4U0QB 1AHWC 3NCFB 1IGIL 4GKZA 1CGSL 2NY2D 3QUXA 2IANA 2YD2A 3BD5A 4R97B 2ARJB 2P46B 3QXAB 3IDXH 4QTHB 5I1DB 5D2NC 5IKCB 1WV7T 1BZ9B 4H88H 5GRWA 1S9XB 1EJ6A 4XCFH 5F7FA 2A0LC 1HEZA 1Y0LB 2NY7L 4AIOA 1CLOL 3JUZA 4DGYH 2ZSVA 5IF0A 1P5VA 4YE4L 3PABB 1RZKC 4P2OC 3FZUD 3LS4H 5A2FA 2ADFH 4WWKD 1UXWA 2UV3A 3M45A 3PUCA 4OZFG 2A74A 3RTQC 3VFPB 1NGQL 5EN2B 2VZTA 3O9WD 1N6QL 2FJFB 3IDUA 4LCUB 3BVNA 4DJMA 1FO0A 5C7XL 1A6WH 1A7RH 4G9FA 3FQNB 5DZOA 4C83A 1E4XL 1MY5A 3ULUL 4NQEB 3EYUH 4PJCB 1LEKB 1GHFL 1OQXA 1ORSB 2WQ8A 5IWLA 5TDPA 4TN9A 4X6FB 3EOTL 5CJBA 1IGJA 2CLVB 5BO1H 4RSVA 1MUJA 2APWA 5HGAA 3V4VH 3RDTA 1RSFA 1A7QH 1YYLH 4JRYA 3S36H 2B1HL 5GRJH 2XKNB 5DJYA 4IRJD 3VCLA 2EDBA 3JSSA 2J8UB 2MWCA 2IMMA 3O3UN 5TQ2H 3EJYC 5IVXE 3T2NH 4L4VD 1QFUL 3V7MA 2RGSA 1IFHL 4NKMB 5DVLA 3WEXB 3QI9C 3FTGB 2GAZA 2YPVL 1XF5A 4JN2B 4J1UB 5EZJB 2H1PH 3E6HA 1R3HA 5EO9A 5IB3B 3MBXH 3QG6A 4M4PA 1H0DA 3S37H 3BPNC 3RFZC 4A6YH 4DGVH 3IS1X 2DLFL 5FDYA 2EXWC 1FP5A 4CADA 3OWEA 3DVGB 3NH7L 1NCDL 4XC1H 2OK0H 2X41A 1L7IH 2R0LL 3MODL 5E2TH 3O6FD 3BEVA 3DVNB 4HIHB 1KNOB 3OJMB 1S9VA 4N1HB 2E7HA 4CGTA 5D2LB 4OFIA 2YXMA 3GGWB 1FGNL 4OZHE 1KCVH 4ZXBC 2W9EH 3O6ML 3BI9X 5CGMA 1R5VA 1RURL 1H0DB 4HKZA 4QRPD 1PAMA 4JR9L 1EO8H 4Y1AD 1OGAA 4BZYA 4LQFL 5E4IA 4OI9A 1JZ3A 2WANA 1KLUB 4WU5B 4TQEL 4ZYKA 4G80B 5TE7L 3HUJB 4JAMA 4MNQA 5J9PB 1AIFB 5J56B 2D4FA 3I02B 1WISA 3I9GH 3SDCD 2Q20A 3U0PA 3CVHL 3FB6B 3RWFB 3QNYB 3MNZB 1YA5A 2R1XA 1A5FL 1I75A 2CD0A 5DK0A 3QUYD 4QXGH 5HGBB 1NMAH 3WNOA 4EN3B 4I77L 5B3JE 4D9RE 3GSQA 3D9AL 3IJYB 4PRIA 3ZE1E 1N5YL 2F58L 4XMKL 1NAKH 1U8OA 3MJ8B 1G7LB 3VMOA 5ISZE 3OJVC 4OGXL 1F4HA 2QSCH 3DV6A 1JHLH 4OV5B 1A6AB 5DK0B 4CRPA 1FO0B 2AJYL 3T65B 4JM2C 5CINL 2MFNA 3TVMA 5CMAB 4KK9C 2F54B 2FR4B 5DD1H 3V52H 1MCOL 3IFPA 2G9HB 3KYNA 5T3ZH 1ETZB 1XCTB 3T0BA 1A21A 1T89C 1FL5B 1NAMH 3RIAF 4GBXB 5F9OH 4XCNA 3K8LA 4GSDL 4LPWA 3FRPG 4LSVL 3H7BB 3AAZA 1TVBB 3BHBA 3KPPA 5C0AE 4PJXB 2X9XA 4DTGL 1WC7B 3L5IA 2IQ9H 5C2BH 4NZRL 5C09B 4NNXB 5IT2L 2DWEB 1FL3B 3QDMA 4S2SA 3HE7B 3WS6A 4L5FH 5E1AB 1CIDA 3IFOB 3KLHC 4GAJH 3EO1A 4OGYL 2QHRL 3HPLA 3QUMB 3U6RB 4U1HA 5FF6A 3VXRA 1AR2A 2LQRA 2YZ1A 4HKBB 2DQIH 1MFEH 1BBDL 4HWBL 4KXZH 5LG1A 1B0GA 4OD2A 1OAKH 2NZIA 2BJMH 1U8IB 4S1RH 5KTEH 2GQHA 4K8RD 3MROB 3MRNA 1JGEA 1IAOB 1LO5A 1TJHH 3B83A 1BQHA 4KJYA 4KI5F 2JIXB 1MRDH 5HI5D 5CGYD 3C8HA 3SO3B 3D85D 3MGTA 2NY2C 5HGDA 4PRHE 2PKDA 4KROD 3V5KA 3UTTD 4ODUA 5AEAA 5K9KB 2XRAH 1A7PL 5CWSB 5DRNA 3LRHA 2P24A 3C9NA 1M6OA 4OF8A 1EVUA 4XP5L 1EIBA 3MV8B 3GK8L 3RUGB 2R23B 4QOKE 4GG6A 4WDIB 3JZ7A 4K8RH 5D96C 5IB4B 4MMZC 5I8CB 4X7FC 3TJEH 4MMXC 1KGCE 1G7HB 4XP6L 4ODWA 3UXFA 4LNVA 1ZT7B 4ZS6C 4ZFGL 3TA3D 2JB5H 4JFHE 4O2FA 3SEPA 4JDZB 1CXKA 3EGSB 3OAUH 2CUMA 4MLSA 4U6VH 5GGTL 1JPFA 5E8EA 4WWKB 3LAFA 3BDBA 3RVTD 5EC2A 4KUZL 4MD5B 4NBYB 5E9DA 4ERSH 5J13B 1VHPA 2A6JB 2FATH 1A3RL 5HYSB 1IGYA 5DEFA 2N4IA 3QCUL 3C08H 4PJ5E 1MAJA 4MZ3A 3IFOA 5IVZA 3F6LA 3OKMA 1J12A 1N6VA 4M3KB 2G75A 4S2SB 4Y5VB 3M8OL 2DQIL 4NQED 2VUYA 2XXMB 3FQXA 3ROOA 3HZVA 3IU4H 3QUYC 5IVOA 3KPQA 5KVFL 1A4JB 4PJEE 2AJSH 3RIAK 3SO5A 3NAAL 3JTSB 5MERA 3MCKA 2BVUA 5ISZD 1GAFL 4WCYL 3MX0A 1V3MA 1F90H 1FL5A 3E8UH 1CICD 4YH6A 4Z5RB 5JW4Q 1XMWA 2EIZA 2VISA 5SX5K 5HHQA 1A6TB 2EE6A 5I2IA 1F13A 1IQDB 4UINH 4XCEB 2X4UB 1CDCA 1KULA 2NY1C 1LWRA 3HRZB 1H3PH 5JDSA 2EDDA 2LTQB 3IDJB 1B4RA 3MGOB 2AK1H 3T65A 1MCEA 1H3VA 1FNFA 3B5HA 3KJ6H 1ZEAL 5D1ZB 3WUWG 1HKFA 3Q0HA 5JXEA 4NKDA 3MJ8A 5C9JB 1QRNA 1U8QA 2Z92A 4FQXC 2BERA 3PL6D 3CFBB 2EE2A 3NCJL 2JCCE 3Q3GA 2VSDA 3V0AC 4MX7B 4XPTH 3ES6A 4Y1AE 5LAXA 5M7QA 1YNLL 4MQXD 2KL6A 5E8PB 5KSAD 5BQ7B 4QNPE 1I1RA 3EO9H 4MJ5A 1IEBB 4P2RD 4JFXA 1RMFL 2GW5A 4LBEB 1WQVT 1LEGA 3GRWH 1Q9KB 5GGUA 1PYWB 4HZAA 2IFFH 3TCLA 2H3NA 5F6IC 4ENEC 4YPGB 4MB4A 4MNQD 1DQMH 1EHAA 1M05B 3WL9B 4Y1AB 3E2HC 5F1SA 5DI8A 4XAWL 3MRCA 1PG7W 5FB8A 2VDLH 2DLGA 3AREB 5I9QC 4RMTA 3RPKA 2A6KB 5K9QG 5E8NA 4HEME 3GI8L 1U93A 3EJYD 3QRGL 1EX0A 4L3EE 3SDCB 4K3DH 4NO3A 4WFFD 5D2LA 4LEXH 2VDNH 4F9PC 3BKJH 3WFEH 2P8LB 4QRQA 5CBAA 15C8L 1HYSC 4EDXA 5JHDE 4FP8L 2XTJE 1NPUA 2F15A 4DQOL 3DYPA 4DN3H 4YBLB 4QXWA 4YHPA 3C2AL 3CDGA 2IQAA 2BDNL 2Y36H 4BQ6A 4EOWH 2VLJA 1AP2A 3KPRD 2WLYA 3CH8A 4ETQA 3AM8C 1VB9A 1AXTH 3ZKSD 1NCCH 4GG6E 3ZE0F 4KKLC 4JKPH 3T2PA 4ORZC 4M7LT 1ED3B 4QRSB 1A1OB 1SEBA 3MLUH 2X89A 4M7LL 5E8NB 4L29A 5IFHH 3JWDH 1G9MC 2CIKA 4XVUC 5IR1A 3T4AB 3C6LC 3QQNA 2GFBB 2APFA 2ATPB 2O5XH 3HC0A 1A4KA 3WO4C 5GS1B 4FTVB 2A6IA 2XZQH 4XP9L 3LN5B 1DQLH 3G5YA 2P42B 3QFJE 3TBSA 3MLWL 2HP4A 1A0QH 1U8PA 4QRPA 4JFFA 2ADJB 4X6FA 4D8PB 1NAMB 5D7KD 4ZO7A 5FA3A 4O02H 3A67H 2WSKA 43C9B 3BYTA 1JI2A 3AS2A 3RIFF 1BM3L 1G1YA 4PV8A 2ICCA 3HE7D 1GOHA 1FRGH 2Z4QA 3S9DB 1RZJC 3L3DA 4KTYA 3BVNB 3QJHA 1JWUA 3KXFA 2ICWA 3WHXA 2F8OA 2DI9A 2DQTL 2ZUVA 3N9GL 4JLRB 4U6XB 3GI8H 4NQTA 2N56A 4OCRL 4ZFZA 2QQKL 2X42A 5HDOA 4R6UA 1ES0A 2AXGB 4HJJL 4HUMB 2EH7L 1FN4B 3STZB 3GMQB 4NSKA 4U1GC 4MJ2A 3DX6A 2JIXD 4EI5B 3Q6GL 3ZTNL 4G3YH 1UJ3C 1PKQA 1UWGH 3G6AA 1RU9H 4QTHA 1VEMA 3QEQA 5I1LB 5EO0A 5GGTH 3J7HA 4P0DA 3BKYH 2QKIB 1NEZB 3FQRB 3ZTJG 3FFDB 1YDPA 4ODVH 5H35B 4DN4L 1ZAGA 1W0WA 1S7QA 1IAKA 1KPUB 2DI8A 4PPTA 5GQBA 1T2JA 5GGRY 1MJJA 1WGOA 1UKSA 4U1MB 4XP1L 4YGVA 4TVPE 5GGVH 5K9OA 1ZHLA 4RA0C 1YEDB 2V2TB 1T6WA 3KNBB 2QQLL 4LOUC 4WTZG 3FOMB 1WZLA 4BSWB 2R1WB 5JMRA 3FCTA 4OCMC 1Q1JL 4DWHA 2Y4SA 4MAYC 4POUB 1ADQA 1IGIH 1RK1A 1TZGL 4M6OH 1KFAH 3B9AA 2PXYD 1OARL 4PV8B 3QDGA 4QHKJ 3KYOB 2FJHB 3VRJB 2J4WH 4DUXA 4GS7B 2R23A 4OT1H 4TPRH 5DYOA 3S5LB 4FQIL 3NIFE 3CXDH 3G5YB 1DQJB 3QEHB 3GIVB 3HI1A 1F6AA 3PWNB 4PRPA 5JIPA 4PTUA 1N3NB 1QBLL 1OTSC 3P0YH 1UACL 1F02I 3HFML 4X6DB 3C60A 1GZQB 3MRPB 2YMXL 4PJ5B 3L3GA 4EI5C 3WXWL 3W0WA 3VFWA 4NN6B 3BKMH 4RDQG 3ARBC 3QIUB 5E08H 1LK3H 1ZA6B 1P1ZA 3PHOB 5EB9A 4F7CA 4CL7A 1DQML 4X6DE 3OGCB 1DFBL 3MV9B 3P73A 3SJVD 3VXME 2V5MA 3R0NA 4RGOH 5DQ9A 3ZDYF 3G5VB 4Y4HB 5DTFA 4PUBH 5BV7L 4KJQD 3U6RA 3U82B 4LU5H 4RBPH 1VENA 5CINH 3A6BL 4DOHE 5JHDD 2M26A 3V5HA 3WJLC 3MA7B 3VXQB 2DOCA 5E56A 5F7DA 3CDCA 4JRYE 5F3BA 15C8H 3MXWL 5HVHC 2ARJQ 1KEGL 4LMQE 2VRAA 4WUUD 3M17B 1MWAH 4UT6H 3ZKQD 4BH7B 4PP2B 4GRLC 1AJ7L 3JVGA 3SHSA 4I18B 4D9LH 4Z7VE 3U0TB 3T2NL 2XWBA 1CF8L 3QAZB 1TZGH 3DIFB 2B2XL 5EU6E 2HJLB 5IJKC 4K94L 3SGKC 1HQ4B 4G43A 3G08B 3MOAL 1GRWA 1ZHBA 1WF5A 3T0ED 5INDB 4LDEB 5D7JB 3C8DA 3KPOB 4Y5XC 2P8PA 4K3JH 3EYSL 2I25N 3OKYA 4M1GL 3CSYA 1KENL 4LSSH 1ZA3A 4GXVH 1XGRA 5IW6A 5LAXB 3QWRA 4V1DD 3ZDYE 1PX4A 1L4IA 4LPVA 2V9TA 3SDDA 1UCBL 1I9IH 3BISA 2R0KL 5IBLC 4Y4FD 1K8DB 1X5KA 2AV7B 1N5YH 3FONB 4PJ8C 4QOKA 2Q6WB 4FS0A 1T0PB 3CK0H 1NCWH 5GGRA 4L3ED 3ILPB 3F7YA 4RAUA 1NCNA 4G7YH 4XCEA 5C0AB 3ARFD 2JJUA 3WIHL 1A6UH 4N0CD 4Z78A 2ZOKA 3HZMA 2SEBB 2WBJA 3IXAB 3X14B 1U8HA 1J0HA 2GUOA 5E6ZA 4NYLA 5FGCE 3NIFF 3QUZB 3H9YA 1L6ZA 3RWGB 4R4BA 3U36A 5DUPH 4XP6H 3VFSA 4BQBA 3KS0H 5T5NG 3GFUA 2DIAA 4X4ME 2EEAA 1URLA 1YPZE 2X44D 1KACB 1RIUH 3BZDA 4KHTH 1KNOA 4KKAC 3DVNA 4PGJA 5T1KB 5HTSA 1TVHA 4U31A 5ITFA 1RIHL 3IETB 2NMSA 5DJZB 3MLRH 4YHNA 1NFIB 2IAMB 1UA6H 4QCIA 4C57C 4ONGH 3SKNA 4ELMA 1IZJA 1A3RH 5GZOC 1MLCB 4JJ5B 1MJ7H 4DK3A 5IMMA 4XNQB 3IGAA 4HS8H 5C0NC 2GKIA 5J1TC 3KYKL 4KRPC 1MPAL 1CXEA 1II4E 3OKOB 3RBGA 4QRTB 3BUYB 3IB4A 4KRMB 1DQDH 3O2VL 3MUJA 3UTPD 4YAQB 5C86A 3LKNA 4MSWA 5CCKL 4X8XA 4X9BA 2E6PA 1NCAH 4QHNB 3IU4L 4JJHA 1WFNA 4HUKB 4YFEA 5BS0B 3IVKB 2VLRD 4ZNEA 3O2DA 3MJGX 1FDLL 2LAGB 1BPVA 4S1DC 4GG6B 4LCCB 1DEDA 5GHWH 5GS2D 1RZFH 3GIVA 3HI1B 4WFHE 3QIWB 1QRKA 4YHLH 1J1XH 2PYFB 3RDTC 2GJ6E 2R2CA 3C9NB 2BSTA 3CK0L 3IKCB 3QFJB 4MDIB 4ODTH 3VGEA 4P9HH 2EZ0C 1W0YT 1LP9B 3JV6B 5GS0D 1CVSC 1XGQA 1J8HB 5EOQH 3RWJA 5JW3L 3T09A 1HH6A 1FGVH 2MMXA 4M7JL 5E24E 1LO5B 4YAQA 4AH2B 3K2UH 5ETUA 5IB5B 1SBSH 3GSNL 4IHOB 5EN2A 3QIBD 3F7PC 4U7SA 4DAGH 1E4XH 3TNNA 4G9FE 1UXWB 3UZVB 1GHFH 1JNLL 1TNNA 2VDNL 4QEGA 1FJ1B 4FQXD 5KSUA 5IF0B 1SM3L 4EBQL 2E6QA 3OKNA 3MLRL 3RNKA 4JQXA 2CK0L 1I9EA 2V5RA 2UUDK 3ULUC 4NQDB 1M7DB 1RAMA 1YY9C 4RWHA 3MLSH 4HKJA 3REVB 3NPSC 3LZFH 1W72L 3E2HB 3LIZH 3C5ZA 3CPLB 5AYUL 2BOCA 3RZCB 1MHCA 3MRGA 4MHHG 3WFBL 1IL1B 4K94C 1PJ9A 3ARGC 5IB1A 2Q87A 4PJFB 1X9QA 2GHWB 4MQ7B 2F54A 2FX9L 4LLAA 3GEWB 3SO3C 3N1MC 4MXVE 5CEXB 3IDMB 1DQLL 2Z35A 3RVXC 3WJLA 4FZEL 1T80A 2AGJL 3GNML 5DUMH 4JY6B 4GW4B 5CFHA 1S7VA 4LCCC 5I19H 4YHYB 1HH6B 1KCLA 4HS3B 1F8TH 4O02L 3QIWC 3MV11 1J8HA 4ZODA 4APQD 3O6MH 3SY0A 3M8OH 2DLIA 4TSAH 4Y8DC 1U3YA 2FB4H 2IJ0C 5GGSY 1K3ZA 5FUCE 4L9LC 2J8UF 2DB8A 2XICA 4XI5C 2R29H 5ESAA 4LP4A 5JHDB 2DKMA 3SBWA 5D72L 1OTSD 1KCSL 4PREB 3VXSA 3O0RL 4M6NL 4LGRB 3QDHA 5D7JA 3D39A 5BS0A 4YHKL 1HXMA 1YY9D 1XCQA 5I1IH 4LCWD 2VXSL 3K4ZA 1MVFA 3IDGB 3WN5B 1A4KB 2X4QA 4NJAL 1N0XL 3PHSA 4TSBL 3TH4T 4LLUB 1ZLSL 3TPKA 1DVFD 1N2RB 3P9WB 2YRLA 4LRIC 4RA3A 2EYRA 5C0IB 1MI5E 4PJAA 3MLXL 1CE6A 4LSTH 1MRCH 3WNLA 3KS0J 5MI0C 1H5BC 1WFOA 4Z7UE 3RY6A 4W4OA 1KLGB 1N64H 5J4MA 4V1DB 4QXUL 4XPGL 3CDGB 3PV6B 4EI6A 4D9RD 1T0NB 1PLGL 4P5MA 4HJGB 4KHXL 1CLCA 2AXFA 1XF4B 3E6HB 1QPXA 4NRXA 4TULH 2ZUYA 3IYLW 2D03H 4AJ0A 4GRWF 1ZVSB 1RIUL 4EKXA 3DGGB 1J05B 1OF2B 1YECL 4R7DB 5J1SC 5C07B 1N26A 5EO1B 3LN9A 4DTGH 3SDCA 1K4DB 2NY5H 3DRTB 4E0RA 4I4WA 1MJUL 5FV2A 3VJ6A 1ZLUK 2P7TA 2Y72A 5C09D 1H5BB 4EIGB 4TSAL 1IBGL 1RZJL 5D70L 1JPSH 4ZS7L 5DUBA 3MLPA 2Z31B 2DQGL 4X5LA 4GAJL 3T77B 3OXSB 4B7LA 3Q5OA 3O3BB 1P7KA 2IMNA 2VKWA 3SDDB 3I50L 4M7KH 3CSPA 4PJGA 3UTSD 1MCSA 5D4QA 3TIDA 1AKJB 4UUJA 2X1QA 5E8PA 4I3RL 5CZKA 5HHXH 1L0QA 1FFNA 2ICWJ 1KOAA 4NJAH 5F8RC 1ND0B 2RBLA 1G84A 5HPMA 3X13B 2JB5L 2Y7QA 3KPMA 3MBEA 4GKSA 5ADPH 4KKBC 3K4DA 4XNZB 3LKPB 1ZANL 4MJIE 5DEZA 3OX8A 1T7YA 2H8PA 3VFUB 4JFEB 4F58H 2WP3T 1QYGH 4U3HA 5HI5C 2JB6A 4JQVC 1N4XH 4I0PD 3ARSA 3W82A 2WINB 2VZ3A 4LHQB 2C3XA 3BWAB 2BMKA 3KPRE 1Q9OB 4OCYL 5CEZH 1K6QL 1FFOB 2VZVA 5I6XC 1T5XA 4RISH 5CJOH 3CFCL 3HC3H 4Y5YA 4PJFA 1GGIH 3BH9B 3K2UL 5F3BB 1ZTXL 2ZUWA 4KQ4H 1WIUA 4X6BA 3V4PH 1JZ8A 1Z9SA 2BOCB 2N7AA 5I16A 1JFQH 1D6EA 1RIVH 1IM9B 4URTB 1JZ4A 3GB7A 3RPIA 1NFDB 4N5ED 4UZGA 1VKXA 4MXQD 1YEJH 5JLZA 1A6ZA 3NN8B 4C4KT 3ZHKA 1IBGH 1RZJH 4L4TD 3BP6A 2IGFL 4OFDA 3C09C 3R1GL 4EEEA 4HJJH 1KJ2H 1UENA 3C6LD 4M1CC 5IOPB 1QBMH 3L7FA 4M6MH 1C5CH 3QEGH 1FCGA 1F6LL 4WWKA 2AK4A 1SJXA 1NBYB 2X2YA 1NDGB 4OSUH 1JE6A 2OM5A 3RGVC 2FBOJ 2W0KA 3CX5J 4R0LB 4G6JL 3UJJH 1TJHL 5DJAA 3C5ZD 5IESL 2FECI 2I9TA 1X4YA 3S5LA 1HXMB 1TXKA 4FQ1L 1JRHI 5F7YC 4XNUL 1RULL 1JWSA 5C0EB 3TO2B 2FJHA 4KDTC 4WV1C 1LP9A 3JV6A 3O8XD 5I1EL 4HDIB 1C08B 3QHFH 4IRJC 4HIJA 1FNSH 3OZ9L 4Z8FH 2EECA 1R3JB 1TZIB 2P8MB 5HYJE 4DZBB 5C0CD 5CWSA 3HC0B 1MEXH 4G8EB 4XWOC 5F3HA 1JZ2A 4Z7QE 1HQRB 4XZUB 2UY7A 1ZT1B 3O6FA 1KCRH 4IIQB 4OCWL 4R2GD 2H2PC 2VDLL 2Z0BA 3LPGA 4BSVB 4GW4A 2R2HA 3WXVL 5D93B 2VR4A 5LXGH 3C2SA 4Z7WB 1T1WA 2AEQL 3QSKB 3VWJB 4FFVC 4F9LC 1DBJL 4KI5C 1RIVL 2YD7A 4MNGB 4EXKA 4DKFL 3D85A 1LP9F 4LLDA 1AQDA 3ZDXE 4DGIH 4ZXBA 4LVEA 2VLJB 1NCUA 4QHMA 2YUWA 4NUJA 4HMDA 3GB7B 5EC1A 3QI9B 4UT9H 2VDKH 1U95A 1OWWA 1R3LA 1XIWA 5FUZL 4JM2B 2AV1B 4Y4KA 4FXGB 6FABL 3OKEB 3BO8B 5IQ7H 3PL6C 3RX8A 2DWEA 3NCYS 5K9JH 3FFCB 1UZ8A 5DMKB 2OTUB 5JMOC 5B8CC 3AGVA 5FECA 4H25A 2MHAB 3BGMB 1A6VH 1Q9OA 2UWEE 2BMKB 3BP5A 4RRPG 5EBGA 1LE5A 2AK4E 2YK1H 1TPXC 1JGDA 5HD8D 5FB8B 5EU3B 3OPZH 4RWYH 3TV3L 4EUPG 3HNVH 3ZKXB 3CSGA 1MAMH 2A77L 4XWGH 1WCBB 1J1OL 5CP7B 3C6SA 1KIQB 3D2UB 1EH9A 4S1QL 4ERSL 1R3IH 5AZEL 1RUPH 3L95A 5IUSA 2CSPA 1WLHA 3MNWB 1XGYH 2YRZA 2OL3B 1VEOA 4P46C 3TBTB 1FVDB 2EC8A 5DJ2B 3PQYA 1SYSB 3EUUA 4U3XA 5EBLB 1DR9A 4R8WL 3VW3H 5FYLE 5BQ7A 2AV7A 1EEYB 2AXHA 5C0RL 1PBYA 4JHWL 5E6IA 5GISL 3RWJB 4KMQA 2EO9A 1I7UA 2J3SA 2E9IA 4JO4L 4WI6A 1J88A 3ARQA 1KC5H 1MI5D 4OCWH 1TENA 2F5AH 1FIGL 4X6EA 2FGZA 5C9KA 1YYMH 1MOEA 5TDNB 3QISA 2ZSWA 3GKZA 3NFNB 5DO2D 3DSFH 3WFHB 2C3HA 1S5IL 2JELH 1FNLA 4RDQF 2ZCKL 3ARDC 3LD8C 5J13C 5BVJB 3F58H 1I8MA 3SDXE 4YDVA 1V7ML 1DZBA 2R56L 3IDNA 3DUSB 1ZKAA 1GPOH 4ZG1A 1HKLL 4UV4L 5C0BE 1EAJA 1QLFA 2A1WH 5B38B 1L6XA 3L5HA 2ITCA 1DBAH 4LPTA 4P5MB 2ICEA 2R15A 3EOAA 5H8DA 3PV6A 3FB5A 3DLQR 2C3WA 1IQWL 3BEWA 2PR4L 2G75B 3BRFA 1S7TB 3ARDB 3HI6L 1FLTX 1JTTA 2EIBA 5TF1H 3NACL 4WFEE 4K8RC 4PRAB 5DR5H 5IBUB 1ACZA 1DUZA 3DHMA 3VXNA 1HIML 2ICEB 2BY2A 4YDIH 4ORGB 4TNWF 2PO6D 5J3HD 2R69H 3V4VL 3U1SL 3BRGC 3L5WB 2X4QB 3S37X 1NBVL 3CCHA 1M05A 2QQQA 4UBDD 2NY5C 3VI3F 2W9EL 1EXUA 3ARWA 4HK3J 4ODWB 5F89B 4EUPA 3MRIB 5INCB 3EJZC 2FB4L 2EYSA 2NXYC 2YOCA 3MR9B 1G9EA 4PJDF 1T21A 1B3JA 4Y2DA 4TOYL 3UTTA 4H8WC 3PP3H 1KG0B 4XP9H 3MFFA 3RHWK 4UT7H 3MV8A 1AE6H 2FIKB 4M3JA 4RGND 5E8OB 4NPYA 1YMHA 1EHNA 3DETD 5DRNB 2VH5H 2BNUB 2HYMA 2NY1B 4X5WB 3V6FA 4OGAD 5SWQB 3DARA 2HVKA 3BH8B 4BKLB 2QADC 1FH5L 4RFNB 3MLTA 1QUNA 5CSZA 2RCSL 3U79A 4ZUWB 3D9AH 1FVDA 2XZCH 3FCTB 3U2SA 1Q0YH 3HRZA 5JDSB 5D2LF 5I6XB 5B8CB 1T83A 1BFOB 3STBA 1ZLVH 4YXKH 3DIFA 1B0GB 1F4WH 3QULA 2PTTA 5E8DH 2UVFA 3UAJD 4TQEH 3M1BB 1AC0A 2Y5TB 1BGXL 2ORBL 1RUKH 3JV4B 2IALB 3N50A 2YPLD 4X7DC 1I8KA 1FYTE 1YMMB 2CO7B 1T2QL 3MRHB 2IBZY 4P46D 2VTFA 1SJEB 1T66C 3V0WL 2XV6B 3B8SA 4GAYB 3VFNA 3TH2T 3FT4A 2XFXA 4R9HA 3GSXA 4CDHA 1JI1A 2B0SL 3EDEA 1RZGB 2GJ6A 2D7QA 4EN3C 2QKIA 2QQNH 4H20H 3FO0H 5HYSA 3UTPE 1Z3GL 4UU9A 1BD2D 5I1LA 5EC1B 1NMCB 2FLRT 2HWZL 2IF7A 1T4KB 4KGLA 2X1WL 2LV4A 2NY4C 1B2WH 3OGCA 3R4DA 1OP3H 1MCPL 4JDVA 3SGEI 2HKFH 1T7XA 4Y19E 4IOSD 1HHJB 3W0WB 4HCRL 4Z77A 1R0AL 1AQKH 1DN2A 1FZOB 2PW2A 3L3JB 1BEYH 1HQRA 4XZUA 3VFRB 5KSVB 3DX8B 3DXAD 3FKUS 4C58B 3C5SA 4HIXH 4X4XA 5DK3A 2NX5A 1UJ3B 1PKOA 3T8XA 3MUY1 2YD3A 2VERN 2PYFA 1MLBA 5BOZG 5T33L 2FX8L 4FA8A 2VLME 4YJZL 5JA9A 4MVBC 1PX3A 2KQNA 2XRAL 1O5DT 5ILTH 2H2PD 3VXOB 2GCYB 3CX5K 5GGVL 4Y2DB 5EIIB 4QHNA 2F53E 4GS7C 1LO0L 4FTVA 3S34L 3O3DA 4K8RL 3RZWA 2A9MH 1QFOA 1SMOA 1DJSA 1JNNH 4JGJA 1WK0A 1KCVL 5EUKB 5DK2A 4Z95H 1S7WA 3LQZB 2BOBB 3ULUD 4JFQB 4YXHH 1GGBH 2HVJB 4CJ1A 5JOFA 4QF1B 4WEMB 1FE8H 3K0WA 4LQFH 4X7EC 5TFSH 5DFWH 3O9WC 2QSVA 4OT1L 3SDAB 2IQAB 1U3HA 4JRXA 5HHME 4TVPD 3P9MA 5C08B 3AU1B 4JFFD 4JM4H 4ZFOA 3ARFB 2VSCA 4D0CB 1A64A 1OD7A 3HG1D 2AEIT 4AEHL 1U2HA 5JO5B 3L1OL 1CGSH 3G9VA 2P8LA 3CFCH 3HC3L 4XBPA 5IK3A 4NOFA 1JTOA 1MJ8H 3TJHC 4U1NA 1BEYL 1PKQB 3PGFH 2X89D 5SWSB 3LSOB 3TVMB 3FT3A 5JW5A 1AO7A 3CAFA 1UADC 2W0FB 3DTXA 5DI8B 1YC7A 5T1KD 2NY7H 3UBXA 4Y1AA 3KPLB 4Q9RL 2OS7A 1DL7L 1N7MH 4UINL 1QFWH 1G7LA 1P9MA 4J6RH 3X11B 4OFVA 4X6EB 2YWZA 1ZLVK 4K3JL 1I7UB 5E70A 2CKNA 3VXTA 4MJIB 3HAEG 2X5PA 2F9BT 4HUUA 4MJ6B 2A2QT 3I6LD 3MNZA 4LK4A 4J3VA 5IROA 2PCPB 4N8PA 3FRUB 3HUJA 4QRPB 4GUPB 4LFHD 2H9GB 5DJ2A 4MDJA 3JWOC 1FZMB 3KXFE 5ACZA 4JPWL 3IAGC 4L3CB 3SE9H 3VXRE 4D0DA 2F53D 3F7RA 4BK4A 4JB9L 4CU7A 3O11A 3UYPA 3PV7A 4L29B 3X12A 5JHLH 4Y16B 1R5VB 1HOCB 5GGVY 4UAOB 3CVIH 3WFDL 2RCSH 3H9SE 1C7TA 5FECB 5KAQF 4UB0L 2OTUA 4QT5B 2CJUL 3P0VL 1CVRA 3QXAA 3VXQA 2AV1A 4Y4KB 4F2MA 3BGMA 4PY7A 1KPVA 3HNTL 4P4KA 5IQ7L 5HHPA 2AXFB 3IDIA 4NC1E 3DUHA 3HHRB 5I18L 5HGHB 2ZG1A 5E5MA 1PSKL 3I6LE 5FO9A 4U49A 1I4FB 2H26A 5DQJA 1S8DA 4O58H 4XC3H 3ZDZE 4LEOB 4NUJB 2X6MA 1WWAX 1G6RA 2BNQE 2EEBA 4LP5A 1WEJL 2HLAA 1HZHH 1S7RB 4JFDB 2XTJD 1GIGH 4WHYH 3H6JA 1R6VA 1NGPL 3VWJA 3GBLA 3STLA 2AS5M 2ESVD 4PJ9B 4NQDD 4JRYB 1N3NA 4XVJL 32C2A 2H32B 3SBWC 5T3XD 4HWUA 4XI5D 2V5SA 1DDHB 3SGEH 4EDWL 1JL8A 1DUYA 4RMUA 4XRCA 1UZ6E 3O2DL 5FM5M 5GJSH 4B41A 3QDGB 1JWSB 3GBML 3IFLL 5MP6L 1LDPL 5D7IE 4MAUH 5EZOH 2N7BA 4Z7VA 4TSCL 3ES6B 2XWTB 1SEQL 3ZKXC 2DD8H 3WJJA 2VXSH 2OXGA 5TGBB 1FCCA 1FVEA 1A9BA 4X6CF 5GZND 3BZEA 1A8JH 3F8UB 3GZKA 2VJXA 2V2WA 3ARVA 2FD6L 3MRQA 1FO0L 2NX5E 2VE6B 3WLBB 4PRID 3MZTA 5HY9A 4FQCL 3FB7A 1OT1A 2XKSA 5FHBL 3O3EB 1MJJB 5BMFL 4LGSB 1BZ9A 1I85C 4OD2B 3BW9A 5FCSH 2FSEB 3O45B 4U1SA 2VDQH 4DGYL 1MHEB 4KRLB 2NY2B 3TT3H 5DD1L 2D7MA 5CIPB 4HUXB 3PDDA 4ODBD 1H3PL 1T2XA 2UYLB 4ZPVA 1C5DB 4UQ2A 4N0UA 4GLRH 3REVA 4GRWH 4AEEA 4NQDA 3QDMB 1D6EB 4HUWB 4WV1B 1RUMH 2MSPA 4JREB 1YUHB 3EFDL 2D7PA 1JYNA 2OP4L 4HC1L 3LV3A 3BH9A 3N9GH 3IJHB 5F7EL 5LGHH 3MRQB 4RFOL 1T5XB 3MV01 4ZXBD 4PLKC 1B6UA 4MXWL 4GOSA 3MLZL 3HTLX 4Z7OE 3QIBC 2IH3B 4GXUM 4X98A 3EGSA 1J1OH 4LVOC 3TIEA 5T3ZD 3Q6GH 3ZTNH 3IS0X 1IZKA 4RFEA 2ZOLA 4NZTL 4F9LA 1SEQH 1A6AA 1QHPA 2A6DA 2RFXA 2VDKL 2Y7QB 4KI1A 1KV3A 3RL2A 3BIKA 4FNLH 4ONFL 5HHXL 4L8SC 2AW2A 5C0DA 5FUZH 1YEIL 4NUGH 4KDVA 3MRJA 4EZMA 2H45A 4OTXL 4UUJB 4YX2L 3D39E 4JFFB 3LKRB 5DMGD 1JGUL 4ZS7H 2IPTL 3HG1B 1OGAE 5FYJU 1F97A 4YGAB 3KPSB 1S7XB 4GRMA 3GSRA 1T5WB 2Z31D 4E41B 1OGTB 2Y1VA 4N8VG 1LGVA 1VFOA 4FP8H 1GXEA 1PQZA 2E27H 1QSEE 2Z8RA 3DSFL 4LNRA 2R2BA 3I02A 4LAQL 3R8BB 4ESKA 3O2WH 5EA0H 4KH2A 1ED3A 4QRSA 5GRXG 5SWSD 5DMIL 1HH9A 3S5LG 1JBJA 2DYPD 4R7DA 5FKPA 1JV5B 2FIRT 4QRTA 1FSKC 4XP4H 2WBWB 4E0RB 5C3LD 4WI2A 4NZDA 4LSRH 3FQUB 1G6RB 1XF2A 4HKZB 5B39A 3LN4B 4HKBA 1A7QL 1YYLL 5DD6B 4U1HB 1OW0C 5E08L 1VPOH 1JMXA 4L4TA 4R7NB 4ISVA 3T2OA 2HMID 3MUZ1 3K3QA 1IRAY 2X10A 1U2CA 4KKAD 4M9PA 2NY4B 4G8GE 4KAQL 4M5YL 4R3SA 1H15A 3LQAC 1V05A 5F7LB 2WWKO 1RPQA 3OV6A 5BRZB 3RKPA 4OSUL 1TIUA 1HKLH 1ETZA 1XCTA 2COQA 3VFTA 3DO7A 4YPGA 1NCDH 2GY7B 1JYWA 1NGYB 1X7QB 1NLBH 3OAYH 2APTA 4M43L 3UJIH 3ARFC 4PV9B 2Q6WA 3TP4A 3ZE0E 1JYXA 1T03L 2HFEA 1MWAA 3HE7C 3BT2H 3SDCC 3WLWD 4PREA 3LHPH 3L3IB 5T1MA 2Z31C 1ZEAH 3ARGB 1MI5A 1CT8B 2ZUXA 4LHJB 5IVXB 4JZNA 3S4SB 4P3CL 1MREH 5CJQL 4BH8B 2QHLA 5KVFH 4NFCA 2HG5A 5DR5L 1BP3B 3KPRB 3RL1A 4OGZA 3MXWH 3UBXB 1RZ7H 3DTXB 4LCUA 3VH8A 3E8UL 4RAVB 1WITA 1A5FH 3MACH 1AO7B 5TPWL 5DRZA 3VD9A 2W0LA 5DJCA 4OGYH 4JKLA 5BZWA 4PJIE 4DKFH 3LV3B 4OUUB 5IEKA 1IL1A 3WJJC 4K9EC 1OB1B 1OGAB 1UM6H 2HJFA 4NO2B 1D5IL 3NIDE 1TJGH 3E0GA 3GM0A 5IK3B 4YZFF 4YDKH 1BWMA 4PJ7B 2WIMA 4JM4L 4LSSL 1TJIH 2X7LA 2XOTA 3L7EA 4Y8AA 4AEHH 2PTUA 4NZUH 1QRNE 2C3VA 3L1OH 2BOBA 3U4AA 2FYYA 4Y5YC 5D7SL 5IWLC 1RZIA 3RNQA 3BQUB 1MAML 2KZ1B 3EYOB 3KPNB 4LRNH 1R3HB 3UJTH 3B43A 4U2ZA 4K3EL 4KVCL 1JP5A 1XF1A 3LKSA 4RQQB 4Q7DA 4HK3N 4QGTA 4JFFE 3VXUE 5ETUB 1CR9L 3ET9F 1NEUA 1F5WA 2E7BA 5IHLB 4QHUB 2O5YH 5IV2A 1OP5H 5KS9E 1MFBL 35C8L 3CLFH 5TH2A 3MV8D 1C12A 4F7PB 5KANG 1MLBB 3KDMB 1EMTH 1NC4D 4MZ2A 3CFJB 3HA0A 3TV3H 3PNWA 3RWCB 3QDJE 4B7IA 4RFNC 4MHHI 3S3JA 3SGDI 3DX7A 5GGQH 3V5KB 1JF5A 2BVTA 4QRRE 3EOBB 5GHWL 5B3NA 5GS0L 4OCLC 5HGDB 2QSTA 4PJHA 1CZ8H 4Z77B 1V7MH 4BZ2L 4YQXL 4P48A 1IT9L 2FJFA 1NLDH 5IJVA 3ZL4H 1UWEL 4UV4H 5D96B 1TJGL 4OF7A 3EYFB 2FEDD 3LKNB 2DJ4A 3U7AA 1T4KA 3D0LB 4NRYA 5B22A 1D9KA 1YEDA 3FFCE 1YJDH 1ITBB 3O8XC 2R0LH 3F6IA 3HS0B 1I4FA 2H26B 4WNQA 3VGBA 4I0PC 1S7UB 2X05A 3G6JB 2D2OA 4LPCA 1WZ1L 4WU7B 3MJ9L 2P44B 3JVGC 3SPVB 2H41A 1MCHA 1KSRA 1PZ5A 5SX5H 3S35X 2CRZA 3ABZA 1A02N 5EDXA 3DUUB 4U6YA 1TVHB 1FC1A 3MTRA 3UTZB 3QZWG 5KZCD 1DTUA 5IJKA 3H7BA 2BFVL 3DYOA 3WUWA 4MB5A 5DQDL 2OTWB 2NNAA 5I1JL 3QUMH 3HMWH 2ICES 3RTQD 2B8OT 4GG8B 2FO4A 4J2XA 2NPLX 3S88L 2OTPA 4MD0A 5FYLL 3QEQE 3CZFB 5AAMA 4QOKB 5JUEL 3F7YB 4I77H 3H0TB 5I8EA 4YFDB 1CD1B 2OXHA 4KQ3H 4ZFZB 2OX5A 5IBTL 3U7WL 1V7NL 4Q0XL 1SY6H 3H9SB 4J3OC 3V6FB 3HUJE 5FYKH 3EOYG 5TE4H 1CZ8L 3FOLA 4P2RB 3ULVC 1NLDL 1XZ0A 2KZWA 3PQYD 4TVPL 1CDIA 2I60L 3BP4B 3FL7A 2H2SD 2V7NA 5HSFA 4E42A 3X3FH 1FZKB 4NQUA 4WUUB 4F57L 5FA3B 4L4VE 4CDGC 5T3ZL 3EKCA 4XVUD 5J9PA 4G43B 3EIFA 2ID5A 4WU5A 5F72S 2P8PB 1U41A 4MD0B 5DVNA 5T1LB 4UTAH 3V7AE 1MRFH 2A6IB 3TNMA 3LSOA 3MRIA 4GRLB 4UT7L 3VXMD 2RAMA 1YN6A 4Z76B 4KZDH 2P5EE 3LQMA 3IAQA 2VWEC 4F37K 3VRLE 3LKQA 2G5BB 4F7MB 1FVCA 3MREA 1Y6NR 3F12A 4QXTA 4TSBH 3T0DA 2BSSA 1H15B 3ESUF 1UYWL 5GRJL 1ZE3C 2BNQB 3P4LA 4KK6D 3AUVA 1MFEL 4OZIA 4HUVA 4CN1A 1VGEL 2EDYA 3H3KA 3QUML 1OAKL 1S7TA 4NN7C 3PXHA 5JPNA 4AZ8A 1EBAA 1Z5LB 2FHFA 5EO9B 3LEVL 3V8CA 2BC4A 4OAWA 4HG4K 2HT4C 5DQ9B 5EUKA 3QCTH 3FTGA 3IU3B 1CU4H 5F21B 4HCRH 1VCAA 2CK2A 4MYWB 4BZ1L 1QSFD 4OF3A 5FKPB 4DKDC 5IEHA 4PJBF 1CL7L 5C08E 5ITBL 4HFWA 4N9GA 4CVXA 3OSKA 2Y36L 1MCRA 4M5ZH 4EOWL 5IMKA 4F7EB 3UJTL 5KVGH 5DYOB 2FGWL 2H32H 4E41A 3RWCA 5TDPB 2HWZH 3EYVB 3TPUA 2IG2L 5AYQA 4ZUVA 3O6KH 4R0LC 4LKXA 1DSFL 3RVVD 1KGCD 1N8ZA 4MXWH 3VGDA 3QG7H 1IGFH 1RJYB 1SVZA 1GAFH 4HV8A 4HH9A 4K55A 1ZT4A 4WCYH 3Q3GB 4WIQA 5I1GH 1CLOH 1C5BH 3BMVA 2ZOLB 5LGJA 3QFDA 4RMWA 3MRDA 5CP7A 4I2XE 4X98B 4I5BA 4FNLL 5HHVL 5C1MB 3RY4A 2L4OA 4H0GA 5IB2A 4DCQB 1YNKL 5SWZA 4G7VH 4GO6B 1QFHA 4NHCH 3G9AB 5D8JH 1WZKA 3GHBL 2YA1A 4YUEL 5FGBC 4H5SA 4IOIB 5I1AB 5CLWA 4LLWB 2J8HA 2NY6C 3GSUA 1KCKA 5E99L 4YGVB 4CUCA 4K9EH 2VAAB 4MNHB 4U1MA 3BYYA 2AQ3A 3NAAH 4U6YB 3FT4B 3QRFM 3L7EB 4XPTL 1U95B 3UTQB 5I73C 1UB5B 3P4MB 4NO0B 1R3LB 1XIWB 4G8IB 2DD8L 2X1XR 4N0UB 1BQUA 1I8LC 5L6YH 3LY6A 1JNHB 4PR5B 3MNVA 5TQ0H 2XA8H 2C1PA 1T3FB 1Z3GH 2P4AB 5DJCB 5I1AA 4QY8A 3P11L 1IC4H 2RQ8A 3TFKC 4ZFFA 4E5XA 5KJRL 3ESVF 1BQHG 2IAMC 3BZFB 1CDGA 5CJXC 1X5IA 3ARZA 3B9KD 4NQXA 4J6RL 4AENB 1GH7A 4G8EA 5CIPH 5F3HB 3U46A 3ME0A 4PJHB 2WZPD 4BSVA 1UKQA 3BT2L 1R3JA 1TZIA 4O51A 4HHAA 2HG5B 4GQ9H 4IRZL 5LGJB 5FM8A 4IDJL 4LF3B 2BNUA 5IBUG 1HHHA 2WMPA 1IVLA 1QQDB 4XVTH 4RIRB 5ADOL 1ZT4B 3B9EA 1EGJH 3VH8G 4C56E 3C2AH 1N8ZB 3GUTA 3Q2CA 1AXSA 3MFFB 3DYMA 2ITDB 2WIIB 3TO2A 5M95B 1MIEL 4CU8A 2JCCB 2PYEA 3VG0H 4PJ7F 2ADJA 4D8PA 3G04A 4S1SL 3VWKA 5MENE 3LKSB 4MXQC 5E7BA 2C1OA 3BOVA 2H32A 2OR9L 3VG9C 5DJ6A 2ATPA 5I1KL 4GKNB 3PGDA 5IFAH 5BCAA 4M6ML 3FJTA 5FYJE 5L8KB 2AK4B 4WFFE 1AQKL 1DQDL 1QVOB 4OLZH 4MB3A 3SJVB 1HWGB 4TPRL 4ETQB 3IDYB 2DQCL 3SGJA 5E2TL 5GRZA 3BRDA 4ONHA 5CP3H 4HXBH 5DD3H 4YHYC 2EZ0D 3D5OF 1MF2L 4OLVL 4PRBB 3S3PA 1DBJH 1AC6A 1I9JH 4TUJB 1FORH 2ZNWA 1XGUB 4OCXL 5HHOA 4YHPB 2Q8AL 2E6JA 5IVXF 4P4RB 1P4LB 1LD9B 1JHLL 5SWSE 4JPIB 4ZMAT 2C26A 1HWHB 4NQVA 4OCSH 1OSZA 4A2MA 1NANI 3MYZA 1U92A 4WFHD 1B9ZA 1LO0H 2BX5A 3OR6A 1MCFA 4MCZB 2ZUTA 4LAJH 4YDJA 4JQIH 3NFSL 1HOCA 9CGTA 5L2KB 2Q76B 3D39D 1EUUA 2H8PB 1S5HA 2NY0C 1LO2H 3U4BH 3HRPA 5AUMB 1LP9E 4JFYB 3X13A 1FHGA 1WWWX 4UBDC 2ZSWB 2YUXA 3MRDB 3CFEA 1XIWC 3BN9C 4PG9B 1CFVH 2ENSA 3MJ9A 1DL7H 2D3VA 2BNQD 1D6VH 4XVSH 5D2LE 1QLRB 3PE9A 1OAQH 5D7LA 4L3AA 2DLEA 1J0YA 3R06A 1CGXA 3CMOH 4QHKI 4KK5C 3JXAA 1TTFA 5DGQA 3P77B 4BFGA 4WHTB 5DJDB 3VRLF 3UP1A 1T04A 5MEQA 5GGTA 2EDWA 3ROLB 1X5HA 2Z31A 5KSBF 1NGYA 2V17H 3QR2A 4FQCH 4EDWH 5I8EB 1YYML 3QBTB 3RWEA 2X9YA 5HHOD 1ZVSA 1DN0B 3TGXA 1OCWH 2VYRE 4M9OA 4MS8D 3DMMD 1H3GA 1OSZB 4UDTB 3PWUB 3JTSA 3PIQB 4FQ2L 4OD1H 4Z0BH 2ZCLL 3KPQB 1ZLUH 2BC4B 5DURB 3IRZA 2VZUA 1WTGT 1HXYA 2AXJA 1U8LB 3F62A 2C4XA 2FBJH 3D48R 4I3SH 2BY0A 4J7RA 5KSBA 4NP4L 2QJDA 3Q6FB 4FZ8H 2X1OA 5FM4A 3SDYL 4R96B 2J5LC 5C09E 5AG8A 2EYRB 3FZUC 3P3YA 4F7TB 5JOPE 3F12B 2VLLB 3HR5A 4G42B 4PRPE 4J1UA 1XH3A 1YN7A 5J1AB 2XY2A 1DEEA 2CMRL 1JYVA 4HH8A 4PJCE 3MGAA 3OMZA 1RJCA 4WTWA 3ULSB 3LOWA 5BXFA 3O6FB 4Z76A 4FXKA 3LRGA 5E2WL 4XNXL 4NZTH 1I3GH 1Q0XL 4UB0H 4EIZC 1YQVL 4DZBA 5I30L 3DI3B 3QDMD 3QDJB 1X5ZA 3P11H 1NGXB 2DQJL 2X4RB 1K4CB 5EU4B 3KG5A 4OLYL 5M94B 3CXDL 2DS4A 1FG2A 4DAGL 3IAPA 1FZKA 5LBSL 2FDBP 2CLVA 2AJUL 4FQPA 3TM6A 4PS4L 3VI4F 5FYLH 5LWYL 2BCKB 4O5LH 5J57B 2I9TB 1UJ3A 5FGCB 2FWOB 1BQSA 3CXHK 4P9MH 2DLTA 3ZYJA 2IPKB 1OCWL 4KJYB 3FN0L 1X5AA 5GPRA 3OKLB 1HZHL 3UO1H 4UTBH 4AT6B 3VDBA 1PVHA 4EN3D 1F3DH 1S7RA 4FQ2H 4NGHL 2UWEB 4Q9QH 1GGCH 2WLZA 1BBJA 3A6CL 2DTSA 3MRLA 4KWUA 4KK6C 3NCYP 2O61B 3C5ZB 2FHBA 3CPLA 5FF6B 4LHUD 4KFZC 3CLEH 4NC0B 1MSPA 4N0UE 3VWKD 4G8IA 2FX9H 5GSRB 4WI9A 2BHUA 2NZ9C 3VXRB 2BRRH 1W72A 3IDXL 2H2SC 5I16B 2IPUG 3SCMC 2DWDA 2YBRB 2C3VB 2Q8BH 2JJSC 3IKKA 4P3DA 4P57A 1TPXB 2AP2A 4BJLA 4X7SH 2KQMA 5D1XC 3ORJA 2Z91A 1HN1A 4GKZB 3DURA 1NCBL 2X70A 1SJEA 2LU4A 3RI5F 3PDOA 4K94H 4XPFL 1UZ6F 3P4OB 3REWB 4LCIL 3TN0D 4YR6A 3SQOL 5GS0C 4LOUD 3FMGL 2HJFB 1CL7I 3QWQB 4QYOB 5DC0A 1FO0H 5E6IC 3QULB 5B4MC 4FMFA 4HC1H 4NCC1 1FIGH 5GRUH 5HYJD 3ARYA 5HI4C 2F5BH 5FA4A 1G9NC 1RFDH 3K80A 1BFOA 4JRWA 3DRQB 5HYQA 3KPMB 3MBEB 4GKSB 5B38G 5IB5A 1UVQB 2P5WA 4KKCC 5T5FH 4M61B 5ID0B 3TT3L 4RRPA 4OKVA 4Z7VB 2BNRD 2FWOA 5KW9L 3VXTB 3PWPD 4EN3A 1T1ZB 1QR1B 2XN9E 4XPBH 3TC9A 2E7MA 3LH2L 1NQBA 4ELME 1JGLL 3NA9L 4LCCA 5FGSA 1BF2A 3LPFA 1P7KB 3CFJA 3VE0A 3S36L 3WN5C 2JJWA 3QO1B 4OIIL 4G5ZL 2LU7A 3UTTB 4H26A 4KTDL 4L9LA 1FL6B 5FIEA 1RURH 4QHUA 3R0MA 3KYAA 5DO2C 4U1KA 1AHWA 3JWDL 5L88L 1KLUA 5EU5B 1YNTA 1J86A 5E99H 2O5ZL 4LEOA 2NW3A 5JO5A 3ETBF 4QO1A 5ICXA 2R2EB 3MUGA 3VMNA 2DLFH 4OAWB 3JTTA 2E7CA 1QHOA 1Z0MA 3NIGF 1P4BH 3U1SH 3BZ4B 1CFTA 1JMZA 5DMGC 1B90A 3GSOB 4LSRL 5T1KA 4L3EA 3HR6A 3IDIB 3LPWA 4OZIB 4HUVB 3DVGA 1J1PL 4P4KB 2ILLA 3QUKA 4ZTPL 4PY7B 3HNSL 3SQOH 1JF6A 2HFGL 3TO4C 4AY0A 2R39A 2Z8WC 3GSNB 2DQTH 2ZCLH 4D0BA 1BF8A 1AGCB 5C70A 1WBXB 1YPZB 1M71B 4NYLB 4AYFA 3GSWB 4POYA 1BFSA 1MEXL 4R4BB 3U36B 1I3UA 1C7SA 1F4YL 2M2DA 3TZVD 1RVFH 4L4JA 3MRRB 4G9DB 4AL8L 1NBQA 3G6JF 3QH3A 4QLRA 5EIIA 2DBJA 1D5BB 5JNYB 4PJBE 5EZIH 3MA9L 1VADB 3N0PB 2PCPA 3VCLB 1Q72H 3CZJA 3GHEH 5LGKA 1F3JA 1Q9LA 4FQJL 3HLAB 4LCYA 4OIAA 3ROLA 1UM4H 5D6DC 4M43H 4WHTA 5DJDA 4Q6IB 5DURD 4D9QE 5BS0E 3MLSL 4C83B 4JZJC 3A0OA 2ZUQC 1K6QH 4KVCH 3ULUH 4P23A 3ARGA 1QA9B 5FKAB 6FABH 1C16B 1RUKL 1RK0B 4XXDB 3FQNA 1HQ4A 1T1XB 2DDQH 3CU7A 3CZFA 3PL6B 1MHHA 1SJHA 3RVXD 4MVBD 4OKDA 4G6KH 4M1GH 3P4NA 2MKWA 1ZHBB 3CH1B 1I8IA 4W6YB 5K59F 3B3IA 1DBBL 3BPCB 4PJXF 3BJLA 5CS7A 3K74B 1MCBA 4JO2H 3T3MF 1TDQA 2A83A 4X4YB 1G7JA 4GAGH 2HTKD 3LMJH 3UO1L 4GRWB 2BSRA 5KVDL 2CR6A 4Y19B 1RZGA 2GJ6B 2Z91B 4WO4A 3V4UH 1RHFA 2X4PB 4BH7A 5J06A 5A3IC 2CH8A 4P57B 1P4IL 1D5IH 1U3HB 4JRXB 2N1KA 1NGWA 4C56D 1FIEA 1Y6MR 2W38A 3HPJA 4N5EC 2AABH 5F7DB 2LFGA 3TA3B 3TF7C 3VA6A 2MNUA 1JZ5A 5L7XH 4XBGB 4JFQA 5GZOD 2AEWA 1PD6A 5HYSG 4L4TB 2IALA 2J6EL 1AD0A 1QR4A 4O2EB 4OZGB 1D9KB 1IQWH 3MRLB 3VU2A 4RBPK 1MCWW 4V2BA 4AG4H 1Z2KA 1NCTA 4IRSC 3EBAA 3QIUA 5T3XE 1AR1C 3Q5YA 1FORL 3S7GA 5HYFA 3MMEB 2BK8A 4YHML 3L3GB 5F96L 3EHBD 1MRCL 3GIZH 2CLZA 3VXPB 5HI3C 3B2VL 4S10A 1XGQB 3GJFK 1YMMD 5LCVH 2DYPA 3O8XB 3O0RH 4M6NH 1CICB 5JQHC 4QGYA 4UV7H 1KXTB 3D69A 4NPYB 1OAUL 2VABA 3LRSB 3ULVL 1MPAH 1C12B 4C59B 2J1KA 3HN3A 4U6HB 3MRJB 5DDHA 1IKNA 1F11B 3QNZB 1ZOXA 3HCVB 4BFIB 2AJSL 1R5IB 1R5WA 2Z93A 2B1AH 3NCMA 5HYIA 1H8NA 5CD3A 3KYMA 5I71C 1SVCP 1MIEH 3NZHL 1EZVY 5JR1H 3FOMA 3BUYA 4BSWA 3L9RA 2GSGA