1YMHA

Anti-hcv fab 19d9d6 complexed with protein l (ppl) mutant a66w
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
220
structure length
220
Chain Sequence
DIVMSQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLAWYQQKPGQSPKVLIYWASTRESGVPDRFTGRGSGTDFTLTISSVQAEDQAVYYCKQAYIPPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comparison of the crystallization and crystal packing of two Fab single-site mutant protein L complexes.
pubmed doi rcsb
molecule keywords Fab 16D9D6, light chain
source organism Finegoldia magna
molecule tags Immune system
total genus 42
structure length 220
sequence length 220
chains with identical sequence C
ec nomenclature
pdb deposition date 2005-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ymhA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ymhA01
4HWBL 4WFHD 4EJ1C 2IH3B 2DMCA 1ETZB 5GS3A 4LU5L 2RCSL 3G6AA 4FP8H 1WZ1H 3WLBB 5T33L 4WW1A 3WO4B 3IXAA 1T2XA 2GY7B 2YZ8A 1FFOA 4OLVL 5GGRA 1VA9A 4KDTC 1BD2B 4C83A 5CWSA 4LLYA 2DBLH 2G9HB 5E94B 3WFZA 5ID1B 1Q38A 3LEVH 3QQ9C 4YDVA 4H26A 2DYPB 3RWHB 4P2OB 4X4MA 2QV2A 5D2NB 1B0RA 2C1OA 1WICA 4LF3A 1CLZL 2BVQA 2AABH 2D31A 4NQDD 4U1KA 1U9KA 3MPCA 3IDYB 5TDNB 3L95A 4IMLA 2W0PA 2IPKA 3NCYS 3TBSB 1NCCH 2FJHA 2W1NA 4XPAH 3MZGB 4P57B 4G9FA 4RNRA 5IW3A 1U8MA 3U4EA 3VXOA 2NX5E 1IBGH 4DGIH 2CIIA 4D0CB 4V1DE 5CKAA 2WUBH 4O02H 1I9JL 1QFWL 1BREA 3LKOB 2PYEE 4Z77B 3GI9H 2BSSB 5A2JH 1I1CA 4Y16D 4JFHD 4JJHA 3W39A 4PJ5B 1I9IH 5D6CB 4Z0XB 2RFXA 3D5OF 1KIQA 3KXFE 3O9WA 3IF1A 5IGXH 4PRHB 1IARB 4MJ6A 2F5BH 1RK0A 4S1DC 4S1RL 1SY6A 4Q6IC 4ODTL 5K33A 1D3CA 4KGLA 4KUCF 4FZ8H 2P49B 3MV7B 5FKPA 3T0EB 5IMMB 4UU9B 4FP8L 2C3HA 4NKOA 2BVOB 3HCVA 2X70B 4RAUB 3TLRA 2NY2D 2MTPA 2DBLL 1HHJA 3C6LA 1X5GA 5C07D 5DYOB 4FXKA 5EBWA 3LEVL 1KTLB 1R3IH 3KPMA 3RVVC 3K2MC 4JREB 1ETZA 3GMLB 4P2QE 2Q3ZA 3MRLA 1TJIH 2WBJC 2D0FA 4ENEC 4ZSOB 2AABL 1OP3K 5CEYA 1M05A 4PJXB 3ZTJH 1UXWA 3MRCA 2IH1A 2XV6B 1NCCL 4HIEA 2W0LA 1QSZA 5E94A 4JQVC 3O2DA 4XPAL 4DKFH 4UV7H 1AQDB 4B7LA 4X6BB 3SGEH 3W9DB 2I9LA 3AREB 3L3DB 5K9KB 5LVEA 1IBGL 4DGIL 4CU8A 3VFTA 4POYA 4XBEH 2OTWB 2WUBL 1FO0H 3GI9L 1XGPA 3TBWB 3NPSC 1JMXA 4F37F 1I9IL 3MMEA 2EZ0C 1KLUA 1NAMA 3S37H 4UAOB 3GEWB 5IGXL 1ED3A 4DGVL 2OR7A 3SKMA 2GKIA 2F5BL 5GRYA 4QOKD 4OCYH 1XMWA 1HQ4A 5E95B 3BD5A 3AS0A 5DJAB 1WAAA 4FZ8L 4Z77A 1Q8MA 4Z0BL 3QQ4B 1P6FA 1K4DB 3DRTB 4Z0XA 4EUPH 2V5TA 3KPSE 4N0FB 3D25B 4U4BA 1IQDA 1E28A 3ZKND 4UUJA 1INQB 1UENA 3G6DH 2L4OA 1A1NB 1WV7T 2C1PB 2YHGA 1DJSA 3RQ3A 1DBAH 1TJIL 5C0DB 3CPLA 3CSBA 5IOPA 4AMKH 3U7WH 1G1YA 1NH6A 3ARDA 4BZYA 3SEPA 5D2LE 3PQYD 4HDIB 2NY1C 2P5EB 3PHQA 5TF0A 3TA3D 3BZDA 5I1DA 5DYOA 4RAVA 1I9EA 4CMMB 3MJ7A 1MCWM 4DKFL 1FCGA 4UV7L 3ETBF 1IGTA 2E9WA 4MNQB 5F1OB 3FHQA 2FL5A 4XBEL 3UJTH 2X5PA 3MR9A 4PRDA 2MOVA 3D85D 1FO0L 1NAKH 3PXJA 4XBPA 2G60H 1HH6B 4PJXA 4L9DA 4OGAD 2VDNH 2QLVB 3A6OA 4BUGA 5TFSH 4P99A 3LRHA 1V8HA 3P0VH 3D3VE 1U3HD 2H2SC 1LE5B 5HBBA 1BOGB 2Z8WC 3S37L 3D6GA 1YJDC 4F7PB 5ACZB 3ARFD 3KWWB 4X6BA 1MVFA 1MCLA 3AREA 3K1DA 3L3DA 3V4VH 2IALB 1W0YT 4OCYL 1YNTA 3QUYC 4OZGB 5I18H 4N8VB 3O3AB 1L6XA 3V8OA 1QTYT 1RJLB 2UY7A 2NY5C 2VDRH 5D7JD 3P30H 3VG9B 3DSFH 1JVKA 4QRPB 1RUKH 1BAFH 4JY5H 1J1PH 4F8QA 1HOCB 3U9UB 3HG1B 3O4OB 2F53B 3HZVA 4PRPE 3G6DL 4ZTPL 4PJ7E 3S36X 4U2ZA 4QRQA 4JPVH 1DBAL 3I3DA 4MJIB 2ZUSA 8CGTA 4G8IA 5IVXE 4AMKL 3U7WL 1CICC 4P2YA 2ZOKB 4F58H 3A0OA 5E8NB 3LS5H 4N0FA 1B4JH 1BFSA 2X6MA 3L3GB 4HUKB 5DS8B 4NKMA 3RKDC 4EN3C 2YA0A 3FT4A 1R24B 3NIGE 2B0SH 1INQA 4Z6AT 3ZYJA 4WFFE 2KZWA 4YBQD 3G5ZB 2NX5A 4M48H 3UJTL 4V1DA 1NAKL 4L8CB 3QIWD 4M6AA 1TVBB 2G60L 3UAJC 1MLCB 4PJGE 1NUGA 3MRQB 3WN5B 3VRJA 2VLKB 4MQ7A 2PYEA 1CD8A 2PO6A 3B8SA 5TFSL 2EE3A 3QG6B 2P5EA 3SDCC 5E8EA 4EEEA 1YQ2A 3IFOB 3QQNA 4OD2A 4QRRD 5IHBA 2F8XC 4WGWB 1RJCA 1GGIH 1FLRH 3KXFA 5CD5D 4FZEH 2H2PC 5EZLA 3V4VL 4CMHB 2DLTA 2X4UB 5C9KA 1ZT7A 5I18L 4EI6A 3RU8H 1JRHL 3TH3T 1ZSDA 3O3EA 3PWUA 3S3JA 2VDRL 2AJZB 3OJVC 4HKZB 4R3SA 3DSFL 4CVWA 1RUKL 1BAFL 4JY5L 1J1PL 4U6VH 3QUZB 4RZCB 4RGND 4YC2C 3WS3A 3GSUB 3CFJB 1KB9J 3OKDA 4P5TB 2H1PH 4R2GD 4RMWA 3BPCA 1BZ7B 1J0HA 4UOJA 3MNZA 3BQUB 4N8VA 3TN0D 1MI5B 2GYSA 4JPVL 4HZLB 3HAEG 1NPUA 4JEGB 3QXDB 1NCTA 3F8UB 1ZHLB 1IEBA 4LARH 5F7HA 2V5MA 3FFDA 3LPGA 1SBSH 1U6AH 3LS5L 4Z7WF 2YPLD 3F58H 4Q9QH 1JTOA 1B4JL 2Z35B 3F62A 5JHDE 1SY6H 5ERWA 4P9HC 3GMQA 2IPTH 3MACH 2B0SL 3MRNB 5FXCH 3O6LH 4KUZH 4OB5L 1E6OH 3SCMD 2Y06H 1OWWA 4M48L 1KIRA 4MJIA 2MCG1 4KTDH 1GSMA 2XG4A 3ULSB 2EKSB 3T4YA 1AR1C 5HGBB 1N59B 5DK2B 1R5VA 1UM4H 5F3HB 2Y36H 4PJ9C 1FJ1B 5EOTB 5BV7B 5DS8A 4HUWA 1GGIL 1OQOA 1FLRL 4IOFD 3W0WE 5FO9A 4FZEL 5CBAB 4MCZA 5H2BA 1I75A 4PRIB 3G5ZA 3SGDI 5TDPB 5E2TL 3HHRB 1U8PA 3RU8L 5KS9F 4NC1C 1AD9B 4FA8A 5F9JA 3MJ9A 2AI0H 1R3HA 2ZWLT 3BIKB 2V9TA 1R6VA 2C9AA 2VR9A 3WIFB 1HSAB 1JNHA 3IFOA 4UT7L 2IPUK 4U6VL 4NDMB 2YRPA 4J3WA 4QGYA 3K1KC 5BXFB 2YPVH 9CGTA 1XF3A 3KPSA 2X4PA 1MUJB 2H1PL 4M9OA 4OFYA 2E9JA 2HH0H 4KXZH 3KYKH 4PJEF 1DUYB 1XGRB 3ISWA 3I75B 2ARWA 4I3RH 3ROLA 1QRKA 1HNGA 2R2EB 2FATH 4K9EH 4JFEB 1F3RB 1NAMH 4R7NA 4Q9QL 1DE4B 1SBSL 1U6AL 3F58L 4QHNA 4OZIF 2XWJA 5D2LA 5BVJA 5HSFA 1K8IB 3KLDA 4HKXA 1AGCA 3MRGA 1SY6L 2VQ1B 2IPTL 3BQUA 5F7EH 1R0AL 3MACL 1CT8B 3QCTL 3ULUL 3O6LL 4KUZL 2R23B 1Z3GH 1E6OL 2Y06L 2A83A 4HZLA 2IG2H 5MHSD 3QXDA 5JO5A 1ZHLA 3GMMA 1SQ2N 5J13B 4IRSB 1UM4L 1W0VA 3FZUC 3D3VA 5E8DH 3ZE2F 3OGCB 4Z76A 5DC0A 4I3SH 1WCBA 4CUCA 2GJZA 1HYSC 1Y0LB 4WTZG 5IBUG 5ISZB 4M6OH 1H5BA 3KJ6H 2AI0L 1G84A 5F7DB 5IF0A 4N0CC 1N59A 4OGZA 2QJDA 4U1GB 3KJ4B 5FA4B 4YHKH 5IJVA 4R6UA 4CDHA 3IDNA 4NKIH 1CBVL 3O2DL 2YPVL 5IMLB 1MCJA 3RA7H 2JJSC 2VN7A 4AL8H 2H8PA 3PL6B 4PRIA 1ADQA 3ZKXC 3HB3D 4OZHF 4ZO6A 2VH5L 4U0RC 2HH0L 1AKJD 3WYRA 4BSWA 3KYKL 3H9HB 2R69H 4PRPA 4I3RL 3VWKC 4PJ7A 3CUPB 2F9BT 2FATL 4Z7NF 3EZJB 3MSPA 2ICES 5IB3B 5IVXA 1AGEB 1NAML 2OXGA 5EU6B 5B8CB 1BF2A 3ZT6A 5HHOB 3QDJD 4P4KB 4YEEA 4IOIA 3OKOA 3C60C 3GSWB 1OP5H 3IDGA 5CS7A 4JZJC 4PV8B 4LCYA 5ITBL 5F7EL 4L1DA 1BPVA 2NY3C 4LGRB 3TZVB 5GHWH 1Z3GL 4I2XE 5D6DC 4RFEA 2AJYH 2IG2L 5I1GH 4KKAC 3BPNC 1S7SB 3M07A 4UOW0 2V6HA 2VRAA 4JN1H 4R0LC 2B7DT 4PJGA 1M7IA 1CL7H 1IM3A 4LOUD 2FB4H 5E8DL 5C0GB 4U6YB 3MV01 4FMFA 3SY0B 1CT8A 4FQ2H 4WO4B 5HVWA 5DVOA 4I3SL 4EOWL 3UROR 1KLGA 1S7TB 3PWJA 4OZ4A 4M6OL 2IAMC 1BQUA 1FZOB 4NO3A 5HDQH 3VXMD 1AO7E 4JRYB 2Q8BH 3IDUA 1A6TA 2AEQH 1KGCD 3KYAA 1NCDH 4Y1AE 4P23B 1A14H 1SJEB 4YHKL 1HXMA 4Q0XH 3DUUA 3Q6FB 3DROA 3TP4A 3RA7L 4P2RE 4FTVB 4AL8L 2X4TB 1TJHH 1E4WH 4X9GA 3D39D 5E8OA 1HHHA 5D5ME 2R69L 3DGGB 4OKVB 1GL4B 4L9LC 5F7DA 4RBPH 3WHE1 2J1KA 5HYSA 5ITFB 1LD9A 5DMGC 1IZJA 1YUHA 4MMZC 5F6IC 4NT6B 5IVNA 3WUWA 4LIQE 3CZFB 3VXQA 1EEUA 1H15A 2C4XA 5FM8A 3R8BB 3V6OE 5HD8C 4TNVK 5JHDA 4WCYH 5GHWL 1NMAH 2FGWH 4L29B 2AJYL 3ES6A 1FNGA 4CBPA 4KKNA 4QY8A 1ZGLA 5I1GL 3GSQA 1K9TA 3TWCL 2X4NB 3D18A 2BY3A 4JN1L 1CL7L 5CMAA 5EU7C 4JVPA 4HWEH 2FB4L 3S5LA 2VXTL 4H25A 1KTKE 1KSRA 5T1LA 3LKRA 2EC9T 3W0WA 4FQ2L 3SKNA 4UIKH 2OYPA 4XI5C 2EH8H 1DN0B 3TBYB 3LKSA 1PKQB 3KPQB 5BMFH 5L2KE 5F88A 1DDHA 5DURD 4G6MH 2Q8BL 4MD0A 2AEQL 3LRSB 1NCDL 3UPRB 1A14L 4BFIB 1YPZB 1DQMH 2XFXA 3IRPX 4FG6D 4G6AD 4LSSH 1QFUH 4Q0XL 4LASH 4F15C 4Y2DC 7CGTA 2EIEA 2AEPH 3FRUB 3LQAL 2YD4A 1TJHL 4WO4A 1E4WL 3LEYH 1D5ZB 2KZ1B 1F3JB 4N0UB 2X7LA 5F8RC 2Z31A 5D7LB 2OMNA 4U6TA 5HHXH 3M17A 2DQGH 1F45A 2YK1H 2HFEB 4G9FD 4GRLC 1G7PA 4PP2B 4PJCE 2BNUB 1I1YB 1LNUB 1SJEA 1G7HB 4AH2A 5HY9A 4CAGA 3T8XA 4K2UH 1H0DB 4FTVA 2ICEA 3U9PH 3TVMC 5JNYB 4WCYL 4FQ1H 2IEPA 1LP9F 3MJ9H 1KELH 4HUMB 1NMAL 2FGWL 5C9JA 1PSKH 4OKVA 3UCRA 3CIQA 3STLB 5ITFA 3FO0H 1CWVA 4D9RD 4NT6A 3SDAB 4Z7VF 5DF0A 3UBXI 3CZFA 4PTTA 1YC7A 2R2BB 5D7IF 2BNRE 3RUGB 1BIHA 1G9MH 4HWEL 4OV5B 4KVNH 3H9SE 2VN4A 5EPMA 3PWPE 4GSDH 5DEGB 4I0PC 3ZKQD 1HWHB 1I8LC 2EH8L 4K3GA 4C55A 3RVWC 1KPVB 5BMFL 1J0KA 1AHWA 4G6ML 4JZNA 1QSFE 4YXHH 1MFEH 3RBSA 5KZCB 1DQML 1OW0A 4GG6B 1KCRH 4LSSL 4LVOB 1QFUL 4OF3A 4LASL 2VIRB 1KCKA 3SBWA 4MJ5B 2SEBB 1BD2D 3MFFA 4ORGA 3LEYL 1S7UB 2OS7A 1W72B 1JHTA 5I73C 1VESA 1PKQA 5DQ9B 5HHXL 3ARBA 5LQBH 2YXFA 4UNUA 3WE6A 1S9WB 2DQGL 4WNQA 2YK1L 2DYPD 3SO3C 4EDXB 5A2IH 2CIKA 3R06B 4NQVB 4P2OD 1WF5A 2BX5A 4LVNB 3F7VB 3LRSA 2V17H 3T1FA 4BFIA 1I4FA 3GMOB 4P49A 1FZKA 5DJDB 4OAWA 1MQKL 4P59H 2BSED 5F7FA 3E6HB 5EUOB 3C9NB 5ABDE 3CDYA 4K2UL 3LN4B 4O9HH 2XWBB 5EN2B 4NFDA 1S7RA 3U9PL 2BHYA 1YEKH 5DA0B 4FQ1L 5DHXB 2ID5A 3CMOH 3MJ9L 1KELL 1NGYB 3FTGB 4QRUA 1PSKL 2HFEA 2VQUA 1WBYA 2N7BA 3CMGA 3GMPB 3NCCB 2A6KA 1SMOA 4XPBL 2DQHH 5BV7H 3BPLC 3D0LB 4X8JA 3FRPG 1EZVX 1ADQH 4KVNL 5EU4B 5JNYA 4GSDL 4RWHA 3U79A 4MJ4A 4PJ5D 3NACH 1OAYH 4I3GA 3HE6A 2YWZA 4LL9A 1Q9OB 4K7PY 4PRHD 3CX5K 1U91B 3G6JB 3RX7A 5C86A 4JKKA 1AO7A 4YXHL 5KW9H 1MFEL 1HINL 3DGCR 1IL1B 4Y1AA 3T0ED 5I8CB 1KCRL 4ZNCD 1RULH 2QADB 1HI6B 1II4E 2W65B 4P2RA 2EECA 2VLRB 4UT6H 2VDLH 4J1UA 1C08B 2XN9B 5LQBL 1MCKA 5D5MA 4U7SA 2B39A 1MCNA 1FH5H 2F74A 2I9TA 2V17L 1A1OA 2AQ2A 3SE4A 4P59L 5FFLA 4BJLA 4OFDA 5E70A 4KDTA 3BRFA 1JPGA 4GBXC 2SEBA 4FNLL 1WBZA 1YEKL 4HIJB 4EI5A 3DTXB 5M7QA 4NKQB 4PJBE 5JUEH 3V6OA 1JUFB 4RAHA 4PJIF 3CMOL 1DBMH 2OCFD 2UVFA 5GGQH 4M8QB 3NCMA 3IFNH 3M1BA 1MJ7H 3ARED 3F7VA 3G08A 3GMOA 5DJDA 1AC6A 1HSBA 2DQHL 1B2WL 3PUCA 2NZ9C 3E6HA 5BV7L 2COQA 1T04A 3VMPA 3GIZL 1ADQL 1KCUH 5CHNA 4J3OC 5C0JA 3REVB 1MLBB 1TXKA 4FQXB 3NACL 1OAYL 3ARZA 1NGYA 3C5ZB 1YEFH 4LHUG 1ZK9A 4M61A 3UZQA 1NEZB 5K93A 1BFVH 5DUBB 4BFEA 3P2TA 2DQJH 4ZQKB 5DJ6A 5J7CC 4W70A 5KW9L 1RULL 1CDUA 2GT9B 2FYYA 4HFWA 4HCRA 4K7FB 4UT6L 2JB5H 2VDLL 3OXSB 3ZT7A 4UQ2A 2LE9A 2V2XB 3BKCL 5SX4I 1D6VH 4XXDB 3C8HA 43CAB 5HGDA 2HT4D 2DJ4A 4OF0A 1FH5L 1FSKC 4PJCA 2UZXB 5CLTA 3U4AA 5CILL 5CJXC 4M3KB 2JJTC 4XMPH 5HVGB 1IQWL 4QLRA 2ZCHL 1F58L 3ULVC 4YH6A 4YJZL 2FECL 2W0KA 2D4DA 4NC2B 2P5ED 3KYMB 3DVFA 3WKNA 2ZCKH 5E6IC 5JUEL 4EDWH 3HTLX 1DBML 5GS2H 5GGQL 4MNQD 3IFNL 1MJ7L 2A6IA 2VWEE 4Y4FA 3OKMA 1NL0H 3QQ3B 1MIMH 3FFCE 4GT7A 2QQNH 1RZJH 4YXLH 5D7KE 1P7KB 1DVFC 5HDBE 4GKZA 2F54E 4ONOA 4KJQD 4RDQF 4XNQA 3QAZC 3E0GA 3DXAE 3PWPA 4JKLA 2ZG1A 1YEFL 3X3FH 4M8QA 4O5LH 4OCMC 3V6FA 1BFVL 3BEWB 2EDQA 5L8KB 1NBVH 1QO3B 2DQJL 4NZRH 3ZO0A 3ILQC 5HGGS 1MY5A 2Z4QA 5F1KC 4MNGB 1QSFA 3RDTA 3R8QA 4Q74A 4ZFGH 1QEWB 5I1LA 2XY1A 4QRPD 2Y5TB 1MLBA 4QRSA 5CP7B 3OSKA 3QDME 1CGTA 3NCEB 4WI3A 2GK0A 3N0PB 4QHUA 2V9QA 3VXUE 4HGWB 2JB5L 1NEZA 4I18B 4NC1E 1D6VL 2GAZB 2F53D 4XMLL 4KJPC 2YUXA 3S4SG 2DMBA 4FQCH 2ZSVB 4GFTB 4MJID 3AM8C 1I3RB 3SHSA 4IDLA 2AXHA 2GT9A 4XMPL 2CQVA 4YHIA 4XVSH 2VC2H 3UTOA 1W8OA 4Y19E 1CDYA 4CVZB 4K7FA 3PIQB 1EO8H 4HG4K 1AGFA 2FDBP 3KLHC 1JMZA 5L0QC 4EDWL 5JLZB 4FOMA 1JHLH 2VTFA 5FYKE 4ZFZB 3K46A 1G9EA 1FNEB 1YDPB 4GKNB 1NL0L 5IHZB 1FZJB 1MIML 3FO2B 3CC5A 5F3BB 4UILL 4LQ1A 1RZJL 2AJ3A 2VLKD 4YXLL 2D7MA 5IT2H 4X5XA 3GJFK 2HKFH 4RRPG 4PTUA 2OR9H 3ZLQC 4NNXB 5DMIH 4LDOB 5CJ5A 2ENYA 3X3FL 4O5LL 3ARXA 5IG7A 1RURH 2ITCB 1UXSB 1NBVL 5CP3A 4FQLH 4Q6YA 2DQEH 5I16A 4ZYKB 3OG6B 3BWUC 4ZFGL 3QDGB 4F7MA 3H7LA 5DMKA 3Q5YA 4L4JA 3QUZD 5BQ7B 4KWUA 1Z0NA 3VRLE 2J5LC 5EORH 1RMFH 3OZ9H 4K3JH 3U6RA 3VD3A 4KZEL 2XKNB 2JJUA 1AXSB 5GZND 3L3HB 4P5TD 3BEWA 5F70A 4IJ3C 1QO3A 4KI5D 3BQUD 5IR1B 4FQCL 1MI5D 4PJFB 3QNXB 3UZEA 3VGGA 1I1AB 4A2LA 3NAAH 4XVSL 1C5BH 2VC2L 2FO4A 5DUPH 1JNNH 3NPZB 3GHEH 1EO8L 1NFDE 2OXHA 2CLRA 3T09A 2I60H 4UBDD 2YC1B 3QXTA 4PJBA 1JHLL 2PF6A 3DHMA 3K0WA 3GHBH 3B2UC 3V52H 5IFJA 3CFDB 3CU1A 3NZHH 1G6RA 4M1DH 2X1OA 1WUNT 5C0BE 5IT2L 2HKFL 3MBEB 4KJYB 2CO7B 5DMIL 5A40E 1CVRA 3GUTB 1LE9B 3QI9B 1RURL 4PRID 1YDPA 3VD9A 1T66C 1GZQB 5B39B 5IHZA 4FQLL 2BVEA 4LSPL 2DQEL 4P46C 4LIQH 5F3BA 1TMCB 4KROC 4FS0A 1JGUH 3BUYB 1LO5B 3U4BL 3VFGH 2FR4B 5JQ6H 1UH4A 4LRIC 1RMFL 3OZ9L 4K3JL 5EORL 5JDSA 43C9B 1I85A 1UM6H 4X9IA 5C3TA 5DRNB 5E03A 1U3ZA 3VFWA 5GS0D 3AAZB 2ADGA 3LVEA 5AWNH 2Z8SA 1MWAA 3MRPB 3NAAL 3BAEH 3VFOA 3G04A 5EU5B 2NLJA 3JTTA 4JFED 3OGOE 3OJDA 1YEGH 1I7RA 5DUPL 1F2XK 1JNNL 5I1CH 3GHEL 5JORB 4OCSH 4KK5D 3R0MA 3ZTJG 2DLIA 3WS6C 4QWWC 2I60L 4K7PH 4WWKC 2CDEB 1U8HB 5GRUL 5DZLA 4OFVA 3NTCH 4JO2H 3GHBL 4PJFA 3V52L 3AU1A 3QNXA 5I17A 3EFFB 2APVA 1T5WA 3QJHB 4M9PA 4TUJA 4LVHB 3NZHL 1QPPA 4NRYA 5F1NB 3FFCA 4KK6D 1MHEB 4HCRH 4M1DL 3VGDA 4LLAA 2EIDA 4LPYA 1YN6B 4HQQL 3IRZA 5AD0A 3NFNB 4BQCA 4X99A 5ALBH 5J6HA 3DO7B 1ES0A 3KPLB 1O7VA 2ZUVA 3C5SA 3IB4A 4HS8H 4MDIB 3DXAA 3D69A 5HI3D 5JA8B 4LFHD 4M00A 1A6PA 1CLCA 3EZ8A 4Y4HA 2BC4A 1HN1A 3VI3F 3MJ8B 3D0VA 3MNWB 5ISZD 5B4MD 4LIQL 3FONB 4WV1A 1JGUL 2APFA 5KAQF 2BMKA 1EAJA 4YBLC 5I71B 3GSOB 1MCHA 3VFGL 4N90E 2LABA 5JQ6L 3QDMA 4PJ8B 4G7VH 4QHKI 1UM6L 2J88H 3PL6D 5C09E 5J6GA 4R96B 3CCHA 2DJSA 4NWUH 5DUML 1S7QB 5AWNL 3WUZA 5I15H 1FAIH 3BAEL 3C09B 3QUXB 1YEGL 3CJJA 2NR6D 4RIRA 3VXTB 5AZ2L 1LEGB 3H42H 5EU6D 5I1CL 5HHOD 4Y19A 4P4KD 5AZEH 5C0AE 4NQCA 5DQDH 5I9QC 4K7PL 5FHAH 3OB0H 2R0KH 3MQIA 1ZS8B 4JO2L 4BA8A 3TZVD 3AFLA 5GS1B 2R1XB 5E4EB 1YY8B 1IKFH 3CH8A 3SO5A 4O4YH 3RWJB 4LCUA 5I1HH 1IGCH 3FT3A 5EU5A 2QL1A 4HCRL 3V4PH 2HLAB 5KOVC 4X8XA 5JXEA 1CIUA 3GKZA 3OMZA 5HGAB 4CADA 1OLZA 3H3KA 4HS8L 5JA9A 2GTZB 1AI1H 1FRGH 5I76B 1ZT1A 3QEQB 1AGBB 4WO4D 1KCVH 2MFNA 2VJXA 2VZUA 3HUJB 5C8JB 2EDRA 4L3EE 2XTJC 3IYLW 2YBRB 2JJVA 4Z78B 5F1NA 4JRYD 5HGHB 2XXMB 4WW2C 3KPNB 1QLFA 1WFUA 3QEHA 4JZOA 3LZFH 4P23D 2AK1H 4FQIL 4MA3A 4HS3A 4RWYL 5KVEH 1U2CA 2UUDK 5T5NG 4G7VL 1JJUA 5EU3B 3P9MB 4FTVD 4PJHE 4MAUH 4E5XB 3QIUC 3FQNB 3MV8B 3RWIA 4LEOA 2F8VA 2A0LC 4OD3H 3V9FA 3FONA 4IRJC 1T4KA 4YNYA 4NWUL 1NGPH 2CK2A 5I15L 3S97C 1G7LA 2PXYA 3J7HA 1RUPH 3OKEA 4ZXBB 3GSOA 1INDH 3KPOA 1IKNA 3H42L 3ESUF 3L3OA 1MY7A 4JHAH 1F8TH 1Q9LB 3B5GA 5BRZE 5AZEL 1NFDA 5DQDL 5FHAL 5HHVH 5JW4R 2R0KL 5ICZA 5EDXA 4E0RA 5KSAB 3VWKA 5FV2A 4YWGH 1IKFL 4YHOH 2UYLB 4O4YL 5I1HL 1IGCL 3QUXA 4MXWH 1RHFA 2ZUWA 5F7WC 3V4PL 3ULVF 1VACB 1FNFA 3I6KB 5C0BA 1YECL 3MRDA 1KTDB 4G9DB 1LDSA 4ZG1A 3SDXE 4U49A 3BWAA 2B5IC 1EPFA 1WEJH 5HYJE 1AI1L 1FRGL 5D6DA 4DZ8A 1KCVL 4QHLB 3MX0A 3RWJA 1QLEL 2GQHA 1ND0B 1E4XH 2YPKA 1JWMA 4LCWB 1T0NA 3JV4B 4WHYG 3LZFL 4QKXB 2AK1L 4YDLB 5ILTH 3PHOB 2P8PB 3GSRB 4ELMF 4MAUL 1AGBA 1HILB 5HHQB 5FKAB 1HCFX 1JF6A 3HUJA 5C8JA 3HPLB 1I8IA 3PJSA 1OTUD 4JDZA 5D7LD 2Q87A 3MUGB 4OD3L 1KB9K 2NY2C 1G6RH 4MA1C 5D9SA 4OCXH 5HGHA 4N5ED 1NGPL 1EUTA 3BH9B 5E5MA 5C0RH 5BO1H 2FHCA 4YHNB 1FYTB 3SDDB 3L5WB 3KGRA 2G75A 2YEZB 1M7DB 2NQCA 1INDL 4NM8H 4BSVB 4F9LC 2YMXH 4JHAL 4DQOH 1F8TL 3QRGL 1KC5H 5HHVL 2NXYB 5SWZE 4KFZC 1IGJB 3BI9X 3FQNA 5TJWK 4YR6B 4ZDHB 3D48R 4N1CA 4TRPH 4NO2B 3RHWF 2NY4B 5EO1B 1OD7A 2DL9A 5IROA 3TO4B 2EEDA 4P2CG 3FO1A 4MXWL 3TGXA 5C70A 3SDAD 1A21A 1YJDL 5BJTB 3OAYH 5EZJB 1YMMB 4LP4A 4U3HA 1IAII 1K6QH 1ONQB 1WFNA 4WTWA 4QNPF 1NMCB 3MGTA 1WEJL 3TBVA 5FUCC 4YPGB 5HHPB 3UX9B 2ATKA 1MWAH 5LCVH 3MLWL 4U1HB 5LGKA 3S35H 1E4XL 3OKNB 4PJDF 4FHBD 5IV2A 4L8BB 5KZCD 2VDKH 4RQQB 4XVUD 5ILTL 5BW7A 5I66A 1J8HB 4FXGA 3OXRB 4G9DA 3SGEI 2P5WB 4Y88A 3ZDYF 2FHFA 3DX9A 3GB7B 1URLA 4GAYA 4NP4H 3IVKB 3TNMB 3RVXD 1HEZB 3BP7B 4MLSA 1JYNA 1T7XA 1FVCB 2IWGA 5C09A 1IGFH 3CVHL 1RHHA 1G6RL 1QSVA 3FO9A 4OCXL 4NRXA 5EIVA 1IC1A 4HKJA 5C0RL 2LU7A 3PWVB 4F2MA 2YS4A 3UTSB 4NM8L 4XPGH 3ZKNC 2ZZUT 4ZFFB 2YMXL 4DQOL 3TCLB 1KC5L 2ADJB 1PX3A 1OM3H 1VGKA 4AQ1B 5C0AA 5HHQA 3CNKA 1T83C 2AW2A 4DKDC 1WT5A 2GEEA 4M1CD 4OJFH 4TVPE 1T5XB 4YHNA 3ZDXE 1ZXQA 1W0WB 3AXLB 3DSNA 4WWID 2YEZA 3V7AE 4MQXD 1G7JB 5D70H 3V2AR 2R2CA 1KPRB 4MCYB 4K23L 3KNBA 1LK2B 4BK5A 2OQJA 3DYOA 1K6QL 1PY4A 5I75B 2OX5A 3TT1L 3X11B 4JDTL 4ZDHA 3DUSB 1OGAB 3V6ZB 3MUY1 4NO2A 4OGAC 1R3LB 1MWAL 5LCVL 1U3HC 1BIIB 2HWZH 5GSVB 4L3EA 3S35L 3ARFC 1NBZA 1OAZH 2VDKL 4Y5VA 5EZJA 3CK0H 2VLJE 3TM6A 1QNZH 4KH2A 4NP4L 4I0PA 2Y6SD 1GPOL 3F7YA 2WWKO 3DV6B 3IETB 3FKUS 3IJSB 5FYKH 2VLRD 4PJHA 4LRNH 1YNKH 3I2CH 1M71A 3P9WB 1IGFL 4G43A 1QLRB 3OHXA 4TSCH 2XN9D 4YAQB 3BDXA 4YPJA 1TQCC 3HZMB 2VXSH 1UZ8A 4IIQB 1T1WA 4RQQA 4JPWH 3LHPH 4MGXA 1WFTA 3RIFK 4XPGL 1FAKT 2P5WA 1UC6A 2DQUH 2Y1VA 3VXRE 3MRKB 5BRZA 1OM3L 3BP7A 1EO7A 1OAUH 5I6XC 2VLME 3DVNA 2R2HB 5KSBE 3VH8B 4OJFL 3HE7A 1BJ1H 3RY6C 5L2JB 3PWVA 5HVHB 1JK8A 3NFSH 4I4WB 4LPVA 2HRLA 5D70L 5IESH 1J8KA 4JFDB 1QSFD 2FIKB 3QFJB 4GG8A 5JW5B 1Y6KR 2Z92B 3PDOA 3BPOC 4PBXA 3QIWC 3EJYD 3SDXA 4JGJA 4FQXD 3I6LD 1K8DB 5HYJA 1T1XB 3B9KA 3C5ZD 3T2QA 1IEAB 1L6ZA 3VE0A 3TJEH 2HWZL 1T5XA 2XPGA 4BM7A 4GXUM 3TIEA 2H3NA 5CD5C 3OKKB 1G7JA 1VDGA 3HKFA 5K59E 4XB8A 1OAZL 1BQHB 3EO9H 1LK2A 5I74B 3CK0L 3ET9F 3TPKA 1FBIH 3HZYA 4QCIA 1QNZL 2VSDA 4LSRH 4P48A 3DUSA 5FYKL 1R3LA 4LRNL 1YNKL 2X89D 3I2CL 4TSCL 1R3KA 3GMNB 3M8OH 5DSCA 5GSVA 4RGNC 5EG6C 1U8OA 8FABB 4OUUA 4YLQT 4Z95H 2VXSL 4JY4A 4G8GB 5FUZH 3LHPL 4W4OC 2DQUL 4XNMB 2XT1B 3FHAA 2JK5B 1OAUL 3DV6A 4D9LL 1QOKA 2ADIA 3PABB 2GSGB 1A47A 4OSUL 3N1QC 4LNRB 4YAQA 3ZSTA 2ORBH 1XIWC 2XA3A 3BE1H 3DX8A 1UJ3C 1A4JB 3NFSL 1CD1B 3DMMB 3T4AB 3QA3B 3D2UA 5IESL 1G7IB 2AERT 5T3ZE 3HFMH 4GBXA 3DX6B 4XWOD 3SCMC 5IP4A 4Y4KB 5D1ZB 4Q58C 3IDIB 3QH3B 3X14A 3NGBC 3IKKA 1XCTA 1JGVL 1Z9SA 1FV1B 4I48B 1AE6H 3TJEL 1X4YA 3GSNB 3MLYL 3Q3GB 5C0FB 5DD1H 4TUOA 2LU3A 3THMH 3EO9L 3QFJA 1U92B 5JW5A 1JF1B 5J3HD 2N7AA 2DLGA 3I02A 1ZA3A 2R9HC 2AK4E 3L3JA 7FABH 4HUVA 4LSRL 5DWUH 1MCWW 5CGTA 2IBBA 1YN7B 2E6JA 1QZ1A 3MLRH 2IADB 3MRBB 2Q1EA 1HHGB 5CSZB 4Z95L 1A6AA 2FX7H 3ZT5A 1D9KB 5CIPB 2W9DH 5FUZL 1B0GB 4D0DB 3WEXB 3I6GB 3VXPB 4ISVB 1FVDB 4ORZC 3ORJA 3WFDH 3BT2H 1JE6A 2HVKA 1VPOL 1JGDA 5E5UB 4Z7WB 3EOAA 2D3VA 2ORBL 4NQEB 3E3QC 1ITBB 1MREH 4X4YB 4R97C 1XGTB 4C4KT 4IM8A 2ITDA 4YFLI 1FN4A 4ZFOB 3RL1A 4Y5YC 1KEMH 3MRIB 4KJWD 4GW4B 2ED8A 2YWYA 3SPVA 1GOHA 1XF4B 4XAKE 3ARSA 4ZAKB 3FN0H 4YXKH 4LKCA 3JWOH 3JXAA 5LBSH 3E8UH 4OIIH 1AE6L 3BW9A 3DI2B 3WLWD 4YO0B 4X6CE 5DD1L 1I9RH 1PLGL 2DWEA 3THML 1FGNL 3QDGD 5IQ9A 4Y4KA 3T77A 2VLJA 5KS9B 7FABL 1MCCA 1XF5B 1LEIA 5DWUL 4QXWA 2CKBB 1YC8A 3VWJB 2BNQE 3K80A 1IRAY 5DJXB 3UPCA 3BX7C 3MLRL 4ZMAT 5MENE 3GSNA 1OF2B 4MAYB 5C0FA 3JV5A 4O58H 1F4WH 4HWZA 3MCKB 5AYUH 5DJZB 1UFUA 3BZEB 2CDFB 3FT2B 5LKNA 2W9DL 1NFIA 4TNWF 1I1AD 4ZOBA 3FQRB 5IMKB 4PJEB 2X1PA 4OLUH 3WFDL 4X5WA 3C8KA 3VXRA 2DD8H 1P4IH 4Q2ZB 5EO0B 4U1SA 3SGDH 5KSBA 5GRVL 3UPAA 3FN3A 4Z5RB 4WJ5B 1FFRA 4UIMA 1CDJA 2EYRB 1ZHKB 1FZMB 4OZIB 3O8XA 1DQQB 1MREL 4RISH 1D9KA 1TVHA 1B0GA 4ODWB 2H6PA 3JVGA 2AJSH 2AEIT 2LAGB 5A3ID 1FVDA 3UBXA 4PB9H 3AVEA 4NQXB 1KEML 4F7CA 1N7MH 3MUZ1 2CLZB 3BH8B 4Y5XC 3MBED 5IB5B 3HRPA 4MMXC 3FN0L 2ERJC 1KFAH 1SJHB 2CKNA 2EDWA 3JWOL 2NNAA 5LBSL 3EYOB 2I25N 4OIIL 2FEDD 4LOUC 2X4SA 3QI9D 4HIIB 3TT3H 4PYGA 1I9RL 5B38B 5EUKA 1QRNB 3FCTB 4MD5B 3RP1A 3PNWA 2PW1B 1KJVB 5IW6B 4ZAKA 1A0QH 4S0SD 3CFEA 1EAPB 1Q94B 3HC4H 5GRZA 1P7QB 4O2FB 4JFFB 4NQCD 4MB5A 3TEUA 5GRJH 1CL7I 3GIVB 4O58L 1EEQA 4K07A 2J7LA 1CGUA 2AV1B 1DLHA 3MREA 4OZHB 3UYRL 2GJJA 4OV6F 4Q6IB 5FO7B 1CR9H 2CRIA 4WFHE 3VFSB 4OLUL 1JWUB 2R56L 5GSRA 2EEAA 2CKBA 4LMQI 2DD8L 2W0FA 1P4IL 5T3XD 3VWJA 5DD6A 5AUMA 3ESVF 3TC9A 4LPWA 4CVXA 3V0AC 1TCMA 2XZQH 1J88A 3T3PE 1FE8H 2ENSA 5JIHA 4RISL 4L1HA 5IWLA 4TSBL 2F5AH 2EDJA 2AJSL 5IMKA 1H3XA 4WVRA 4PB9L 5AAMA 1N7ML 2WBJB 1OP5K 2ILLA 4X6EB 4NQDE 5EBLB 4IS6A 5FGBA 1KFAL 2LU4A 3MLXH 2Y23A 3D87B 4OZIA 4U1JB 5DK0A 2YR3A 2YD5A 3TT3L 3MC0A 5HYSG 3ALPA 3BKJH 5DRZB 2P7TA 2NW2B 3DVGB 4LLWB 3OR7A 2CO6B 3T04D 5LGJB 2QSCH 3BH8A 5TQ2H 4JHZA 1WTLA 2AK4A 1LO2H 1T20A 1T21A 1A0QL 1N2RB 4PJ8D 4A2MA 4MLIA 2GHWB 4HMCA 4JFHE 3NPSB 1XAUA 3QIBB 3N1GC 4FG6C 1E0OB 4G6AC 5GRJL 1OSPH 5ACLA 3BN9D 1K3IA 2K7PA 4JAMB 2ZUYA 5TE7H 3FCTA 3QWOB 4MD5A 5FOJA 3LV3A 3QUXD 2GCYB 5DFTA 5HYQB 4PLJD 3S5LG 2EC9U 2VDQH 3QUML 3RRQA 4BELD 1NDGA 5L8JB 3CX2A 3MV9B 3TYFA 2XZQL 3RPIA 1FE8L 4ZPTA 5GGVY 4YBHA 5C07E 4F3FA 5KN5B 4OLEA 4U6HA 1CFQA 3O9WC 3OTTA 3B2VH 3HI1B 1ZVSA 5ESVB 2H45A 4LK4A 4WWKA 2WBKA 5E0QA 1T03H 1DCLA 5DHVB 1S9VB 4X6DE 2AXGB 4WUUB 4D0BB 3MLXL 1AD0A 1U8KA 2ATPB 2X2YA 4U33A 4XH2B 2NY1B 3QEQD 4GXUN 4YHZH 3HNTH 1N3NB 2BVPA 3BKJL 4EBQH 5IM7B 2I07B 4AEEA 2PW2B 3C6LC 1A3RH 2J4WH 3L3KB 5TQ2L 5DVMA 2EDXA 4NNYB 1LO2L 2ZKHH 1OTTC 1IC7L 1VCAA 4JR9H 4NUJB 2Q7NA 4TVPH 2BNQA 1RK1A 3MV8D 1NGQL 4HH9B 4YK4B 4ZNEE 5TE7L 1TJGL 2NW2A 3O3DA 3DVGA 4QOKE 5I19H 2E7BA 3LEXB 1WBXB 1JN6B 3QUYB 3HNSH 1AIFA 1A1MB 1KXVC 4ZXBD 4AT6A 4PP1C 1RQ5A 1L0QA 4TUKH 3TO2A 2VDQL 2ZG3A 1Z5LA 4M93C 4YHMH 1JTPA 3QIBA 1U93A 5TQ0H 2OL3A 4ZD3H 2X4OB 1T1ZB 4NYLA 5KSAD 1MVUA 2VO5A 1N8ZA 4K9EC 2M8XA 3QWOA 4H5SA 3UTQB 1XZ0A 4HJGA 2VZTA 1LP9B 1P4LB 2GCYA 3BZFB 2UWEF 1XCQA 3B2VL 1TTUA 2BRQA 3QSKB 3QNZA 3GGWA 1T03L 3H0TA 2DL2A 1CICB 1BGXH 1PX4A 5BS0B 2NY0C 3GSNH 4Z7VB 3HNVL 3MA7B 1GRWA 2W07A 4WU7B 3PQYE 5JPNB 3QXAA 4NO0B 2D9CA 5D7IB 2CH8A 2CLVA 4C56B 4A6YB 4YHZL 3HNTL 4LLQA 4I5BA 5C09D 5KN5A 4EN3B 3MYZA 3AS1A 4EBQL 3MLVL 3MJGX 1PZ5A 5C7XH 4LCWD 1C12B 3MBXH 1A3RL 2J4WL 4OCRH 1WC7B 2I26N 4UI2A 2C4FT 1S9VA 3GO1L 4D0BA 2ZKHL 1NUNB 5IEHB 1CXHA 1WIOA 3FL7A 2MHAB 3SDCB 3PGCA 4JR9L 4TVPL 3T0EC 5GGSY 5KTEH 4X6FB 1DFBH 3BP5A 2BERA 3VXNA 2PKDA 4CN4A 3ARDC 3VFRB 3ARRA 5IM7A 2YA2A 4HZAA 3VG0H 3HNSL 4K8RD 2FJGB 1FYTD 3SDDD 4MX7B 4G42A 3NIDF 4N8CH 4MQTB 5EIQA 2APTA 5JTWA 4JREC 5IKCB 4YHML 1NKOA 5CEXB 1ORQB 2NXYD 2OTUA 4KK8C 4MDJA 4QHMB 5FGRA 4ZD3L 5TQ0L 4HH9A 1JPTH 2FH8A 4YC2B 2BSRB 3BMVA 2NY4D 4ZOAA 3U36A 2VABA 4KDVA 3TO4D 2A73B 4NQUA 4OZFA 4UQ3A 4NHUB 1NBYB 3HZKB 4MQSB 3RWGA 3MLTA 1ROWA 3P40A 2BDNH 5I8OH 3MYJA 3AREC 1YMMD 3CFKB 3RI5K 5SWQA 2JJWA 1BGXL 2VAAB 3GSNL 2YD7A 1OD9A 4NQDA 3A67H 1FIEA 2MNUA 4OFKA 2O5ZL 2Q8AH 1K85A 4JLRB 4APQA 3VXSB 3ARUA 3DVIA 4AIOA 2EXWD 3LKNB 3P73A 4LSUH 5I1JH 1AP2A 3UTQA 4O00A 1NC2B 4L5FH 4PY8I 5C7XL 2CKBH 3MBXL 4NFBA 4OCRL 4NJ9L 1J8HD 2AKRB 3NMEA 3G5YB 4Z7VA 2P5WD 4KUCD 5IMOA 4PJ9B 5D7IA 5FAAA 4C56A 4Y16A 4QRRE 2AXFA 3ZL4H 1J5OL 1DFBL 2HMID 5GGSA 3OKLA 2Z93B 3NCBB 4UV4H 2EH7H 3T3ME 1ZHNB 2XYCA 2RAMA 5T3ZH 5LXGH 3VG0L 5FYKU 5FYJH 1T0PB 3Q6GH 1K2DB 1J12A 4YZFE 3LSOB 1YMHA 3MRMB 3UTSD 3S98A 2HT4C 4N8CL 3QJFA 2Y5EA 3UXFA 3V5DB 5B38G 1G0YR 4OFIA 2VE6B 1JPTL 1S7VA 1VFMA 3TJHD 1ZTXH 2F19H 5D93C 2PO6C 5B3JE 4F57H 2NYYC 1TCRA 5C07A 4NO5B 5IHLB 1OQXA 4PJIB 4XGZB 4F9LA 4J7RA 4HBQA 1FFNB 2BDNL 3RWCB 5I8OL 3NFPB 3CD4A 4DOHE 2IANB 4UMGA 3ZHLA 3VFVB 3QFDB 1DSFH 5GGUB 2YPLE 1DQJA 1OGAD 1GC1H 4LSUL 4WGVB 2A73A 4LHJB 1KJMB 3HZKA 4L5FL 3MOAH 4GRWE 1R5WA 3CAFA 1TVDA 3S37X 1MCFA 2CKBL 2J8UF 3QEUA 3K4ZA 4FQQA 4J4PD 2EYTA 3WHXB 3MRHB 3KHOA 1QKZH 1FL6A 1S5HA 3V5HB 3VXSA 1FVEB 2C3VA 1T7ZA 1GGTA 3ZL4L 1IAKB 1NC2A 5H37G 1HQRA 4UV4L 2EH7L 4ZNEA 4BH8A 5T3ZL 5LXGL 5FYJL 2JB6B 3Q6GL 4HK0B 4I77L 1D6EB 3GJEB 4JFOB 1CDGA 3D2UD 3N1PC 5TH2A 4GOSA 2G2RB 2A77H 3SJVB 5HI5C 4OFPA 4XPFH 3CSYA 2FD6H 4J12A 5D71H 2I24N 2PNDA 4TQEH 5CFHA 1ZTXL 2AJVH 2F19L 2EDEA 4GW1B 2BSTA 3VI4E 4F57L 3KLAA 3ZKXB 5T5NF 4U0RB 1K2DA 1HH9A 4JFDD 1JNLH 3QFJD 4JPIA 1MAMH 1T83A 1KF9B 1U8NA 1WZLA 3TF7C 1DSFL 4P4RA 5SX4H 3E3QE 5K9JH 3WN5C 1ZHBB 3TA3A 3C60B 1QBLH 4JZJB 1RU9L 1WLHA 3IU4H 3QNYA 2JCCF 1HXYB 2QSVA 3MOAL 4PJAE 4XGZA 1Y18A 4PG2C 5ESAB 3BO8A 2C7UB 1G9MC 4KQ3H 5MHSE 4EIZC 1EEZB 3BPNB 1GGCH 5J1AA 1EXUB 3D85A 3X17A 5J0BA 2OL3H 4R0LB 4XZUB 4CVUA 1KG0B 5DEFB 1QKZL 1IM9A 1QFPA 1IGYB 1GGUA 3VGAC 1SYVB 5GZNC 2IAMB 4G8GD 1K5NB 5JPMB 4GXVH 1U95B 4KI5C 1EH9A 3BQUC 1F4HA 3AY4C 5D7JA 2A77L 3BSZL 2DQDH 3MODH 5C6TH 4XPFL 2WQ8A 2FD6L 4NCC1 3IXTB 1UKQA 2HTLC 2PTTA 1OTSC 4TQEL 5TE6H 3EO1B 2AJVL 4PGEB 4MXQC 1QA9B 4XCYB 1MPAH 2J12B 4LLDB 4UBDC 1KN2L 3DMMD 3MRRA 2P8LB 4KPHH 5DHVH 3MV11 3ZDZE 3NABH 1B90A 2DKSA 5D1QA 3OPZH 3SJVA 4Y4KD 5D1ZD 2VLJD 5F6IB 3CLEL 1JZ4A 4OCNC 3VRIA 2V5SA 5K9JL 3QDJE 4G8FA 1I3VA 1KJ2B 2DQTH 4L8SA 1S7WA 1BZ9A 3DBXA 3QXVA 3DOSA 1QBLL 4HK3J 4LLUB 4PGBA 4XB7A 4ZUTA 32C2B 3MTRA 3IU4L 3O6KH 2A6DB 4KKCD 3VDCA 5BV7C 4OD1L 4PIRF 3P4OB 3T65A 5ANME 2VNCA 4K3HA 4KAQH 3BESR 4D9QD 5K9OA 5L7XL 4KQ3L 5E2JA 4AENB 5IEKB 4P5KB 1GGCL 1MJJB 2HJFB 3BGMA 3QIWA 5DZNA 2OL3L 3GSXA 3ULUF 4OI8A 5F93C 1S9YA 1QP1A 3SGJA 1KT2B 3EBAA 2VQTA 4OZFH 4YHPB 4QRRA 4JFPA 5MEOA 5GIRA 5IVZA 3I50H 1HXYA 5C6WH 3BP6B 2R1YA 4XNXL 1WVZA 3U2SB 2C7UA 1D9KD 2KH2B 3VXME 1MHPL 4FFWD 1SM3H 3QEGH 1RUAH 2W38A 1BLNA 1KGCE 4TTDC 3MODL 3NZ8A 1I1FA 4QYOB 5C6TL 2VDPH 2DKUA 1I7TB 1IGYA 4Y2DB 1ZT4B 5K9QG 3MA9H 2FSEA 4FFVC 5TE6L 3EDFA 3ZKMD 5EIIA 4NQED 3D39E 1SYVA 1MPAL 4GJTB 1MQ8A 3NA9H 5EOCJ 5D4QA 1K5NA 1U95A 3TN0A 4KPHL 4GRLB 3C6SB 1NLBH 2DWDB 3NABL 1EEYB 3OPZL 2H26B 3QUKA 4Y0GA 4O2CB 3B9EA 1ZGLP 1L9NA 3HC0B 5KOMC 4PRNA 4Z7QF 4ZAKD 2EEBA 3OL2A 2Y25A 2YPLA 1PYWA 2DQTL 1F11B 3UTZA 3TVMB 5IK3A 3CFBB 4YX2L 1MRDL 1F2QA 4D8PA 4PV9A 4I9WE 5IB2B 4MXVE 2DQCH 4S10A 3TIDA 1FL3A 3ZE0F 2VLLA 4JY6A 1MNUH 4KAQL 4G80B 4DVBA 1PG7H 1J0ZA 1QSEB 3ARGB 1WAAF 3UTTB 4HF5H 3WDIA 4J6RL 4AM0B 3O11B 2RIKA 3VWJD 3KJ4C 5E9DB 2J8OA 1MSPA 1GGBH 2HG5A 1MF2H 3I50L 3CVIH 4MAYD 2ZUXA 3HRZB 1FIGH 4BH7B 4EQ3A 2MPAH 4P5KA 1I1RA 4P3WA 1SM3L 3QEGL 4QT5A 1RUAL 1FL5B 6CGTA 4X4ME 4OLWH 5EA0H 1TZGH 2A74B 2Y4SA 5MI0C 4QF1A 5FYJD 2VDPL 1KT2A 3MA9L 2YD2A 2R4SH 1YQVH 3GDBA 1Q1JH 3IS0X 3MUHL 3NA9L 4R7DB 2V5YA 2FX8H 2OP4H 4G9FE 3SO3B 3U0PB 3ABZA 1NLBL 5ICXB 3BD3A 1F6AA 4MHHI 4QEGA 5MP6H 3TNNB 3P4NB 2AK4D 4PG9A 1S7XA 1BP3B 1JV5B 4F33A 5C0ND 2DTMH 1GH7A 4Z7UE 1UM5H 4KKLC 1MNUL 1QRND 4ZS7H 1EEYA 4WO4C 2MKWA 3O41B 4S2SB 4D9RE 4DEPC 4O2CA 1PG7L 1YEJH 3ZHDA 4HF5L 1XR9A 2NXZC 1P7QD 4JFFD 2CPCA 3DECA 1GGBL 1MF2L 3CVIL 1JGEB 5KANI 3PWNB 3QPXH 5EC1B 1I7ZA 2X42A 2KQMA 3U0WH 1FIGL 4Z9KB 2X1WL 2DF3A 1KB5B 4G80A 4S1DD 4YGVB 4RMRA 3BHBA 3FOMA 4OLWL 1OSZA 3ARGA 4BKLA 5EA0L 3S7GA 1RJYB 5D96B 2R4SL 1YQVL 4UDTA 3FMGH 1Q1JL 4P3DA 4U1MA 1MHCA 5I1AB 3GKWH 1BD2E 1QVOA 4U1LB 2HP4A 2FX8L 1AKJA 2BK8A 1UADC 4V2BA 2OP4L 1Q0XL 4R4NC 1FL5A 3RVVD 4DN3H 5D2NE 1ZLWH 2WBJD 3DX7A 4UINH 3OB0K 5CBEB 4ENED 1D5BA 3EOBA 5MP6L 3DRQA 1AHWC 1NGXB 5C0EB 2OJEA 1QFOA 3VFNB 3KHQA 3VW3H 5I8EB 1HIMH 1OW0C 4NKDA 2DTML 5GJSH 2GITB 3OAUH 1H3GA 4L8DA 2R0ZH 5B22A 1UM5L 2PUQT 5ANMA 5ICXA 4ZS7L 3SBWC 3GMRB 5E6YA 4POZC 3IDJB 3FQTA 1DANT 3ARBC 3P4NA 1YEJL 2GTWB 2Q86B 3DETC 2NW3B 1FLTX 3KYNB 1KIPA 5H35B 4M8VA 3QIBD 3TBTA 4PJ5E 2EZ0D 3EJZC 3STZB 2V7NA 3VFPB 3QPXL 4PRHE 3U0WL 2IBZY 5ID0B 1XT5A 3EYQC 3O41A 3VXMA 1OTUC 4RDQG 4GUPB 3MV7E 3WFHA 2VXVH 3T0EE 4ELKB 4N9GA 5BZDB 4NUGH 1U8JB 5A16B 1E4XI 4LSVL 1BJ8A 5DTFA 1FG2B 3FMGL 1FGVH 2D0GA 3BKYH 3MV9D 1VFAA 2VXUH 3V5KA 3T1WA 1FP5A 3GKWL 5FA3B 3Q1SH 1J9CT 2D7OA 4JB9L 4LLMB 3H3BC 2GY5A 2ESVB 1FSKB 4DN3L 1AR2A 3KPPB 5HYIA 5CGYD 4ZSOE 1RJYA 2WIIB 4PJXE 2Y7QB 1UVQB 4WUUD 5FECA 3VW3L 4DK3A 2O61B 4PY7A 4ODUB 4U1LA 1HIML 2FO1A 5E6IB 5GJSL 1EERB 3HAEB 3OAUL 1NDMB 2R0ZL 4PRBB 4HBCH 2D7TH 3VA2C 4AYFA 2GFBB 1NCWL 2YUZA 1TQBC 4H0GA 1CDHA 1ORSB 3TFKD 2FZ3B 1SVZA 4RGMC 1TFHA 1WIUA 1TENA 4PREB 3B9DA 4WY7H 3RWFB 2H2SD 3SE4C 3QAZB 3AC0A 2C5DC 1ZAGA 5CD3B 1ZE3C 4ZUWA 4LBEB 3SOBH 5DVLA 2RB8A 4UDUB 4XCEA 4ELMB 5DRWA 1EHLL 3GMRA 2FJFA 3SGKA 3RNQB 2MJWA 4EI5C 3RVTC 3IDJA 3QUYD 3V6OC 4NRZB 2H32B 1S9XB 2VXVL 3F12B 3BDBA 4LMQE 4HX1B 4NUGL 4HK3N 3L6FB 2V2WA 4LKXA 1TZIA 4XBGB 1FGVL 3BKYL 3QO0B 2VXUL 1LWRA 4GRWH 3Q1SL 4APQD 1M6OB 5D2LF 6FABH 5HTSA 1T3FB 5TE4H 1V3MA 3TYGL 5E00A 2XXCB 1DR9A 5DGQA 3BZ4A 1XGQA 4PD4J 3MO1B 5INCA 5D8JH 4ELKA 2GUOB 4KRMB 4XCCH 5HJ3B 1FNHA 1X6NA 1Z0MA 1CICD 4S1SH 5BS0D 4MQXC 3A6CL 4NO0D 2BCKA 2P5EE 4E42B 4C56D 5LJYH 1DN2A 3ZMRA 5L0QB 5CZKA 1BBJB 3RKDD 4HMDA 4Z7UA 4PYHA 4WEUD 4OGYL 4MNQE 5DRXA 5KG9A 3OAYK 4YIQA 2BOCB 2D7TL 2IPUG 2HFFA 4CNIB 3RI5F 4JDVB 5DZOA 3UAJD 1PKOA 3FQXA 2Y7QA 4WHDA 1Q9WA 4PJDB 1BF8A 3GI8H 5E1AB 1I8KA 4WY7L 3W82A 3SDCD 3LMJH 1WZ1L 5MEPB 4PRBA 3DHJA 3CH1B 2H2PD 4Y7MA 2EDHA 3FOLA 1K3ZA 2R1WB 1QBBA 1T80A 4OZGE 2X4QB 1IAIH 4AIZB 2FZ3A 2IH3A 4PJ7F 5EFIB 3A6BH 4Y4FC 4QRPE 1H8OA 3FAWA 5FYJU 3WLBA 5IVXF 4MSWB 3ZYIA 3ZE1E 5CD3A 1JYVA 2J5LB 3S8WA 5IBUB 3HG1E 3S3SA 1BD2A 6FABL 2G9HA 3TPUB 2EDNA 4ODHH 1FNLA 3IDMB 1BQLH 4IJ3B 5TE4L 3X12B 2F53E 5ID1A 1F90H 1ZANH 4BUHA 2DYPA 3NIGF 1F00I 3RWHA 4P2OA 2YSSB 4MJIE 5D2NA 5D8JL 4IEFB 4WU5B 2YD3A 1NC4B 4O02L 4KKBD 4XCCL 5LAXB 4S1SL 2F15A 5T1KB 3REWB 3VCLB 1FC2D 4PJGF 1FNSH 2IFFH 5TDNA 4JKPH 4KY1H 3RDTC 1M6OA 4XHJC 3VXSD 2IJ0C 4M7LT 5E99H 3TBSA 3RNKB 2W92A 1T3FA 5C2UB 1NC2D 5F9AC 4P57A 3EYVB 3NCJH 5J56B 4D0CA 3WFCH 2GUOA 4PGDB 1L4IA 3LKOA 1AR1D 2VLKE 4XP1H 4RMSA 3LDBC 3W11C 2BSSA 1L7TH 2H9GB 3LMJL 4PJ9D 1CFNB 1J0IA 2GJ6B 4PJ5A 5D6CA 1MCIA 5F9WB 5ENWB 4OI9A 1KULA 1FC1A 1ZWIB 1QD0A 1IC4H 2X9WA 4PRHA 3AS3A 5D1XB 2DTSA 5DD3H 1IAIL 1R3IL 2W59A 4P46B 4OI7A 3U48A 2DBJA 4GS7C 4KROB 4IHOB 1BVLB 1P7HL 3A6BL 3MV7A 4XP9H 5IHUH 4DGYH 3T0EA 1T0MB 3GM8A 4UU9A 5IMMA 5MEQB 1ITCA 1U58B 2BVOA 2X70A 4RAUA 5IW1B 3IT8D 4JJ5B 5ECJE 3TH4T 4O2EB 2VMFA 2HJLB 5SWSB 3WFEH 1BQLL 1OAQH 4KI5E 1KTLA 5KAQG 2X4QA 1F90L 1ZANL 1MI5E 4QTHB 2EDOA 1NUDA 3GMLA 4BK4A 3LY6A 2E9IA 2PYFB 4GQPH 1JZ2A 4ZSOA 3WJJA 4MSWA 5E8PB 5TDOB 4X5LA 4OBSA 4JRXB 1FNSL 2IFFL 3V6BR 2Z8RA 4JKPL 3EYFB 4KY1L 4H8WH 3JTSB 4XWOC 1IM9D 5E99L 1E27B 4FXLA 4QHKJ 3DV4B 3IDMA 1D5XB 1PW3A 4X7SH 3WCYA 2MQCA 1AQDA 5DJ8B 3W9DA 2YSSA 3NCJL 5K9KA 3O81A 3STBA 3WFCL 2OTWA 3OBAA 2M2DA 4OQ1A 1OCWH 1ZA6B 3B43A 4XP1L 2UV3A 4JKWA 4GKOA 5FEBA 3BOVA 1L7TL 3TBWA 4ZPVB 1EJOH 4EXKA 2BVTA 3BDYH 3RGVB 3WL9B 4PRIE 1CIDA 1IGMH 5DD3L 4XWGH 5FF6B 1YY9C 4L4VB 3AB0C 4RMTA 2AAVA 2I27N 3V79C 5DJAA 4NGHH 1DEEB 5DJCB 5IBLD 4N0CD 4XP9L 4YBLB 5IHUL 5D1QD 3QQ4A 3SJVD 3RFZC 2GJ6A 1K4DA 3DRTA 2L0DA 3D25A 4PRAB 3W9EB 3WFEL 5D1XA 2EE6A 1HZHH 3BGAA 1U8LB 2QQKH 1RVFH 1A1NA 3P11H 2C1PA 4IHOA 4C54A 4W6WB 5F97E 5C0CB 2OZ4A 5C0DA 5FUOH 5DGRA 3RVUC 4JFEE 1A6WH 1BX2B 4JJ5A 2VDNL 4BFGA 4H8WL 4HDIA 3P0VL 4KMLB 2N56A 3C60D 4X7SL 1L0XA 1TITA 4CMMA 1UWXH 2EYSB 5KSUB 3BRDA 1DL7H 4MNQA 3L3IB 4HS6B 3O4LB 4NN6B 1I85C 1QQDB 4DKAA 1HHKB 3UMTA 1LO0H 1XR8B 5E8PA 1HH6A 1XGYH 3BP4B 3ZYOA 5JW4N 1PFCA 3P30L 1DUZB 2EKJA 3GJFB 1EJOL 1X6LA 2WP3T 1E27A 4CU6A 1LE5A 5IB4B 2R0WH 1CFSB 1BOGA 1E6JH 3BDYL 1CLOH 5DJ8A 4YGAB 4F7PA 1C16B 1TLKA 5ACZA 3KWWA 1IGML 3BGFC 3E2HC 4XWGL 1OP9A 2IALA 3V7AG 5ISZE 2XTJB 4OZGA 3O3AA 2Q76B 4NGHL 1RJLA 4DAGH 3WNMA 4JKMA 4OM1H 2VWEC 4M1GH 3UDWA 4ZPVA 3CXDH 5DFVC 4QRPA 2WM0A 4IRZH 4F58L 1HOCA 3U9UA 4XNUH 1F4AA 3HG1A 1JPFB 3QIUB 3ILPB 4N8PA 3MUJA 5CSBA 4LCCB 1BWWA 2F53A 5BVPH 2QQKL 4IRJB 3T2NH 3P11L 4GW5B 5DJCA 2P47B 1LQSR 5JDJA 2A6JB 4Y4HC 3C08H 5FUOL 4HD9A 1WZKA 5DMGD 3VFMB 3FJTA 5GRVK 5DC9B 3F7RA 3HAEH 5EU6E 1A6WL 5HHOE 2DB8A 2VZ1A 2ZOKA 2ZPKH 4WV1C 1BFOB 5A3IC 5E8NA 1IAMA 3WHE0 4X4ZA 3L3GA 3MBEC 5FB8B 4WFED 3G5XB 1SJXA 1OAKH 2IC2A 1R24A 2IMNA 1DL7L 4PLKC 1GHFH 3WMSA 4X9FA 5J11C 3DIFB 2FEDC 2EIZB 1I7UB 1LO0L 3QCVH 4L8CA 1UZ6E 1TVBA 1MLCA 2XZCH 1WFOA 3MRQA 4PFEA 3WN5A 2VLKA 1I3UA 1IAIM 3QG6A 1G7QB 2R0WL 3QDHA 4IMKA 1E6JL 2B5IB 4DCQB 1CLOL 1CE6B 4PG2A 1G1CA 3MJ6A 4JM2F 5FOBB 4XI5D 3L3IA 1N64H 2V7HB 2X4UA 3UBXG 4X80H 4JRYE 5D5MF 4OF6A 4XP5H 4DAGL 1J18A 1Z9LA 5INDB 2AJZA 4HKZA 4OM1L 1A7QH 4M1GL 1R5IB 4KVCH 3NIFE 4YHLH 4LARL 5IB4A 2HRPH 3QUZA 4IRZL 4Y2DD 4HKBB 4RZCA 2UZYB 4NHCH 2WUCH 5BOPA 4XNUL 4FTVE 4G6JH 3H6JA 3GSUA 3O6FB 3CFJA 5JXEC 4P5TA 4HWUA 1BZ7A 2JELH 4F9PA 1P1ZB 4E41B 1WISA 4MA1B 1MI5A 3T2NL 3AY4A 4GRLD 3C08L 4KTDL 1QFHA 3HS0B 4B7IA 3QULB 1RUQH 2ZPKL 4JN2B 2DJUA 2Y36L 1XF1A 2A2QT 2Z35A 2W60B 2WINB 1PZUB 4LCCA 1OAKL 1OGTB 4MS8C 3MRNA 1GHFL 3QPQC 3UJJH 2JLLA 1AGDB 3L7EB 2W9EH 3QCVL 4HGMA 3V8CA 2VDMH 2PTVA 3U82B 3ULSA 2EKSA 1QSED 2XZCL 3ARGD 1LEKB 3I85A 5HGBA 5DK2A 5F3HA 5F1IB 1EHAA 2PXYC 4R4BB 4XCNB 3OQ3B 1FJ1A 4Q97A 5E9DD 4AQOA 4HV8B 5EOTA 1SYSB 1IKNC 1CE1H 5CBAA 2LQRA 2ARJB 5L6YH 3DIFA 2FX9H 3WXVH 5EC2B 1N64L 1PKQE 5TDPA 1T22B 5A1AA 2XWTB 1MRCH 4X80L 3HLAB 1AD9A 2AV7B 4XP5L 3BIKA 3FB7B 4GKSB 4PJCF 4K9EL 1A7QL 1YPZE 3PP4H 4KVCL 5CUSH 1MFNA 4LHUB 4XVTH 3WIFA 4YHLL 1HSAA 4LQFH 3QUXC 2HT3C 1FORH 4WHTB 2HRPL 4NDMA 5BXFA 4NHCL 2WUCL 3MNVB 1LO4H 4G6JL 1A8JH 5JMOC 1MUJA 4JFQB 4N0UE 2JELL 5D7LE 3FRPA 5FDWB 1H8SA 4K7PX 4M7KH 1DUYA 1XGRA 3I75A 4HJ0C 2R2EA 4QXGH 4YFEA 4JFEA 1NJ9B 1RUQL 4HKBA 1J05B 4ZUVB 1DE4A 5DJ2B 3O6FA 1K8IA 2VQ1A 1P9MA 3SKOB 1DBKH 1TDQA 2R23A 2UVEA 2ZSWB 2W9EL 3KJ6L 4RX4D 2NY6D 2VDML 1VEOA 4HUXB 4IRSA 3RUGE 5M95B 1CDCA 2NTFB 3F6IA 4HUUB 4NKIL 3OGCA 1X7QB 3BIAX 1CE1L 5L6YL 2FX9L 3WXVL 1U3HB 2OZ4H 2AQ1A 4XHQA 1Y0LA 1MRCL 5ISZA 5MERB 2C3XA 5DMYA 1VGEH 1CGVA 4H1LG 1A3LH 3S96B 1CGSH 5KSVB 5IROC 4GG6E 3PP4L 5CUSL 3KPRB 4XVTL 4R4BA 5FA4A 4LQFL 1FORL 4X4XB 1P2CB 5L88H 5IMLA 1LO4L 5GZOD 1KV3A 3WJLA 4KV5E 4RMUA 1BVKB 3PL6A 1CFTB 3K4DA 3RGHA 3LPWA 4M7KL 2EDYA 1TQCB 2WLZA 3H9HA 4I9WD 5C0IB 4EKXA 5KSAC 3CUPA 3NVQA 4QXGL 1U42A 4WI5A 5IB3A 1AGEA 4IBLT 5DD5H 5EUOE 5E2UH 3D9AH 4ZUUB 4K3EH 5EU6A 5B8CA 5HHOA 2XACC 4P4KA 5I6XB 2Z9TA 4HLZG 3S4SB 3GSWA 3L9RB 5BW7C 4PV8A 5FDWA 5E7BA 4WFGE 1DBKL 3C5JB 3TZVA 5HVFB 1HWGB 2PCPB 4OCLC 5HDQL 2CK0H 3JV6B 5EZOH 1S7SA 4NSKB 4GMSH 3O2VH 3JWOC 5HHMB 1N0XH 5E7FA 5DJ2A 3IJHB 3BPOB 5C0GA 4U6YA 1CQYA 1RUMH 1GIGH 1A4KB 3SY0A 1RD6A 2WAHA 2OZ4L 1X5FA 1U0QA 1S7TA 4L4TB 1G6VK 5JZ7C 3TCXA 3G6JE 1FYHB 1FZOA 2QQLH 4MD4B 1WT5C 4JRYA 3VJ6B 1VGEL 1A3LL 4M02A 4HUXA 5DLMH 4P23A 5EO9B 3L1OH 4NWTH 4GAFB 1D7FA 5L88L 3Q6FA 1X7QA 2VLRE 5CJBA 2X4TA 3FQUB 1OHQA 2XN9E 4PJBF 3P77B 4RGNB 4U31A 5IUSA 3DGGA 1JZ6A 1WTGT 2ESVD 3S96A 2C4FU 4XRCB 3LB6D 3EYSH 2R4RH 1JIBA 3VMOA 5DD5L 5E2UL 3D9AL 4K3EL 1SMAA 2UWEB 2BHUA 2VKXA 3ULVD 4NZTH 4Y5VC 2P45B 2VSCA 2WBWB 5E6ID 5F9DC 1WWBX 4UIKL 5HPOA 1XIWB 4L29A 1SJVA 4K71C 1CFVH 4TOYH 2AJXH 5EZOL 1KUMA 5FCSH 2X4NA 3OF6D 4BZ1H 5CEZH 3UTPD 4JO4H 1N0XL 2YUVA 3SCMB 5FYLH 3FB5B 4XT1C 1FFQA 3RWDB 5FGCB 1RUML 3NGBB 1GIGL 2DOCA 2AXJA 3I6LE 2AEPL 1MH5B 1UB6B 5E2VH 1DN0A 3TBYA 1T1YB 3KPQA 1H9VA 3U46B 1F42A 2QQLL 3F5WB 3ROOB 5H94B 2HMIC 2EXYC 3HE7C 4YDKH 3UPRA 5DLML 3L1OL 1YPZA 4NWTL 5A2KH 3FRUA 1A4KA 4GAGH 3CFCH 3HI6H 3BEVB 1A6ZB 1D5ZA 4XCFH 1F3JA 4L4TA 4N0UA 5D7LA 3FQWB 3CDFA 4B50A 5DO2C 2ZCLH 1ZVYA 4MD4A 4RRPA 4ODSH 3TJHC 4PP2A 3B9KC 4KRPC 4XNZB 1UH2A 4ODXB 2BVUA 3FO0L 2V2TB 2BNUA 3EYSL 1I1YA 1IAOB 1LNUA 1G7HA 1DBJH 2ZUQC 4PGCB 3E6FB 1RZFH 4NZTL 1G9ML 4P5MB 1H0DA 3LH2H 5HDBF 4IDJH 3KDMB 3KLHD 3EYUH 4OBRA 1Z6JT 3INUH 3QDAA 1VEPA 4FRWA 3PWLB 3FB8B 3N06B 4R97B 3STLA 4FQHB 1CFVL 4TOYL 2AJXL 4BZ1L 3SDAA 4JCMA 4JO4L 3S35X 3VFUB 1S8DB 2R2BA 3MV7D 3RUGA 3HI5H 5FYLL 4OV5A 3MROB 4OLXH 5GS0H 1UACH 4KC3B 5DEGA 4FFYH 5E2VL 5HPMB 2QEJA 1KPVA 1J1OH 1FO0B 4DKEH 3T0XA 4MNGE 2W9LA 1MHHB 3MRFB 4QRTB 4GG6A 3HA0A 1FFPB 3RWDA 2VIRA 3UJIH 2R0LH 2OI9C 5BOZG 4O9HL 4GAGL 3CFCL 3HI6L 4MJ5A 2CR3A 2XG5A 5I1EH 4XCFL 3T2PA 1S7UA 3MXVH 1W72A 5IB1B 3R1GH 5DQ9A 3F7QA 1RZIB 2ZCLL 3ROOA 2Q7YB 1S9WA 2D2OA 4ODSL 3RL2B 1J7VR 5E4IA 4M3JA 4EDXA 2JIXB 3R06A 4NQVA 1QBMH 4QXUH 4AEHH 1NC4D 5ETUB 1DBJL 3QZWB 1J87A 5T1KD 5EUOA 3C9NA 3LN4A 1RZFL 4LLVB 2XWBA 5T1MB 5EN2A 5C08B 3BEVA 3EYUL 2P4AB 3VGBA 3UP1A 4Z7OE 1L9MA 1OY3B 3NBNA 3INUL 3RJDA 1UQSB 3FTGA 1XGUB 3B2UD 4ODXA 1OB1B 3GMPA 1W8NA 4NBZB 1F02I 1U41A 4FQJH 3D0LA 2D7PA 2J8UB 4Y5XB 3RY4A 5EU4A 5GS0L 2Q6WB 2ERJB 2GJ6D 1UACL 3AUVA 3VRLF 3L5XH 4RCAA 4FFYL 1A9BB 5DVKA 1Q9OA 5F89B 3FB8A 5D1XD 1U91A 3ZTNH 1J1OL 1D5MB 4DKEL 3G6JA 3WXWH 4P46D 2HFGH 4KROD 4U7MA 5E5RB 3B9VA 1BM3H 5J89A 1MFAH 1S8DA 3QDGE 1IL1A 2LAAA 5I8CA 1A2YB 3C8DA 2VITB 1Q72H 4QXTB 3UJIL 2R0LL 4UT9H 4PR5B 5F7YC 1HI6A 4LSDA 1KCSH 2W65A 1NFDF 2VLRA 5I1EL 5SWSD 1C08A 5DC4B 4CW1B 2XN9A 3R1GL 2OLDA 2HTKC 1XH3B 5H8DA 1AQKH 4PJFE 1QBML 4QXUL 3D39B 2NMSA 4AEHL 4N1EA 2X1QA 3X13B 3B9AA 3P9LB 1WIPA 4JRXD 2B8OT 1KCUL 3NN8B 1E4KA 4HIJA 4QWWD 4Y4KC 3DTXA 2E8ZA 1EVUA 1UEYA 5IBTH 1JUFA 5TGBB 2LTQC 5JOFB 5J8OA 3QWRD 1HHIB 3GSVB 5TF1H 2JCCB 5ETUA 4FQJL 1G0XA 5GRWA 4WEMB 3H7BB 5C08A 2D9QB 5JW3H 3REVA 3AMKA 2CRMA 4FQXA 1Y6MR 2VZOA 3RGVD 1MEXH 1UQSA 3L5XL 1J1XH 3C5ZA 3HG1D 4KTYA 1XGUA 3G6AB 2F58H 1PGRB 5DUBA 1OB1A 4L4VD 1A9EB 4WW1B 3I84A 4U2YA 3IXAB 4ZQKA 3WXWL 5T5FH 5GGRB 1PY9A 2HFGL 1BM3L 3O8XC 4C83B 1F13A 1MFAL 4LLYB 5CWSB 1D9KC 1TPXB 1Q72L 4YDVB 2B20A 4UT9L 3JVGC 4CU7A 1UWGH 1KCSL 5IFAH 4OT1H 4NQCE 1B0RB 2C1OB 3EGSB 5F89A 2X89A 3OXSA 4LF3B 2ZCKL 5FDYA 1SVCP 2BVQB 2V2XA 2D31B 4XXDA 4GLRH 4KHTH 43CAA 4U1KB 1AQKL 3L95B 4QTIH 2FJHB 3WNPA 1B88A 2QQNL 1MFBH 4RNRB 3U4EB 1EGJA 1L0YA 4P9MH 3VXOB 2X10A 2DDQH 2PN5A 5T3XE 4DN4H 3KYMA 1P5VA 2G5RA 4HG4J 5IBTL 2DM3A 4J3TA 4ZAKC 2XY2A 1XH3A 1T7WA 3O4LD 2QSTA 4NZRL 3W39B 3VDBA 3QQ3A 1W2KT 5TF1L 2RFXB 1KIQB 3O9WB 4OF8A 3PV7A 3P9LA 4HIHB 4MJ6B 1ZLVH 1P7KA 1RV6X 1RK0B 3NN8A 5JW3L 5CEZD 1QFWH 1M7XA 4RFNC 1MEXL 5FKPB 5FYLD 5JOFA 2BP3A 4NKOB 3HCVB 3VWJC 2XTJD 5T5FL 1EK3A 2JCCA 4MAYC 4MNGA 5K9QI 4LGSB 2HT2D 2ICWB 1HHJB 3C6LB 2WZPD 5IWLC 4FXKB 1QEWA 3H7BA 5EBWB 3X3GH 2Y5TA 5CP7A 3KPMB 1UWGL 5IFAL 4NCC2 4OT1L 2LVCA 3MRLB 4HGWA 3L7FB 3QIUD 4I18A 5CEYB 1A9EA 1M05B 2GAZA 1BBDH 4KHTL 5FGBC 1UXWB 2A0LD 2E6QA 4IRJD 3MRCB 4M62H 2IH1B 4QTIL 3IGAB 2ZSVA 4HIEB 3QHZH 1I3RA 1CTOA 4EVNB 4K94H 4PD4K 4KGJA 1MFBL 4P9ML 2I9LB 4CVZA 2DDQL 3PIQA 3VFTB 4DN4L 3EGSA 4M93B 1WWCA 3OX8B 2OR9L 5JLZA 2YN5A 4ZFZA 2HLFC 1XGPB 1FNEA 3LCYA 3RY5A 4GKNA 5C0NC 1FZJA 3FO2A 3MMEB 1K4CB 1WJ3A 1KLUB 1NAMB 2GK2A 1ED3B 4NNPH 2YZ1A 3SKMB 2B4CH 4HLJA 3SKUD 1GC1C 1C5CH 1Z9MA 1W72H 2NY0B 1HQ4B 2VISB 3BRGC 4NNXA 2EDTA 15C8H 3QEQE 4PJHF 2ITCA 3HUJE 1MCEA 1UXSA 3B6SB 4LNVA 1JCKA 1KIUA 2P42B 4ZYKA 1ODAA 4DGVH 4HIHA 3DNKA 1IQDB 1E28B 3QDGA 3X3GL 1UKSA 1C5BL 4UUJB 5BQ7A 2X41A 2WWKT 4EXPX 1MELA 4U7KA 2XKNA 1AXSA 3O6FD 4Z0BH 3CPLB 3L3HA 1ZV5A 2CD0A 5IOPB 2WV3A 3MV8E 1ZLSH 1BBDL 4E41D 3ARDB 3CU7A 1QHPA 5IR1A 3LD8C 4M62L 2GIYA 3PHQB 4PY8J 2QBWA 1NANI 2ICWA 3QHZL 1KTRL 1I1AA 5I1DB 4RAVB 3MJ7B 4K94L 1IE5A 2WNGA 1IGTB 1G9NH 2CMRH 4IRSD 2FL5B 2DIAA 3JUZA 3L7FA 3MR9B 4PRDB 2LFGA 1JHKH 2YC1A 4XBPB 3SDXF 1RJZB 2L7UA 1CVSC 2IF7A 3IGAA 1CTNA 5J9PB 2DM2A 3CFDA 5ICYB 4EQ2A 4EVNA 4NNPL 1B6UA 4NN7C 2B4CL 3MLPA 1C5CL 3MBEA 1YNTB 3OX8A 1W72L 5C3LD 4KJYA 5F7KC 4HAFA 3EHBC 1DP0A 15C8L 2A9MH 1EMTH 3GUTA 3SE3A 1LE9A 4EUPG 3QI9A 3QZWG 5TPWH 1CXFA 1CF8H 1GZQA 2WQRA 5B39A 3QIBC 1K4CA 1ACZA 2EO1A 4LCWE 3CZJA 3BUYA 3HZVB 4LHUD 1LO5A 2VISA 2FR4A 1H3UA 4QRQB 4LPCA 4OCSL 43C9A 1YEEH 4G8IB 2E3VA 2NCMA 5DRNA 3B6SA 1ZLSL 1P6AB 1X5XA 3AAZA 3NTCL 1RIHH 4X9HA 1DANU 1ERNA 3MRPA 5KBNC 1FYTE 1WITA 4NKMB 4WEBH 3FT4B 4WIQA 1G9NL 2CMRL 4ZTPH 4KK9C 5A2LH 4DW2H 5JORA 2NX5B 5ALBL 5CGYC 1JHKL 3K7UA 4V1DB 2CDEA 4TNVF 1U8HA 2KKQA 3VRJB 4MQ7B 5D93B 2PYEB 5EOQH 3RTQB 2PO6B 1VERA 4S11A 4BQBA 1ZLWK 4LSQH 5JIKA 2IBGA 1B3JA 3EFDH 5E8EB 3EFFA 1EIBA 3QJHA 4XPHH 2FLBT 5I2IB 4OD2B 1HK6A 2EDDA 5FV1L 4XVJH 3KXFB 1MHEA 2WWMC 1YN6A 2CGRH 5EZLB 1X5YA 1YMME 1JWSB 4DVRH 3NFNA 1SHMA 1ZT7B 3DO7A 4EI6B 3KPLA 5JQHC 3TFKC 1ZSDB 3O3EB 1X44A 3PWUB 4MDIA 1RJZA 2A9ML 1EMTL 4R3SB 2J88L 3T2OA 5TPWL 1PEZA 1CF8L 3Q5TA 5J9PA 1KPUB 3MJ8A 1F5WA 3MNWA 5ICYA 4YK4C 3RBGA 1J10A 3WS3B 1EGJH 2P1YA 4L3CB 3OKDB 1FAIL 1YEIH 3BPCB 3KPRD 1J8HE 3MNZB 3I3EA 2P5WE 1JRHH 4WUKH 4PJ8A 4P2QB 3JWNC 1YEEL 4ONGH 3B5HA 1IEBB 4R96A 1RIHL 3FFDB 4APQC 1S7QA 4W81A 3ARQA 5ERWB 4L3AA 3GMQB 3UTSE 4WEBL 3ZDXF 3VXTA 12E8H 1LEGA 3L5IA 3BVNB 4WI4A 4DW2L 3U1SH 1KIRB 1B6DA 1V7NH 5JR1H 1C1EH 3T4YB 1ZS8A 1IMHC 5EOQL 5A2FA 5GS1A 2R1XA 1R5VB 1YY8A 4LSQL 3EFDL 1TNNA 4Y16C 4XPHL 2ADFH 1QFWM 2FBJH 4HUWB 4XVJL 5JIPA 3GBMH 5FO9B 4MCZB 5H2BB 5HHMD 2RBLA 2CGRL 2HLAA 4OB5H 4DVRL 1U8IB 1LMKA 1U8PB 4BFBD 2ZUTA 5KVEL 5HGAA 5F9JB 3S6CA 1R3HB 1OPGH 4LHQB 1OGAE 2GTZA 2N1KA 3QG7H 3RZCB 5I76A 3RTQA 3QEQA 1RZKH 5E56A 1NMBH 1JNHB 4L4TD 5I2IA 2YBRA 1NEUA 4Z78A 1NUFA 1XF3B 1BZQK 3KPSB 1EGJL 2X4PB 4WHCA 3S3PA 2RR3A 3KPNA 3RX8A 1YEIL 1JWSA 1RUPL 3KVQA 5E2TH 3BD4A 4WHYH 4WUKL 3ROLB 5EU3A 3P9MA 4E5XA 4ONGL 5CSGA 4KQ4H 5KSBF 3MV8A 1KPUA 4UT7H 1UEMA 3VGAB 4R7NB 5ESQB 4KU1A 4YWGL 4QHNB 4YHOL 5C6PB 1X5LA 2IQ9H 2UY6A 2XWJB 5D2LB 4L3CA 3B8YA 5BVJB 4HKXB 5EWIH 1AGCB 1GCFA 5FIEA 2JF1A 5IJKA 4HUNB 3MRGB 4UB0H 4I0CC 4ZXBA 12E8L 1YA5A 3H9YA 3O3BB 2A83B 1Q9LA 3U1SL 4P2QA 4JFYB 4BQ9A 1V7NL 4KKBC 4CJ0A 5JR1L 3MZTA 5JO5B 1C1EL 3CSGA 3GMMB 2ZOLB 2VYRE 5KSAA 1IZKA 1XIWD 2UYLA 1W0VB 3N1FC 5ALCH 2ADFL 3D3VB 3ARPA 5F72S 5JOEA 3N50A 2FBJL 4G6KH 3GBML 1R0AH 4Z76B 4JFDE 3QCTH 4NN5C 3ULUH 3QFJE 5K59F 1VACA 3BVNA 3I6KA 1WCBB 5JIIA 2GJZB 1KTDA 2HYMA 3LQMA 1H5BB 4WENB 1OPGL 2APXA 2P8MB 3QG7L 5IF0B 1RZKL 1P69B 4QHLA 1NMBL 2YUWA 5IJVB 3DARA 1WSST 3IDNB 1MRFH 3IU3B 1KLFA 3PXHA 1ND0A 4JGMA 1UA6H 2H8PB 3BXNB 4LCWA 2EIBA 3JV4A 5BO1L 2DI7A 4AK1A 4FN0A 1CD9B 1U8IA 2R9HD 4BSWB 1CGXA 3PHOA 4PRPB 1GOGA 2D7NA 2H41A 4PJ7B 2P8PA 3GSRA 2EDLA 5I1IH 3RZCA 1NCNA 2LVEA 5ELIA 1HILA 4N0YH 5FKAA 4KQ4L 5IVXB 3HPLA 4TRPL 3HMWH 1CBVH 3O2DH 4WFGD 3MUGA 3U30B 2IQ9L 4HAGA 3BH9A 4IOIB 3OKOB 1NGZB 5EWIL 3TA3C 4G8GE 3IDGB 4UB0L 3W2DH 4LCYB 2VH5H 1FYTA 3SDDA 3L5WA 1M7DA 4BSVA 4BYHA 1INEH 4RFEB 3B3IB 4UNVA 2AGJH 1IGJA 4YR6A 4V2CB 2VKWA 4XAWH 4PJGB 4DUXA 1M7IB 1IM3B 5ESQA 5EO1A 5SX5K 5M94B 1N5AB 5ALCL 3TO4A 4HMEA 4ZO8A 2YD1A 1CCZA 1OL0A 4Y8DC 5ITBH 4G6KL 2VB5A 3T0AA 3O3BA 5BJTA 1KLGB 1YMMA 3PWJB 5J06A 3LN5B 4ONHB 3QP3A 4JFYA 4OZ4B 5IIEB 4NO3B 1ONQA 1NGWB 2J3SA 2QADD 1A6TB 2ZOLA 4YPGA 5HHPA 5D7JC 3U83A 3G9VA 4X7CC 1DQLH 1HXMB 3DUUB 1MRFL 1AXTH 4U1HA 3Q2CA 3DROB 1R3JB 4D9QE 3OKNA 1UA6L 5IQ7H 3S9DB 4L8BA 4EOWH 5T3XH 5E8OB 1HHHB 3P3YA 1J8HA 5D72H 3OXRA 3U0TB 2C3WA 1PG7W 1MCBA 3GB7A 5IBLC 3IVKA 3TNMA 2P8MA 5I1IL