1YMHA

Anti-hcv fab 19d9d6 complexed with protein l (ppl) mutant a66w
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
220
structure length
220
Chain Sequence
b'DIVMSQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLAWYQQKPGQSPKVLIYWASTRESGVPDRFTGRGSGTDFTLTISSVQAEDQAVYYCKQAYIPPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab 16D9D6, light chain
publication title Comparison of the crystallization and crystal packing of two Fab single-site mutant protein L complexes.
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Immune system
total genus 42
structure length 220
sequence length 220
chains with identical sequence C
ec nomenclature
pdb deposition date 2005-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ymhA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ymhA01
5GRUL 5E56A 5CZVL 1ERNA 1CZ8L 4RISH 4ZPTA 4QHKI 4EI5D 5FDWA 4BFBD 1RFDH 1ZHBB 2O61B 1T04A 1BMGA 1GVIA 2YBRA 3PWJB 5F8RC 2Y36H 1K8IB 3V8OA 4JKPH 4JKKA 1CS6A 4HXAL 5E6IB 5HI4C 4X5LA 3EGSA 1KIUA 2ATPB 5E00B 3AVEA 2NY5C 1OTSD 3E1F1 1G7QB 4KK9D 3V4PH 4DKEH 3LMJL 3UBXG 4YHKL 3K1DA 5EBLA 4OZ4A 4U1GC 3U36A 1YY9D 2J6EA 3TH4T 3I6LD 2JB5H 2ICCA 5C07A 4DKFL 1Z9OA 1FG2B 1A22B 1DSFH 5TGBB 4PS4L 2N56A 2DB8A 3RY6A 2FL5B 4M5YH 1YNLL 4UT9H 4PRAA 4O2FA 3MV9B 1KJMA 3PABB 5DT1L 3RTQA 1A4KB 4CGTA 1MREH 2UVFA 4Z7OE 2DQIL 4GW4B 4P5TB 3T09A 3BPCA 1L7IL 1YPZE 2EC9U 4P9HH 5EC2B 3RPIB 5GS0D 3ALXA 1ETZA 4LLMB 1IQWL 2GAZB 2GSGA 3GK8L 4ODSL 5D71L 1I8LC 4EI5B 3ILPA 3QULB 3ARDD 5D9SA 1D9KC 1BOYA 4PJ8D 4Y4HD 3F7RA 2FIKB 5KVMC 5CSBA 1J5OH 1TQBC 3EHBD 1UYWL 4LPXA 2R2EB 4IRJA 4JN2A 3NGBB 5SX4I 4TVPH 3QI9D 5F9WB 2I60L 2ORBH 5DMJB 4FFVD 4LPUA 1BBDL 4JQVA 1FH5L 4FP8L 4F9PC 1ZHBA 4UAOC 3PWJA 1FAIL 1N2RA 4PJGE 3VXSE 1CFNB 5IBTL 5DHVB 1K8IA 4B7LA 4MAUL 2Q76B 35C8H 4LCWD 3MX0A 1REIA 2XRAL 4D9RE 4PG9B 1H3PH 1RUML 2M8XA 3C5JB 2ATPA 4NZUH 4QOKD 3ZYJA 4HDIB 3QPXL 4KJWD 4YHOL 2VDOH 5IROC 3LZFH 1G7QA 2E5EA 4NGHL 1N6QH 4OT1L 3S37X 3GO1H 3ULVC 2ARJB 2Z92B 1EJOL 1G0XA 1JPSL 4NPYB 1A14H 1WZ1L 4YFLF 4H25A 3ARZA 4JRYE 3T0VA 4NT6B 1OW0C 3E2HC 3KJ6H 4KPHL 4U1IB 2FL5A 3S8WA 1R5IB 4ZSOE 3VRJA 3BOVA 3MV9A 4PJ8B 3LN9A 4Y4HB 3PABA 4I2XB 5IWLC 4UILL 1A4KA 2DBLH 4HS3A 4C4KT 4GW4A 4P5TA 1U9KA 5E8DH 4CVZB 4WEUD 3QI9B 3U9PL 5CBEB 5EC2A 1BWMA 3RPIA 4LLMA 2OTUB 2GAZA 3MPCA 1FBIH 1J0IA 2MQ0A 3VA2C 1VERA 3D39D 3QULA 3O4LB 1NGYA 4F58H 3RQ3A 4QWWD 1JI1A 1ZAGA 5I1KL 5DJ8B 3QDME 2FIKA 4PD4K 4LCWB 1LO4L 2HJLB 3KPNB 4ZTOH 4QOKB 3LKPA 1G0DA 4ZUSA 5GGRB 3MRQB 4HUKB 3VFRB 5F1KC 2NZIA 1OAKL 4ODTH 5DHXB 3X11B 2EDDA 3IJYA 1EUTA 5I30L 4LP4A 1IGFH 1NMAL 1ZS8B 1QG3A 1I9EA 1S8DA 4GAJH 4PG9A 4CW1B 3C5JA 3L3DA 4X5XB 4HDIA 2JLLA 1QLEH 2OR9H 4XBPB 4KJQC 4HKBB 1OAYL 1MRCL 4R4ND 5KTEH 4CJ1A 2ARJA 2Z92A 2FBJL 3IAQA 3BAEL 1A9EB 4X8JA 3RL1B 2NNAB 3QEUB 4NPYA 5F9JB 1JYWA 3IJHB 4NT6A 5BMFL 3MV11 4KRNA 4D9QE 1TNMA 4DFHA 2AJXH 3D39B 4U1IA 2BP3A 1Q9KA 2APTA 2HT2D 3ARDA 3CX5K 1R5IA 1VGKA 2WANA 4FNLH 3UTPE 4PJ8A 4Y4HA 4I2XA 4HJ0C 4WEMB 4XC3H 1H5BC 3CFKB 4PJXB 4FTVD 3PWNA 4R4BB 1GSMA 4BA8A 3QI9A 1MCNA 2L7JA 3HUJF 4NKIH 5EG6C 4X7SL 5ID1B 4NCC1 5E08H 4OGZA 1P1ZB 5DMGC 2YD7A 4RIRA 4KTDH 4PV9A 3V6OC 4EVNA 3BI9X 1PD6A 1KV3A 4M43H 4C56A 4UB0L 4FFZH 5DJ8A 1HI6B 1ZOXA 4L9DA 2OK0L 3SGJC 4HUWB 4LCWA 2ZJSH 2Y72A 2ZOKB 5JW4M 2HJLA 3KPNA 4QOKA 3O2WL 3P30L 5BO1L 4I8DA 3KYKH 5JPMB 3VFRA 1RUQH 5HGHB 3X11A 4NZJA 3WIIL 3CFCH 4YNYB 3TIEB 1ZS8A 1WF5A 4UT7L 5C0RH 2HTKD 1V05A 2WP3T 3FT2B 3OGOE 4YFLI 2J8OA 2WUBL 2GEEA 3NA9L 3UROR 1CQYA 4R0LB 2JB6B 4HAGA 4HKBA 4HUMB 4OLZH 2VSDA 3ORJA 5CUSL 3UTSE 4P2OB 1A9EA 4X4MA 3RL1A 1JF6A 2NNAA 3QEUA 4FTVB 4X4YB 5F9JA 5MEQB 3FAXA 4JO1H 3B6SA 3IJHA 1HCVA 2J2ZA 4HW6A 4EBQH 1YEHH 3DUHA 4NM8L 1EIBA 4XWOD 4K94L 4HFWB 2WSKA 3O2DL 5IF0B 3IS1X 2BVPB 1ZT1A 2ARJQ 1P9MC 3T3PF 2C3XA 3QNYA 1FHGA 1Q9WA 4PJXA 1OTUD 4KK6C 3TV3H 3JZ7A 1J9CT 3MNZA 5KVDL 5A40E 5HHMD 4NNPH 2M1KA 1U3JA 2VAAA 1J87A 4NO0D 5KSVB 1T89C 4FABL 1LDSA 4JFQB 2C4FU 4N5ED 2VZSA 4HUWA 4RISL 4WWKA 5C7XH 1QBBA 4XNYH 5DD1H 2K7PA 1ZKAA 4M5ZH 5I73B 2PTUA 2AEQH 2Y36L 3UJTH 2F54D 5JPMA 4JKPL 2FNBA 3D1MC 5HGHA 5GS2D 2DWEB 2W9EL 4YNYA 1OCWH 3MRKA 3TIEA 1IC7L 1KYOK 5SV3A 4DKEL 5GRVK 5B3NA 5I6XB 5GGTH 1JF1B 3DHMA 1F8TL 1CIDA 5HYIA 5IT2H 3FT2A 4WI2A 4HIJA 1AH1A 5KVGH 5D2NB 1GAFH 5ALBH 4WFHD 2PETA 2JB6A 1KCSL 3RWCB 2MTPA 4JFEE 1DSFL 2Y7QB 3RGVC 5I15H 4L8DA 4M5YL 4FTVA 4X4YA 1X5KA 4Y2DD 4AQOA 2BMKB 4LSSL 4K2UL 5MEQA 4OD1L 3MRFA 4CVUA 1BFOA 5HHMB 4PJ9A 2DLFH 1FE8L 1Z5LA 4HFWA 2JCCE 4GUPB 1BVKB 5E2WL 4P9HL 4NO0B 3CSYA 5IF0A 1CL7H 4Y19D 5D4QA 1ZHKA 2BVPA 2A77L 5FYKE 3RVXD 1A02N 1YUHB 2VISB 1F6AB 2I07B 1MFAH 5JQHC 2VZOA 3NFNA 1JWUB 4P48A 2J8UE 1WTGT 1IC4L 2FO4A 4LSUL 2F54B 3LQAH 3HNSL 3RVTD 1KJ2B 5FEBA 2IMNA 1T2QH 1X4XA 4TVPL 2VB5A 3RZCC 5KSVA 1U2CA 4QRQB 4JFQA 5F97E 3C9NB 4LPWA 3ULUL 5DHYB 1HK6A 2E27L 1OGAD 2C1PA 3BGAA 4WY7L 4KTYA 4R90H 1IKFH 1VACA 1UB6B 4TUOB 5IVZB 4YUEL 1XR8B 1A6ZB 3OF6D 5JOPE 1M7XA 2VE6B 5DO2D 2GFBB 3UJJH 4RZCB 4F7EB 3QDGE 1MLBB 4MA7H 2DWEA 4JPVH 4Y2DB 3UTOA 3CFEA 1MY5A 5BCAA 3EJYC 3AMLA 2P8PB 4GG6F 1FN4B 4MMXC 4QLRA 1CXIA 1A14L 2XWJB 4ZFGL 5DGQA 2JJTC 2EDHA 4Y19B 3RWCA 1QOKA 3SGDI 3U1SH 4U4BA 4YC2B 2Y7QA 1XGQA 2F5AL 2BMKA 3G5XA 5IK3B 4Z0BH 4ETYA 3I3BA 4AEHH 1DQJB 3O41A 5FO7B 4MZ2A 4NO0A 4PJDF 4PJFE 1ADQH 3HZVB 3PL6C 2VISA 4XX1E 1OGAB 1CICD 2X4OA 2I07A 1BHGA 1MF2L 4F58L 1T03L 4Q9BA 5D1XC 1T7YA 2ZUSA 4HC1H 5HHXH 4E5XB 5MERB 1KJ2A 4ZTOL 5CAYB 5CSZA 4GAFB 1XEDA 4YDLB 5JW4R 5IW3A 4QRQA 3CJJA 4PJCE 3UO1H 1EFQA 2ID5A 3C9NA 3ROLB 4J4PD 2NR6C 1TFHA 2CIKA 2OZ4L 5C0CE 2VXQL 3SCMC 1LE5A 3U4AA 1UB6A 1ZGLA 1XR8A 1A6ZA 2VE6A 5GGQL 4PREB 1FNLA 1QBMH 2GFBA 5T3ZL 3BP5B 3QEGL 4RZCA 4F7EA 3QNZB 5EULV 2OR9L 3S4SA 1Z0MA 3DO3A 1YMMD 4L4TE 2P8PA 2R39A 1FN4A 3TBVB 3BD5A 1NBYB 2R1WB 2XWJA 1OD9A 4ZMAT 2LU3A 4Y19A 3SJVE 1GGBH 5E2TH 1CICB 3R1GH 4FNLL 4RMTA 1ZANH 3QB7C 3V9FA 4J23A 5DC9B 2L4OA 3QWOB 5SX5K 4YHNB 3VFUB 4XC3L 4HLZG 5LWYH 1F11B 1DQJA 3EOTH 4CAGA 3UDWC 4WVRA 1VFBB 5FO7A 5FK9A 1D6EB 3TBWB 1KF9B 3KVQA 3FN3A 3HZVA 3BUTA 4KTDL 2A74B 4ONFH 4PRHE 1TIUA 3TZVA 4EOWH 4BFEA 4LVOB 3L1OL 4M43L 1N5YL 4FFZL 3CGTA 3OF6A 4NHCH 4KQ4L 2ILLA 5D5MA 5MERA 3O3BB 2FH6A 1F4XL 3KYKL 5C92A 5EU4B 1YMMB 3S3JA 4N0CC 1RUQL 1F2XK 5HPMA 4KZEL 1DLFH 3CFCL 1DN2A 2QQNH 1HQ4B 5I1GH 5GQBA 3DVGA 2OMNA 1AC6A 1U91B 3RWGA 4PREA 5C0RL 4Z7VB 2F5BL 3UAJC 4OD2A 1E0OB 3BP4B 2MCG1 4S10A 4BH8B 3VXSD 1R0AH 2APXA 3RI5F 1KCRH 2R23A 2X40A 1XAUA 3R4DA 4D9RD 4G6FD 3TBVA 4ZS6D 1NBYA 1D5IL 2DMBA 2R1WA 5IG7B 1LO3H 4JO1L 4FXKA 2ATKB 2EYSB 1YEHL 5TPWH 5TQ2H 4M7ZC 1L7TH 1P6AB 2CRYA 1CICA 4Y5VC 4YHML 1ACZA 4P4RB 5GJSH 3TA3D 4MVBC 5TF1H 2CO7B 1FVDB 4YHNA 4NQSB 2JE8A 3VFUA 3EOYG 1F11A 3S36H 1CLYL 1XIWC 3GJFB 1D6EA 4NNPL 2VXVL 3TBWA 3AGVA 4RMUA 2XQYK 2D31B 2Z35B 1I75A 4J4PA 2A74A 1KNOB 2GIYA 2QR0A 4JPIA 1OARL 5C7XL 2X4PB 4XNYL 3O3BA 1E4XL 2EIBA 3LKRA 1ORSB 4X9FA 1P2CB 5A3IC 2AEQL 3VXSB 4I77H 2FZ3B 3QDMD 3UJTL 3MTRA 1DQMH 4JREC 1T1WA 4G6FB 2DJUA 1YEKH 1OCWL 1HQ4A 2VO5A 3K4ZA 1INQB 1U91A 2BRQA 1FFNB 4R9HA 3LIZH 4Z7VA 5GGTL 3LHPL 2R0ZL 1TNNA 5IT2L 3RRQA 2BY1A 3BP4A 4BH8A 2NXYC 4IS6B 3QAZB 3VXME 1R5WB 2FR4B 4HEME 1DVFA 1ADQA 1T1ZA 4ZXBD 4ESKA 1UH4A 2VZ3A 4WRLA 4ZSOB 5IG7A 1S5HA 5SX5H 2BFVH 4MJ4A 1KC5H 4J3TA 2DLFL 3QEQE 3QUYC 2EYSA 3EDJA 4TOYH 2V2XB 1QSFE 1ZEAH 5DMIH 3VXPB 3HZYB 4P4RA 1HYRC 4NBXB 1CL7L 1HKFA 3UBXI 5IBUB 3VI3E 1DQQB 4UOJA 3Q6FB 4D9QD 4NQSA 1TJIL 5L2JB 1I9RH 3M8OL 5E99L 5EFIB 3GJFA 4X6BB 4OCYH 2WM0A 1BEYL 2Z35A 2VSCA 4EQ2A 3IU3B 2CK0H 3ULSA 1KNOA 5IJKA 3HAEB 2I9TA 2VLME 3CSBA 3V6OE 3CAFA 2X4PA 1NCNA 3LN4B 3NCJH 1ORSA 1P2CA 1RIHH 4R90L 3GIVB 1IKFL 1HQRB 5LGHH 4PJGA 3VXSA 3FMGL 2FZ3A 3IB4A 4NRXB 5AEAA 2YC1A 2QTEA 4ZXBB 4MA7L 5FYJU 3T0AA 2D7OA 4JPVL 3O0RL 3EYOB 4OZIB 4MXWH 1CFVH 3CFDB 4GG8B 2VWEC 4RWHA 2EZ0D 1PSKH 1JTPA 5E4EC 4U1HA 3TJEH 3BN3B 3CDFA 2XA8H 3F62A 5T1LD 3TA3A 1KIQB 1BFVH 1AR2A 1R5WA 1G7LB 4R97B 4WW2C 5CKAA 3N1QC 5FGSA 2EDYA 2EXYD 3MLPA 4ZSOA 2J7LA 5BZDB 4Z0BL 2V2XA 4TUJB 3UTSD 2H6PB 4AEHL 4QRPE 2RR3A 3VXPA 3HZYA 2OMBA 4MD0A 3WNKA 5ESQB 2NW2A 4CN4A 1AD0B 3QIUB 2NYYC 4OZGF 5DVMA 1DQQA 2E8ZA 3Q6FA 1S78C 3V6ZB 1T5WB 3P73B 2VQUA 5L2JA 1FCGA 1C08A 2GHWB 4POYA 1ZXQA 4U7KA 1MI5E 5SWQB 1MLCA 2CO6B 3JWDH 3EJZC 4X6BA 3QDMA 3MRHB 5DJAB 4HC1L 4PJ5E 1Z2KA 2X1WL 5HHXL 3IU3A 1GGYA 5EIIB 3V5DB 2H2SD 1MCIA 2OBGA 4KUCF 3HAEA 5FYKH 3JWOH 5IVNA 2AJSL 3LN4A 3PXJA 2VDLL 1I9IL 1I1YA 5GRVL 2Q7NA 4AIZB 1HQRA 4X4ZA 3IAPA 4NRXA 5T1LB 5IGXL 4JGMA 1CGUA 1QBML 3QXDA 3WFHB 5I16B 4Z9KB 1FDLH 2KH2B 4YXHH 4ZXBA 4GH7B 3IS0X 1JHTB 2AV1A 3KPSD 4UUJB 3MUJA 4EUPG 3AS3A 3S9DB 2F8XC 4LSQH 1MFBL 3CFDA 4GG8A 1EPFA 3WFBL 1A6VH 5HXMA 3UTSB 1I85A 5CGMA 1F2QA 3EFDH 2BSSB 2FYYB 1KIQA 1TCRB 2PTVA 1BLNB 1WIPA 1G7LA 4DEPB 1GGBL 5E2TL 3X17A 3DVNB 2R9HD 3R1GL 2B4CC 4W81A 1H3VA 3DGGA 4BQ8A 4C54A 3VD9A 3QXUA 4U2ZA 4JFED 4NN7C 4JR9H 2FD6L 3EOTL 2JJSC 4HV8B 3G6JF 5JXED 4EI6B 3DGCR 1BQHG 3LEVH 1AD0A 5DRXB 5I8OL 5MHSE 1FZKB 2H32H 2IWGA 2J12B 3MLRL 3V6ZA 2PW2B 3MO1A 4ONFL 5E2JA 3LS4H 1KJ3L 3T2OA 5SWQA 2W0FA 4NC1C 5I9QC 4YBLC 2I25N 5FYKD 1JGDB 3QSKB 3V5DA 2DM7A 5EIIA 2F53D 2SEBB 4ZOEA 4JY5H 2UYLA 4KK5D 1WWBX 4LHUD 3KPSB 5E8EB 5HDQL 4JB9H 4XH2B 1TVBB 2VDNL 3BPLC 3QRFM 1ZV5A 4FZEL 2EKSB 4MMZC 1KFAH 2QQNL 2X4QA 4AIZA 4JDTH 4P9ML 2IBZX 5CZXC 5I1GL 5J4MA 5I8KH 1F3JB 3IRZA 3FHQA 5T1LA 4AEIL 2KL6A 1XGYH 3KJ4B 4I13B 4RFNB 1OSZB 3WFHA 5I16A 1NEUA 1RURH 3DJ9A 1F02I 2V7HA 1GIGH 5DFTA 5DGRA 1JHTA 3PQYB 4UUJA 4J3WA 1KCRL 4LVHC 2IH3B 1RZJC 1W8OA 2IADB 3QH3A 4XVSL 4JFEB 4N8VG 3UTSA 5JA8B 3QDGD 3RAJH 4P3DB 2BSSA 4XBGA 2EDLA 2FYYA 4DW2H 2FHFA 3MUGB 1TCRA 1ZA6B 2WLZA 4J3SA 1BLNA 4QCIB 1N5AB 1QFHA 3V52L 5TQ2L 4Q9RH 3DVNA 2JCCB 1MIEH 5GJSL 3RX8A 4YZFF 2NY5H 4UOW1 1UA6L 2F53B 3WDIA 4HV8A 3ARED 4LSPH 4WWID 3I2CL 5DRXA 4N0YH 4AEEA 4LCIL 1JZ8A 1AY1L 4TQEH 3S6CA 3UZEA 3EO1B 12E8H 3MSPA 4I3SH 5DMKB 2SEBA 4MSWB 1CD9B 1G7HB 3OB8A 3KPSA 3E6FB 3HCVB 1LWRA 5E8EA 4I77L 3KS0H 1MCOL 1A7RH 4XH2A 1TVBA 3OJDA 4F37K 2EKSA 5DQ9B 1YEKL 3T2NL 3HMXH 4L3CA 4PRPE 5F3HA 3HE7D 1F3JA 1KPUB 1K2DA 3PNWB 3LIZL 4OD3H 4LSVH 3O4OC 2X70B 5C0CD 3A6CL 1TETH 4F15C 1I3GL 2IH3A 1VENA 2IADA 3RX7A 4JFEA 4HIXH 1V3JA 3F12B 3ULUF 3KPMB 4P3DA 4WU5B 1ZTXL 3AREB 3HB3D 3B9KD 5JXEA 5JR1L 5LBSH 4LHJB 1E27B 2A6JB 4OB5H 5F7DB 3MUGA 1ZA6A 1F6LL 4L4TD 1N5AA 4TOYL 5GZOC 1KTLB 1G6RB 5F7HA 2JCCA 4EDWH 2C1OA 4CU7A 3ARGD 4M8QA 4PJFB 4TSBH 4PGEB 1Q0YH 4JPKH 4LPVA 2IF7A 1X5FA 4OGYH 4KKCD 2WWMC 3LD8B 1K3ZA 2F53A 1I9RL 3ULVH 3NCYP 2J8UA 4LHUA 1SYVB 3H9SE 4KV5E 3K7UA 4X6DE 2A6KB 4IHOB 2Y07L 3EO1A 1RU9H 3HE7B 4U6HA 3CC5B 3PUCA 3PHSA 4P46B 4WTZG 3LKNA 1GCFA 4W70A 4MSWA 1G7HA 3HE6C 1KN2L 4TSCH 3VWKC 4IOSD 5C0CB 3HCVA 4O2CA 3VWJD 2XICA 1UWEH 3GMRB 5LCVH 4PV8B 1JGUH 3QDGA 2XQBH 5INCA 3B9KB 1FO0L 1KPUA 1PW3A 3PNWA 1CFVL 4L4TB 2OI9C 2AJYL 4AG4H 1A3LH 2AJZB 2WBKA 4OCRH 3I85A 2VYRE 4MJ2A 4ZQKB 1BFVL 3ARGB 1KJVB 3PGFL 4RX4D 4Y4KC 4XP1L 4C4KO 5F7UA 3GSWB 4WU5A 3AREA 5DQJB 4DQOL 2YMXL 1DQDH 2A6JA 1JNLL 5F7DA 1ZLWK 5I1AB 1UCBH 2HTLC 4YHYC 1OAXH 1G6RA 1G84A 3TVMC 2KPNA 2CUIA 4K8RD 2A6IA 4PJFA 4PGEA 3IDGB 2W92A 3WLBA 2D2OA 2MSPA 2B1AH 3O2VH 1ZLVK 3VFVB 1WCBB 1B6DA 2JJWA 3B2VL 2AABH 3FO1B 1RZKC 1SYVA 3JWDL 5ECJE 3VWJB 4FQLH 5L7XL 1OM3L 1MHPH 1X5HA 1E28B 4IHOA 3HPJB 4OGXL 1RUPH 4LL9A 5F7YC 5DI8B 2P45B 3HE7A 4HUUB 4M1DH 4PJCA 4L3ED 4ELME 4Q9CA 5JIIA 5C0CA 1G1CA 1QKZH 1A47A 5DJXB 3HNTH 5B39G 5F9DC 1U36A 1FDLL 4LEXH 1FRGL 4KKNA 1RV6X 3B9KA 1PEWA 4YR6B 4MYWB 5DZNA 5FGRA 4L4TA 1S7RB 2EDOA 2AJZA 5EZIH 4ZQKA 5I18L 3E8UL 5FV1L 5FYJE 3ARGA 2HYMA 3GI8H 4O51B 3NIDE 3ES6B 1AXTH 2HFGH 4FQXC 3T65B 3GSWA 3VFMB 4KC3B 4B7IA 5DQJA 1WJ3A 5I1AA 2F15A 5FV2A 1INEH 3ET9F 3A6BL 2IPTH 2O5YH 3LV3B 3NCCB 2P43B 3T8XA 4DVRL 2GCYB 3QHZH 3LEVL 2OXGA 3QEQD 5GJTL 3IDGA 1MCEA 4L3EB 5CHNB 3BH9B 3VG9C 1IBGH 1WCBA 3OKLB 3T1FB 1T0NA 5E9DD 5K33A 3VWJA 1XZ0A 1I8LA 4UQ2B 4LNVA 4RMSA 4Y1AE 3KPOB 1D9KA 3HPJA 4JY5L 3M45A 5DI8A 3TF7C 4JB9L 4GKNA 4PBWD 2AQ3A 43CAB 4FQCH 1I1FB 2WP3O 4MB5A 4G6ML 3FO9B 5I8KL 5DJXA 4ALAL 4MX7B 1X4ZA 4LCCC 1XGYL 2VLMD 3G5VB 5DMGD 4F9PA 4RX4A 4MQSB 1RURL 5E7BA 3TYFB 1IC5H 2KBGA 3WS6C 3ARBC 1KPVA 2VXSH 4JHAL 4YHLH 3SHSA 1A6AB 2X1OA 4PRNB 2DOCA 1S7RA 3DROA 4PJEB 1ZLWH 3N1FC 4P23C 4DW2L 3C08H 5DVNA 4O51A 2DJ4A 3ES6A 1WSST 3QEQB 5GGRY 4ZFOL 3T65A 4GRWB 4Q9RL 3WFCH 3FHAA 3VFMA 1QLFB 4NQVB 2VDQH 1OQOA 5E9DB 1OW0A 4N90E 3VRIB 1ZLVH 4HHAB 3ZKND 1B88A 3S88L 5JW5B 2QADC 1TPXC 4Q74A 1JRHH 5SWSE 2A1WL 3CMGA 3ETBF 5IWLA 4MDIB 4N0YL 5IQ9A 1FPTH 4TQEL 5FIEA 4L3EA 1HH6B 5CHNA 3BH9A 1C5DA 3U0PB 3GMPB 3OKLA 2VL5B 4HSQA 2OYPA 1IAMA 3G5YB 1JV5A 3FO2B 5CEXA 4UQ2A 4G6AC 2Z93B 1I7UB 2Q8BH 4N8PA 4U1MB 5ALCL 3R06A 4Y5YB 2BOBB 5DS8B 3K8KA 5EZLB 5L0QB 2YA1A 1NAMB 4PJ5D 3TWCL 1DLHA 1PDKA 4TNVF 1I1FA 2OJZH 4N5UA 3RHWK 3VDCA 3FO9A 5EU3B 4MX7A 1YN7A 4Y16D 3G5VA 5FKPB 4LSVL 4QHNB 1FZOB 4LOUC 4BSVB 3TYFA 2CKBH 5IVXE 2FGWH 3MLXH 3P77A 4Z76B 3QA3B 1TETL 4UDUA 3WFDL 1OT2A 3V95A 5BW7A 3DX6B 3VXMA 1T22B 4HIXL 1A64A 1U8JB 4PJEA 4S1QL 4YDIH 4OB5L 2ZSVB 4OI9A 1UM5H 1BQSA 3QEQA 4HIEB 3DYPA 5EU7C 3BVNB 4QT5B 3M1BB 3BP6B 4B41A 4F33B 1QLFA 4XVTL 4EDWL 3Q3GB 3GBNH 2DIAA 5LJYH 4ONGH 4TSBL 1CCZA 2CLRB 2IBBA 5D1ZC 4C59B 3VRIA 2Z8SA 4HHAA 4JPKL 4RAVB 5CJOH 5BXFB 4OGYL 5JW5A 4UU9B 3ULVL 4Z77B 2HFFB 3WJLA 1OP9A 4MDIA 4PJ5B 1H5BA 2Z8VC 2NY2C 5EC1A 3U0PA 4A6YB 2VL5A 5MHSD 3G5YA 2PXYC 3FO2A 1KOAA 4Y16B 1N7MH 1WBZB 3V6OA 1I7UA 4I4WB 2FECL 4U1MA 1YEFH 3W9DB 3O8XC 2BOBA 1ZK9A 5DS8A 3SGJA 1NAMA 1VB9A 4N0UB 5HYEA 5IW1A 1JGUL 4X80H 5EU3A 4PJBF 4XP5H 3FO0H 5FKPA 3MNVA 4QHNA 4NUGH 4BSVA 4NN6C 32C2B 4YHZL 1VEOA 2WLYA 3QA3A 3SQOL 4FQ2H 3OBAA 1E4XI 4FG6C 3GSUB 1KEML 3C09B 3HLAB 4KI1A 3DX6A 4DGIH 4LSTH 1PG7H 4YEEA 1T22A 1A5FH 3KLHC 2R4RL 1VKXB 1DQDL 5DTFB 2ZSVA 5ILTL 2EDQA 5F1NB 5DR5H 4HIEA 2PN5A 3NABL 2EDRA 1OAXL 3BVNA 5DDHA 1CR9H 2DMCA 1QZ1A 3BP6A 4F33A 4X6CB 5GS0L 3ZKXC 3Q3GA 2CLRA 1QYGH 2YD9A 1KELL 4RAVA 2Q8AL 1CLOH 5BXFA 1T4KB 3LN5A 2DWDB 3O2VL 4UU9A 3SKJL 1OAUH 5DVOA 4Z77A 2HFFA 1MI5A 2AABL 5D1QB 3HR6A 5GIRB 1P9MA 4PJ5A 5CGYC 5E1HB 3CVHB 2UZYB 1RUPL 2JKXA 3ARSA 4A6YA 3RA7H 3D6GA 2X6MA 4LLYB 4N0FB 2M2DA 4ODUB 4DTGH 3WUZA 3CFIC 4M1DL 4BFIB 4Y16A 2NQCA 2ICES 2MWCA 2Z31D 2D0FA 4J3XA 1Q94B 3NIFE 1P84J 4H1LH 3SBWA 1T89A 3HNTL 3PL6D 1SEQH 1MRFL 4WO4C 3TESA 2C3VB 4ODBD 4LEXL 2DQTH 4WI6A 4MNGB 2J4WL 4RSVA 1K85A 5GHWH 2QEJA 3JXAA 5SV4A 5EZIL 4PRPD 4LDOB 5J8OA 3GSUA 3V4VH 2HFGL 2YS4A 3D0VB 3EYUH 1DBMH 3N9GH 5L6YL 1R3LA 2VABB 1KB5B 5ESVB 5IBLC 5ACMA 1B2WH 1VKXA 5DTFA 5JMOC 3ARQA 1INEL 3K1KC 2O5YL 4M1CC 3MREB 3QHZL 3IKCB 4PJHB 3V5KB 1EMTL 1QPXA 5EUOF 5K9OB 1AR1C 2Z31B 1T4KA 1T3FB 1IBGL 2ICWJ 5HHOE 4U31A 4PR5B 5IESL 2YRZA 5F7WC 5GIRA 4XB8A 3U30B 3CVHA 3GM0A 5D2LB 3BKJL 5C0IA 4ODVH 4H26B 3MBXL 3SDAD 4ODUA 4S1SL 3H9SD 1A7PH 3K4AA 3MRDA 4BFIA 4U2YA 5FOBB 4FQCL 4CU8A 1Q94A 3RZCA 4B0MM 3BZFB 4PRPB 4U6YB 5GRJH 1R5VA 4Q97A 1UZ6F 2C3VA 2YHGA 5ICYB 4LVNC 4IRZH 5HI3D 2H2PD 1Y6KR 4YHLL 4OFPA 5AWNH 1NCAL 3QDJE 1SM3H 3I02B 1JNNH 4XC1H 5IB2B 2BY3A 3S96B 3MRNB 1D5ZB 3C08L 4KUZL 4OM0L 5EZOH 2DN7A 3WFCL 2J88H 3IDYC 2VABA 1Q0XL 1KB5A 5ESVA 4BH7B 4HQQH 1W8NA 4KDVA 2ZSWB 2AJ3B 4L4VD 5EZJA 5B38A 3KPQB 1UG9A 3CUPB 5FYJH 2R15A 1L6XA 4LVEA 3IKCA 4PJHA 3V5KA 5JMRA 1I3RA 5DD0H 3SDAB 4BYHA 3H9SB 3OGCB 3TIDB 2HJKA 5K9OA 3DXAD 2Z31A 4OFYA 2MJWA 2NY0C 3RKPA 3BFOA 2ZUUA 5D7KD 3C2AL 3TO4C 1B0RB 3TNMB 3PL6A 1LK2B 2VOTA 1NC4A 1BP3B 5KAQF 2VZ1A 4MVBD 3B9DA 1N64H 2DQDH 4H26A 4PGCA 1MCWW 3D69B 3FQNA 3VXUE 1PZUB 4AM0B 3W81A 4NC2B 2ZCKH 5FOBA 1YA5A 1MWAB 2OJZL 3TPUB 4EN3C 1XIWD 3SQBA 1URLA 4PRPA 4U6YA 4YPGA 4JZOB 5KBNC 3WL9B 1P4LB 1KIRA 2YZ8A 3NN8B 3IDMB 1I9JL 1W0WB 4ENED 2CKBL 4OF7A 4JQIH 2FGWL 3MLXL 4RGOL 4M8VA 4XCFL 1RZIB 2DICA 2NXZB 4JM2C 3HI1B 4L4VB 2Y4SA 4YDIL 2ZUWA 5EUKB 3U2SA 1J0HA 5IB2A 1N0LA 1D5ZA 3MRNA 1A1NB 1UM5L 1CFSB 5AG8A 2Y6SC 2FATH 4J7RA 2GQHA 3DXAB 3EO9L 4LSDA 3VXRE 4M6MH 3O6FC 3GBNL 5E8OB 4W6YB 5CIPB 2ZSWA 2AJ3A 1JCKA 3L3GB 5C08E 3DVIA 5L9DH 3VU2A 2V2WA 4X8XA 4MNHB 3LS5H 4WHYH 3SDAA 3H9SA 5TH2A 3OGCA 1ZMYA 2KZWA 4BQCA 1U8IB 5B21A 3UDWA 3G6DH 5HGBB 5HI5C 4KXZH 1XIWB 3BQUC 1B0RA 1UWGH 3TNMA 1N7ML 3EW3B 4JKLA 1IM3B 3SDDD 1YEFL 1X5LA 2VITB 3QQ9C 2ZCLL 3QO1B 4XMKH 4P5MB 1RK0B 3D69A 3TC9A 3GDBA 4AM0A 5IV2A 2BSRB 4KFZC 3TBTA 3CCHB 1MHHB 1VEPA 2IAMC 3ILQD 4JGUA 3TPUA 3NH7L 4KVCL 4X80L 3F7YA 4GMTL 5D7IF 4JZOA 1P4LA 2B1HH 2HT3D 4F3FA 2B0SH 1A6UH 2OP4L 4NUGL 3QUXC 4R2GD 4OZFB 1RZIA 4G8GE 3HI1A 1WFOA 4JG0H 1LVEA 1NGPL 4L4VA 4QXWA 1SY6L 5KSBB 1NBVH 3SE9H 5EUKA 5CP3A 1A1NA 1CFSA 4I3GA 1UGNA 3SDXF 3FTGB 5MENE 3DXAA 5C6WH 1TDQA 3DETD 5GGSB 3NPSC 1KTKE 4OTXL 5DWUH 5CIPA 1HHHB 4JFXB 3BIKB 3BGFB 4G8EB 3FB7A 3Q1SH 4I48B 5DQDH 3GSQB 4I5BB 2GK2A 5DLMH 5MEPB 4Y5VA 3MRPB 1XH3B 3SDDB 1OAUL 2H8PB 1JE6A 3BPOB 4U1LB 4IBLT 4MNHA 3W5MA 3EFFB 5A2JH 4N90D 2O5XL 5D6DC 2OR7A 1BD2E 1HXYA 3O9WC 3NBNA 5HGBA 5HHVL 5BV7L 1XIWA 4M00A 1PZ5B 2F8VA 2LTQC 1OSPH 5EPMB 5I1DA 4IDLA 3BJLA 1J1XH 2B4CH 5JIKA 5EO9A 4ZAKD 3RKDC 3H7BB 1IM3A 1HSBB 4ELMA 4UBDC 5EOCH 3EYVA 2D7QA 2VITA 4BJLA 4R2GB 5HDBF 3QO1A 4HK0A 3HZKB 1RK0A 4N0RA 5J6HB 4OQTH 1SEQL 4O02H 4KK8C 3CCHA 3C8KB 3REWB 1YQVH 4HPYL 4D3CH 1WFNA 5ADPL 4OF8A 1YQ2A 1XGPA 3QIWD 3WD5L 2W07A 4OZFA 5HYQB 4R4FH 3S4SG 4M02A 2ZWLT 1PEZA 1YEEL 4JPWL 1CDYA 1EVUA 1OHQA 3EYUL 5IQ7L 4Z95L 1IM9D 1JZ6A 3FFCE 4NZRL 5D93B 3IAGC 3L3OB 3ESUF 3UMTA 1CLZH 3QWRD 3VGAB 4LASH 3VXOB 3FTGA 3WYRA 5GGSA 3HMWH 3OJMB 1LO2L 2IGFH 4HG4K 3BIKA 3FN9A 4I48A 1F97A 5EU7E 5HHPB 4I5BA 1QEWB 4XNXL 4ZAKB 1AGFB 3MRPA 1RZJH 1XH3A 4WHDA 3GRWH 3SDDA 1IAIM 2H8PA 3AY4C 4KRPD 1F42A 1QBLH 5ERWB 1UJ3B 1H8OA 2H41A 3EFFA 1ROWA 4MWFB 4RWYH 5SX4H 3IDIB 4UTBL 5D7JD 1A6TB 1WITA 2VH5H 4ODVL 1A7OL 3HHRB 4KJPD 3FQRB 1PZ5A 4MHHG 5I74C 1N59B 4XP9L 2HRLA 1YEGH 5DJ2B 3H7BA 4R26L 1HSBA 3QIWB 4F7PA 3KR3H 4GAGH 3AS1A 3HZKA 5J6HA 5I1IH 3PP3K 4KI5F 1X5YA 5J13C 1UACH 1FC2D 4IRZL 4K3HA 5E1AB 2VNCA 1IM9B 4R8WL 3REWA 1VSCA 3SDCC 4FXLA 4R3SB 4AK1A 1F4WH 3OG6B 2G5RA 5AWNL 5ACLA 1VFOA 4NQTA 3OB0K 2O93L 2XN9E 3X14B 5HYQA 1G7IA 4K94C 3V8CA 3DV4B 1OQXA 3T2PA 5CEZE 5EO0B 1CWVA 3MRJB 4KRPB 5LQBH 1MCBA 4W4NA 2EH7H 3L3OA 4WW2A 1TQCB 5IR1B 5CFHA 5HY9B 5D7JB 4K3DL 4MQXC 1GC1L 3D2UB 5CCKL 4R7DB 5DD0L 4MA8H 3QUZC 4AY0A 3UTQB 3IF1B 2XPGB 1RJYB 1QEWA 2AQ1A 3WN5C 2CQVA 4ZAKA 4DOHB 3JV4B 1BFSA 5IM7A 1M1SA 1VFAB 3MACH 1GGCH 4NKMB 3STLB 3E3QC 3KPRD 4X9HA 4GG6E 5J3HC 5H94A 4HJJL 1A6TA 3OAZK 4RGNB 3FQRA 5DUMH 4HBCH 5JXAL 2R69H 5F9OH 4WUUB 2CLVA 4LQFH 1U8LB 5DJ2A 4LAJH 4RA0C 3MBEC 4Z7WE 3CZJA 3QIWA 4WFGD 4LIQE 1VESA 4G9FD 4W6WB 3ULVF 3OXSA 4MQ7B 2MHAB 3W11D 1WWAX 5AZ2L 3WKNA 4GQ9H 4LU5L 5E1AA 4JQIL 1EXUA 4JAMB 1UC6A 1IM9A 3LPGA 2E3VA 1LHZA 4MB3A 4R3SA 1MFDH 5FF6A 1Q1JH 3QR2A 2EYRB 5FM4A 3QWRA 5D70H 1MCKA 3FRUB 5DA4A 4JE4B 4LVHB 3MV01 5EIVA 5DVLA 5EO0A 3MUZ1 3MRJA 4M6ML 3FB6B 4ZOAA 3MLWH 3QEHB 3VRLF 3KPRB 3SGKC 4I0PC 2P42B 1J7VR 1OLLA 5HY9A 4UIMB 2XTJD 1UKTA 4R7DA 3KAAA 3B5TA 4OCNC 3IF1A 2XPGA 4XTRD 1RJYA 5KOMC 2JJSA 3JV4A 3ZTJH 1EEQA 3G6DL 3ULUC 3UJIH 1VFAA 1UWGL 4G9FB 2I27N 3S5LB 2XXMB 3STLA 3WXVH 3IDXH 1NGQH 4ONHB 4YDVB 3CH1B 3PP3H 4GMSL 4NN5C 4XMKL 2GKIA 4JQXC 5BVPL 2WWMD 3VFPB 2FLRT 3SDYH 4S1DC 2HG5B 4MQ7A 2B0SL 3PHOB 3OB0H 1RZKH 1R6VA 3PWLB 2QQLH 5A1AA 5ITFB 2EYRA 1RJCA 4YPJA 2YZ1A 3EIFA 2N7AA 2XTJB 5E94B 1QQDB 1FSKC 2A83B 3LSOB 3MJ9A 3U0TB 5FAAA 3U4BH 5LKNA 1JHKL 4YO0A 3OAUH 1K5NA 2PYEB 3FB6A 4XXDB 2APBA 2V17H 4POZD 4GAYB 1T20A 2Q1EA 5DLML 1BZ7B 5JO5A 3JV6B 4UIMA 1DDHA 1QSEE 2K1MA 5GXBB 2NY1C 3OAZH 3V0AC 1TMCB 3BD4A 5CILH 5IBUG 2CRMA 2H9GB 3VGDA 5K9JL 1J1PH 4S0SD 1LO5B 5J89A 4G9FA 3S5LA 5KVFH 2B4CL 4UI2A 4ONHA 3TVMD 4P5KB 3NCMA 4XWGH 5EOCL 2R0LH 3TO2B 4JFHE 1HDMA 4OQTL 4LBEB 4CVWA 2OCFD 3HAEG 1A21A 2VLRB 3VFPA 3VMNA 4JCLA 3WHE1 1YQVL 3VXUD 5DJ6B 5GSVB 1HINL 3PHOA 4OAWB 3SO5A 3PWLA 3MC0A 1CG9A 4RFOH 1IZJA 2FECI 2QL1A 1HH9B 4PD4J 1U6AH 5IW6B 2Q3AA 2YD3A 3T04D 2C7UB 3BRGC 4K3JL 1LEIB 5E94A 5H35B 2A83A 3LSOA 3QCTH 4M93C 3U0TA 1F4HA 3WSQH 4DUWA 1IKNC 4LASL 2IQ9H 2X4UB 1VADB 1X9QA 2P47B 3HC4L 3HMWL 1QTYT 4XXDA 3SOBH 2ZUQC 1KB9K 1Y0LB 3NACH 1RZJL 3GRWL 3VXRD 2YKLH 2DI9A 3MCLL 3CLEH 1T2XA 4RWYL 1D3CA 2WWKO 3O3EB 5JUEL 3RVUC 2H9GA 2VH5L 1FLTX 4XAKE 2DQUH 3MA9H 2XIDA 1LO5A 3VXUB 1NBZB 1RPQA 1NCWH 1SVZA 5E95B 1BOGA 1E4KC 4HBQA 3CX5J 4P5KA 4LAQH 3TO2A 3O6LH 4GAGL 5I1IL 2ERJB 4TUKL 3BZ4B 4KDTC 2DQGH 5IHUH 3QXVA 5A16B 3PHQB 2EIDA 4G8FA 1L6ZA 4HF5H 1JYVA 4W4OC 3CMOL 2JIXD 5DJ6A 3ELAT 2BVEA 1AFVH 5GSVA 1F4WL 4WI9A 4OAWA 3VI4F 4OCSH 3QDJA 2DL2A 1HKLH 2FEDD 3SGDH 4OF0A 3LCYA 1HH9A 3MLVH 2LU4A 5IW6A 5F7EH 3L95B 4P4KD 1B3JA 2YXMA 1AGBB 3HZMB 2C7UA 1CD1B 3QPQC 1YEJH 4F57H 1JNHB 1U8PB 4DGVH 3VXRB 1LEIA 3NCFB 5LQBL 5H35A 4G8GD 3FQTB 5GZNC 2EH7L 4Y5XB 4X9BA 5CMAB 4IOFC 4LNRB 5ICZB 1VADA 2QQQA 2EDKA 3ZYZA 2GYSA 3IXAB 3ARBD 2QSCL 1FVEA 3GGWB 2WIIB 3QZWB 4P59H 3TVMA 1QNZL 2F74B 4NSKB 4P23D 4ZO8A 1GGCL 2IANE 4LK4A 3LQZB 1BPVA 3O3EA 1I1RA 3R8QA 5C0FB 1VEMA 5JORB 5DUML 5E03A 2N1KA 2JIXB 3VXUA 1NBZA 4ZFZB 5F9OL 4YXLH 5IEHB 4GT7A 2HA1A 2XOTA 1FYTE 4PY8J 4OIIH 3DV6B 4NQEE 5B3JF 1FFOA 1ES0B 4P4KB 3BZ4A 1U8MB 2XTLA 5A16A 3HUJB 5CD5D 1NUFA 4Q2ZA 4MA1C 4OZGE 4G8GB 2YSSB 3BPNB 3CSPA 5IFHH 3MLYH 1QR4A 4ODWB 3JVGA 1CDBA 2GK0B 5D70L 3ARBB 4HUNB 4NKOB 2PR4L 2E6JA 5F71A 1LO0L 3HZMA 2BVOA 3QFDA 4PJ7E 2XQYG 3WO3B 1NMBH 1JNHA 1U8PA 5J9PB 1CE6B 5DD3H 3VXRA 1M71B 3ZTNL 1AQDB 3MLWL 4GRLC 5CMAA 3THMH 4LNRA 5C08A 5ICZA 1A1MB 4CADB 2DLIA 3RVVC 1DUZB 1KYOJ 2NTSP 3IXAA 1JWSA 3P4NA 1CF8H 2R1YA 4JZNA 1I3UA 3OKNB 1NAKH 5CEZH 3FOLB 4JJ5B 3GGWA 2WIIA 3GSNB 3QZWA 2F74A 3BH8B 4GW5A 3JSSA 1CK0H 3ZYIA 4XHQA 5AUMB 4PLJC 5FHBH 4JJHA 2XI9A 3LQZA 4QHUA 2X4NB 4LHUG 1DE4B 3IDXL 1NGQL 2CUMA 4AQ1B 3GHEH 1HIML 5C0FA 4HGWA 5JORA 2JIXA 3QG6A 4ZFZA 3SO3C 2NY6D 2EDWA 2CXKA 3BUYA 3T1WA 1ZLSL 3C60C 3DV6A 3NFPB 4ACPA 1U8MA 4NWUH 2NY4B 1RZKL 5T5FH 3G6JE 3NTCL 3GJEA 4OI7A 3HUJA 4XXCC 1R3IH 4LCCA 4G8GA 2YSSA 3B8YA 4JY4B 4LFHD 1CGSL 3FQWB 2DQEL 5J57B 1EGJL 4OLUL 2GK0A 3I6KB 3RHWF 3ARBA 3G04A 1T1XB 3KGRA 1TZGH 2RB8A 3IDNB 4X6DF 1NCDL 5HBBA 2CDEB 1CDIA 1RZ8B 2OSLB 5F88B 5HHQB 2Z9TA 4P23A 5J9PA 4EIGB 1CE6A 4PUBH 5C0BB 5GS1B 1M71A 2XN9D 3QHFH 2P5WE 4NM4H 1AQDA 2W9LA 4JO3L 1A1MA 2DLHA 1EBPA 4IIQB 1DUZA 1CE1H 1CDCA 1I8IA 3KPLB 2C3HA 4APQC 1U3HD 3REVA 3OKNA 3MXVH 3FOLA 4JJ5A 4HEPG 1K4CA 5DFWH 3GSNA 2NY6B 4HPOL 3O3DB 5CILL 3BH8A 5GGUA 4XX1G 5GISH 1J1PL 4ODXB 2DBJA 5AUMA 4V1DE 4LMQI 3D85A 2X4NA 2QJDA 1DE4A 3RWDA 4KKAC 1PJ9A 5TE6H 5C0AD 7FABH 3DX8B 3E3QE 5EWIH 4O9HH 4EZMA 4NRZB 1MAKA 2OL3H 5JDJA 4LSRH 4KH2A 4G3YH 4YZFE 2QKIB 3NFPA 3B8SA 1AIFA 5BRZE 3EDKA 5H2BB 1C1EH 5C71A 5C0ND 1MH5A 3DSNA 2XN9B 4JY4A 4OLWH 3B2UC 1RZ7L 3I50H 1XGTB 4CKVX 2CJUH 3ARYA 4U6VH 3I6KA 1IGYA 3GSXB 1U3HB 1T1XA 3WSQL 2CDEA 4PLKC 4WCYH 1RZ8A 5DXWA 2OSLA 5F88A 5HHQA 1G6VK 2XWTB 5I66B 3SOBL 3LKOB 1BBJB 5F70A 5HVWA 1ZSDB 4K9EL 3NACL 1OB1B 4IIQA 2WQRA 1JPTH 3KPLA 5C0AB 5FM5M 5C8JA 3D48R 5LAXB 3O3DA 1KCVH 4HGMA 5KG9B 2DQUL 2HKFH 3MA9L 1PLGH 4ODXA 4TVPE 5JHDE 1GHFH 4LKCB 4RAUB 1NCWL 2P24B 5IB4B 3MOAH 4E9LA 3ULUE 2QLVB 4M1CD 4KVNL 4LAQL 3DX8A 4L5FH 2AQ2A 5HVHB 1AR1D 1MFCH 4NRZA 4MCYB 3Q5OA 2OX5A 5IFAH 3MRRA 3O8XA 5I8CB 4PJDB 2QKIA 5CZVH 1AFVL 3V79C 1Y6MR 5H2BA 2EDEA 5C0JB 5B8CC 1HKLL 2OLDA 3LDBB 4MHHI 4DN4H 3DTXB 3K74B 2XN9A 3HS0B 5F7EL 3OAYK 4NZTH 4HXAH 4R6UA 1A1OB 1XGTA 4GLRI 5TF0A 1IFHL 1RMFL 4DGVL 3VGHA 3GSXA 1FZMA 2N7BA 3HFML 3F8UB 4JO2H 3LMJH 1CN4A 5E8PB 2JJUA 2I5YH 3U46B 4CMHC 2YK1L 1NBQA 3DX9B 4P99A 2AXGB 2CDFA 3KG5A 2CMRL 2FLBT 4Z7UF 5I66A 3LKOA 1BBJA 3NCEB 3ARFD 1EHXA 1A7NL 3JBG7 5MP6L 3L3IB 1ZSDA 1YMHB 1YNLH 3DLQR 5C0AA 5DT1H 1YEIL 4GG6A 3UP1A 3V7MA 5F3BB 3EYQC 4OM1H 5KG9A 3ZKMC 1MJJA 2ZNXA 1L7IH 1QSED 1P7HL 4M9OA 4YE4H 4XCEB 1IQWH 3GK8H 4RAUA 4ODSH 5D71H 2VAJA 2B20A 2A6DA 1FORL 1YYLL 1PX4A 2A9NL 1AQKH 1YNTB 4MCYA 4FQHA 5DRZB 4CMMB 5T3ZE 2NLJB 5I8CA 2HRPH 3EYFA 3TO4D 4PJDA 1NAML 3TYGH 3ZE2F 4OGAC 5EN2B 3X3GH 1T21B 2E7LA 1FH5H 4FP8H 4LDEB 5E5RB 4Y0GA 2XFXB 3DTXA 1IGTB 3CDYA 3V4UH 5I75C 1SHMA 4AJ0A 3ARFB 1I1AC 4ETQB 1A1OA 1RUMH 4XVUD 4NP4L 2IMMA 3FT4B 3RDTD 4OT1H 2H45A 3THML 3TT1H 2MOVA 5E8PA 4X6EA 1OP3K 3U46A 1JPSH 4YLQT 1WZ1H 1MQKL 2VZTA 5T3XD 1QSEB 2AXGA 1NANI 1NDMB 1GZQA 1O0VA 1YMHA 2AXFA 2CRZA 4U0RB 5ADOL 1JZ2A 5DUPL 1CK0L 3BP7B 4OZIF 2OL3A 4UILH 5BJTB 3WEXB 4WFFD 5IB1B 5F3BA 3F6IA 1VDGA 4X4XA 1PBYA 5IVXF 4BFGA 1F90H 2Z0BA 3TO4B 1YJDC 5KVEH 3B9VA 3LRSB 1WWWX 4D8PB 1BQLH 4NFDA 1INDH 2BJML 5DJZB 1U42A 2CD0A 5I1KH 2W65B 2FWOB 2RGSA 3DPBA 1YNTA 4GS7B 4NWUL 3GMLA 4CMMA 1LO4H 3T4AB 4QHMB 3U6RB 5IHZA 2AVGA 1LP9F 3OAYH 2F58L 1S7VB 1R3IL 3JUZA 3RDTB 3H2WA 4A2LA 2BY2A 4E41D 5I30H 1V3MA 1IGTA 3ZE0F 2HWZH 1TZGL 4LARH 3L3HB 2IAMD 4HJGB 4U1NB 1WC7B 5L8KB 1RULL 1EO8H 1XCQB 5D6CB 4RDQG 5JTWA 4NM4L 3UYRL 1IILE 2FBJH 1SJXA 3BAEH 4YXKH 1YEDB 3BZEB 3TJHD 5T5NG 1JPFB 2X10A 4JRWA 1QSEA 4WV1C 5J7CC 5JDSB 3MXVL 5BMFH 3TCLA 1NDMA 1IVLA 3LRHA 3ZT5A 4UOW0 5I1LB 4OCLC 4PYHA 1FIGH 3BP7A 5KSAC 2A2QT 1SJVA 3WEXA 4AEFA 3BN9C 5L8LB 1AKJD 1MELA 1QP1A 3CXHK 2A0LC 15C8H 3TO4A 1NMCC 1WZLA 5EWIL 4KGJA 3LRSA 1QFWL 4D8PA 4JVUA 1F3DH 2EEDA 4WGVB 3FQXA 2UV3A 4E41B 1T5XA 5DJZA 4UB0H 5INDB 2W65A 4Y89A 2OK0H 1YYMH 1U8HB 3O9WD 5DJYB 3T4AA 1T04B 1C1EL 4QHMA 3U6RA 2X1PA 3GMQB 3QQ3A 2R4SH 3P30H 5BO1H 4HWNA 4U3CA 1S7VA 1FNAA 4OLWL 3RDTA 3GB7B 3RKDD 4I0CC 5H8DA 3MJ6A 3P0VH 3ZDXF 3ROOA 3SE3C 2MQCA 1OP3H 1MJUL 3HPLB 4KK8D 3L3HA 4U1NA 2ESVE 1WC7A 5EBMB 3U36B 1OPGH 1S9WB 3JTSB 3NA9H 4L1DA 5D6CA 3INUH 2EECA 5C07B 3WE6A 3KS0J 5ANME 1MHEA 1N0XL 1YEDA 1KB5L 5C86A 3ARXA 3BZEA 3NPSB 1WQVT 3C5ZC 1JPTL 1JPFA 2WBJC 1AKJB 3EO0B 3NIFF 4KUCD 4PRAB 5JDSA 5JLZB 4X7FC 1RHHB 1PAMA 2YD8A 3LB6D 3RL2B 4K94H 2EE6A 5I1LA 2HKFL 2V9TA 1FFQA 2WNGA 3O2DH 3LY6A 1GHFL 3ILPB 3O9WB 4N9OB 3MOAL 1GOGA 2APVA 5KVDH 2NMSA 5C3LD 4YBQC 2HMIC 3IJSB 2GY7B 4N1HB 3W0WE 1MFCL 3ZHLA 2IFFH 3DYMA 4E41A 3JV5A 5IFAL 2FX7H 4Z8FH 3MODL 5F1OB 3BW9B 3GM8A 5TDNB 4JEGB 4FABH 5INDA 4OZGB 4UZGA 1ZWIB 5E5MA 4N8CH 1U8HA 2YOCA 2IAMA 3I3DA 4QRRE 5DJYA 2YN3A 3GMQA 2FH8A 4DN4L 3PWVA 1N2RB 4NO5B 5J0BA 25C8H 4TNWK 3GB7A 3NCYS 5HD8D 1S7UB 3RNQB 3RWFA 4NZTL 4BSWA 5HSFA 4W6XB 3QUXA 4L9LC 2W9EH 5FUOH 1IC7H 5K59F 5ETUA 2UWEF 1F3RB 3HPLA 4JO2L 4KI5C 4YBHA 4HCRL 1F8TH 1QLRA 2I5YL 3RTQC 5EBMA 4DVBB 1JHLH 5F6IC 1S9WA 1X5JA 3JTSA 2G9HB 2QSVA 3WIHL 1J88A 2DQCH 4H25B 3P40A 1KCSH 1TENA 3LKQA 1RAMA 4KROD 5EO1A 3EO0A 3QDHA 1AKJA 1H3GA 4LSSH 3VRJB 4K2UH 5B38G 4MNQE 1WLHA 2P5WD 4K7PY 4OD1H 4PJBE 5D72H 2AJVL 5JLZA 4HS3B 3OSKA 4XPBL 1RHHA 1H3WM 4OM1L 1FE8H 4IJ3C 3RL2A 3BKYL 5E2WH 4IRJC 4YE4L 4Y8AA 4LRIC 2A77H 2BX5A 3OMZA 4LPTA 3O9WA 4JQVC 1N4XH 4N9GA 1NGYB 1IC4H 3QUZD 4RMQA 2DS4A 4V1DD 4NQEA 3IJSA 4LSUH 1AQKL 4KHTL 2YUZA 3HNSH 2D9QB 2E9BA 5DK2B 5E6IC 3LKPB 5J12B 2P5EE 5C0GB 4ZUSB 3BW9A 5TDNA 2HRPL 4NQCE 4XAWH 1RK1B 3TYGL 3K80A 4OZGA 1ZWIA 1EAPA 4M7KL 2LABA 3X3GL 1C16B 3ULUH 4I18B 1MWAL 2E27H 4DUVA 2AI0L 4WY7H 3IJYB 4NO2B 3IXTB 5GSRB 1D5BB 2MCPL 4C56D 5DMYA 4NO5A 1YECL 4ZTPL 4NHUB 4YUEH 3V4UL 1S8DB 3RNQA 1S7UA 4GSDH 2VIRB 5HVGB 3F65A 2GJ6E 3L3DB 4MJIE 4KROB 4IOIB 2P5WB 1R3JB 1ZLUK 1FIEA 3TT1L 1OAZH 4X8JB 5LG1A 4DVBA 2I9LB 4JZJB 5FO8B 2G9HA 3BHBB 4P5TC 4B53A 1MCWM 4ZFGH 2AP2A 3QXAA 3S7GA 5KW9H 3GSRB 5IJVB 4QHLB 4YGAB 4V2CB 1RIVH 1FYHB 4PIRF 4OFKA 5JIPA 2F5AH 4EI5C 1Q9KB 3ARDB 4G6KH 1VGKB 3CK0L 1XMWA 4V1DB 4K23L 3WN5B 5CLWA 1IAKB 3GNMH 4UIKL 3PWNB 3AY4A 3WDJA 4EJ1C 1S3KH 1F90L 3NGBC 4HLZH 4DN3L 4FQPA 5F9WC 5KVEL 4KK9C 4RIRB 4PV9B 1QRND 1BQLL 4EVNB 2YEZB 1INDL 4Q0XH 1MF2H 5F7FA 1IEAB 1T03H 4C56B 1YY9C 4TVPD 4YWGH 5JHDD 4HWEL 3LEXA 3PV6B 2HJFB 2MNUA 1NJ9A 2ADFL 4J6RL 3HI5L 1H3UA 5DK2A 3ULUD 2Y9RT 5C0GA 1MFNA 1RK1A 4BELD 3GFUA 1C16A 4I18A 5EUOE 5A43C 4H5SB 4NO2A 3IXTA 2OZ4H 5GSRA 1D5BA 4GXUN 2VXQH 2CSPA 1PY9A 3QIBD 4NHUA 1G7JB 4LKXB 5GGQH 2HWZL 5T3ZH 4WWKD 4LARL 5GS0C 3QEGH 5J1SC 2VIRA 4JFOA 1TJHH 4WW1B 1H8SA 5J11B 1EO8L 4IOIA 2W1NA 1FFRA 2P5WA 5I2IB 1R3JA 2AK4E 3O2DA 4PJ8C 1QR1A 4YXKL 4MXQD 3DMMD 5FO8A 2I9LA 4JZJA 2HFTA 4Y2OA 3BHBA 1BGXH 3B6SB 3GSRA 2VTFA 5FCSH 5IJVA 4FFVC 3UPRB 4QHLA 1EZVY 1UZ6E 1QRNB 4U49A 4DKAA 2G60L 1FIGL 2HH0H 1W0YT 3QUZA 4V1DA 1CD0A 2LVEA 2YUXA 4XCCL 5JHDB 1ZT1B 3WN5A 3QNYB 1Q9WB 5FGCE 1IAKA 4PB0H 3MNZB 15C8L 4PJ9D 4KJWC 4KY1L 5JQ6H 1BIIB 3T0EC 1K6QL 1D6VL 4TNVK 1AXIB 2VAAB 3QJHA 2YEZA 1MCLA 4TTDD 1UWXK 3L1OH 1IEAA 1N5YH 4G7YH 3QIBB 3PV6A 1FJ1A 2HJFA 1YYML 3B5HA 4KQ4H 4WWKB 2EDNA 3MBEA 5BRZA 1JI2A 1F4XH 4ZYKB 3EKCA 1H15B 2R4SL 1WIOA 1EJ6A 1V7ML 3L5IA 2ZKHL 4OLEA 4H5SA 3P0VL 4KZEH 3DMMB 3MRKB 3QUMH 3WDHA 4HMDA 1ZLUH 3GHBH 3BZDA 5DFVD 1G7JA 4LKXA 4OZFG 4L29B 2NPLX 2F5BH 2FHCA 4K7PL 3P4OB 2EICA 1OAQL 4WW1A 4HIJB 1OPGL 3C2SA 3INUL 1UVQB 3TN0D 4QWWC 5I2IA 4P3WA 2EE3A 4L8DB 2DM4A 1D5IH 3DX7B 2H1PH 2DM3A 1HHIB 3ABZA 2VLKE 3MRFB 3WFZA 1BFOB 4MAYD 3HA0A 4PJ9B 1ZGLP 4N1CA 3SGKA 3UPRA 1JPST 4OCXH 5F6HI 1P4BH 4D94A 1QRNA 1Z5LB 2W0PA 4YHMH 2VDMH 1I4FB 1G9NH 3CSYB 1ZHKB 4JFDE 4KTEL 5JHDA 1W72H 3WXWL 5DZLA 3H3PL 4XNZB 3NFNB 1CLYH 2FO4B 4PJIF 3B4NA 2VXVH 1BIIA 3FOMA 2IFFL 4J3VA 4GRWF 2FX7L 4Z8FL 4KWUA 3U79A 4LPCA 3QIBA 5ISZE 1FNEB 1OARH 2ADJB 4N8CL 2C1PB 2C9AA 2AERT 1E4XH 1TZIA 4ZYKA 5IOPB 3KYAA 1H15A 1VACB 2V5SA 25C8L 3MYJB 2HT2C 3Q2CA 1OOAA 4NQXB 2X1XR 4R0LC 1GRWA 3TN0B 1I7TB 3P3YA 3FFDB 5I76A 4P2OC 4XHJD 3DMMA 3KXFE 3Q5YA 2OQJB 5FUOL 1DFBL 2OM5A 3CFEB 3QRGH 2DTSA 4MAYB 4L29A 1KUMA 3P4OA 3D0LB 3LHPH 2R0ZH 5JW3H 1JHLL 3ZSSA 4BZ1H 4HS6B 2DQCL 4OF5A 4LDLB 4CN6A 4X83A 1UVQA 1B4RA 1FGNL 3DRTB 4HT1L 4P57B 1B4JL 4M6OL 1XGQB 4CL7A 4X6FB 3DX7A 1HHIA 3G5XB 5D7IE 4FOMA 5D72L 3NAAL 3RIFK 4PRIE 2GI7A 4FQQA 1IGMH 4A2MA 4WFEE 1I4FA 3O41B 5GZND 4KAQH 1UWXH 3N1MC 1TJIH 1N4XL 2X4OB 2HTKC 4OSUL 3M8OH 5E99H 4DZBB 3QCUL 4J3UA 3WUWB 5I73C 2OZ4A 1BEYH 3CZFB 3K8MA 3DIFB 1IGCL 2VJXA 4CNIB 1BQUA 3SDXE 5CSZB 1J8HD 1IL1B 2LQRA 4XAWL 4CRPA 4HWBL 1FNEA 2ADJA 5I6XC 3VMOA 3C8DA 3I6GB 2CIKB 3TZVD 2YUVA 3BKML 3ZMRA 5IOPA 1LE5B 3FMGH 1ZGLB 2BXYA 2C5DC 2IALB 3MYJA 4NQXA 5D2NC 1NQBA 1KBGL 4WJ5B 3TN0A 1I7TA 3FFDA 3VFGL 4GSDL 3SKNB 2B5IB 2R2HB 2R29H 2OQJA 3H3KA 3O0RH 4MDJA 1OTUC 3S4SB 1PKQE 4YAQB 2IPKB 4MAYA 1CBVH 2AGJL 5CBAB 1OAZL 4EUPH 3D0LA 1SJHA 1JGVH 5HDBE 4HS6A 5KW9L 3K46A 3KYMB 2R0WH 3MV8E 4FMKA 1FNHA 4BSJA 3DRTA 4P57A 2ZG3A 1RIVL 4N5EC 4X6FA 4HZLB 4Z7WF 2R0KL 4G6KL 3RWJA 2FJGB 5FHAH 1T83A 3KLAB 3J8F7 3WO4C 1A3RH 5IMMB 2I26N 3GNML 1U92B 4XVJL 3UC0L 3DHJA 1S3KL 5FK9B 1J8HB 3NMEA 5KANG 4KKBD 1PY4A 3BT2H 4P3CH 1CFBA 3QG7L 3TZVB 4Q0XL 4DZBA 3WUWA 4YWGL 3EOBA 3CZFA 4ZO6A 3DIFA 3AU1B 5D5MB 4CNIA 1P69B 3SY0A 5CJ8A 4AT6A 4X6CF 1IL1A 3VW3L 4Y2DC 5J56B 1BZQK 4Q9QH 2W9DL 5IMKB 2V9QA 2AJSH 1CXEA 3I6GA 5HPMB 1BX2A 2VDLH 4XCYA 3V0WL 1I9IH 4PG2C 4W4OA 4MS8D 3M17B 3DVGB 2IALA 4QF1B 5IGXH 3RWGB 4WJ5A 1WCQA 4QRRD 3SKNA 1TJHL 2R2HA 4YC2C 4OD2B 3RVXC 1NCBL 5CWSB 2R23B 4YAQA 2IPKA 1MFBH 3WFBH 2IBGA 5ANMB 5CBAA 1QVOA 3ESVF 3RVTC 5DF0A 1BGXL 1X5XA 3KYMA 4KI5E 4FXKB 4NNYA 4PRDB 3PP4L 5BV7C 4HZLA 3CXDL 1PQZA 4N68A 2FJGA 2HH0L 3KLAA 1LE9B 1DVFD 1KGCE 2FD6H 1TVDA 5IMMA 4G80A 4PB0L 1U92A 1KACB 4HKXB 4U05A 1U95B 5B4MD 4X0KB 1K3IA 1NDGA 4MNQD 5I8OH 5A2FA 1J8HA 5MI0B 4YDLC 4BK5A 5JQ6L 3RWIA 1LEGB 3MLRH 3CLFL 3S5LG 4LLVB 4APQD 1KJ3H 1CIUA 1KTDA 3RPKA 4G7YL 2J5LB 2QR0B 4JPIB 2XT1B 3AU1A 1M7DB 1JVKA 1NEZB 1EHNA 4IMKC 3LKRB 5GGTA 3N1GC 1MJ8H 5HDQH 4CN1A 4NJAH 2VDNH 3HI6H 1GOHA 5IMKA 1T1WB 3NIGF 4FZEH 5HGAB 2NY3D 1HILB 1ULVA 3K2UH 3RNKB 2P5ED 2WINB 1LGVA 3QUML 4P9MH 3M17A 3UCRA 4NQCD 3GHBL 4QF1A 3S36X 4AEIH 1UEYA 2NY7H 1ED3B 3AFLA 3T0WA 1K4DA 4JANB 4WIQA 2DQHH 4F7TA 1X5GA 5D2LF 3WLWD 1FV1A 4OV5B 3R0MA 1CICC 5CWSA 4OZHF 1HHJB 2X4SA 4JO4H 4XVSH 1J11A 1DVFB 2VQTA 4I3RL 5ANMA 4LPYA 1AJ7H 1T1ZB 1MQ8A 2GJ6D 5EU6E 4MJID 1DQTA 3OZ9L 2H1PL 3L7FB 5K9KB 4F2MB 1S5HB 4GRLA 4MNQB 4UT6L 5DEZA 3ULVE 1MRDH 4PRDA 3PDGA 2HLFD 4CJ0A 4OCXL 3V52H 1P4BL 5C9JB 2VDML 1CGXA 1G9NL 3SKOB 1YPZB 2W38A 3QHTC 4JRYD 4ZDHB 4LVOC 1QO3A 1LE9A 1W72L 4HUVB 1MNUL 1UA6H 2BC4B 3GKWL 1SMOA 2EDXA 4HKXA 3RX5A 1U95A 4X0KA 3I2CH 1MCJA 4KJYB 1BJ1H 4LCIH 1AY1H 4HULB 2VC2L 1LEGA 2A9MH 1WGOA 3MGAA 4LLVA 2NY3B 3ECBB 3FL7A 2HN7B 3ULSB 4JM2F 4L8CB 5CS7A 2CUHA 2I9TB 1RVFL 4JVPA 3VRLE 5FA4B 1M7DA 1Q8MA 1NEZA 5ELIA 2IPUK 1NL0H 4QRRA 1EFXA 2RBLA 4PJGB 2W0KA 3VD3A 1MCOH 5BVJB 1NH6A 3ZSTA 2YC1B 3NVQA 5HGAA 1HILA 1WISA 2GJ6B 3RNKA 1QFWI 2WINA 1OTTD 4MJIB 3T2NH 1JZ7A 4XXCA 3WJJC 3VDBA 3QRGL 1BVLB 3FZUD 4WEBH 1GC1C 1ED3A 2ZCHL 4JANA 5JW3L 4BZ1L 4U1HB 3A6CH 3RUGF 4OV5A 5C2BL 3TA3B 1HHJA 4JRYB 1I3GH 3BISA 3G6AB 3L9RA 1DCLA 1Q9LB 3MRLA 5DJ0A 3ZTJG 3S34L 3L7FA 4QTIL 1ZTXH 5K9KA 3S3SA 4F2MA 1ZHNA 5JR1H 2XXCB 4OJFL 1EHLL 5DYOA 4MNQA 2AK4D 4KGLA 5C9JA 3EZJB 1IGML 4HC1A 4APQA 1QFOA 4MD0B 4ZUUB 3SKOA 1YPZA 2NW2B 4KAQL 4ZDHA 1LD9B 1HYSD 2VDRH 3BIBX 4HUVA 3DOSA 1AXSB 4FS0A 2BC4A 4JFFE 4MD5A 1NLDL 3O4LE 1C08B 1TTUA 4GFTB 3UTPD 1MLCB 2HVKA 4KJYA 2FX8H 4NFCA 1ITCA 3QDMB 4FQIH 2VN7A 1HHKA 4LCWE 4NJ9L 2Y07H 3ECBA 2HN7A 2P5EA 4G43B 4HH9B 4L8CA 2MFNA 4NQCA 3T0EE 5FA4A 3MZTA 5EUOB 1DZBA 1MCFA 4ISVB 1KN2H 3ZHDA 1I1YB 3ZLQC 5E2UL 5HGDB 5BVJA 1XT5A 3QAZC 4Z18A 3QXDB 1M4KA 5KS9F 3OKOB 2BVTA 1YJDH 2GJ6A 2R29L 2QHLA 4HH8A 4MJIA 2AV1B 1TITA 5HJ3B 5L88H 1FO0H 1BVLA 4QHKJ 4Z0XB 1CBVL 1AGDB 4Z78B 2AK4B 2IC2A 1B9ZA 4X4ME 5F8QC 2AJYH 1L0QA 1JGVL 2Z8WC 4JG1L 5EOCJ 1U8NB 3WKMH 1FL3B 2R0WL 4JRYA 3VFWB 3G6AA 3PGFH 1Q9LA 1AHWC 4XP1H 4JN1H 3D39E 4GQPH 2CLZB 3QQNA 4XBEH 4DQOH 2YMXH 3DGGB 2MPAL 5FHAL 1GGUA 1JNLH 1I1AD 4HKJB 1A3RL 4JCMA 5FGCB 3QZWG 4ZUUA 4JKWA 2VLKD 4LF3B 1LD9A 3BT2L 1PYWA 1AXSA 4P3CL 3MO1B 5DRNB 5KSBF 1T66D 4QTHB 3B2VH 1JP5A 4AIOA 2W0FB 3IFLH 5C70A 5L7XH 4E42A 4O2EB 1X4YA 1OM3H 4YK4B 3OR7B 3S35H 4PJ7F 4OGXH 3AM8C 2UYLB 3RFZC 4KDWA 4ZXBC 4G43A 4HH9A 4LLQB 4TPRL 1IARB 4Q9QL 5EUOA 3WFEL 3C5SB 4ISVA 4NUJA 2X4QB 1LK3L 5JOEA 4OI8A 4ZUVB 4S2SB 5HGDA 1MVFA 4OBSA 2O5ZL 3OKOA 2X42A 2V7HB 1XGRB 1FRGH 2B2XL 5HJ3A 2ZOLB 3T3ME 3A67L 1I1AB 4Z0XA 1AGDA 3QH3B 3KPTA 4Z78A 2AK4A 3LOWA 4XI5D 2RHEA 3MLUL 4FTVE 1D5XB 4XBGB 3VG0H 1U8NA 3PF2A 4RGMB 4BM7A 5I18H 2X7LA 2VLKB 3E8UH 1FL3A 4D0CB 3VFWA 1CTOA 1PX3A 3QIUC 4QO1A 1UXSA 3KHOA 4FFYL 4MA3B 2CLZA 1EVTC 4HKJA 3AROA 2EYTB 3VI4E 3A6BH 1WAAF 1XCTA 3MMEB 4DVRH 2PO6D 1U8KA 4LF3A 4Z7NF 3OXRA 5GJTH 5JNYA 3OHXB 5H37H 4WFED 1CDUA 2VR5A 5DRNA 5I1CH 4QTHA 5GGVL 2ICEB 1J18A 4GKZB 2XZAH 3D87B 4O2EA 2LV4A 3OR7A 1KG0B 2VUYA 1MJ8L 2D03H 4LLQA 4NJAL 2EXYC 2VQ1B 5BZWB 8CGTA 3OJDB 3HI6L 3C5SA 3L3KB 3K2UL 4G6MH 3JTTB 4K55A 1DBBL 4HS8L 4L3CB 1B0GA 4ZUVA 5F3HB 4ALAH 4FFWD 3H42L 4KHXH 4S2SA 2HKHH 4UV7H 3W9EB 1K2DB 4IEFB 5D96C 2NY7L 5E8NB 1U2HA 3GKZA 4DEPC 2DQHL 4JKMA 3DRQB 2V5YA 1XGRA 1CD8A 5D2NE 2XKUA 2ZOLA 5JOPD 3D25B 1I1AA 3UX9B 4JO4L 4JHAH 2ZUTA 3BO8B 3O6KH 1AJ7L 4DK6A 4O00A 1BM3H 3O3UN 1IEBB 1D5XA 4R96B 2H2SC 2PO6B 5B3JE 2VLKA 1A3QA 5D7IB 4D0CA 2BNUA 3MRGB 3CD4A 4GOSA 5KJRL 1MRDL 5HHME 5L2KE 3MA7B 4QXUH 2J6EH 3I75B 4MA3A 3CU7A 4QY8B 4GBXD 2C1OB 3MV8D 4M8QB 4D2NA 4JFDA 5I1JH 2EYTA 2MKLC 3IGAA 3LPWA 2DTML 3S88H 3MMEA 1WZKA 3KDMB 2A1WH 2J8UB 4LHUB 1JYNA 2F54E 2XZCH 2A9ML 3MGOB 4L8BB 1XF4A 3OHXA 1F6FB 4HG4J 2ICEA 3NFSH 1P7KB 1F13A 3PDDA 4GKZA 3J7HA 4U6HB 1K8DA 5ISZA 3U7YL 1FO0A 3LKNB 4LFHG 1NL0L 4RFNC 1KG0A 5DSCB 5ALCH 4F9LC 4BQ6A 2ZPKH 3WBDA 4O2CB 2R9HC 3O45B 4WFHE 2GTWB 2QQKH 2VQ1A 4XMPH 5BZWA 3TWCH 1A7BA 5CJ5A 4N1EA 4U1KA 3L3KA 2ED7A 1T0MB 4IRSD 3QDGB 3JTTA 3KXFA 4YBQD 5INCB 2DDQH 4GRMA 1J86A 5JXEC 1E6OH 3W9EA 2LFGA 4WEBL 5E8NA 1MIMH 1IC1A 3DRQA 3RWEB 5C09E 4K71B 4GBXB 3WFDH 3MV8B 3D25A 1RI8A 3BO8A 1JZ4A 1U3YA 2H32B 4MJ6B 4S1QH 1IEBA 1OGTB 1KEGH 4R96A 2PO6A 4X9GA 4XP6L 5D7IA 4KK5C 3MRGA 5HI4D 5J1TC 3MA7A 3MOBL 3I75A 4PRIA 4HK3J 5DK0B 2Y23A 1JL8A 4QY8A 3TEUA 2C3WA 2R1XB 4XVTH 1DQLL 2A6IB 2XKSA 1WWCA 2VDRL 3ZYOA 1N6VA 3SJVD 3KYNB 4EXPX 1FLRL 2W0LA 3WLBB 3MROB 4KZDH 1OGAE 4OQ1A 2X41A 3KDMA 4MCZB 2FX8L 4JLRB 4FQIL 2YRLA 1KGCD 1YNKH 3MGOA 4L8BA 3SDXA 1YDPA 4RAHA 4IRSB 1KIPB 4J8RB 2DRUA 1DBKL 5IB3A 1P7KA 4PJCB 4PJAF 4PRHD 4OF3A 5DSCA 3AXLA 1V5JA 3O45A 4MLIA 2GTWA 2FO1A 1D9KD 1B6UA 1T0MA 2YPVH 1A6WL 1YJDL 3P9LB 3LEYL 3PGCB 5L88L 1FNSL 3AREC 1PKQA 1SMAA 1S9KC 1FNFA 3UPAA 2V2TB 3HG1E 4KQ3L 5DJDB 4YHZH 3H7LA 3RWEA 2Y25A 3SQOH 4GBXA 5DHVH 2YD5A 3WKML 1KEMH 3MV8A 4TNWF 5CJBA 4G8IA 3C6SB 3BE1H 2R56L 2XKNB 3MNWB 3SJVB 4JN1L 2GTZB 4U1GB 4F80A 2H32A 2RFXB 3Q48A 4MJ6A 2HFEB 1OGTA 3P4MB 1CGYA 2CH8A 4XBEL 3QYCA 3LD8C 2R4RH 5ILTH 1RD6A 2QHRH 5FGBC 3NABH 4BUHA 2FJHA 3HC0B 4Q7DA 2OTWA 3C5ZA 5DK0A 5EU6D 1S9YB 4ZD3L 2R1XA 3T8XB 5GS0H 1FL6B 3ZDYF 3ULVD 2IG2H 3HE7C 1KELH 3KYNA 4G6JL 3MROA 2Q8AH 3VGFA 4O4YL 3SKJH 1VFUA 4PRHB 2YPKA 4P46C 1T0NB 2F19H 4MCZA 4JLRA 4O58L 1XZ0B 3IFLL 4HXBH 2VL4A 3IFNH 3UPCA 5TDOA 1F58H 2R8SL 3S35L 1D9KB 4IRSA 43C9B 1KIPA 4J8RA 1DL7H 1AP2B 5DD6B 4QRTA 4GKNB 5KSUA 3HB3C 4X99B 3B9KC 1TQBB 1YMME 5EA0H 1NGZA 1OF2A 3SE4C 4PGBA 5KANI 1EEUA 4FHBD 2PNDA 1MRFH 3ARGC 4Z7VE 4UAOB 3P9LA 3G9VA 3L5XL 4ZFOA 1WIUA 5E2VL 3PGCA 4KKCC 2J4WH 1KPVB 1CLCA 3I9GH 1MAML 3WS3A 2V2TA 4IMLA 3HR5A 1NGXA 2ZUXA 5DJDA 5EORL 3V7AE 3DROB 4L9LA 4CVXB 5CD3B 5EU6B 5T3XL 4HMCA 5F9AC 3VG0L 5FYLL 5FCUH 1F4YH 3C6SA 5I1HH 2XKNA 3MNWA 3SJVA 3STZA 2GTZA 3U48A 2RFXA 2HFEA 5L6YH 3RU8L 3P4MA 3VXMD 3E2HB 3VWJC 3HC0A 3ALWA 4OIAA 4G9DB 4KJQD 1S9YA 3CPLB 1FL6A 2Z4QB 2LAAA 1EMTH 5CP7B 3L7EB 5IQ9B 1ZT4B 2EH8H 2WQ8A 5KZCD 1QSFD 5TQ0L 5D7LE 1E6JL 1C5DB 4PRHA 3ZE1F 5I1CL 1GPOH 4LRIA 5CINL 5IESH 1JV5B 5CEXB 2XZAL 2NX5E 3HMXA 3RBGA 4JFFD 4G5ZL 2ZG2A 4X98B 1C12B 43C9A 3BKJH 2O61A 3O4LD 3R06B 3MBXH 1RUKL 1AP2A 4Z7UE 1WFTA 5DD6A 2D03L 3GIZH 4HJ0D 4S1SH 4X99A 1DLHB 2OXHA 5E6IA 1BWWA 3NCBB 1KT2B 4WI3A 4HZAA 5E00A 4KHXL 2GT9B 1YN7B 2HKHL 1QD0A 4UV7L 1GJIA 3T0ED 1J0YA 5TE4H 4K8RC 4L3AA 4TRPL 2APWA 1BJMA 3P77B 1CFTB 3GBML 4UDUB 4K9EC 4BK4A 1FG2A 3VXMB 1VCAA 1DEEB 1NCAH 3O6KL 5TGBA 4CVXA 1BM3L 5CD3A 5EU6A 1CVRA 5IROA 3RZWA 2VWEE 4M62H 3IRPX 4I0KA 2BVYA 4KUZH 4OM0H 4QGTA 4QXUL 5KZCB 2J6EL 4AMKH 2EE9A 1QSFB 4JFYB 2R2BB 2BOCB 4Q6YA 1Q0XH 4H88H 3ZE2E 2YA0A 1EO5A 5I1JL 1U58B 2YWYA 3AS2A 4KMQA 4JFFB 4EI5A 4G9DA 4AENB 3S37H 4G7VH 3CPLA 2Z4QA 5CP7A 2D7NA 3L7EA 5F93C 1P53A 3KNBB 1ZT4A 2XZCL 1H5BB 4HLJA 4QRPD 3CSGA 5EC1B 2R2EA 5AYQA 3C2AH 3NFSL 1KB9J 1J1OL 3T0EB 4Q58C 4X98A 1C12A 1RSFA 2ZPKL 2CPCA 1MI5D 1U0QA 1CFNA 1EAJA 2P4AB 2QQKL 4XMPL 1XR9B 5DHVA 2Q76A 4KK6D 5BW7C 2FSEB 5IW1B 4GXVH 1KT2A 1LEKB 1IAOB 2DDQL 4OZIE 2GT9A 2X4TB 1E6OL 4X7DC 2D7TH 2P44B 4GW1B 3MNVB 3GUTB 1I9JH 1MIML 4CU6A 4RGOH 4XCFH 1CFTA 3ZKSD 4CBPA 2UY6A 5I0DA 1RJLB 2E8YA 1DEEA 1MCSA 4P0DA 1KEGL 4I1NB 4PFEA 5D8JL 1R3KB 4IDJL 4OLVL 3WJLC 3SGEI 4P2OD 4DGYL 2BXZA 1QSFA 4JFYA 4OFVA 4QRPB 3EO9H 1ACYH 5DDHB 2R2BA 4C83B 1LP9E 2BOCA 4CVZA 1MPAH 5CBEA 4LP5A 3WNOA 1U58A 2Q6WB 2OTUA 3E0GA 2BNQE 4KZDL 4JFFA 3LN5B 2DIJA 3ZZ1A 3C6LC 4AENA 3O4LA 4ERSH 4P2QE 1V8HA 1MI5B 3BEVB 4Y5YC 3ZE0E 3KNBA 1YNKL 3RGVD 5L0QC 1V7NH 1QHPA 1PG7X 1SJEB 4AL8L 2K9UA 5GGRA 3MRQA 4YHIB 3T0EA 2FHBA 5F96L 1UZ8B 4XMLL 3D9AL 2QV2A 3PXHA 2ZCLH 3GMNB 1X5ZA 4NC1E 4JGJA 4U6XB 1PVHA 4OCMC 1NFDF 1XR9A 3FN0H 1KJ2H 4Y8DC 2FSEA 5GS2H 2YPVL 4CW1A 3ZKNC 3NH7H 4KVCH 4X5XA 1LEKA 1IAOA 2BVQB 3BX7C 4GMTH 4XBPA 3VD4A 2X4TA 5JW4N 3D18B 1IT9L 4GW1A 3GUTA 2OP4H 3RZCD 4CDGC 1P6FA 3BE1L 1NGPH 1RJLA 2Z91B 3SE8L 1SY6H 3D39A 3JV0A 4UTAH 1R3LB 1LILA 2C26A 1R3KA 3RIAF 1GH7A 1SVCP 2E6QA 3BGMB 2QHRL 3TFKC 2DI7A 2VN4A 4RCAA 3RGVB 4QRPA 3CFKA 4C83A 2XA3A 5T1DH 4R4BA 3UZVB 3EJYD 4OTXH 3KYOB 2CR6A 5L2KD 3MRIB 2Q6WA 5ID1A 2IG2L 5E6ZA 1P1ZA 4H0GA 4Y16C 3FRPA 4C55A 3BKCH 3ZDXE 2F19L 3BEVA 3SBWC 4NC0B 5TDPB 1HI6A 2O5XH 4HXBL 3RY5A 2F9BT 3RIFF 3IFNL 1F58L 1RFDL 4H8WC 2ZOKA 3G9AB 5C0IB 1SJEA 5HHVH 1DL7L 5BV7H 1J0JA 3KPSE 2CKBB 4YHIA 1J0KA 3MRDB 2XWBB 3BDYH 5EA0L 1UZ8A 1BVZA 4OFYD 3TT3H 3RZCB 1HNFA 3GMNA 4XP4H 1R5VB 4U6XA 3GJFK 5EH1A 4GLRH 3V4PL 3C09C 1NC4D 3S98A 5EBWB 3PQYE 5D1XD 2BVQA 4HPYH 2JB5L 4R0LA 1T0PB 4WTWA 1WV7T 3I9GL 3D18A 3NOIA 5ADPH 4P2OA 3WD5H 4P2RE 3V6FB 4UT9L 1OP5K 5FCUL 2VZVA 3ARTA 3FT3B 1F4YL 3FJTA 5I1HL 5L2KB 2NR6D 2CIIB 1YEEH 1MREL 2Z91A 4JPWH 5IQ7H 3SKMB 3SCMD 1G9EA 1Z9MA 4Z95H 5C09D 4NZRH 1FNGB 3BGMA 4K7FB 5D1QC 5EZJB 3RGVA 5B38B 3N0PB 2F53E 5FM5O 3UZQA 3KYOA 1I3RB 1LO2H 3WO4B 3MRIA 2HJKB 2EH8L 2A38A 3VXTB 3CU1A 4XNXH 1J5OL 2W59A 1BZ9B 5K59E 1GPOL 3GI9H 2ORBL 3F7QA 5TDPA 2UWEE 5F7KC 3PV7A 3PL6B 2DL9A 3BWAB 4U3HA 3OL2A 1SYSB 4UTBH 4HX1B 1NC4B 3OKMB 3QWQB 5IFJB 4J2XA 1A7OH 3AUVA 4PGCB 5KN5B 5D1XB 2ZZUT 2CKBA 3FQNB 3GIZL 3P0GB 2YPLE 4XP9H 2JK5B 2XWBA 35C8L 5JIHA 3PJSB 2BCKB 4ORGB 4Y7MA 1H3PL 4R26H 4NZUL 4AIXA 3EZ8A 5JOFB 2VDOL 3LZFL 4YPGB 1N6QL 1MSPA 5TE4L 3GO1L 1KIRB 4FZ8H 1JF1A 1EV2E 3SCMB 5EBWA 4R8WH 5C09B 5D2NA 1HNGA 3KJ6L 2EE2A 3Q5TA 3T08A 3U2SB 3V6FA 1NANH 1AGCB 2EDJA 4N0CD 3FT3A 5L2KA 5GRYA 4M62L 1V3LA 2CIIA 2DBLL 3FB5B 3HG1D 4AMKL 3SKMA 3CFBB 2Z31C 5E8DL 2JJTA 1MAJA 4H88L 4GUPA 1BVKA 5DC0A 1FNGA 2H26B 5BV7B 4Z7QE 2CGRH 1FBIL 4K7FA 3UAJD 3TH2T 3U30C 1YUHA 5F21B 4K3DH 1S7WB 1F6AA 1CVSC 1GC1H 2V2WB 4G7VL 3S37L 5CCKH 1JWUA