1YMHA

Anti-hcv fab 19d9d6 complexed with protein l (ppl) mutant a66w
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
220
structure length
220
Chain Sequence
DIVMSQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLAWYQQKPGQSPKVLIYWASTRESGVPDRFTGRGSGTDFTLTISSVQAEDQAVYYCKQAYIPPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comparison of the crystallization and crystal packing of two Fab single-site mutant protein L complexes.
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Immune system
molecule keywords Fab 16D9D6, light chain
total genus 42
structure length 220
sequence length 220
chains with identical sequence C
ec nomenclature
pdb deposition date 2005-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ymhA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ymhA01
4BQCA 3MLZL 4L1DA 5IMMB 1F11B 5F3BA 4NZUL 3F8UB 2NTFA 2WINA 5B38G 4OZFH 3FT4B 1NBVL 1K6QH 3ILPA 3MV7B 4XXCA 3WXWL 1PEZA 4X5WA 3IAQA 4JHWH 1YECH 2APFA 4WFGE 5F8QC 4BKLB 1N5YH 3LEYL 2VLJB 3WFEH 4CDHA 2F8VA 1F00I 1C12A 1U8HA 1FJ1A 2YWYA 5AD0B 2E8ZA 1EA9C 2J6EH 3F65A 4PRDA 2VXTH 2UUDK 4MWFA 4GW1A 2NY1D 2EDQA 1AGDB 3UYRL 4X6CE 4P5TA 3IFPA 2EO9A 3UTZB 1FP5A 4QRTA 3B83A 3L3KA 1QNZL 5ENWB 2P8MB 4PLNC 3RJDA 2G5BB 3MRFB 4FQQA 2ZSVB 4DCQB 3VXQB 4XXDA 3WNLA 5ERWA 1MI5A 1PY9A 3MRKA 2DQJL 3O3EB 4EQ3A 4QOKA 3QDJA 5I74B 4QNPF 4K7PL 3VXSB 4LIQL 4QTIH 4RGMB 3QCVH 3OAYH 5JIIA 1KGCD 4HHAB 4HZAA 3BDBA 3KNBB 4ZO9A 3V0AC 1GVIA 1UXSB 3RTQC 2WWMC 3OKMB 3OF6A 4CMMA 3VW3H 1TTGA 1RUKH 3HLAB 4LRIA 3IJYA 2AXGB 5DO2D 1NLDH 2CRYA 1LGVA 1D6VL 1BVKB 3P30H 3QEQB 2ESVD 5H35A 1QRNB 3FO9B 3V6ZA 4QYOA 5ADOL 1GSMA 1P9MC 1R3HA 3EHBD 2XZZA 4MDJA 2EKJA 2DQCH 2D03H 3CSBA 1MF2L 4YZFF 3V0WH 4KK9C 5IB5B 5CWSB 2HWZH 1MAML 3EFFB 5DVNA 2BVQA 1BLNA 2VLLA 3FQXA 1BQHA 1G9NC 1XR8A 3SDCB 5ENWA 1ZHNA 1M1SA 1A0QL 3CFBB 4EDWH 4NO0D 3NFNB 4H0GA 4MQ7B 4JFEB 2GJ6D 2DQUL 3CDGA 2Z31A 3WCYA 3D3VE 1YDPB 5MERB 4ONGL 3WLWD 3BP7A 1NC4D 3QUXC 3TBVB 1T1ZB 4Z7VB 3VD3A 1CFQA 5LKNA 2HVKB 3MJGX 5I15L 1QA9A 4YIQB 1DQQA 4KK9D 1F4WH 2YUZA 2W9LA 3MBED 1CD0A 1H3GA 2GJZA 5EBWA 3IDMA 1MREL 3LRSB 1JV5B 3SGEH 2WZPD 4ZO7A 3GBLA 1IAII 3MXWL 5LJYH 1JWUA 3F12B 5GZOD 2VDLH 1MEXH 4BQ6A 3WS3A 1X6NA 3AB0B 3KR3H 1ITBB 4X0KA 3PIQB 3DRTA 1FVEB 3K8LA 2VLKE 2AJUL 3WNMA 4KZDH 3H42L 3MV8D 4X80L 3H3PH 2CRZA 4QRRA 4DGVL 4HZLB 3T0AA 4OF7A 5BVJB 4Z7UB 4TULH 1UXWA 3EJZC 4IRJA 4UOW0 2ATPB 2DBJA 2E9IA 5EZJA 3IU4L 3O3UN 3TWCL 2X4NA 3VWKA 4DN3H 4M61A 2PUQT 4UILL 4P2QD 4MQXD 3QJFB 1DQLH 4LASH 5I16A 5IJVA 3O11A 1E4KA 2HFFA 3FO1A 4EUPG 4Z7VF 4H1LA 1HSBB 5KN5A 1GC1H 1FNEB 2EC8A 5B38A 1GGBH 5BV7C 1CE6B 5T3ZL 4HGMA 4HUUB 4GRMA 3S5LB 3EYOA 5CUSH 1WTGT 5H94A 4X4XA 2E7HA 1A1NA 3C08H 3UO1L 2VKWA 1B88A 2CJUH 3D2UD 3H9SB 5KS9F 4PJAE 4PBWD 4RGNB 2XKSA 3DIFA 4HFWA 1DQTA 3VXMB 1W0WB 2ATKB 3O45B 1BEYL 5SX5K 2X70B 3QUZD 2VZ3A 3GJEA 4HJ0D 5BZDA 2H1PH 4TQEL 1EXUB 4LCWD 3LS4L 3FONB 2PO6C 1QR1A 3KPSA 1K2DB 1X5XA 3TVMD 3O41B 1H5BA 3LHPH 2P5WB 3WFDL 5ICZA 1F6LL 4U6YA 1JYXA 3TO4B 4HDIA 4KH2A 3TJHC 1OF2A 4A6YB 2PYED 3DRQB 2C1OB 3MNVB 4DUXA 1JNLH 3UBXG 3QCVL 3FB5B 1F4AA 2OYPA 5DJXA 3HAEA 1NMAH 3MRQB 4K94L 1CDBA 2DI9A 5F1IA 1EV2E 2OBGA 4JHAL 1DN0A 5J13B 1E6JL 1U8LB 1L7IL 3G5ZB 4EN3A 5CEXB 3S9DB 5C0DB 3I3BA 1A02N 4FQ1H 3QWQB 4H1LH 3KPQB 4LLMA 1HXMB 1CG9A 1ORQB 3BEVB 5J3HC 2J88L 1B3JA 1WBZB 1J0IA 2BNQA 4CW1B 5I18L 5B3JF 5I8OL 1A47A 2HTLD 5MHSD 1HOCA 2VXQL 4MWFB 5I1JH 3SOBL 2AV1A 5JHLH 4IRSA 3TA3B 4YXHL 5JHDB 2D7TL 4PJ7E 4AYFA 4K2UH 4XP5H 5INCA 5A2LH 4XCEA 2EYSA 5D7SH 5F9WC 3TT1H 2BRRH 2CR6A 4NFBA 4ZO8A 4OCMC 4WHTB 5CAYB 5CD3A 3VXTA 4RMRA 3PHOB 2Y36H 3EDDA 1KV3A 5T1DH 1J1XL 4ODSL 2GI7A 4GSDL 1U6AL 4ZXBC 3SE9L 5FO8A 1PZ5B 1YN6A 1UM5H 1ZS8B 4L9DA 4JEGB 4N8PA 4BFBD 1U2CA 1KGCE 4LKCA 4G9FD 1U8KA 1ZLUK 4LCIH 1IAOA 4JFFA 2XWBA 3OAZK 6FABL 2ADGA 1RHFA 3X17A 1EBAA 1P6AB 3QEGH 2EYRA 1KJ2L 4NO0B 4Y4HD 3CXHK 2QQKL 5I8KH 3EOBB 3DVNA 3LQAC 3TA3A 3TPUB 2HG5B 5ID0B 2VZUA 4GBXB 4HUNB 4OIIL 1ZANH 1MPAH 2UWEF 3CD4A 4JFDD 3HG1E 2PCPB 4MD0A 1IM9A 4OGXL 3QEQA 5H35B 1I9IL 3TV3H 1D5IH 2FZ3B 3PWVB 4JFEA 3QXVA 1U3HB 3FFCB 2D9QB 2R4RH 1LP9E 3ARBA 4YFLI 3S98A 4D0BA 4LFHD 1EMTL 4EUPA 3CDFA 4H1LG 4Q2ZB 1MCBA 3QIWB 4GUPB 1WLHA 3QBTB 2E9JA 2NMSA 3KPLB 1MCJA 4C54A 5LGHH 2VDPL 4OLXH 2VXTL 5C0AE 2JIXB 3L6FA 3MLXH 3U1SH 2ZNXA 2YPLD 4Q58C 2Y4SA 1KCUH 5A16B 5K9OB 5FYJE 2H2PC 1M05B 3P9WB 5I73B 4IS6A 3U1SL 5EBLA 4IHOA 3RQ3A 1HZHL 3EOBA 4WI2A 3ZHLA 4PJXE 1KLFA 1QD0A 4W70A 2Q86B 3ARGD 4P9HH 5DTFB 4YHOL 3UZVB 1XF1A 2A73B 1UM6H 3VRLF 1XGPB 3V5DB 3G04A 1IQDB 3FOLB 5TQ0H 2ENYA 4YHOH 1EHAA 4LVEA 4K07A 3I50H 4K7PY 2PXYC 3O9WA 4NIKB 1N5AA 4LIQH 4UOJA 4QTIL 1ZLVK 2UWEE 2R8SL 3QUZB 5ILTH 5EU3A 1YMHB 3GSQB 4P2QE 5GRJH 1NAML 2X1WL 4A2LA 4R4FH 1GL4B 2YC1A 5HPMA 1HYRC 5JW5A 5I9QB 2OQJB 1L0YA 1JZ8A 2V2XA 3GMRA 3RTQB 2BJMH 1W0VA 4KY1L 5DJZA 1MNUH 1HCFX 2X05A 3F58H 1I3GL 4IRJB 5I1IL 3MJ9A 4R26L 1YNLH 1FLRH 3P2TA 1JGEB 1ZGLA 2QADB 3E6FA 4KDWA 2KDGA 2P5EA 3S7GA 5F89B 2DTMH 1T66C 3O6FB 1S7TB 4ZUWB 1GGTA 1I8MA 5HDBF 4P2OB 2ICEB 1FNAA 4FXGA 4D8PA 3I6GB 5JTWA 1CR9H 2XFXB 1B4JH 1KIPB 2GK0A 4F33A 1CGTA 5HHVH 2CDGB 4G7VH 4LNRB 3DARA 4JFOA 5TDNA 4HMEA 3QO0B 1AHWB 4P5MB 2EDHA 2Q6WB 4JHWL 3GSOA 4KJPD 3ALWA 4HS8H 5D7JD 3G5ZA 4EN3B 3EGSA 5I8CA 5C0DA 1CICB 3HE7A 1ZT4B 2R23A 3JBG7 3VFGL 2XZQH 5KG9B 1G1YA 3IKKA 5DVOA 5FYJL 2EZ0D 2XOTA 1OY3B 2OQJA 2DIBA 3EFDH 2O61A 4DVBA 2Y6SC 4AEHH 5MEQA 1EX0A 2LVCA 1HKFA 1FO0L 1T22B 3LQZA 3FJTA 2D0GA 4QRSB 1UC6A 1FGNH 3GSNA 1WBYA 4R96A 4GRWE 4PB9L 3O41A 2FX7L 4LL9A 5ICXB 5ICZB 4EOWL 3MLRL 1UG9A 4JR9H 1QACA 1CXFA 4HKBB 5CKAA 3F7YB 3QPXH 5HY9B 3BHBB 2EEDA 4U1IA 3WEXA 3VG0L 1CICC 1KBGL 1EAPB 4TNVK 3FB5A 3U6RB 4KZDL 4ZNEE 2AJUH 5BQ7B 3QPXL 1JNHB 5AZ2L 4G6AC 2FL5B 3H3KA 2YK1L 1JMZA 1BIIB 1UQSB 2DKMA 3LN5B 5D5MA 1H5BB 5GRWA 1J05B 1YEFL 4YDJB 3VGEA 5C0BA 3EO0B 3DGGA 5F7EL 5IFJA 1NCAH 3MCKA 3W9DA 4BZYA 1DDHA 3QYCA 2R69L 1UJTA 4ZG1A 4MA1B 5C8JB 1AKJD 1AQDB 2AKRA 5DUML 4PRPE 3HZVB 4L9LA 2AV1B 4ZFOB 4M8QB 3V52L 4KI5D 4F7EB 2YXFA 1K85A 1P2CA 4XAKD 3TN0A 4HGWA 2JIXD 5C0AD 5C09E 1NDMA 5CZXC 4HKBA 2DYPB 3P4MB 3UJIH 2Q7YB 1KELH 1RK0A 3DO7A 4NQCB 2XNAA 4BELD 2PYEE 3K7UA 4HPOH 1DQJA 2B0SL 4YO0A 3SDAB 4GQ9L 5F3BB 2B2XL 1ZVYA 2Y72A 4JVWA 4OJFL 4ONOA 1BIIA 1HNGA 4U31A 3X13B 4KDVA 2WP3T 4ZS7L 1KC5H 4H88H 1H3WM 4EDXB 5H2BA 4QNPE 25C8H 4WFED 4B7IA 5GGVH 1LEIA 1A7NL 3QR2A 5HGAA 5LBSL 4ZYKB 5CGYC 3PWUA 2B4CC 2VLRE 3HG1D 2APTA 2R2BB 2LV4A 2ID5A 4N5ED 1AJ7H 2YHGA 1NCCH 1F3JB 3NCMA 4APQA 3IKCB 1MIEH 2CKNA 5T1MA 5F9JB 3DHJA 4DKEL 4YPGA 1C5BH 4HGWB 4G43B 2PYFA 3WFHA 2IGFH 3FOLA 4L3ED 4K7FA 4LKCB 5I8OH 1N3NB 1JWSA 4LLQB 4ZOAA 2YOCA 4KKAD 1GGCH 4EI6B 3BKCH 4Y4KD 5J4MA 3BDYL 4WEUD 2JB5L 1EEUA 3QG7L 4YBLB 5CP7A 1DUYB 4PJBA 5SWQA 1Z9OA 3PWPE 3CMGA 5MEND 3CCHA 3C6SA 5CMAB 1T1WA 1JGUH 1SHMA 1IGJB 4LVOC 3BWAB 3VXRE 5SV3A 3FT2B 3IFNH 4LCWA 4OQ1A 2A83A 1BQUA 3GZKA 4XGZA 3UDWC 5C2BH 2GJJA 1A4JB 5IHLB 5GS0C 1MLCB 2KZWA 3P4NB 5D4QA 1KB9K 2YPVH 4Y2DA 4PRHE 3O4LE 3U82B 3VD4A 3ZE1F 1CN4A 4N0YH 1FNHA 3O3DA 1MRCH 1D5BB 2ADJB 5JW5B 5CCKL 3HI5L 5KSBE 4R4BA 4XP4L 1J9CT 3C5ZD 5TQ2L 4CDGC 4OF6A 1T21A 4IRZH 2IFFH 4NQCE 4B50A 2FO1A 1NCDH 1RIUH 4KDTC 3UAJD 2D4FA 5A16A 4XC1L 3G6JB 4YGVB 1GJIA 5JORA 2X42A 5TF0A 3AB0C 2Y25A 5BRZD 3QULA 4ORGA 5SWQB 2C3GA 1U8IB 5CEZL 2VE6A 4DFHA 3W0WA 5D1XC 1OGTB 4PRHD 3G6AA 4YDKH 3ZKXC 2P5WE 2UY6A 2VIRB 2RAMA 1G9MH 1AXTL 4JZJB 3CX5J 3T0EE 3ZDXF 1X5IA 4QCIB 1DQDL 4MD5B 3RZCC 1LD9B 1V7NH 3GSNB 3KPRD 3ZTNL 2X41A 2L7UA 1FG2B 2XN9E 1OT2A 1OP9A 2ARWA 1H8OA 1S7RB 4HJ0C 4O2EB 3ZL4L 4D8PB 2KL6A 2O5XH 2XTJB 4R2GB 4KUZH 1T20B 3IFLH 4C4KO 3IGAA 1RY7B 5TDOA 1P7KB 8FABA 1A7QH 2OZ4H 1A2YB 4OBRA 2HWZL 4P46D 4LAQL 3RY4A 5L7XH 3ZKXB 2NTSP 4RQQB 2OZ4L 4EXPX 1NGXB 4OZGB 1JPTH 3QULB 3RY6C 4KVNH 3PL6B 4HQQL 3PWPB 3NIDF 3QUML 4NNXA 3IXTA 4LMQE 1EO7A 2XY2A 4JKLA 4OT1L 1I75A 5L9DH 5IV2B 2R0ZL 4R0LC 3Q6FB 5IBLC 1JNHA 1QO3A 1A7NH 4PS4H 4QGTA 5F6HI 5A43C 5IWLA 3FO2B 1WWCA 1EJ6A 1P7QA 1YY9C 1G7PA 4OZIF 3A6CL 3QZWB 2DQTL 2NY1C 3BGFC 1KYOJ 1W8OA 4Z76B 3NIFE 4YAQA 4DUVA 3QXDA 3OX8B 2WNGA 1BM3H 2E9WA 7CGTA 5C3LD 1INQA 3P9LB 4XPBL 3K1DA 5GZOC 1S3KH 3T09A 3LQZB 1BM3L 2A38A 4IDLA 4U0QB 4QY8A 1IC5L 5FYKH 3O4LA 1AI1H 1K2DA 3OV6A 2IFGA 1T7YA 4X99B 3MZTA 3MREA 2CQVA 4IMKA 1RJYA 4LLMB 3VG9B 2BXYA 4D9RE 4HXAH 2GTZA 1KTLA 4PRPD 2XTLA 3L5XH 3H8NA 3SJVB 4OZFG 5J6HA 1ORSA 3ROOA 3OAUH 3HG1B 1MCFA 4Z9KB 1OVZA 5CP3A 2JELH 5EOTA 4YBQC 2YA0A 1FE8L 1FL5B 3CSGA 3KPRA 5BMFL 2A77H 1LQSR 3D25A 4MDJB 3ILQD 3RIAF 1QSEE 1K4CA 1MCIA 4JGMA 4Y19A 1Y6MR 2H6PA 1QFWL 2PW2A 1LE9B 3CU7A 5CUSL 1YEIH 4PY7B 2AABH 4JRYB 4JFQA 1HXMA 1ZHNB 2IQAB 1JZ2A 4G3YL 5HDLA 1KXTB 3L3DA 2VDKL 2VLRD 3VRIA 4JM4L 4X7SL 2FH6A 3O6KH 3O3EA 1S7QA 1F4XH 2GUOA 5DEGA 3LRHA 3VXMD 4YDIL 5C0FB 3EDKA 4NPYB 4PJ9A 3CCHB 5I1EL 2YEZA 1LEGB 4IM8A 2P5EE 1AO7B 1Q0XL 3UTOA 3LS4H 1ZHLA 1EGJL 3STLA 3H7BB 4R9HA 4H26A 1MRFL 5TFSL 1A6PA 4N9GA 3OPZL 3L1OH 2UZXB 3ECBA 5D1ZA 2DICA 5IHUH 4FOMA 3C5JA 4KKBC 5EUOE 1ND0A 1I8KA 3RVTD 3D25B 4L3CA 3WFBH 1G9ML 3VFSA 1P7QD 3ARVA 4QTHA 4I18C 3O6LH 3BZEA 3KGRA 4MLIA 3AM8A 4P3DA 4GJTB 4LPWA 4NNPH 4NWTH 1UKSA 3C60C 3K0WA 4RGND 1CGSL 1UADC 2HP4A 2OMBA 1G9NH 3D3VA 2DM2A 1I3RA 1R3IL 5L88H 4FQJL 3T2OA 2VERN 3SOBH 1PQZA 2C5DC 5D2LB 5E6YA 4XWGH 1KJ3L 1Z0NA 4ONGH 4WW2A 1A7QL 4G6JH 1YUHA 5GGTA 3DRTB 3SDXA 3BKYL 5EOQH 1FZJA 1NEZG 2WUBL 1CDHA 3WN5A 3OJ2C 3H3BC 3UC0H 2BFVH 4LHUA 2HKHL 5MEPB 2IH1B 4LOUC 3CLFH 4EBQH 3OSKA 3S5LG 5E99H 4HBCL 1UJ3C 5CP7B 3EFDL 3GO1L 5CLTA 2LAAA 5GS1B 5L8JB 2APXA 4YHYB 1QPPA 1NMBH 3MBXL 4OLYH 3ULSA 1IARB 2B1AH 4M62L 1F90L 1V7MH 1NC2A 1D3CA 2NXYD 1OB1A 4J3OC 3HI1B 4WEBH 3SGDH 1U58B 1MI5E 4RQQA 1GXEA 1BD2D 4XH2A 5T1LA 2K9UA 3NACL 3MV9D 1J0HA 1KENL 3TA3D 4X6BA 4U6XB 5J1TC 3GUTA 3VGAC 3TVMC 4A6YA 2NY6D 2WANA 1S5IL 3BP5A 5F7LB 5C1MB 1KENH 1VEMA 4G5ZH 3ARSA 5HHNB 5F1NA 1QHOA 3RGVC 1IEAA 4LSQL 4GXVL 3EYOB 3NCBB 4RBPH 5F1IB 2G9HA 2PYEA 3ARDA 2ZZUT 1CGYA 1LE5A 4NUGH 4JQXA 1V5JA 1I8MB 5LGKA 3FL7A 3VFVB 5JXAH 2HT4D 3HS0B 1I3VA 1K8DA 1T83A 1A7RL 2XRAL 3G5YB 4KK8C 1VACA 4PLJD 4M6ML 3BUYB 3VI3E 2EDXA 1MFCL 3KJ6L 5D71L 2MNUA 4PJIE 4FABL 4ODWA 2CLRB 1C5CH 4QY8B 1A6AA 4PRNB 4U3XA 4QRQA 3TCLA 4XXCC 1JE6A 5IVXE 5D2LF 2XPGB 3UJIL 5C2BL 3GHBL 3PNWB 4JGJA 4KKNA 3UPCA 1QBBA 2I07A 2BY2A 4OFDA 4RRPA 4M02A 4LPVA 1I1AA 4LBEB 3TFKC 3PHOA 4XNYL 4MQXC 3QO0A 4RA3A 4ZNEA 1IBGH 1NLBL 2JKXA 4UQ2A 1MCSA 1F2XK 5JOFA 2G9HB 4TTDD 2EIDA 1CFVL 1W72A 1QHPA 2GY5A 3GGWB 3KHOA 3OJDB 4U7MA 1Z5LA 1LO5A 3QDMD 2DAVA 4KAQL 4JFZL 2XYCA 3S8WA 4JREC 5F6IC 4TUJA 2ARJB 4U1MA 1GGIH 2DN7A 3E2HC 3MA7B 1N6QL 1XIWB 2JJUA 2JCCB 4KAQH 2ZUWA 4NKMA 3QXDB 2AV7B 3CFKB 5B3JE 2Z31D 3WJLC 2VTFA 5KW9H 4YEFA 5GRJL 4WHTA 4IBLT 4QXUH 5EFIB 1G6VK 4JRXD 5F7MC 2XWTA 1ZLWK 5IIEB 1S7QB 3QPQC 3HNTL 4ZUUA 2VLRB 2R2EA 3T3MF 4PV8B 5JHDD 1SJHB 2WWKT 5F72S 5IEKB 4MB5A 5FM5M 3TC9A 1FPTL 4NN6B 5A2KH 1ZLSH 4PLKD 1C12B 1VADA 4OF0A 5HXMA 4H26B 4AG4H 2OJEB 4ODXB 2P5WD 3DI2B 4HCRH 1P84J 2DM4A 3ZL4H 4NRXA 5F7YC 3MOQA 3BMVA 4WI6A 1H3UA 3T1FB 3KPMB 2Y06L 1LP9B 4LLYB 1FL5A 1M71B 3BZ4B 4M1DL 2Z92B 2YD1A 1A22B 1H0DB 3MRCB 1AGCA 1KN4L 2ARJA 4QRRE 4M1DH 1F58L 2Q1EA 4MNQD 3BJ91 3REWA 4I3SH 4HCRA 2W60B 1T0PB 2QKIA 4HS8L 2EE9A 4HG4K 3ARTA 3JWDC 5J1AA 4X9GA 5IFJB 2EXWD 1WUNT 2ZUQC 4HIHB 4MDIB 2CK0H 4KVCL 4ODUA 5K59F 1BIHA 1A21A 4JJHA 5HGHA 3VFPB 3HKFA 4QXGH 3OG6B 3GJFB 4LRNL 4ZDHA 3O6MH 1IJ9A 2YR3A 4U6HA 1CL7L 1C5DA 4DQOL 5GS0D 4ODBD 4JPVH 5KVDL 1OLZA 3EJYC 1MUJA 4LRNH 4P0DA 4O00A 2H6PB 2AI0L 3U36A 5IW3A 2P48B 3NZHH 3MRLA 1MPAL 4X6DE 2DQEL 1NGQL 4TSAL 5FUOH 1T4KB 2ESVA 3C9NB 4EEEA 2FSEB 4UI2A 4XP9H 4Y89A 1OGAB 2KKQA 4KC3B 3GSXB 4PGCB 4I2XB 4Z7OE 5AYQA 1EFXB 3T0ED 3L3OB 4CMHB 5EWIL 4F3FB 4KKAC 2GSIA 5CZKA 2XQBH 4YFLF 5IB4B 5EWIH 3L6FB 3TJEH 4NOBA 3KPSD 3P30L 1BFTA 4U1SB 4HIHA 1B2WH 2Y1VA 5B4MD 4XMPL 4LCCC 1CDIA 4HW6A 4Z5RA 1MCWM 5EH1A 5GGQH 4CJ1A 1MHCA 1NAKH 2DDQH 2B7DT 3PV6B 5FGSA 4YPJA 4AT6A 5IQ9B 2YBRA 3BVNA 3K2MC 1AD9B 1O5DT 3OTTA 4M5ZH 3R4DA 2F54E 1G9EA 4O58L 1HSAB 5J56B 4JFOB 2EDKA 4LSDA 5EO1A 3RBGA 1NCWL 1UM4L 3GMQA 1HN1A 3BP6B 2X4OB 4Z0XB 4JREB 5D6DC 5KJRH 4G7YH 4NQSB 5DVKA 3GSXA 5F89A 1XGQB 4RISH 4U1HA 5EU4A 1IKNA 2HN7B 5D7JA 5DD3L 1SM3H 1DBBH 1CFVH 3HPJA 1YYLL 4GT7A 5BO1H 5GS2H 1TDQA 3PDOB 3QXTA 3D9AH 3LKPB 2M26A 5I6XC 3L3HB 2KZ1B 2ZOLB 1MCQA 1OSZB 2FR4A 4WV1A 3MUZ1 4KI5C 5ICXA 2G60H 1FLRL 4YFDB 2HFEB 3O6FA 2N56A 3N50A 4PTTA 1XF2A 5GSVB 2BHYA 1JNLL 1ZOXA 2A2QT 4NWTL 3BUTA 3QHZH 4E41E 1AJ7L 4OGYH 1JIBA 2EDNA 3O3DB 4F33B 2BXZA 1UWEL 2GQHA 4M3JA 5DURD 4K3JL 1H15B 2A9MH 5C0JB 1FCGA 3UYOD 5DQDL 1FNGB 3EO9H 4UQ2B 2MHAA 3HMXH 1XR9A 4GAGL 1XF3A 2V2TB 2VLME 3PWNB 1RU9H 4IDJH 5HYFA 2FATH 3NA9L 4NQSA 2AEWA 1G0XA 1I1CA 3VFVA 5T1KB 4LASL 5C0AB 2MCG1 4Y1AD 2YSSB 3D39A 4MHHG 3BDYH 1R3LA 2C3WA 2IAMA 5K93A 2WBJC 1Y18B 4ODWB 1KIQB 1S7WB 1D5XB 5A2IH 4JZJC 4PJDF 4K23L 4ZFOA 4XPTH 5DWUH 4YEEA 3A6BL 1NQBA 3KPNB 1LDPH 2R29H 2ZG2A 3UZQA 1BZ9B 3P4OA 3MZGB 3H9SA 2NXZB 3SDDA 5BZWB 4BJLA 1X7QB 3U0TA 1YEHH 4JFED 4FZEL 4XAKE 3ZHKA 3VXQA 3SE9H 1P4IH 2AW2A 3QUMA 4UB0L 2H2PD 4UINH 4FZEH 1KCSL 3I9GH 2Z92A 1T80A 4NGHH 1OQXA 2DQEH 2UYLA 1A3QA 1DVFC 4U6YB 4IMKC 4GLRH 3FMGH 3Q5OA 5FOJA 4Z76A 1RIUL 4MXVE 2F15A 5DRNB 5LQBL 1AO7E 4AM0A 1FCCA 1U93B 3ZSTA 1EERB 5FUZL 3LEVH 3LN9A 5KANI 4CVWA 3O4OB 4LSQH 3EYFB 1MFDH 5KSAB 1KJMB 4P23B 3Q6GH 4OV5A 3HI6H 2DYPD 1JZ4A 4FZ8L 4CVUA 3HC3H 4MAUL 2RFXA 4LSVH 2AV7A 3SQOL 5CD3B 2R56H 2AXGA 3AS0A 2IWGA 1I85C 4MAYD 3U7YH 3MNZA 3RJQB 3CGTA 2V7NA 3LS5L 1ZS8A 1UGNA 1H0DA 2PNDA 1KCVH 5L0QB 2D7MA 4LU5L 4OCRH 3TBYA 1IGJA 3T65B 1NFDF 5GJSL 1G7LB 5B39B 5EORL 4HUMB 1CIUA 3L7EA 5E00B 4KXZH 2F19H 2F5BL 5MEOB 4UDTB 1LDSA 5AYUH 4BH7B 4FQLH 1Q1JH 3IKCA 3MBEA 1PFCA 4NDMB 1S9YB 5BO1L 1LMKA 3UTSE 4AT6B 2A6DB 2GTWB 2FIKA 4OZHE 4XTRD 3S34L 1V7ML 1IAIL 1KG0A 4OKDA 2VN4A 5IMOB 4LCYB 1SMAA 2IANA 1U41A 5FO7B 5D7KD 3ULVH 1Q38A 2B4CH 3F7VB 4PRBB 3BI9X 2NY2C 3H9SE 1UH3A 5DHYA 1JVKA 4TPRL 4NO5B 3MOAH 4HT1H 2CR3A 4ZDHB 2H9GB 4KDTA 2DRUA 3C6SB 3VXRA 1D9KD 3BW9A 3FQWB 4GXUM 4R26H 3T65A 4N0UE 4HGKC 3VFMA 1I4FA 1YN7A 1OD9A 1EDQA 3T1WA 3OAUL 1S7XB 1G7HA 4MXWH 3MLZH 1DSFH 5TH2B 9CGTA 1JTPA 1CD8A 1QUNA 3RA7H 1OGAA 5HHXL 4KTDH 4XP1L 2X4OA 5BJTA 4N8VG 2VDMH 4MHHI 1KACB 1QFWH 1Q94B 1TVBA 3IXAA 4ODVL 4J2XA 1NPUA 3MQIA 3EYUL 1WITA 3WNKA 2YPKB 4XPTL 2NY2D 5DWUL 4Q0XH 3E8UH 2BY0A 4Z7QE 4L8SA 5C0CD 4M1CD 2W9EL 4OGAC 5FHBL 4NP4L 2R1YB 3SKOA 4GG6E 2WV3A 4JANA 3BZFA 4QRPB 1DFBH 1RURL 2XG5A 3FRPG 1QEWA 1BBJB 2AJVL 1N0XL 3W0WB 4O2EA 4OQTH 5TDPB 5IQ7L 2ZKHH 3MLSL 1JHTA 3FQRA 1CXHA 3BW9B 3FQWA 3O6ML 4X7DC 4PUBH 5F71A 3MLYL 5C08D 2V2WA 3FN0H 3KPOA 3MXVL 3HRZB 3O0RL 5FDWB 4EOWH 2R0KL 5DJ0A 4ODTH 3FCTA 3WFCL 1N7ML 2ED7A 3SE8H 3VW3L 2QSVA 2AJXH 5K59E 1NGXA 3I6GA 4JAMA 1XFPA 1ORQA 1G7JA 4XCFL 2CLZA 1GZPA 3T4AA 3HPJB 3RVWD 2HKFL 5C6WH 1NANH 3GI8H 4HJJL 2ZUXA 3SGJC 2EDWA 3HZYA 4PJAA 4H20H 3S36H 5J57B 1BX2A 2EIEA 1ZHKB 5ESVB 2FR4B 5ADPL 4I0PA 2FX9H 5CJQL 4BH8B 3PL6A 2J88H 3O4LD 2AJYL 1IGIL 2DLFL 4PG9B 1AGBB 1B4JL 1WT5C 2ZCLH 4WDIA 3GSRB 4YHLH 4G7VL 3OR7A 4R7DB 4H0HB 4KGJA 1CXIA 3GDBA 5D1QB 1AHWA 4MVBC 4P5MA 2L7JA 1XF3B 3TBSB 1TXKA 3V5HA 4UU9B 2EKSB 3LKNB 1NMBL 1EEZB 1IM3B 2GAZA 4IOIB 5M7QA 1F90H 1WAAA 2BC4B 1DBAL 1MCPH 4XHJC 4YQXL 1HIML 5E08L 3ARUA 1DVFD 4F7CA 3ULUC 5E0QA 4LLUA 2MMXA 4PRNA 4DQOH 3L5IA 4TSBL 4OZIE 4WO4A 5DQJB 4ZTOH 1J5OH 3MLRH 4PJCE 5HGBA 4JR9L 4K3JH 3RNKA 3RWFB 4JB9L 3IS1X 1FYTB 1NEZB 1DJSA 2ARJQ 4MVBD 4S1SH 3IVKA 5T3XD 5GGSY 4QXWA 1FSKB 3FQTB 4TULL 4CVZA 5DJAB 3KPPA 4KJWC 5F8RC 1S7VB 3IAPA 2WMPA 3ILPB 3QZWG 5C0FA 4LSUL 1UZ8B 2XQBL 3OZ9L 1NDMB 3MTRA 3QIWA 3VA2C 4K2UL 2OJEA 1NFIB 4ODXA 3ZE0F 4F7PA 1QSFB 2VABB 2Y23A 2IALA 4WUUE 2QADD 2ZUTA 1MY5A 3TNNB 1LK3H 4PFEA 4ZUUB 2BHZA 5CJXC 4RMVA 4L3CB 1UT9A 4WI8A 5KTEH 3ZYJA 5DFTA 1P4BL 1QTYT 1KCRH 1Z9MA 4Y1AE 2NW3B 3DVGB 4L4TD 4K3EH 4NHCH 5FEBA 2VDPH 3B9DA 4MJIA 3MBEC 2DMKA 4R97C 4Z7NE 5DK2A 1BEYH 3IVKB 1QOKA 4OZFB 1ZKAA 1U8OB 1R6VA 1T2XA 4M7LT 4ERSH 4X5XA 1BJMA 4LHUD 4MAYB 5BW7C 2NX5D 5HD8D 3VFUA 4EDXA 1DUZA 2H9GA 4MNHA 1TZGH 5GISH 5I66A 3BISA 4K7PH 4JCLA 4OQTA 3FQXB 4TRPL 1T2QH 3SDXB 3ESUF 2P1YA 3EW3B 4G80B 4WHCA 2I5YH 1N2RB 5FO7A 1T2QL 3G9AB 4F9LC 4V2BA 3TBWB 3TNMA 4HK3J 1OAXL 2X89A 4NYLB 3WO3B 2XZAH 3BPNB 4GKZB 3V6FB 5ID1A 3V6OE 1NFKA 3EO1B 2IAMD 3NIGF 1MJ8H 4TVPD 1FL3A 4O51A 3BPCA 1RZKL 4KRMB 4HWBA 2A83B 5DK2B 1ZGLM 4E41B 1S7XA 1V3MA 1HQ4A 3VI4F 3X3FH 1N6UA 3BJLA 1AO7D 1YNKH 1ZE3C 4LARH 2DM3A 4MS8D 2WW8A 4XPAL 2H32A 4NKDA 1D6EA 3P40A 5C09A 1A6TA 3IU3A 3FOMB 4PJ8A 4Y2DD 1J1PH 3QQ4B 4LFHG 4M48L 2JB5H 4R0LB 3QQ9D 4EVNB 1FC1A 3T0BA 3DTXA 1Q94A 4P46C 3N9GH 5GJSH 4HUVA 3L3OA 4P2OA 3AAZA 3TZVA 1AXSB 1VKXA 2BRRL 5AEAA 3SKJL 3SY0A 4P57A 1SJEB 4BYHA 1F6AB 3D0LA 4YHKH 1EEYA 5DJCA 5EZJB 2HFTA 4NYLA 4CU7A 1J0YA 1PLGL 5ISZB 1RZ7H 4JFFE 1G1CA 4OLUL 3PJSB 5FCSH 4X6DA 4NCC2 5GGTH 4FG6C 5E8OA 5IG7B 2AJ3A 4WW1B 4OF8A 1E28B 4HWZA 4PGBB 3HUJE 4ZTOL 5E6ID 1Y6KR 2FL5A 3RPIA 4NKDB 2AI0H 2PXYD 5E8EB 1BBDH 5FB8B 1IFHL 1JGVH 3LIZL 1JRHH 1M7DA 4WY7H 3VJ6B 2KQNA 4UMGA 2E3VA 3BGMA 1F6FB 2I27N 4JVUA 5HHOA 5LAXB 3O11B 3C09B 3UROR 4YUEL 5JXAL 1I8LC 5J6GB 4P23C 5FDYA 1TETH 5KVEH 2PETA 1G7QB 1VESA 2XWTB 3OKEB 4YX2H 4HUUA 4B5EA 5JDJA 3GHEH 1JL8A 1VENA 2NTFB 5I1CL 3CVHL 4J3XA 3MA7A 4XNZC 3K1KC 4BK5A 2DQCL 3AY4C 3TIEA 4JDTL 2D7NA 3R1GL 2CLZB 3B2UC 4W81A 4ALAH 4LQFL 1AKJB 2XKNB 2DKUA 3TCXA 3K4ZA 3MRQA 2OL3L 2CDFA 5ICYB 4FFYL 4RNRB 1F4XL 5DO2C 5FM8A 3IDJB 2BNUB 3TO2B 3FFCE 2Z4QB 2CIIB 4FNLH 5I1HH 4Q9RL 1UCBH 4DGYL 1CG9B 1MCOH 2DD8H 2EO1A 3MRDA 3O2DL 3OX8A 3MRBB 2BHUA 1UCBL 4NQCA 4YBLC 3RX7A 3QUMB 5TFSH 3MGOA 4DGYH 3BRDA 1TITA 4MDIA 5L0QC 3P73B 1TZGL 3VXME 2IMNA 1HOCB 1XCTB 2XKUA 4JRXE 1C1EH 1UB5B 1ZWIB 4NQVA 2F54D 3JTTB 2BJML 1P7QB 3RHWF 3TYGL 3KPNA 2GT9B 4U1KA 4AIZB 1VB9A 4M43H 3B9KB 2F53B 3B8YA 2VDQL 4HUWB 3LKOB 5F88A 3S97C 1CCZA 1EEZA 1VGEH 3M8OL 3GMOB 3ES6A 1QVOA 4I3RH 1P53A 2EXYC 1Q9OA 2JK5B 2R1WB 3CPLA 3KPRB 3VFNB 4X5XB 4G9FE 3MRNA 2HT2C 5FYKL 3EYFA 1AI1L 3HR5A 5C6TH 1MH5B 4C55A 3L7FA 1JMXA 4L4JA 1XGTA 2FWOA 5A2FA 4X6FA 5GZND 1BJ1H 4JKPL 2X4UB 4H0IA 2X4TB 4Y19E 2IQAA 4LCWB 3BD5A 3OL2A 5CZVH 2GY7B 4JRWA 1VFAB 4POYA 1YMMA 3AU1A 2AEIT 2A6JB 3RGVD 4AMKH 4ODUB 4NM8L 2OS7A 1T7ZA 1GGBL 4KWUA 1TVHA 1S7VA 2BVUA 2GIYA 1DLFL 1RZJL 5BV7B 4PGCA 1AD9A 5IM7B 1CLCA 4U1KB 4AIZA 1FVEA 1EFXA 3BQUB 2NZ9C 3KLAB 4MCYB 4KGLA 5JHDE 5HYIA 4XMKL 5IHZB 4XRCA 1JK8B 3JV4B 1FFQA 1T4KA 3SBWC 2ADGB 3PWVA 3C9NA 1A1MB 4H8WL 2NZ9D 1X5HA 4LCIL 4DKFH 3TNMB 3QQ4A 4MCZA 5C92A 1A6UL 1J8KA 2HJKA 3H9HA 4WU7A 5IQ7H 4LRIC 2XWJB 4MD4B 2MSPA 1MRCL 5AZEL 2HFFB 3W82A 4Q6IB 1I7TB 5FYKE 1IGTA 4X9BA 4PJCA 4QLRA 5IMOA 1KPRA 2MWCA 2YPLA 1CE6A 3QEGL 5CBAA 3LDBB 4GXVH 4Z7UE 4S10A 1MVUA 2BMKA 1FHGA 4BSVA 2F54A 2A6DA 3FO0H 4NQDD 5IQ9A 5IJKC 4KHTH 1I1AD 5T1KD 2LFGA 4WV1C 4GQPH 2LTQB 4KHTL 4PJ5E 4Y0GA 1NH6A 3BIKB 5GIRA 3QUYA 4U05A 1PD6A 4IJ3C 3OB0H 1R5VA 3AXLA 1JN6B 5HYJE 4KQ3L 3LPGA 2H32B 3O81A 5ADPH 5JO5A 2FHCA 3VI3F 4ALAL 3W5NA 2IF7A 1UM4H 1EGJA 2XWJA 3CFCL 3BGMB 1HXYB 2R56L 4KI1A 4PG2A 5FM5O 1ACYH 3D2UA 1NAMB 5D71H 3U7YL 4JRYD 4H25A 1Q72H 2VITA 4TNVF 1T20A 2Q76A 1WCBA 1RUMH 1U8QB 7FABH 2D7QA 5D2NE 2X4SB 1A6WH 2IJ0C 3BZFB 4AL8L 1Q9KB 3MRPA 3SGJA 3ZO0A 2HJFA 5T1DL 1ZV5A 3R8BB 3EJYD 2P5WA 4R90L 4APQC 3LCYA 1G6RL 25C8L 3E3QC 2PTTB 5LAXA 2VKXA 3BX7C 2VDNL 4U1JA 4JZOA 1U91A 2XT1B 4WTWA 5DR5H 5LWYL 4JZNB 2CO7B 3ULVL 1KT2B 4IOFD 2PYEB 3EOTH 5GHWH 2CIKA 4DN4L 1F97A 2HT2D 5C07B 4LLDA 4WWKD 4DAGH 3OBAA 4XTRC 1I8LA 4M00A 1P84K 1GH7A 4GOSA 4YDVB 4BM7A 1FPTH 1V3LA 3WL9A 1ODAA 4TUOB 2YD4A 3WUWG 3GUTB 2YUXA 3ULUH 3D39B 5IGXL 5HHQA 1U8QA 1WEJL 1QQDB 3FFDB 2R9HD 4UIKL 4N0CC 2A0LC 5I19H 3RVUD 4X98A 4YHIB 3K3QA 5DRXA 3QI9B 5DD6B 4KTDL 4XP1H 3WD5H 4WHDA 2FIRT 1GIGH 3NGBC 4XVSH 3BPOB 3ZDYF 4PY7A 1AGBA 5CEZE 1SEBB 1IAOB 2YPVL 1TMCB 5BOZG 1QVOB 2BX5A 4Z78A 3CC5A 5JQ6H 4GRLB 3MGOB 3BKJH 1H3PH 1MHHB 5I73C 1KF9B 4C56D 4LVNC 1C5CL 2WINB 4AEHL 4ZPTA 3T0EA 2DBLL 3QO1A 1I7ZA 5JW4M 4WU5B 4N0UA 5E9DB 3KXFE 2XQYG 3R06A 3UBXI 3JWOL 5FA3A 5AAMA 1RMFL 3BHBA 4J1UB 4P9HL 5EU7E 2B5IC 3FB7B 4KKLC 4AEFA 5L2KB 4QHKI 4LDOB 1JHKH 1OPGH 1FZMA 2V7NB 2ZOKA 5E4EC 1A3RH 1RIHH 1UQSA 3QQ9C 1E4XL 3JUYA 4DZ8B 2XA3A 1INDL 2BNUA 4H8WC 4MYWB 3TO2A 1DBKH 5GSRA 3UTZA 3BT2H 2YEZB 4OM0H 4P9MH 4NBXB 3QISA 3BRFA 1KTRL 3FZUD 2HJLB 3OPZH 1KG0B 1FIGL 1G7LA 4HKZB 1XF5A 1IL1A 1CU4H 1DQLL 1VFAA 1M7XA 3MYZA 1CK0H 1LK2A 1MRDH 3HFML 2ADIA 3KXFD 3E6HA 2AKRB 3WDJA 1T7XA 3FAWA 2P49B 4IHOB 3BH9B 1PKQA 1MH5A 4JLRB 5TE7H 5BS0B 4ENED 4DVRL 3DX7A 3O8XB 1JF1B 2DTML 1OP3K 3MLWH 4JFEE 1E0OB 4S2SA 3KYMB 3SKUD 5B39A 1J88A 5L7XL 2D03L 3IDXH 4OCYL 3SCMD 3CVHA 1CI5A 1UEYA 4NRXB 5EZOL 2E7CA 2R2HB 2DDQL 5KOMC 3FQTA 1OTUD 3VGAB 3MJ6A 1NCUA 5BJTB 3DVIA 4G6JL 5HVHB 1WC7B 5D7IF 1BAFH 2FGZA 5CD5C 3NPSB 4CAGA 4I3SL 5FKAB 4ZFZB 3WFHB 2YPKA 3LHPL 3MRLB 1J0JA 1BZQK 2NW2B 5JMRA 2QHRH 4WHYG 1OARL 4P23D 1ZHBB 2LU4A 2XN9D 3DYPA 5SWSB 4RCAA 3MRJA 4LHQB 1OWRM 3SKOB 5F7WC 3BMWA 2EEBA 1F3JA 5I1DB 1NJ9B 1DBBL 3NCYS 4RIRB 3MLUL 1MWAL 1YEDB 4MNHB 3LZFH 5E8DH 5CMAA 1I3UA 4NO3A 1BD2A 1IAKB 1KCLA 4I77H 4JB9H 3GB7A 4PJIB 4P4KC 4B0MM 4UAOC 2Q76B 2I24N 1EH9A 1OAKH 3LMJL 5EU6E 3U30C 4LVHC 4NO2A 5IT2H 5KVFH 4JQIH 4JFDB 2APVA 3LIZH 4WUKL 2AXJA 3GSOB 5I1AA 5KVFL 5IGXH 1HILA 1DSFL 5FYJD 3QA3A 3H9HB 4WU7B 1OSPH 4UTAH 2OTPA 3DBXB 4K71B 5GS3A 1MFEH 3ORJA 2OJZH 4KKCC 1U91B 1NBQA 1WCBB 1GIGL 5KS9B 5SV4A 2NCMA 2DL2A 4MA7H 5C07D 1HHJB 3A6BH 4XVTL 2FHBA 1K8IB 3SGKC 1OGTA 2FJGA 3BKJL 3W0WD 5FCUL 4Z6AT 1H3PL 3TBTA 1Z2KA 3BKMH 3PWJA 4OBSA 4UT9H 5B38B 2OL3H 5KAQG 3BIKA 5GIRB 3H7LA 5BVJA 3SJVE 1KELL 4MD5A 3NTCL 3FZUC 5DJ0B 5I75B 1CFSB 1RIVL 5ELIA 5DJ6B 2X4RB 3V4PL 3U46B 1OP3H 5SX4H 5GISL 1B0GA 4ONHB 4YXKH 3RU8L 3W2DH 3F5WB 3GSUA 2IBBA 3BOVA 1KJ2A 1B90A 4JRYE 5HSFA 1ZANL 3L3GB 5JPMB 3RPIB 4YDKL 4Y5XB 3B5GA 4F7CB 4U1LB 1I9EA 2ZJSH 4X4YA 1U36A 1Q9LA 2ICES 4HWEL 4UOW1 3IDNA 3MRPB 1CU4L 3I6KB 4HH9A 1Z5LB 2NY3B 4Q74A 5CJ8A 4D9LL 2I5YL 3C8KB 3ZTNH 3RNKB 3RWFA 5JW4R 3M8OH 4J3UA 4Y1AA 1XGRA 4GKOA 4WO4D 1DL7L 4XMLH 4JN1L 3DMMB 4XXDB 4HWZB 5GJTL 1MFDL 1RPQA 1L6ZA 1EFXD 2GYSA 4JO3L 5FK9A 5C08E 3T0EB 2R2EB 5MHSE 4F9PC 1FG9C 4RAVA 3OKKB 1ZLVH 4LPYA 4YHNB 5EZOH 4OAWB 2H3NB 4P5TD 4XNQB 4OLVL 2HJLA 3VMNA 2XN9B 4NZRL 1JNNH 3UTTB 1JPTL 2GK2A 5FYLD 4ZS6C 3OWEA 3DJ9A 4UUJB 2BP3A 4X4ZA 4NZTL 2BY3A 4YHKL 3UPAA 5I15H 2CRMA 4G8FB 1OAZL 5E08H 3ZZ1A 4BUHA 4YHIA 3REVB 3AREA 5D7LE 4HQQH 1KOAA 5B8CB 3C8KA 3PV7A 3VMPA 2GJ6E 3C8DA 5IVOA 1WV7T 1RVFH 4JFPA 5FGCB 2FH8A 4OZGE 3BEVA 4OLYL 2DQTH 2XACC 1L9NA 3A6OA 1RZKC 4O4YL 2Q8AH 4APQD 2ADFL 3E6HB 3NFSH 4XPGL 5DC4B 4ZUTB 3VFPA 5HGHB 4RNRA 3ARFC 3ZYOA 1FL6B 3NCEB 5I1IH 1LO4L 1S3KL 4F7TB 5IB2A 3OKKA 4M6OH 5DMYA 2MJWA 1NBZA 2C26A 4JY4A 5HHOD 3SE4C 4YUEH 2UVFA 3U36B 5HJ3B 4OV6F 1W2KT 1D5MA 1I1YB 3UPRB 2V5MA 3SJVA 1WZLA 1VPOL 4NZUH 4YNYA 3RDTD 4NQDE 3MNZB 5D70H 2R2HA 3LH2L 5J11B 1ETZA 1YEKL 2J5LC 2NY5L 4PRAA 4OCSH 3U0WL 4OGXH 3GI9H 4O9HL 1K4CB 4FQCL 1DUYA 3ULUE 5B8CA 1RAMA 3RVXD 3Q6GL 4BSWA 3QXAB 1WBXA 5DD1L 4E42B 2P24B 4YR6B 1TZHB 4Z7WA 4K94C 4I1NB 2YRZA 2ADIB 4TSCH 1ZGLP 2ENSA 4POZC 1F02I 1TNNA 3S88L 2P7TB 4OGAD 5JNYB 4LAQH 4ORGB 5MI0C 3WIHA 3HE6D 5F9OH 5IB2B 2OK0L 5E95B 2AABL 2HAZA 4TQEH 1NKRA 1QNZH 1UH2A 1CQYA 4RFEA 3TBYB 3TEUA 2FNBA 4O2CA 1ZHLB 3STLB 2VLKD 3H0TB 1DFBL 3T0XA 4YNYB 4PRBA 4DW2L 1NGQH 3D1MC 4TSAH 3MXVH 3O0RH 5JIKA 3UTQA 3IDIA 2W59A 4RMWA 3OJMB 2AS5M 2VQ1B 2PW1B 4S1QH 1T2JA 2FD6L 4QTHB 3IT8D 5D7LB 2Q86A 3M45A 1TVDA 1XZ0A 4DOHB 3GB7B 2NYYC 1G0DA 4G8GE 3D9AL 3QWRA 2X1QA 5BOPA 3O3BA 3HCVB 1NUFA 3L95B 1LO0L 4EN3C 4NUJB 4N5UA 4R6UA 1ZT1A 2FJFB 1M6OB 4FN0A 3T2QA 4NKIL 4KY1H 1JPSL 4YGAB 5H94B 5E56A 4GO6B 2X44D 3QHZL 1BJ8A 1DEEB 1MAMH 3HE6B 1UKQA 2GCYB 4WUUB 3UZEA 3V5KA 5A3IC 3GIVA 5DTFA 1ZLUH 1HHIB 3QWOB 3QEHA 3U7WL 5A40E 5EO9A 4J6RL 5MP6H 3SJVD 2FEDD 3CFEB 3RGVA 1FNGA 1YPZE 4W6YB 3QFDB 4G8GD 3X12B 4XAWL 2NY0C 5CZVL 4QXTA 4KK5D 4P49A 2D0HA 2FJGB 3PWLA 5FECB 1X7QA 3U0TB 2DQGH 1PLGH 2X9WA 3HCVA 3MYJB 4PV9B 4GAJH 5L8LB 3PHSA 2V2WB 4HIJA 5JPMA 3NGBB 1U8MA 4UNVA 3VFRA 1AIFB 1U58A 5E8EA 5L6YL 1RURH 4X99A 4GSDH 3DVFA 1JF6A 1JWMA 1AGEB 3UJTL 4PJXF 3MJ8A 3IETB 2GSGB 4I0CC 1MAKA 4N68A 1P4IL 3BP5B 4DK6A 5AG9A 5JLZA 3UJJL 2H8PA 3LPFA 5E5MA 3WFZA 4NQVB 4WW2C 3L1OL 4F15C 2K1MA 5DHXB 1PJ9A 5DI8A 1MWAB 4DGIL 1CQKA 3BP4A 1UKTA 3EYQC 5D70L 4I9WE 2EDDA 4JG0L 5SWZE 4OIIH 3WS6C 2IADA 3QWRD 4DOHE 1RULH 4UIMA 3MRDB 1KTLB 1JPFA 2BOBA 3OR7B 2C4XA 4PJFF 5TPWH 1BQLL 2J8HA 5GPRA 1MCLA 2N7AA 1N64H 4G9DA 2B1HL 4P5KB 2XTJD 1EUUA 4XVJH 4PJBE 4HS3B 1HEZB 5KOVC 4XVTH 4F2MB 4GW1B 2R4SH 1OGAE 3TBSA 2CRIA 2X9YA 2ZG1A 1RUAH 1MFNA 4YHPA 4OKVA 5IMLB 1W0YT 2JF1A 4JO2H 3MV8B 5IR1B 1WQVT 1EFQA 2J2ZA 3HZMA 3BFOA 3DXAA 4I9WD 5C0NC 3MCKB 5FA4B 1GHFL 5FGBA 1EAPA 2D7OA 3FFDA 4ZPTB 2BNQE 1S8DB 2P42B 2VLRA 5E6IC 1Q9OB 2R1WA 4NQUA 2N4IA 4XBGA 1IC7L 2YUWA 3P11H 4U0RC 3REVA 5IP4A 3FT4A 2DB8A 4N0UB 1RUML 3LKQB 3QDJE 2WBJD 3P0YL 1MSPA 3KLAA 1EHLL 3K80A 5TGBA 2W0KA 1IILE 4GBXA 1VADB 1V05A 3HUJB 3R8QA 5CJXA 1AO7A 1K9TA 2X4UA 5AWNL 2EDEA 3P0YH 5IF0B 1QFPA 4XCCH 1D5MB 2D2OA 1FN4B 3L7EB 2IANB 1A1MA 3JZ7A 4HWEH 4R90H 2Q8BL 3W9DB 2WUCL 3EDJA 5IVXA 2GFBB 2O5ZH 5E2UL 3ULUD 1N6VA 1QLRA 4GAFB 5DMGC 5INDB 3FRUA 3WIFB 5FUCC 4BFIA 1PG7L 5H2BB 3NAAH 3W11C 1EHXA 5I8EA 4FTVD 1NUNB 4TNWK 3WDIA 4D0BB 5E9DA 5IM7A 3P0VL 1XCQB 4DN4H 3GBMH 5IR1A 2VAAA 3JTSA 2YA2A 3DX9B 4OUUA 5DUBB 1UJ3B 4F7MA 3P0VH 4YC2C 5IBLD 3EOAA 3CFIC 3O9WB 4LCWE 4NQEA 2AJZB 3QHFH 5J7CC 2J12B 4NN6C 1UYWL 1UA6H 4XBGB 5GGUA 3WXWH 4IRJC 5HDQL 1QLFA 3T8XB 3GMMB 3PGFL 3W39B 1RZJH 3ULSB 4NQDA 1KN4H 1Q0YH 2P24A 3V4VL 1XF5B 4HKZA 2XRAH 1I4FB 1YN7B 1LDPL 2R29L 1JN6A 4MA7L 2OSLB 5GGSA 3DHMA 3VFGH 3WIIH 5CBAB 4KKLD 4PJ5A 2RQ8A 1T03L 5C0CA 1UM5L 3JV0A 1JHLL 2WP3O 3OR6B 2LVEA 2CK0L 3EIFA 5DD0L 2BRQA 5SWZA 5F7KC 5C7XL 5I1GL 1XCQA 4Q0XL 3RP1A 3TZVC 1ZT7B 3TIDA 5L6YH 2VR9A 4N1HB 4I18A 4Y5VA 4ZUSB 2EC9U 3DXAD 5DJZB 1JV5A 5EB9A 3BQUC 1X4ZA 2WLYA 3V4PH 3ARDB 1MFBL 4QRPD 2ATPA 3VA6A 3MODL 4X6DF 1CL7H 1CICA 1KJVA 1JRHL 2YBRB 1FQ9C 3MLVL 4WY7L 1S9WA 3DV4A 3MV9A 1MJ7L 3X14A 1BOGA 4PJEE 3TH4T 5C70A 3O3BB 1GGIL 4HC1A 5DS8A 3DPBA 3TWCH 4UT7H 4L8BA 4ZOBA 2X9XA 4M93B 1HQRA 1D6EB 1I1FB 2ERJB 2P44B 5EN2B 4FXKB 1II4E 3SO5A 1IGMH 4PJGA 1LO3L 1GC1L 5T3XH 3LH2H 5B21A 1YEKH 4QRRD 4NQCD 3GIVB 1Z3GH 2C9AA 1A7OL 4WDIB 4XPHH 4MNGB 3VRJB 4LK4A 3QIUB 3C6LB 4ISVB 2MCPL 3RWDB 4I48A 2CDEA 2H2SC 4GRMB 4LQ1A 4LU5H 4CVXB 3GJFK 3S36L 5JOFB 2CJUL 2APWA 1H3TA 2WQRA 2CLRA 4S1DC 1KLGA 1HHJA 3HZYB 4JDTH 4U33A 1KSRA 3FHAA 3KLHD 5FO9B 1S9XB 2AJVH 2EYTA 3S88H 2QHRL 4X7EC 2E6JA 1HINL 1G6RH 5GRYA 3ARGA 3ULVD 5EFIA 3MFFB 2VRAA 4PJ5D 3S5LA 2R0ZH 4N0RA 2VZVA 3WFCH 3WHXB 1MWAH 3STZB 3KXFB 4YHPB 3KLDA 2VXUL 4PTTB 4M7KH 3IETA 4ZFFB 2W9DL 3ZKQD 4KTEH 1NEZA 3L3GA 1MIEL 5IVNA 3FB7A 2AK4A 1K4DB 3TESA 3IDYB 4QWWC 1FO0A 4PJXA 3MRKB 3GM8A 4LLUB 2FO4A 4LKXA 4LGPB 4MNQE 1IGYB 5J8OA 5JHDA 5DEZA 4OGYL 4FMFA 5MP6L 4FFVC 1CDJA 5HYJB 2VN7A 3QDGB 5SX4I 1OP5K 1FBIH 5HDOA 1TPXB 2Z91B 2VNCA 2M8XA 4EN3D 4TOYL 4PB0L 1Q8MA 3KPPB 4WRLA 1PKQB 3QRFM 3NFPB 1ZVSA 2FLRT 4MGXA 3I75B 12E8L 4XBEL 2HRPL 2FBOJ 2W9EH 3IDYC 3MRCA 1LP9F 4Z8FL 3THML 4MNQA 3MV8A 3QZWA 4XAWH 3D69B 1NUGA 1PEWA 5F7DB 4RSVA 2CXKA 3UO1H 1PVHA 2DF3A 2P8PB 4L4TA 4LCUB 1UH4A 5TE6H 1I7UA 4KJQD 2AJZA 2H1PL 1TQBB 3RWJA 2I9TA 4N0FA 1TQCB 5TE6L 2BDNH 1JHKL 4Y8DC 5GRXG 1GPOL 4AZ8A 4C83A 5JW4Q 1Q0XH 1N4XH 5I66B 1YY8A 4LVNB 4V1DE 4POZD 1UWXH 3AS1A 1YZZA 1ONQA 2V7HB 2YK1H 3LEXB 2HT3C 4OZFA 1DVFB 2OX5A 3RU8H 3W2DL 1NCDL 4S0SD 3RWCB 3VG0H 4LEXL 1YEDA 3NCCB 4H5SB 2ZNWA 3C60A 5EULV 1NMCB 4U49A 3UTPD 1PX3A 1Z9SA 3V79C 2GT9A 4Y19B 4MX7A 5H37H 5L2KD 2ADJA 4NUGL 1CGSH 3QFJB 3QIUC 4JFPB 1BQLH 4P59H 1MCKA 1OQOA 1YMMB 4M6NH 5F7DA 3MFGB 3P9MB 4RGMC 2VJXA 3HTLX 3WV0A 4NZDA 5D7JC 4PJ9D 1UWGH 1E4JA 1PYWB 5IW1A 3V52H 3G6JA 4YGVA 1IGCH 2ED8A 1CTNA 3TT3H 2HLAB 4K9EH 3B3IB 5EIQA 3D48R 5E24E 2H2SD 5I76B 4XP5L 4OLXL 5L88L 1GGYA 4CU8A 1KCRL 1HHHA 4PJIA 4FS0A 4KUZL 2JIXA 1XGUB 4YHLL 3OKOA 4F7MB 2IAND 2XZCL 1EZVY 4HXBL 5DJCB 1B9ZA 3RWHA 5JZ7D 3OJVC 4KV5E 5D5ME 1SY6L 2HT4C 3QNYA 1RJZA 4HIXL 3UX9B 1RK1B 3VDAA 3BPOC 3MBXH 5IROA 3DV6A 4AQOA 3CLFL 4F37K 4P4KB 4JPKH 3D3VD 2V2XB 2YD6A 2JCCF 3C5SB 3HN3A 1KPRB 3RTQA 2BNQD 1XF4A 3H6JA 4WWID 2OCFD 3J7HA 3MJ7B 3SY0B 1HNFA 3S3PA 1FRGH 1CFSA 3CVIL 4M3KB 4BZ1L 3OHXB 3FHQA 5EU6B 4LF3A 1KB9J 5DHYB 1IT9L 2OR8A 3C09C 4IRSD 4ONFH 4LPUA 1IZJA 4BZ1H 4M6OL 2X1PA 1PQZB 3PJSA 1J5OL 2WSKA 3TBTB 4R3SA 4ZS6D 2A6KA 1T89C 5EU5B 4HF5L 3RY5A 4OZHB 4NKOA 2X70A 3F7QA 4TN9A 4PGBA 3FO2A 1FZKB 1YPZA 3UTQB 1CT8B 3F62A 4NT6A 2FECI 2DLHA 5KS9E 3FB8B 2QQNH 2VL4A 2GJ6A 4WUUA 1G7IA 1AE6H 3ZYZA 43CAA 3MRGB 4ZD3H 5FFLA 4X7TB 4F15B 3PWJB 2YC1B 1DBMH 1WIPA 3C6LA 4ISVA 3CJJA 3QSKB 5IMMA 4O9HH 3L5XL 3RGVB 4E41D 1SMOA 2BVPA 2FJHB 1JZ5A 3DURA 1KCUL 4S1RL 2R0WL 4GW5B 4NHCL 5CILL 3VXUB 4ZAKD 3IJSA 2AQ3A 2ZSWB 4IRSB 5BV7H 4O5LH 1H3VA 1UB6A 2F74A 2VLJA 1QSZA 5FXCH 3HE6A 4AIXA 2VAJA 2QSCH 3U4EA 3QNZB 5DK3A 2YA1A 4ZUVA 4MS8C 5DJDB 1GHFH 3BWUC 3E8UL 1KCVL 1P5UA 3DECA 1U8MB 1A1OB 4XPFL 5DSCA 3U7AA 3DX6B 4G3YH 5D93C 3G6JE 3D87B 1X5FA 1HHGA 3MLVH 1CT8A 4TRPH 4YFEA 5I71B 2WIMA 2R8SH 4XNYH 1EGJH 5ILTL 2CO6B 1A7PH 1O7SA 4LKXB 1E4XH 1MCOL 1AGEA 3CMOL 2UWEA 5MENB 4QRPE 4JAMB 3MSPA 4PLOB 1U8KB 2DLIA 4FQXD 3WKML 2F53D 2AK4B 2P47B 3AROA 4M5YH 4PRHA 4ODTL 5J6HB 4OF5A 1WJ3A 1VFBB 3N85H 3T2NH 2MOVA 2H26B 2YKLH 3WHXA 4OD2A 3GMNB 4P5TB 1KIUA 3KNBA 5TE7L 5EIIB 4XCFH 4BH8A 4PJDA 5I1CH 4FFWC 1IKFL 2DYPA 3P4MA 4NC1C 3HLAA 3MRIA 2IBGA 3SDCD 4JQXC 4HLJA 3WLBB 4R7DA 3HUJF 1HHGB 3ARBB 1CR9L 3QI9A 4PV8A 5DHVB 2R39A 3SE3A 4FQHA 1J1PL 3VXSA 3WXVL 1OAZH 1I9RH 2MKWA 2M2DA 2Q7YA 2EKSA 3UTTD 3WE6B 3TVMA 3KPLA 1HH9A 5DLMH 1T1YB 3IJHA 2G5BA 1U8PA 2NXZD 5MI0B 2OP4L 3F7VA 3A67H 3UC0L 1FGNL 2C4FU 5I0DA 3GMPB 2E27L 2MKLC 4Z7UF 5HVWA 2CGRH 4OLUH 4BQBA 3QFJA 1P5VA 3RWIA 3MLSH 4DKFL 5F9DC 1NGWA 2W9DH 1MEXL 3RWHB 4Z77A 4RAHA 4W4OC 1JYNA 1BJ1J 2HJKB 4L8CB 4G8GB 1NCBH 1OAYH 1TVBB 2Z8WC 3T3ME 5C6TL 3CZFB 4P4KA 3ZT6A 4G43A 3DUSA 5D9SA 3RL1B 3BN9C 4WENB 1C08B 5SX5H 4PJCB 2PF6A 5C08B 4TOYH 4POUB 4XGZB 2R69H 2DWDB 4FMKA 4UTBH 4C59B 4AMKL 4F9LA 3FO0L 3EBAA 4I5BB 3VWKB 3M17B 3PQYB 1CZ8L 1R3HB 3TBVA 4KROC 3RHWK 3THMH 1QFUL 2KBGA 3TLRA 3RKDD 4QHUA 1N8ZB 1RQ5A 3PWPD 5D8JH 1N64L 2J5LB 4PLJC 3O8XA 3IXAB 4TVSa 2VITB 4Y5YA 2VC2H 4Y19D 5D6CA 1X4YA 1T6WA 3SDCA 1B0WA 4NUJA 4M9OA 1IKNC 3L3IA 3VXPA 4JDVB 2NY2B 5EZLB 1GOHA 1QKZL 5FYJU 2Q6WA 1DR9A 4PIRF 4HPYL 1SJXA 2FRGP 4P2RD 3VXSD 4JM2A 4NO3B 4G8GA 2AK4D 2B0SH 4M4PA 3QQNA 3VXMA 3CK0L 4Q97A 4FXGB 4XNUL 5C0BD 5IW6A 5E7FA 3CFDA 3WUWB 2VZSA 4V1DA 5AUMB 1ED3B 4JFZH 5HI4C 3ZDXE 4R0LA 1E4WH 2OL3B 1CL7I 1U8IA 3QNZA 2B8OT 4D9LH 3U0PA 4P2OD 4QXUL 5D1XB 1BD2B 1H9VA 3DV6B 2F8OA 4YJZL 1ZT7A 1I1AB 1W0WA 2ATKA 3QEHB 1OAKL 3K46A 2BVPB 1EZVX 2DJSA 4DAGL 3Q0HA 4Z95L 1ZLSL 3OQ3B 4WV1B 4CU6A 1JZ6A 5C07A 2VH5L 1T89A 2FB4H 3IU3B 4PJ8B 1VDGA 1DL7H 2YD3A 1S7RA 3V0WL 3V0VB 4OLZH 1ZHKA 4UU9A 2V9QA 1G7IB 4PJBF 5HYSA 4I0PD 3BD3A 3RIFK 3B9KD 3WDHA 5K9JH 1CLZL 4NM8H 5DRWA 3EJJX 5L2KE 4UIMB 3O45A 3V4VH 1F3DJ 5B22A 4F58L 3NN8A 1RZ8A 1VKXB 5AD0A 4RRPG 5I1JL 5KS9A 3ALXA 1ACZA 4NKOB 3O6FD 4J3WA 1K6QL 1I1FA 3FRPA 5I9QC 1N5YL 4XMKH 3MROA 1BGXH 1UFUA 3M1BA 1LEKA 2X5PA 3SCMB 1QBMH 1FIEA 5E2WL 3CX2A 4NZTH 5HI3D 1HWGB 3L3KB 4EXKA 5J6GA 4KJPC 1CYGA 1YEGH 1JPFB 2BOBB 4OTXH 4JDZA 4XCNA 4BZ2H 5DFWH 3NTCH 1A9EA 3RVTC 3C87A 4X8XA 5EU7C 1BFSA 4EIZC 2AGJH 3QDJB 4M7ZC 3WNOA 5I8KL 5ECJE 4ACPA 2Y6SD 4UINL 5MENA 3U46A 4WCYH 2LU3A 1JCKA 1S9XA 3OKNA 5IF0A 1L6XA 3MODH 1SYVA 2VABA 1NDGB 4ZSOE 1OF2B 1ZK9A 4GMTL 2ITDB 1PZUB 3PL6C 3B2VH 1VFBA 2J6EA 3MFFA 1BBDL 1WFUA 1FFPA 3I6LE 1A3LL 3GMLB 3MROB 4FP8L 4FQHB 4K8RC 3DUUA 3GHEL 3DX7B 5T3ZE 2B39A 1FV1B 2UWEB 2YXMA 2EYSB 3OXSB 2BVQB 4FP8H 3REWB 5D1QD 1OHQA 3ARFA 4OFIA 2UY7A 1X3DA 5E9DD 5T3ZH 1CIDA 3VXUD 2X6MA 1FNSH 5T3XL 2VUYA 1R3JA 1WZ1L 2SEBB 4MAUH 4D94A 5IVXB 4GW4B 4TSCL 1YEIL 3ARED 1X5LA 4L8CA 4O58H 4MB4A 3T4YB 3HMXA 4MSWA 3B9EA 2UYLB 4HEME 3CAFA 1I9JH 5BS0A 4OLVH 3B9KA 3JVGC 1X6LA 4UT6L 1URLA 1RFDH 2EZ0C 3JTSB 3GHBH 4WO4C 1UM6L 1FJ1B 3PHQB 2V5YA 5KJRL 2IPUG 4E0RA 5C0IB 4OFKA 1AC6A 3TPKA 1XCTA 3MLYH 1I8KB 2BVEA 1FL6A 3ZSSA 4Y2DB 4GKZA 4F7TA 4PPTA 3MRRA 5C9JA 3KPTA 4NWUL 3VDBA 4X7FC 4XCYB 5D5MF 5KSAA 2AVGA 2NX5B 1CFNA 3DX9A 5DRZB 1X5GA 2BCKB 5SWZD 4YBHA 4BK4A 1UCTA 1JFQH 4XP6H 3S34H 2IPKB 1JZ7A 1HWHB 2DIJA 2ADFH 3NFSL 3QIBB 1CE1H 4AJ0A 3P4NA 1TENA 2I9LB 1YEEH 1MJUL 5DJ2B 4PP1C 1YUHB 4R97B 3TZVB 4XNXL 1F3RB 5K9KB 2WBJB 4CADA 1TCRA 3U2SB 2I26N 4JKPH 3W9EB 4Z0BL 5E00A 3RBSA 4UQ3B 1NFDB 1QSFD 4HG4J 4WFFD 3WJLA 3NZ8B 1S7TA 5EOQL 1J86A 1XF2B 4ELMF 4JO4L 1ROWA 2DI7A 1M7IA 5IOPA 3DIFB 4HFWB 5T5FL 1FZJB 1BFOA 2DBLH 5IKCB 2VLLB 4K23H 1J87A 2P46B 2Z93B 3MO1B 4GH7B 3P4LA 4EBQL 4UNUA 1RUPL 2A9NL 4WFGD 2MHAB 5JQ6L 5EG6C 1GOGA 2QSTA 3MRHB 3U48A 2VQ1A 1A9BB 3NCJL 3BPNC 3GSQA 1JUFA 3B6SA 5D93B 1N4XL 2X4PA 2FECL 5T1KA 5I76A 4YIQA 1AP2B 4CKVX 1KCKA 3L9RB 4JM4H 4X6DB 5IW6B 1RZ8B 2IPUK 3P0GB 4QHNB 3UEZA 4IRSC 2BDNL 2DD8L 3IGAB 4PJHE 3NA4A 1AH1A 4NCC1 1QFWI 3UBXA 4L3EE 1H8SA 3NACH 3NIGE 3KPSE 2OTUA 5CSZB 5IHUL 5IT2L 1TJGL 1FDLH 3K2UL 1INEL 3ESVF 2F58H 3I9GL 4P46B 3MUHL 3HE7B 5DMIH 4ZQKA 3CSYB 5H37G 4NJAH 1B4RA 1MRDL 1S7SB 4P2QB 3F7PC 1OLLA 2HLFD 5IB3B 4N1EA 4P5TC 2P8LA 4OCNC 4JQVC 2X4SA 1VEOA 3RWGA 4NQXB 3PQYD 5DA0B 2DMCA 2CDFB 5LCVL 5ICYA 1X9QA 5I2IB 3HNSH 4NQEE 4I3GA 4K9EL 3LN5A 5ADOH 5ACZA 2GJ6B 2YD2A 3S4SA 4MXVF 5DT1L 2Y5TB 5ESQA 2P5EB 4R8WL 3ZTJG 5K9QI 3QJFA 3ZT5A 5FO9A 4U6XA 3D2UB 3H9SD 3QDGE 3ZDZE 4Q9QL 2DOCA 3BKML 4UUJA 4PJCF 1NAKL 4U1NA 2FJHA 3LS5H 1YC7A 1NCWH 1S9KC 3P73A 4XWGL 3UBXB 1FNFA 5IVXF 5KSBF 1RUAL 4UT6H 3RUGE 1X44A 4PJAB 5ALBL 2OR7A 4OJFH 1H3XA 3VGGA 2J8UE 4ZS7H 3ZKMD 2ZUQB 1JNNL 3VCLA 5ALBH 1FSKC 2F19L 1XIWC 5J11C 3NABL 3K81A 1DBAH 1K8DB 4ERSL 3WMSA 4YQXH 5GRUL 5FYLE 3TH3T 5ACMA 3GBNL 4DVBB 3EO0A 1DN2A 5IBTH 2OM5A 5E94B 3QJHA 4A2MA 2JK5A 1OTSD 2GW5A 3CPLB 2Q8BH 2Z9TA 4YK4B 3VFNA 2VYRE 5IIEA 1RZGA 1Q1JL 4FHBD 3EOTL 5AWNH 3BRGC 1TJHL 3LB6D 5J12C 1MCDA 1L7TL 2EDYA 3MJ8B 4P2OC 4P2CG 1CE1L 1RK0B 2F53E 2R2BA 3DO7B 4GRLA 2Z91A 1ONQB 2V7HA 3LMJH 4U1IB 5JIHA 1YNLL 5B4MC 4LCUA 5E70A 3VH8A 1F45A 4I0KA 5DJXB 1F11A 1LWRA 3FTGB 3KPRE 2K3TA 2NNAA 5HPOA 3IU4H 4G9FB 4HUKB 3MV8E 3L5WA 5FKPB 3VCLB 4MCYA 3PF2A 3QXAA 3S3JA 4Z7QF 5I71C 1IGFL 2WIIA 4E42A 1U3HC 2LABA 3MRIB 4NN7B 3Q3GB 4Y16D 5L2KA 2BNQB 3E2HB 5DHVH 3HZKB 4GKSA 5HHME 3D3VB 1O7VA 1TQBC 1YDPA 5D1ZB 5MERA 1CDGA 2YN5A 3PGFH 2IEPA 1BFVL 1WWWX 2OI9C 2WQ8A 4MD4A 4CJ0A 4PRPB 5GGRA 2BNRA 3PP4H 4WU5A 5DD1H 4HULB 2O5YL 1IQWH 3BZEB 4OKVB 5IMLA 3EFFA 4NRYA 3TA3C 2PYFB 5FGBC 1IL1B 1GC1C 2IANE 3G04B 4S11A 5FA3B 3QNXB 1ZEAL 2XNAB 1EAJA 3P9MA 5E2WH 5C0IA 5KBNC 4NC2B 4C58B 1N0XH 3P77B 4DCQA 4MZ2A 2W91A 3QIWD 3QNYB 5EUOA 5T1MB 3P11L 4JFHE 4K8RH 4G8EA 3I02B 1WWAX 2HTKD 3K8MA 3ZMRA 5E2VL 2HH0L 4NHUB 4I2XA 4XCYA 1VGKA 3PIQA 1GGUA 4I8DA 4OZGF 1LO4H 1R0AH 1WCQA 1CFNB 3KVQA 3FFCD 3L3JA 4HJGA 2PR4L 3VXRD 3LAFA 3C5SA 1IC1A 1CWVA 4C4KT 5AZ2H 2P4AB 5J1AB 3QUXD 1D7FA 3CMOH 1R3KB 5EC2B 1A7BA 3HI1A 5DFVD 3ULUF 3FO9A 4S1QL 1MHPH 3V6ZB 2VLJE 1U8NB 3EJZD 1FFOA 2QR0A 2HG5A 2EDTA 1IGCL 4U6HB 1AP2A 1MAJA 1QA9B 3QP3A 1J8HE 4UT7L 5D9SB 1HKLL 5HI5D 5CHNB 4PJ8C 1OP5H 4RWHA 4S2SB 2AERT 5ESAB 1EPFA 1HSAA 2RBLA 3RKPA 4R8WH 3U83A 4JKWA 4CRPA 5GJTH 3NFNA 4EJ1C 4Z77B 4NT6B 1SEQL 1ADQH 4P4RB 5DQ9A 4QT5A 5DUPL 3SKMA 3CU1A 3QI9D 4ZQKB 2V5SA 5KSUA 3HS0A 1ADQL 3GMMA 2JCCE 3OAYK 1U3YA 4Y5YB 3V5KB 3M07A 1IAIM 1DBJH 3VFOB 5EU5A 2AK1L 3QH3B 2RGSA 5MEQB 4U3HA 3U9PH 5IB4A 2OP4H 1CVSC 1QSVA 3MRHA 3HRPA 2JJVA 5IESL 1NGPH 1NJ9A 2RHEA 4CN1A 4AEEA 3MV9B 1J10A 5AYUL 3TN0D 1RZJC 4FFWD 3G6AB 3QXWA 1TCMA 3MUGA 2WK2A 4PS4L 4XC3H 3E1F1 4QXGL 4U1JB 1F6AA 2DQHH 4HIJB 5E5MB 2YRPA 1NGYA 3EHBC 4JKKA 2J8OA 4DWHA 3MLUH 2DWEB 1TQCC 2EDJA 1QFOA 3BP6A 3EYSH 2EIBA 2QQKH 3C8HA 4TUJB 4U1MB 1J11A 5DDHA 1JUFB 4Z18A 3ZKNC 1AY1L 1JTTA 1DEDA 4RMUA 3AGVA 1MCRA 2AK4E 1SEBA 1KBGH 1MI5D 3B2VL 2YSSA 3V6OC 4F8QA 4P2RE 1YQ2A 3ILQC 5E94A 1W0VB 5C0RL 1SBSH 1D9KA 3D39E 4CNIA 5BZDB 1VPOH 1DBML 2QHLA 4N8CL 4LCCA 4FQXA 1OCWL 4G8IB 1U3HD 5AG8A 4L9LC 3QXUA 2FX8H 4DN3L 1I7ZB 2FYYB 2H45A 2FLBT 2ZG3A 3S37H 3TJEL 4FFVD 3PWPA 3SO3C 1Z3GL 1VHPA 1G6RA 1B2WL 4O5LL 1J8HB 1DLFH 1KIPA 2YMXH 4OCXH 3MLWL 3RWDA 1QFHA 5D96B 1Q9LB 4IEFB 1ZAGA 4RDQF 1QBAA 2VISB 5LGJA 1DN0B 2VC2L 2D4DA 1AGCB 4RISL 3D39D 1RJYB 1WF5A 2AQ1A 3CK0H 4E5XB 4ZYKA 1KN2L 3DSFL 3GFUA 5DD5L 3W11D 2G5RA 4L3AA 5F1SA 4YXKL 4HPYH 3LSOA 1N59A 4OQTL 4CVZB 5KZCD 5T5NG 3Q2CA 1AC0A 1XIWD 1YYLH 3N85L 3KYKH 4M43L 3SGDI 5BRZB 1LEGA 1SJVA 4LLWB 1G7PB 5FHAL 4K3GA 5DF0A 4OLWH 3LZFL 3QNXA 3HMWL 4QHKJ 1IKFH 1IVLA 1MCEA 1BQSA 5CINH 1A9EB 1RUQL 2NXYC 2VISA 2J3SA 4DFIA 1LNUA 4IDJL 4I3RL 2Y9RT 2G75B 3IDJA 3ISWA 4X5WB 2CMRH 4PJGE 1P1ZB 5DQDH 1ADQA 1T1WB 1EO5A 5CIPA 1DANT 5HYJA 3AREC 3ROLB 5DUBA 1QYGH 5E6IB 1NGWB 3ROOB 1AQDA 1U93A 3GJFH 4PJEB 1L0XA 1U3HA 4XPAH 4C83B 1T66D 2EDRA 2VDRL 4D0CA 3VFUB 1JGUL 1F5WA 1QBML 5HVGB 3MGTB 3C2AH 3ARWA 1JZ3A 2KUTA 3MRFA 4HIXH 3VGBA 4GRWH 1V8HA 5I1AB 2DWDA 2WM0A 3C60D 3WHE1 1GPOH 2QLVB 4XPGH 2UZIH 1LEIB 5KANG 1CD9B 1UZ6E 3GMRB 3QCTH 4WFEE 4XP4H 5CIPB 5D72H 5TQ2H 2E7LA 3QUYC 1Z9LA 4P57B 2IPKA 1PYWA 4UDTA 3UYPA 1VFMA 2C1PB 2V5RA 5C3TA 1T1ZA 5EUOB 4Z7VA 3UP1A 4X6BB 3JWOC 3MRRB 5C9JB 5GS0H 5F6IB 4K3DL 1HHHB 4U1GB 3DBXA 2DIAA 1QSFE 2XFXA 2PO6B 3PQYE 1XMWA 3BAEH 1H8NA 1JI2A 1FC2D 4KK5C 3HC3L 1BQHB 1XR8B 3MCLL 4IMLB 5E5RB 4XRCB 4HS6B 1MFCH 3KJ6H 4X4ME 4BA8A 1IGFH 1P7KA 8FABB 5F7EH 3JWNC 1IC4L 4LCYA 4X5LA 2HMIC 1PBYA 4P4RA 5DQ9B 5EN2A 3PP4L 3Q1SH 3HAEG 4XH2B 3V95A 4WWKB 3S6CA 5KSVB 5EZIL 3VXSE 4JO3H 2QSCL 3CUPA 1A6VH 2ZP0T 2O61B 1GYAA 1I7TA 4EQ2A 2FEEI 1ZT1B 4W68A 2JLLA 3R1GH 3SPVB 3TO4D 4KXZI 4Y4HC 3KPOB 3KS0H 2J6EL 2JB6B 2JJSC 1NGYB 3TGXA 1N5AB 5F7FA 1ZEAH 3MR9A 3D18B 1T7VA 5FB8A 3VJ6A 1HYSC 4BSJA 3QT2A 4BFEA 4KRNA 5FIEA 4YLQT 4OT1H 4K8RL 5IBTL 3N1PC 5CEZH 2ESVE 3ALPA 4LBEA 1K5NA 3OKYA 4PJFB 5DURB 5IKCA 4QHMA 4R4FL 4G6FD 4HZLA 5HI4D 1MJJA 3BESR 1CXLA 4NWUH 1PSKL 4L8SB 5GXBB 3BN3B 4U1LA 1F42A 4G8IA 3RIFF 1JGEA 4QRQB 1GOFA 2YKLL 2FGWH 3MOBH 2VXVH 5KG9A 4EIGB 1T6VN 5CINL 4X9IA 4DK3A 2N7BA 4ZSOB 3SDDB 5E1HB 4ZOCA 5CEYB 4AG4L 3B5HA 3SPVA 4XWOC 4NKIH 4XNMA 5FAAA 4GW5A 3WLWC 4PRIA 5TDNB 3HRZA 5FDWA 5JPNA 4NN7C 1FO0B 4PJXB 5IK3A 3KS0J 5I30H 4X4XB 3VE0A 1MFAH 2XPGA 3SDYL 1AFVL 4CN6A 5C6PB 1XEDA 3MV7A 1CLYL 4LARL 2QBWA 4QRUA 2VSCA 1BWWA 2HTLC 1UEMA 3DYOA 5JR1L 4LMQI 5J1SC 4U1NB 1BGXL 1P6FA 5E2JA 1B6UA 1MHEA 2ZUUA 1FORL 4G6FB 3L3DB 3N9GL 3UDWA 1S7UA 4OZ4B 2VL5A 3MRMA 3AUVA 5I1GH 5A2JH 2CIKB 5DD6A 1EXUA 3NCJH 1I1RA 3MRNB 3QI9C 5DVLA 2ZUSA 3EYUH 1UB5A 3VWJB 1NKOA 5MENE 2R15A 5EUKA 4PJHF 4WO4B 4RWYL 5BRZA 1IE5A 4XB8A 1MCHA 4Y4FA 1F3DH 1JPGA 1MFBH 2C7UA 4WI5A 3RZWA 3H7BA 2F53A 3IJYB 2OR9H 1KUMA 1TPXC 1N59B 3CNKA 1NMCC 1MHHA 3QDME 4MLSA 3SDDC 1WICA 1BMGA 5JW3H 4KMTH 3KDMA 3W5MA 4PB9H 4X98B 3SHSA 1DE4B 2J1KA 1BD2E 3DETC 4XC1H 3WUZA 3B8SA 1FIGH 4LLWA 4P3CH 1MJ7H 3VD7A 3HZMB 1SBSL 3ARRA 1JGVL 1OW0A 3Q5YA 4RGNE 2JCCA 2O93L 1INDH 3QIBC 4ELME 1KNOB 1O0VA 5A1AA 4JY5L 5DZLA 1KPVA 5D7IA 4MCZB 5DVMA 2AAVA 4U7KA 5D8JL 2L4OA 5FYLH 2X10A 1FYTA 1JWSB 4GRWB 4YR6A 3R0MA 2P5ED 1X5YA 4JE4B 1QKZH 2DQFB 4YXLH 4BUGA 3NZ8A 3WBDA 1M71A 3BZ4A 4M5ZL 1WVZA 5JIPA 4LSTL 5F9JA 5ALCH 2ZCHH 3MV11 4WJ5A 4LP5A 2P7TA 3MV7D 4PJBB 4AQ1B 4F3FA 1SVZA 2WUBH 3U9PL 2ZCHL 2EDBA 5DRZA 4AL8H 2Z93A 3MO1A 2W60A 2C4FT 5CS7A 1WAAF 1SBBA 4RX4D 4RMTA 4OB5H 3KYOB 4JN2B 2VO5A 4ZODA 3NCFB 2GFBA 2X4NB 1FFNA 2CH8A 5E8PA 4L4VE 3MUY1 2AJSH 1NAMA 4K9EC 3BVNB 2CGRL 2NXZC 4OI9A 4PJ7B 4Y4FD 3EUUA 5CP3H 4MJ6B 3NAAL 2FHFA 4G80A 3QQ3A 4N8VA 3CVIH 4NFCA 3J8F7 1U8JB 2IAMC 4ODHH 2VXVL 5K9OA 3H3PL 3QDMB 3X12A 5GHWL 2EE3A 5C09B 4HIIA 4JHAH 4A6YL 3VFSB 3RDTB 4MAYA 1U42A 5GRZA 3AS3A 1IAKA 2DQIH 5D7JB 3IRZA 4X8JB 3TIDB 1BFOB 3HMXL 4HCRL 3G6DH 4WUUD 4RDQG 3T4AB 4IMLA 4IIQB 3QIBD 1C08A 4PLKC 1XR9B 3SCMC 5I18H 1MFEL 2ZUVA 4L4VD 4Z8FH 4XX1E 3GSWB 3SGEI 4HXBH 3FOMA 3IFOB 2R0LL 1ZVHA 5ESVA 3PQYA 4JM2B 2VMFA 1K3IA 1F58H 3C2AL 3WD5L 1CFTB 4XVUC 1T03H 5GSVA 3V7AE 1OWWA 4HBCH 1S7SA 4EI5A 2JJSA 3G08A 3PUCA 1MCNA 4O51B 1BHGA 2X4QA 1HYSD 1FYTD 4KKBD 4NFDA 4R7NB 1MCCA 4KVCH 1D5XA 5M95B 1S78C 5EIVA 3QEQD 5F7NC 1J1XH 4ODSH 3BSZH 4UT9L 5GS1C 1JHLH 1WFNA 4JHBA 4PJHB 3T3PF 5I1KL 2NY3C 1XGQA 3RY6A 3KPQA 3HI5H 4O02L 5E8OB 4Q9CA 2GSGA 3T77A 4QHMB 3O4OC 1T0NB 4GMTH 1JGDA 1W72L 4K7PX 1MRFH 4ZPVB 4Y5XC 3T3PE 4RZCA 1PG7W 4P3CL 5F3HB 2XA8L 5HGGS 2J4WL 5D2NA 4KK8D 2P43B 3MR9B 5FUZH 1ZT4A 2MQ0A 2R23B 3S35L 5INCB 2Z35B 3LN4A 4PR5A 4HDIB 4OLEA 2GTZB 3Q48A 4UNTA 2D31B 3LQAL 4EI5B 3DUHA 1A6ZB 3GI9L 2Z31C 3GK8L 4PJEF 5JOPE 1JNJA 4R4NC 2NY4B 4LNRA 3GBML 1DQDH 1XGYL 5C0JA 4DVRH 1YNKL 3GSVB 1RHHB 1WZ1H 3PDGA 2ICCA 3SN6N 4YWGL 2VH5H 3CFCH 3VWJA 5IUSA 4M7LH 5FKPA 1BZ9A 2NYYD 5KSBB 4EDWL 4M93C