1YMHA

Anti-hcv fab 19d9d6 complexed with protein l (ppl) mutant a66w
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
220
structure length
220
Chain Sequence
DIVMSQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLAWYQQKPGQSPKVLIYWASTRESGVPDRFTGRGSGTDFTLTISSVQAEDQAVYYCKQAYIPPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab 16D9D6, light chain
publication title Comparison of the crystallization and crystal packing of two Fab single-site mutant protein L complexes.
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Immune system
total genus 42
structure length 220
sequence length 220
chains with identical sequence C
ec nomenclature
pdb deposition date 2005-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ymhA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ymhA01
3PHQA 5FV1L 3T4AA 5EULV 1I8KB 1CT8B 1JPTH 4X4MA 1T5WA 3BKCL 3HZMB 2O5ZH 4Y5VC 5CEXB 1KTKE 3KPQA 4NKIH 5AD0B 3GBML 3DO7B 1XH3B 4JRYE 1AR1C 3KYKL 5MHSD 1QOKA 3ZKXB 2K7PA 3MRCA 4KGJA 2IMNA 5C0DA 2W0PA 5D7IA 3SQOL 3OAUH 2Q8AL 3MLSH 4NZTH 3H8NA 4X8JB 2J6EA 3T1WA 4U1IB 1ACYH 3O41B 2OP4L 4OD3H 4YNYB 3WL9A 5FGSA 1JRHI 3QQ3B 4L1DA 4G3YH 1KCSL 1HSBB 3QHFH 4L4TB 2GJZA 4FQ1L 3S37H 1NKOA 2CRMA 1I9RL 5EU7E 4MAYB 2OTUA 5T5NF 5MP6H 2VMFA 3TESA 4QHNB 3RPKA 3VDCA 5CCKL 1AHWB 2EIZB 4XCNA 5J7CC 2FR4A 1I7RA 4L8CB 2XA3A 2IFFH 3KVQA 4LDOB 3U2SA 2APBA 2PCPB 3Q6FA 5I74B 3RZWA 4WW2A 5L2KD 4QHLA 3BPNB 5E94A 1LNUA 4KK9D 4PRPE 4XH2A 4HSQA 5IP4A 3VWJA 3NMEA 1LO0L 1J8HB 2VXSL 1JPGA 5DTFB 2OX5A 4OM1L 3LKRA 5J13B 1A8JH 5DMIH 1KCLA 4OF7A 3GM0A 4J7RA 1FIGH 1R3IL 4LNRA 2DWDB 1GVIA 2J8OA 5DJ2A 4XXCA 1QRKA 3O2VL 1MHPH 2AK4B 2V7NB 5L0QC 2E5EA 2EYRA 4M48H 1L0XA 2JIXA 1UB5B 3MOBL 4JKMA 4PRPA 2XTLA 4K2UL 1DN0B 1VFAB 1D5XB 1S7SA 1TZHB 1MPAL 1S7TA 3G04B 3IU4L 4WY7H 1GIGH 2XACC 4OCWL 5HI4C 1LEIA 2LAGB 5EUOA 3JBG7 2PETA 3V9FA 4QRUB 1GGCL 4FTVE 1B0WA 4NQTA 4F57H 1T1WA 4GS7C 4L3EA 3EOTH 1S7UB 1CFQB 2XZQH 4JM2F 3X13A 4HUXA 5FO9A 1GAFH 1FVEB 3FN0L 3DYOA 1VCAA 5C0IB 3PDOA 1OTUC 4L9LA 4Z7NE 3P0VL 3IDXL 2OBGA 1JFQL 1E4XH 3ZKMC 3BPCB 5IB2B 4QT5A 5ENWA 4ETQB 4X4YB 5E08L 4M8VA 4FTVA 4ZXBA 2EDNA 4GW5A 3U4AA 4JFEB 5CUSL 1GGIL 3RL1A 4YDJA 3T4YA 3IAQA 4MX7B 1IAKB 1I8MB 3O9WB 4GMSL 1T20A 1UXWB 3OAYH 4X6BB 5C2BL 4LPCA 4ELKB 4YDIH 3CH8A 1Q94B 2VIRB 3ILPA 4U33A 4U6XA 3PHSA 2A6JA 3WFBL 1G9NL 2UUDK 2XFXA 3MUHL 5DSCB 2V2TB 2W65A 3S8WA 1IC4L 3R06B 4XGZB 1CFSA 1KELL 3ARBB 1CXLA 4HX1A 1DBKH 3SE9L 2G9HB 1DQJA 3PWJA 4PJXB 5GIRB 3TO4B 5E5RB 4MD0A 5CAYB 1TJHH 2IQ9L 4YPGA 3L3GB 3TEUA 1DJSA 4NC1C 1D5MA 1YY8B 4I0PB 35C8L 5KTEL 5D7KD 3OKMB 4JN2A 3ZKQD 4TTDC 1G1YA 1V3MA 1UYWL 3T0EE 1EV2E 4JE4B 4ODUA 3QQ4B 3QDAA 5EZJB 1BQHG 5ISZB 3HTLX 2YPLB 4ENED 3VJ6A 5A3IC 4URTB 5CEZL 3MRNB 4G9FD 3UJTL 2NLJA 6FABL 3P40A 4LL9A 2F54B 4UILH 3MLUL 2BMKB 3ALPA 4JFDD 4X6EB 4OFKA 3EO0B 4ZUVB 4X6FB 4N0FB 3U7WL 3VE0A 5EZOL 1E4KC 5DGQA 2X89D 3G5VB 1UWXH 1FHGA 5H94A 4WDIB 5DFVD 3FO1A 3PF2A 2VITB 3MRQA 4GSDH 4HIEB 3VMOA 3L3KB 5J8OA 1M71A 3WJJA 4BFBD 2FZ3A 5IV2A 4GFTB 4J6RL 12E8H 4EI6B 4DQOL 3LZFL 4HWBH 2Z31A 1T80A 3WN5C 4U6TA 3DETC 1XGQA 4XP9H 5H37H 4W81A 1RV6X 3KPMB 1BAFH 5FCSH 3FCTB 4MCZB 1J0JA 2AJXL 4Q9RL 3O3AB 3QEUB 1A1NB 1WWAX 2OR9H 4BQCA 3QAZB 3ARGA 3OF6A 5KVFH 1Z3GH 4H25A 1HI6A 5JMRA 4OI8A 1DDHA 1NBYA 4BZYA 1U3ZA 1OCWH 5J3HD 3ARSA 3MCKA 4K71B 3OB8A 4OCXH 1NLDL 4X99A 3QWOA 1C5CL 2GI7A 3N85H 3ECBA 1INEH 1LK3H 1ES0A 5TDNA 1ETZB 4P46A 5EO1B 4H20L 4TYUA 4PRHB 3RBSA 3QCVL 5IHZA 1BJMA 1AXSB 4UT6L 2VZUA 2KZ1B 4GMTL 4LARH 1QLFA 2VNCA 5DMKA 1UJ3C 4M4PA 1ZLVK 4HPOH 3N1PC 1KJVB 3VXQB 4HG4J 3HCVA 5D1QB 4H5SB 3MV8B 4RGNC 4LSVH 1A22B 1MFDH 4PRAB 1WCBB 2DM7A 1RIHL 3IETB 2CRZA 4P2OC 4Q9CA 2NW3B 3HAEG 4CU7A 1T7ZA 3E3QE 1AGEA 5ETUB 2EYSA 3KHQA 4FXKA 3HR6A 4NQCB 2Y9RT 2CKNA 3VFTB 2VR5A 2R39A 5CWSA 4F7MA 5GJSL 2BCKB 5E2TL 4QRPE 3QFDA 4X8XA 5IR1B 2Z4QA 1UWEL 1JP5A 3EGSA 4DCQA 1WJ3A 5FYLL 1LK2A 1OP5H 1WVZA 1B3JA 3BZFB 3SY0B 3BZ4B 5EBLA 4ZTPL 1Y18B 4PJ9C 3UJIH 2FYYA 1MLBB 4GRWE 1HKFA 3DIFA 3QIWD 1A4JA 2Z35A 3RWIB 5EIIB 2VKXA 1AGFB 4HWZB 5B3JE 2X4TB 2R56H 2EDKA 2XKUA 1T03H 2R2HB 5E8PA 3G08B 2EDBA 4YHPA 1U8QA 3V52L 1QKZH 4P3CH 5FKPB 3KLAA 3QO0B 3C6LC 2HJFA 3LV3B 5D6DC 3V6FB 3VFPA 3VFRA 3LH2H 4BSVA 2B1AH 2H9GA 4JFFB 3MBEA 2YA0A 4QYOA 3VXMD 1GZQB 1MCEA 1TVBB 3HPLB 2YD4A 1SBBA 5CP7A 2GCYA 4JO1H 2XWTA 4NKOB 1A7PH 1N7ML 5FUZL 1QRNB 3ULVL 1MCPH 4HJGB 3VRLF 3CXDH 5F9OH 1CQKA 4HFUL 1IAOB 5DMGC 1Y6KR 4WFGE 1VFOA 1X5FA 1IC7H 3KPOA 4QHUB 3QUMB 3OR6B 3WXWH 2K1MA 4J3UA 4HS6A 4MJIA 3SBWA 4M00A 1JZ8A 2YUXA 3GB7A 3DMMD 5DZOA 3VXUD 4DUXA 4HUVB 2AEPL 5CJXC 4DEPB 4J2XA 4YHKL 3LPFA 4P3WA 4P3DA 3V4UL 3ZHLA 1AXTH 1B4JL 3HZYB 4OZFA 3RVVC 4IOIB 4YK4B 5CEZE 1H5BA 4DAGL 3SHSA 4LU5L 4KJPD 1DEEB 5ADPH 5E9DB 5IQ7H 1ZHBB 2CIIA 3WDJA 4CVXA 1IGTB 2YSSB 3MRJA 5F7LB 3TT3H 3UBXB 4PP1C 4BKLB 1JMZA 1KPRA 1AO7E 1DE4B 1FQ9C 3UJJL 3SDYL 4RMTA 3KYNB 1T1YB 1NGWA 4PBWD 4U7SA 1C8PA 3DGCR 2C4FT 3QHZH 1ZGLM 4LHUD 2JCCB 3QXDB 2PO6B 1N3NA 4XBPB 1JZ7A 1BFVH 3MRIB 1DQML 4P5TA 3RJQB 5F88B 1PAMA 3GIVA 3EJJX 5CILL 1FCGA 1ZOXA 4OLUL 4IIQA 3QZWG 4M1DL 2AABL 2B1HH 1PLGH 1BQLL 1FPTL 5L2JA 2ARJA 2VL5A 2VTFA 3KYMA 2KH2B 3O8XC 1AO7A 4LSDA 3CCHB 1S9VA 4JFHD 2I5YL 3TM6A 2MMXA 4RGOH 1RJYA 5A2KH 1N5AA 3H7BB 2IAMB 4I18C 4P2QD 4QY8B 3DVGB 4U49A 4PJBF 5HHOB 1I8KA 1CT8A 3VWKC 1QTYT 4XT1C 4YEEA 4DW2H 4QWWD 3DOSA 4X6DE 1FRGL 1AY1H 3FJTA 3UTZB 3KPNB 3EO9H 1FNFA 4JCMA 3HLAB 3HZMA 5D6CA 3A67L 2C7UB 3H9HA 4PJHF 1WT5A 4Z0BH 4UBDC 4JG0H 3PE9A 3BP5B 1NFKA 2JELL 3VFWB 4JPWL 4X5XB 2DQUH 2VH5L 1JYWA 1BOGA 3C5ZD 1NC4B 3MA9L 4F58L 4HJ0D 5E8NB 3UZVB 5DC0A 1CDBA 2YPKB 1AGBA 3WV0A 3BH8B 1RK1B 4U05A 4X6DA 5HTSA 2PYEB 1SQ2N 1D9KB 4YNYA 1XT5A 3QQ3A 1U0QA 5J1SC 1BM3H 1HSBA 3HC0A 3V7MA 5IB1B 2A9MH 2P8MB 2DQGL 2BXZA 4PJ8A 5HXMA 5TDPA 3BDXA 4RISH 4QNPF 5I0DA 3GSUB 5E95B 4RQQB 4P9HH 4JDVB 4ZQKB 5BVPH 2HH0L 4M7KL 5J6GB 1TTFA 4L8CA 5HYJE 4ZMAT 2WBJD 3F12B 2PCPA 3V4PL 5JXEA 3EFDH 2AJZB 3O6LL 5HVWA 2YBRB 3WFEL 5HYSA 3CMOH 3BQUC 3TZVB 1FBIH 4FFZH 1BZ9B 2WWKT 2H8PB 3TN0C 1XF5B 4FN0A 1J8HA 4H88H 5DTFA 3LEVH 2ZCLL 1WBYB 2DWDA 5DS8B 1WWCA 3FRUA 4NQXB 4RWHA 4HH9B 5HYJA 2CDEB 5HYEA 3ULUL 3ZE1F 3ZO0A 4WFEE 4NKMB 1UGNA 1EUUA 2BFVL 3K4DA 4HDIB 5J0BA 1UB5A 5HY9B 3FB7B 1GL4B 5EU6E 4PREB 1P9MC 4XCCH 4LCYB 3RKDD 1YMMD 1JNNH 1L0QA 5GISL 4JFQA 4ZNCD 1VFAA 3ULVE 3QH3B 4K7FB 3F65A 3VFGH 3G04A 1JHTB 2GAZB 2GFBA 2HT3D 4NN6C 4GKNB 1MJJB 1P4IH 3HI5L 1T4KB 4XNYL 1P7QA 3GGWB 5CINH 4O5LH 4AT6A 4CNIA 1U8MA 2IMMA 2RB8A 5C6TH 2EEAA 3O6MH 4JZJB 2XKNA 2W9LA 3DVFA 4K9EC 3P4MB 4YGAB 3KLHD 4X0KA 3PP4H 2AJVH 4KWUA 5TH2A 1WIOA 1I1AC 4FP8L 1AKJD 1VACB 3BPCA 1BVLB 5IB2A 3KNBA 2V5TA 4X4YA 3FOLB 4KPHL 1OHQA 2CIKA 3OKKB 4FQQB 4G9FB 3O6FD 1NBVL 1RU9H 4KJYA 3AXLB 1JWMB 5I1DB 3H9ZA 1KGCD 3U0PB 2DS4A 1YN7A 1YY9C 4Y5XB 3O9WA 1G7HA 4B50A 4KKNA 4ELKA 1WC7B 2VDNL 2VIRA 4ZOBA 4UQ2B 3GUTB 3BUYA 5BVJB 2ZG3A 1BFOA 4XVJH 4Z5RB 2ZG1A 4M62L 3R06A 5D7LB 15C8H 4OLZH 3ARBA 1P1ZA 2X7LB 1KJ3H 4N8VA 4KRPD 2VLJE 3T0AA 2G9HA 3IVKB 5GIRA 3TO4A 3TJHC 1A6AB 4NO5B 4WWKC 3AU1B 1KTDB 1IT9H 3I6KB 2NY0C 5ILTH 1VDGA 3FT2A 3L3GA 1LEKB 3KGRA 3AB0C 1QR1B 4JHBA 3QUKA 4LCCA 1NGZA 1NL0L 1YY8A 4YIQB 3WNMA 1WAAA 3LKNA 5IVXF 4N9GB 2NY6D 4MXVF 1A6ZB 3WNNA 4F80A 4RAVA 1R3HB 1IKFH 4K8RC 2BP3A 4JM2B 5ISZA 1ORSA 2VLJA 4Y4HB 3MRNA 3WD5L 2Z0BA 1KCRL 4OQ1A 2I60H 4ONFH 2F54A 4Z77B 4F7PB 4OZIE 4KKBC 3TCLA 2CJUH 3QDGB 1EJOL 5SX4I 3EO0A 5E2VL 5CGYC 5EO9B 1NUNB 1C5DB 5J06A 1TTGA 1C12A 2XRAH 3G5VA 4U0RC 5A2JH 5ACZA 4O2EB 3PNWA 4WDIA 4DK3A 5JOPD 3Q5YA 5DURB 1BWMA 3QEHB 5ITFA 3RIFK 2VITA 4HT1L 4Y2OA 2BOCA 3MV7E 4EXPX 3TJEH 4TPRH 1K4CA 4ZYKB 3B9KB 1EO7A 1U6AH 4K7PH 1UG9A 2QSQA 4OZIA 1PEZA 3GMMA 3ARPA 4KKCD 3QI9C 4NQDD 5ANME 3RZCD 3ZTNL 1AQDB 2ZSWA 2ZCHL 5DJ8B 1IGML 25C8H 4NQED 5I17B 5D2NE 3KPMA 1TIUA 3LRGA 1A6WH 3MRHB 4I77H 4X6CB 3FCTA 3SJVB 3QULA 5CJOL 4L4VD 2F74B 3OAZH 4LMQE 5ESVA 2VZ1A 1IJ9A 3E2HB 5CD5C 4G6AC 1DBBH 3BYYA 3BN9D 3HR5B 3MCLL 3MV7A 5C0BE 5EUKB 3FRPA 4F3FB 5IFJB 4UNUA 1X5ZA 4IRJB 4Y5YC 2PTTA 5DEGA 4Y16C 1S5HB 1MFBH 1YEJH 1BHGA 3BGFC 3CFKB 3SDCC 5HDQL 4UT9H 5D2NA 4P23B 1QBBA 4NM8L 4NKQB 3DECA 4APQB 4OD2B 4YXLH 2OS7A 5HPMA 1VB9A 5ICXB 1AXSA 1UA6L 3LHPH 5C0BA 2GY7B 3KPRE 4AEFA 1QLRA 2N56A 5HDBE 1ZSDA 3MRFA 2QADC 3VXQA 2N7BA 3WEXB 2ADJA 1HQRB 1T83A 4PR5B 1INDL 4H5SA 5CBEA 5HHVH 5KG9B 3PWPB 4EUPB 5KAQG 3X11B 4Z7UE 1MVUB 4K07A 4NOFA 5I66B 1WCBA 4HF5L 3MRBB 5E56A 2NW3A 2VDLH 1J0HA 4UAOC 1FZJB 3WIIL 5F7YC 4JDZB 3IJHA 3SGEH 4NQCA 2IC2A 2A6KB 2HKFL 4KI1A 3LPWA 3FQTB 4O00A 1HHIB 2OXGA 1AGCB 3I3DA 4YQXH 5HJ3B 4Z7UA 2DQFB 3BZ4A 5C08A 4MAUH 4EN3D 4S1SL 5TPWH 1RZJL 4GXUM 5I18L 3ARFD 4W4OC 4AIOA 2VSCA 3G6DL 4M5ZL 3VRJB 4QRQA 2E8ZA 2MTPA 4IRSD 1AGFA 2ATPA 2FX7H 2X4TA 1C7SA 2H45A 1ZVHA 4Z7WF 5L9DH 2FBJL 4OM0H 1JWSA 3G08A 2B4CL 4E5XB 3TBVA 1XIWD 4WO4B 2Q8BL 3LV3A 2D31B 1PQZB 5LWYH 5FUOL 3RHWF 2NTFB 3HB3D 3HPLA 3TNMB 4NKOA 2ITDA 1S7QA 3Q3GA 5LGHL 4KZEH 3GMPB 4HJGA 1DVFB 1EMTH 2P5WD 5DT1L 4XPTL 2QSCH 3P11H 3F7YB 3HE7D 3OR6A 3H3KA 5GRJL 1HINL 2DTML 3IFNL 2PXYC 1RVFL 1SYSA 3Q1SL 4LEXH 5T5FH 1T3FA 4FQXB 3F5WB 1FLRH 2AV1B 3EUUA 3HUJE 3T3PF 5DHYA 1X5XA 4MS8D 1U36A 3S5LA 5CKAA 1QSEB 2FO4B 2YSSA 3PQYE 4Q9QH 2X4QA 4LGSB 1EEYA 2Q6WA 5D71H 3UBXA 3MJGX 2XA8L 4HIJB 3L3JA 3HN3A 1NCDH 1F3JB 4TUJA 8FABA 1B9ZA 2F19L 1T7WA 1CIUA 1OAQL 2ZPKH 5E6IB 3MJ7B 3HUJA 4NCC1 2ZJSH 1FE8L 3INUH 4P0DA 2APFA 2E8YA 3PQYA 5FO8B 3MUZ1 2NXZB 3HG1E 4IOFD 3FQRB 1OSPH 2IAND 4Q58C 1MRFL 3C6SB 2DN7A 4X5WA 4Z7QF 5H2BB 3QBTB 5F8QC 3CCHA 1QBLH 4J3SA 3SGJC 4NN5C 4JKWA 1IGFL 2IAMA 5T1LA 3FZUC 4U1HB 1FZKB 2FEDD 3O2WH 3W11D 4AIZA 1RIUH 4QY8A 3IJSB 3OKOA 4BK4A 5BS0D 3P9WB 5HHOA 3QYCA 1FNGB 2HKHH 4XRCB 2FATH 4RMWA 1AFVH 3T2NL 5JHDD 3HG1A 4XMLH 4KTEL 5CKGA 5I8KL 3LKSA 4RMUA 1L0YA 5IBTL 2XTJD 5ITBL 4R7NB 1EA9C 4HMDA 2IPKB 5F6HJ 4OTXH 3ARZA 4KFZC 2H2PD 2HT2D 4X5XA 4NC1E 3HRZB 1NCBL 3F58H 1G9MC 5GRYA 3FB6A 1A14H 1J1XL 4KHXH 4F9LC 1YNKH 4U1SA 3CXHK 3IS1X 3MACH 3ZDYF 2VZTA 4XCYB 2P8MA 1FNAA 2V5YA 3LD8B 4Z76A 3DVNB 5DJCA 1C16A 4DVBB 3AREC 3QUZB 3KJ6L 4JQVC 4UQ3B 1J12A 4RAUB 3GSUA 4WHDA 3QG7L 4RQQA 5C0RL 1VFMA 2BNQE 5D5MF 3GDBA 1S78D 2MKWA 4HULB 4ODSL 5J6GA 4WCYH 3D5OF 3F12A 1X4XA 1IQDA 2F5AH 2V2WA 4JVPA 1TJGH 4C4KO 1CR9L 4TTGA 3TA3B 1RZKC 3TZVA 4U1NA 5H8DA 1TNNA 3FMGL 2H8PA 4XX1E 1UKTA 3B5TA 4HMCA 1XF5A 3SGKC 3NFPA 2WUBH 2DLHA 3PDDA 1RSFA 1L6ZA 5DS8A 1B6UA 2BNQA 1CXHA 3DUSB 4G8EA 4IHOB 4OLWL 4MA7H 4NQXA 1BGXH 2NW2B 3SDAD 1BBDH 3IFLL 5DVLA 4K3DL 3TYGH 5FYJE 1K5NA 2P7TB 3I02A 1CICC 2VDRL 4Z8FH 4WU7A 5J1AB 3ZYZA 4YDKL 1DUYA 4FNLH 1L4IA 4GO6B 5HY9A 4TSCL 5DD3H 1S3KL 3V0VA 3UTSD 2XPGB 1YEKH 3HE6C 5F7HA 1KXTB 3WNLA 5T1KB 4K7FA 3FFCD 2F8XC 4DZBA 1XR8A 4U1MB 5DA4A 5IJVB 5JW4N 2BSTB 4LSRH 1FCCA 3P0YL 2DQDH 4KRPB 1QFWI 5DEZA 3GGWA 5D1XB 4CN1A 1YECH 3QAZC 1G0YR 4ZUSA 2HRPL 4HC1A 4KDTC 4KRMB 4OJFH 1QP1A 3V8OA 4G43B 3QXVA 2NY4B 2J4WH 3LN5A 3O45A 1JPTL 2FLRT 4P4KB 3C5SA 4K71C 1DTUA 2E7LC 2WWMC 1S9KC 5ACMA 4Z78B 1F8TH 4UNTA 1ODAA 3IKCB 1BVLA 1B6DA 4FMFA 5MI0B 4NKIL 4TVPH 1KIQA 3FOLA 3QFJB 4KKAC 4IDLA 1FYTD 5ELIA 4FQQA 4NZUH 3CFCL 2GT9B 4LVOB 3M1BA 3OAUL 2AI0L 1UJ3A 3RIAF 4PY7B 2A6IA 3MLSL 4HS8L 4NZTL 1P84J 4Q6IC 3MLXL 2Y6SC 5D1QC 1BEYH 5GZND 2D03H 4CDGC 1KB9J 4BH7A 4OD3L 3TBWB 3TCXA 4G3YL 4FZEH 4NRYB 3QHFL 4JG1L 3S37L 4OZ4B 1ZLWK 4CJ1A 5MERB 3AS0A 5JTWA 2HT4D 3N9GH 5F7KC 2DKSA 5MP6L 2XQBH 4RA0C 3MX0A 4NIKB 1T89A 5D7SH 5FDYA 3BPLC 3LOWA 3OKLB 3AU1A 1KTDA 4S1RH 3HAEH 2IFFL 3LDBB 3FOMA 2A9NL 3BZDA 1OAZH 1SVZA 3VGFA 2WIIA 2PW2B 4OZFG 1RUMH 1QR1A 2HTLD 5JORB 1E4WH 1QLEH 3BEVA 1XZ0A 3CH1B 4LCWD 4P48A 2R2CA 4X9FA 1R3HA 4XWGH 3DNKA 3MJ9H 5ERWA 4AEIH 1UH4A 2G75B 1FIGL 2R8SH 3LCYA 3WFZA 1QQDA 4POUB 1VENA 2ZUTA 1MHPL 4Z77A 4EDWH 3MUGB 4ONGL 1W0YT 1TPXC 5IM7B 4M48L 2AJYL 3D25B 1ZHLB 4OZHE 4EIZC 4J3TA 4WTZG 1GC1C 2XWBB 3DXAD 3MOAH 1Q1JH 4WHCA 5DUPH 5JDJA 4WY7L 5FHAH 1GIGL 1ADQH 5GHWH 2BVYA 4JDTH 5F3HA 3TGXA 3U7YH 2Q87A 4ZYKA 2OYPA 4FQHA 3MRGB 2R23B 4KK5C 2R9HD 4NWUH 3HNTH 1A02N 3VFVB 1DBMH 4F57L 4DEPC 1AD9B 3RU8H 3X14B 3VD3A 3EOTL 4YXHH 5CJXA 2XZQL 4HK3J 2Q3AA 1WWBX 5DJAB 1GAFL 5TF0A 5F1IB 4YK4C 4X6CA 3IDYC 5FV2A 5IIEB 1W0VB 2F74A 4CN4A 5F72S 2J3SA 1CFBA 5C7XH 3HR5A 3PUCA 1E4XL 3IDMB 4AIXA 1NGYA 2ZSVB 5IFJA 1NMCC 3BFOA 1LGVA 4OI7A 1JYVA 3BSZH 4GKZB 5EC1B 4GG8A 4HUWB 1L7IL 3KAAA 4NCC2 4XCEA 1H3PH 1F5WA 4NUGH 1CFNA 4P23A 5CEYB 2PO6C 1NUDA 4IMKA 2F53E 1LO4H 4APQA 4OD2A 4YDIL 1U3HB 2VLLA 5F9DC 2JJUA 2EO1A 3D6GA 4FQCL 2DMCA 3SKJL 3STLA 4OI9A 1NFDE 3HMWL 2Z93B 1S7WB 2V17L 3K7UA 2QHRL 3PWPA 4EUPA 1DBKL 3X11A 4MQSB 3EKCA 5I66A 5I6XB 4I18A 4AMKL 5MENB 4JO4H 1FGNH 1P84K 4MNGB 1TJHL 2UZIH 4H26B 3LPGA 3OKNA 1KTRL 1FZJA 2VR9A 4QO1A 1KB9K 3VWKA 2XZCL 3CU7A 1ROWA 4G8GD 4KK9C 3QEQE 5HYSG 3EYOB 2R1WA 3QUYD 4Y4KB 1F3DJ 4MNHB 1FL5B 1NFDA 3FQTA 1A2YA 2IGFH 4EI5B 4HAGA 1ZHKB 5GRXG 4LDLB 2QKIB 4XBGA 5HJ3A 3EYVB 3DV6B 2C1OA 3CC5B 2DQFA 1UCBH 3LIZH 4ISVA 4UILL 4TUOB 2ORBH 2I9LB 4KHTL 2EC9T 2W9EH 3HC4H 2FRGP 3WNPA 4CMMB 3VRJA 3QEQA 4RBPK 3LEYH 5JOEA 3UZEA 4E5XA 3FQXA 4JJHA 4YHIA 2YRPA 4JM4H 2A73B 4WO4A 4BQ6A 1PQZA 1F11B 4GSDL 2NTFA 4FQJH 4N9OB 4AH2B 1FFQA 12E8L 3DV4A 4HKZA 3BGAA 4B7IA 2BSSB 2XY2A 4U1LA 4PRIB 4U3CA 1R3JB 1WF5A 2UWEE 2EXWD 4XP9L 4MNQE 4LLMB 4PJAF 1BAFL 5GGRY 3J8F7 3GI9H 5T3ZD 4UT7H 3BQUA 3DI2B 1M7DA 4PJ5E 5KVFL 1WSST 1Z3GL 43CAB 4YHNB 1HH9A 5C0EA 1OCWL 2BVTA 5JHDB 2HFTA 3IXTA 4OCXL 3ZSSA 1BECA 2B0SL 5HGHB 3MRPB 2NNAB 4PGDB 3N85L 1JN6B 5J11B 1TVHB 4POYA 5JA9A 3O3UN 4D9QE 4L8SB 2NY5L 5E8EB 1K4DA 4LARL 3C60D 3L1OH 4PJ5A 4HPOL 2EE6A 4PJ7F 1FV1B 2NY7H 5ALCH 1XGPB 3MRKB 4UDUB 1IGJB 3W0WD 2ZUQC 4G6KH 4N8VG 4LSVL 2EDJA 1MFDL 5HVGB 5FO8A 4JZJC 4U6HA 4JRWA 3FQRA 4FFYH 5LGJB 5K9KA 2R2BB 3O3EA 2ESVD 5BXFB 1TLKA 2EZ0D 1UVQA 3GSNA 3T77B 1NDGA 4YEFA 3UYPA 4E41E 1FZKA 1BZ7B 4JB9L 1MRDH 5HHMD 1FNGA 1F4XH 5JUEH 2R1YB 5EDXA 2J8UF 3UJIL 1KG0B 2Y07H 1SYVB 4WEBH 1HYRC 1KYOJ 3VGEA 3GSWA 2E7HA 1AQKH 4Y5XC 5KSBE 1D7FA 1JF5A 1SM3H 2X10A 2D7NA 4PJFB 1T03L 3FO0H 5LCVH 2VAAA 1CLCA 5D7JB 1D5ZB 4NNXB 3TVMD 4E41A 1QKZL 3HRZA 5DFVC 4EZMA 2YWYA 2IEPA 3GMRB 3LH2L 2B1AL 4OCNC 4D0DA 3FAWA 5C09D 3PWVA 4PGCA 4FQIH 3CSBA 4JO1L 3SE8H 5HGAB 1A7PL 3UYOD 1CXEA 1MCPL 2OK0L 2ZZUT 3CXDL 3V0AC 5F9OL 4IJ3C 4LLAA 4PGBB 3U30B 5IKCB 3DVNA 5IFAH 1IC7L 2VABB 3GO1H 3QUZA 3WXWL 4UQ3A 3O3DA 1BBJB 3T8XA 4YDVB 3RTQB 1I3GH 3FRPG 1MRCH 4XXDB 3D39D 4JM2C 5CZXC 1ZHNA 4CADA 2Z91B 1DANT 2VQUA 3CLFH 1P69B 1MAML 5J3HC 1AXTL 5IROC 1ZGLP 1A5FH 5FK9B 1CE6A 1T0MA 4LPTA 4YPJA 5IQ7L 3TT3L 3TYFA 2KQNA 3WS6C 1YJDC 3GMLB 4AENB 5FECA 5FGCE 2NW2A 3C8KB 3TNNA 3SCMD 2P7TA 1LP9E 2EKSA 3QHZL 1BFVL 4EJ1C 4LLUB 5KSVB 5CMAA 2ICEB 3BOVA 4QCIB 5DF0A 2B1HL 3ZDXF 2OZ4H 3ZKND 1PLGL 3BEWA 3GSVA 5C07D 5EOCH 2BNRE 2IH1B 1ZXQA 4HKJB 4U1JA 1PG7W 3QDMD 4M43H 4BZ1H 1DSFH 5IJVA 5T3XE 1RUAH 4HWUA 2BSTA 4U0QB 3DUUA 4KV5E 1CD1B 5D1XA 1MIEH 1LP9A 4QRRB 2FL5B 3CJJA 3S7GA 1NBZB 5FB8B 3VFOA 1Z5LB 4IRJC 4XAKE 4B41A 3KPSB 1RZGA 2ZUXA 2AXGB 4PV9B 2P43B 4ZAKD 4E9LA 4H8WH 1DP0A 2DBLH 2IBZX 3ARDD 1AY1L 3C5JB 3DGGA 3IAGC 3EO9L 4J3OC 1FAIH 1KNOA 5FCUH 3SDCA 2C3GA 3EAKA 3IKCA 3QDJB 5TF1H 4KY1H 2YD6A 3FKUS 4EBQH 4Z0BL 4PLKD 4WNQA 3VFMB 4QTIH 2EEBA 1SJHB 4QXTA 1G7LB 4JANB 2X4PB 2BRQA 1GJIA 1XMWA 4JRXE 2J6EH 1PYWB 5MEPA 5ESAB 5IOPB 2ADGA 5E0QA 3OR7B 4HLZG 5IBUG 1E28B 4YFLI 3NCMA 4HV8B 1BM3L 1U8HA 3MLTB 2A9ML 4OZ4A 1KYOK 4LNVA 5LJYH 2E9JA 2CRIA 1H15B 4Y1AB 1JF1A 1C1EH 1F4YH 4M03A 1OY3B 1RY7B 4RISL 1BD2B 4ELME 1RFDH 1U8KA 3DBXB 2EE9A 5IMLB 4P9HL 5FYKL 5BVPL 2A83B 4OLYH 3SEPA 3G6JE 4ZSOE 3IFPB 3TC9A 4M5YH 5MEOB 2V6HA 1OTSC 2PW2A 3EFDL 2DM2A 5KVEH 3ABZA 1OAYL 4KJPC 3P9MB 3CMOL 1FBIL 4FFZL 3S5LG 5GS0D 4M61B 3OAYK 3CH1A 4H88L 2FGWH 3BE1H 3QJFA 1HHHB 1CDJA 2G75A 5JIHA 3G6JA 1VFUA 1JWUA 4MA8H 4PV8B 4TNVF 4ZSOA 3ZE2E 2IJ0C 5IM7A 4A6YH 5EFIA 3LN9A 1TMCB 3KWWB 3CZFB 4ETYA 1ZHLA 4XCCL 2W0LA 1U41A 4XNMA 3VMNA 1JNNL 3UTTD 1M4KA 5D70H 2YXMA 4ZFZA 3BP6A 2C1PA 2E6QA 1UXSB 4LLWB 4PGEA 3V5HA 4XPGH 1WWWX 2X4NB 3ZT5A 2PXYA 5TQ0H 3BZEA 2X2YA 4FRWA 5CINL 5BZWB 4CBPA 5A2FA 1AD9A 5FIEA 3O6ML 3NIGE 2MKLC 2ZKHL 5DJAA 4QWWC 4WUKH 5T33H 3PP4L 2AJVL 2NY2B 2XG4A 2AKRA 1JVKA 3ALXA 1KLUB 2ZSVA 4GAYB 4D8PB 1B0GB 2EO9A 4KI5F 1T0PB 4R0LB 3TIDB 5DQ9A 4HUMB 4HUWA 4KDVA 3C5ZC 4HJ0C 5E6IC 2E7MA 2NY1D 3D3VE 2VAJA 3NVQA 4TSBL 1SVCP 1PKQB 5KBNC 1QBML 1NDMA 2CUIA 1FO0H 3IU3B 1RI8A 1N0XH 4XVJL 5EOTB 5GS3A 1G7MA 1QR4A 3MRRB 4OLZL 1ORQB 4MD5A 4L8BA 3D3VA 1OGAB 1ND0B 1X44A 3FQNB 4MDJB 3TIEB 5DUBB 5IVNA 1IT9L 5ILTL 5AZ2L 3HNVH 4H26A 2X1WL 1HYSD 4P2RA 3VXNA 3JWOH 1ULVA 4OCYH 5D2LE 2AJ3B 5IG7A 5D1ZD 3LQZB 4Y4KA 4PJXE 4Z7VB 4UDTA 3FT4A 1IKFL 3CDCA 3QXAA 4DKAA 1MFEH 5HI4D 2HFGH 1QSFD 2F15A 2DL2A 3MGTB 3DV6A 1OM3L 3D0VB 4Z9KB 1EERB 2R0KH 4NFBA 5SWQA 3RGVA 2DJ4A 4WRLA 2EDQA 3L7FA 2I9LA 2CJUL 2DBJA 4NO2A 1J1OH 1YUHB 2WQ8A 5D2LA 1UQSA 3NCYS 5IB3A 1BREA 5ADOL 1T0NB 2XRAL 3RKDC 5HGGS 1MOEA 3BKCH 1A6VL 4O51A 4XX1G 4PRNB 3QIBB 3NZ8B 1OWRM 5IF0A 1PEWA 3REWB 3ZKMD 4PJCE 4U6VH 4XVTL 3LD8C 1M6OB 3GBMH 3JWDC 1A9EB 2MNUA 3KYKH 3TJEL 4FOMA 5CD3B 3NN8A 1R0AH 3AREA 1U6AL 3KS0H 4K7PL 1IZKA 1ZEAL 1PZ5B 1RD6A 2XQYK 1GHFL 1R24B 2WUCL 5FYKE 3ULSB 25C8L 4Y19D 4HXAH 5EZLB 1OP5K 3KLHC 2ESVB 1A6WL 4I77L 5I75C 3TA3C 3G5ZB 1I7ZB 4U1KB 5JPNA 4PJCA 3TBTB 2CKBB 3L5XH 3QIUB 2WLZA 1MWAB 3P9LA 4QTHA 1HNFA 3O6FC 2GSIA 2RFXA 1MFBL 4YHYC 1YEJL 3AUVA 3PL6D 4NKDA 1TCRB 3MRPA 3PXJA 2B7DT 5GGSB 1TVHA 5HHXL 2DLTA 1MI5B 1XF1A 4KI5D 4YXLL 1MCHA 3P77A 4BELD 3HE6A 2BHYA 1MCBA 3O11B 4GBXD 5GJTL 1TETH 1B4RA 1I1FB 3ARVA 4GUPA 1BQHB 2G60H 1XGPA 2EDDA 1Y0LA 4KRPC 1DQDH 1IGJA 5HHVL 5A3ID 1NAKL 1S7XA 2OTPA 3O2VH 4QOKE 4GRLA 2BVOA 2BNUB 5SWZE 3DRTA 3QUXD 3SKMA 5BQ7A 1HSAB 5LGJA 2R4SH 3MOBH 3LKOB 3VXRE 4Y2DB 3TWCL 3ZYJA 3KG5A 2E7LA 1F6FB 4K2UH 2NY6C 2AP2A 3F7VB 3T2PA 3VXOB 4BFGA 2HWZH 5MI0C 4DGYH 1QSVA 1VFBA 4OCWH 4O9HL 3W2DH 1BZ7A 4WW2F 2LV4A 5SWZA 4KVCH 3N0PB 1IGCL 1GGCH 3NACL 1XGTB 1X5JA 5KS9E 3UYRH 4MAUL 5TPWL 1SYVA 5DFTA 3VXRA 4YZFF 4WV1B 1U8LB 3FN0H 1NAMA 1J88A 2FX7L 4V1DD 5DMYA 4XCFL 5L9DL 3P0VH 4GAFB 4LVEA 3D0LB 4WUUD 2D4FA 3GIZH 1P7KA 3EDJA 1BWWA 1JFQH 3GKZA 3OHXB 4PJDF 4RX4A 5LWYL 1B88A 1X4ZA 1EPFA 2GJ6E 5E08H 1PX4A 5JO5B 3I3EA 3MV9B 5KS9A 1I1YB 4KKCC 3H9SE 4GRWH 4HPYH 4JZOA 5HGAA 3RZCC 1IL1A 1H3UA 2EDXA 3WFCH 3P73B 4KZEL 1KLGB 1EMTL 5DZLA 5C07B 5EUOF 3LDBC 4XTRC 1WFNA 4GMSH 2QSCL 4PGBA 5C2BH 5IKCA 3P11L 4JFFE 3RUGB 5I1GL 3S36X 4GXUN 2BC4B 4G7VH 2XWJB 3BN9C 1MEXH 5EH1A 5EA0H 3WFBH 3VG0H 2F58H 5BRZE 1WZKA 2GJ6A 3VI3F 4YJZL 5J9PA 1NANH 3RTQA 4LEXL 2ZOKA 5T5FL 1IC4H 5DJ6B 3CFJB 2Z91A 4HUKB 1FLRL 3FONA 2Q86A 4RGND 1ONQA 4ZS6D 4NNYB 3OJMB 4O4YL 5FK9A 4ODXA 4D3CH 1UEYA 3KYOB 2HMID 4C56E 3CSGA 3HAEB 2LU3A 4Q9QL 3K2MC 5D71L 4PYGA 3WO4C 35C8H 2ITCA 4AJ0A 1CLYL 1UYWH 3C8KA 2ZPKL 3CU1A 2J8UB 1CF8H 4LAJH 3U36A 2YK1H 5CEZH 1AR2A 1I75A 4RZCA 3UJTH 4LLDA 1FDLL 3I9GH 6FABH 1VERA 5MHSE 2ZJSL 1WFOA 3INUL 4GW4B 4C56A 5GSVB 5DLMH 1WICA 4YBQC 3ZE0E 3P4OB 4HKJA 4WI6A 1S9WB 3GSOA 1JGEA 3O4LE 4IRZH 2BSRB 1FLTX 4OFVA 4YBLC 4WI9A 3NA9H 1ZE3C 4I1NB 3C6LD 1RUPH 3MBXH 1OWWA 4XB8A 3C8DA 1KCVH 3O2WL 1RIUL 3OV6A 4J6RH 2P4AB 1UKSA 2HKHL 3QWRD 2FATL 3TFKD 1AFVL 4EN3C 3C5JA 1I7UA 4XMLL 3ARFC 3CUPB 5I71B 3VGGA 3O4LA 3NPZB 7FABH 2OLDA 3QDJA 4IRSC 3SGDI 1K6QH 4MA1B 5HGBB 3WFHB 1G7IA 1JPST 4F7EB 1FG2A 2VE6A 4X7TA 2Y7QB 3RX7A 1SEBB 2GITA 3T0WA 1XIWC 4LSTH 1G7LA 4JANA 1S7VB 5L2KE 2X4PA 3VWJD 4BJLA 3F58L 4G8FA 3MROB 5LKNA 4RFOL 1A14L 4KHXL 1HEZA 1YNKL 5IOPA 3HB3C 2JK5B 3OXSA 1EAPA 3OR7A 3VRIA 1ZT7B 4J23A 1NGQH 1CG9B 3MACL 5ALBH 1P4LB 1KJ2H 1JGVH 4H20H 1H15A 4Y1AA 4XNZC 4DKDC 2VLKB 5KOVC 1K8IB 4GMTH 3PV6A 3DBXA 4WGWB 4FXGB 2X41A 3GK8H 5KVMC 2DIJA 3EO1B 3FL7A 5B8CC 2VQ1B 5FA3B 5D9SB 4WCYL 4D0CB 2HVJB 2IH3B 2F5AL 3QZWB 1TJGL 3CSYB 4FQ2H 2FWOB 4MS8C 3T08A 2D7PA 2P5ED 3P9MA 3GMOA 1KUMA 3GSXB 4WJ5B 4L3ED 4R2GB 4YBHA 4N5ED 2X4UB 2E9BA 2WUBL 4I2XB 5DYOB 3G9AB 1T5XB 1Q8MA 4U7KA 2BX5A 4KAQH 5F71A 2HJKA 1MNUH 5T1MA 5E2TH 4MA7L 3BIKB 4PTTB 5B4MD 4PV8A 5BMFL 1BBDL 1FZMA 3TYGL 2FB4H 3OZ9H 4Z8FL 4OIAA 2V7HA 2VLRE 1MCIA 4FNLL 4LFHD 4LASH 3P4NA 5DD3L 2Q7YB 3MFFB 2X4OB 1CDUA 4R97C 4IOFC 5K9JL 1U8OA 5FYKU 1OGTB 5A16A 4NUJB 4ZTOH 1UXSA 3ME0A 3GSQB 4GW1B 4JFXB 2DQDL 1MVFA 3IS0X 1NC2D 5BZWA 4MLSA 2FEDC 2VLRA 1ZLUK 3W11C 4OJFL 1U8JA 3SE3A 1V8HA 2P8PA 2BSED 2J4WL 4PJIB 5C2UB 5B39A 4FG6D 4OF8A 1RUQL 5TFSL 2FD6H 2WQRA 2A77H 4HIIB 2VISB 2LABA 5DEFB 3NCEB 5J11C 1F8TL 3KXFD 3TT1H 1FVDB 1KLUA 2XTJC 2XN9B 4GAYA 1B0GA 5D96C 1P6AB 5DRZA 5TQ2H 2Q76B 3TIDA 1FSKC 2W60B 2H2PC 2ZCKH 2HT2C 3FQUA 4NZUL 5IEHA 2FDBP 4PRBA 1I9JL 1UJTA 5HVFB 5D7KE 1IC5L 2JLLA 2NX5B 1IE5A 2GTWB 4YHKH 1YEFH 4R8WL 4W6WB 3V4UH 1PKQA 1BEYL 5J56B 4HJJH 2D03L 2CMRH 1EGJH 3LKPB 4M7ZC 4GG6B 2OR8A 4LU5H 1U92A 4FZEL 1F6AB 1NCCH 4MGXA 3TN0D 4BQBA 2DQCH 1XGYL 1WIUA 4JFDE 3U6RA 5IEKA 4M93C 4XI5D 3Q6GH 1XFPA 3N9GL 2XQBL 3MLZL 1ORQA 5E00B 1CWVA 1JGDA 3D2UB 1LWRA 4IMLB 3UC0H 3MJ8A 3K4ZA 1OGAA 4XZUB 5D7SL 1ND0A 3FQNA 1S78C 4LKXB 4C4KT 3PXHA 1LE5A 4S1RL 3DROA 4NSKB 4CVWA 1KLFA 1U91A 1OAZL 4F9PC 1BVZA 5AUMB 1RUML 5JLZB 2AABH 2AJ3A 1CL7H 2ENSA 1U95A 1E4WL 1QLEL 4Z7VA 4XWGL 3T1FB 3UPRB 1WFUA 4LHQB 3KR3H 2I5YH 2X89A 3MJ9L 4AEIL 1CDGA 3MGTA 2R8SL 5D7JC 4ZDHB 4O2FB 3SDAC 4S0SD 2YC1B 4EDWL 3ARGD 3OF6D 1MHCB 2DOCA 5BV7H 4Z6AT 1AIFA 3MLYL 4KMQA 1YUHA 5LXGH 3RVTC 1VGKB 3THMH 1YEHH 1UM6H 1RULH 4JCLA 5CP3H 3MOAL 5T1DL 5SWSD 1A7RL 5DUPL 3REWA 3LRSA 1M6OA 3BX7C 1N6VA 5FHAL 3WS3B 4OZGE 1ADQL 5GHWL 4JDTL 3ZDZF 3U7YL 4ERSH 4I0CC 2H41A 2JELH 1KIRB 5I73B 4NWUL 1PZ5A 4Q2ZA 5C3TA 3HNTL 1R5VA 3S6CA 1DBML 3WFDH 5KSUA 3RU8L 3K1KC 3ULSA 4YXHL 3Q48A 5EZLA 4PB0H 5GGQH 1G1CA 1INQB 4LOUD 1IVLA 5HVHB 2VZVA 5C7XL 2DQGH 1T2JA 4BA8A 1KPUA 4OZGA 4ZUWB 5EU3A 1NGXA 1XAUA 3BSZL 4M4RA 3KJ4B 2HH0H 1H3PL 2ATKB 1TCRA 2H3NB 3VGHA 2UY6A 3BP4A 4NUGL 3V8CA 4OFDA 5GZNC 5GGSA 1YPZB 4C57C 1LO4L 3O6LH 4P59H 3WIFB 5BZDB 4JFZH 3A6BH 4Q0XL 4KXZI 3EW3B 1ITCA 3O11A 1J8KA 4WTWA 3ROLB 1V3KA 1Q9WB 3S3JA 2HT4C 4K8RD 4S10A 3VH8A 1YMHB 4Q74A 1Q9LB 4RDQF 5I1JH 3I3BA 4C55A 4RGMC 2YEZA 2BNUA 3N50A 2FJGB 4AL8L 2OJZH 3OKDB 3ARTA 1HSAA 4CKVX 3WIHH 4WI3A 2UZIL 4HW6A 2XXCB 5DR5H 1CXIA 1TZIA 3VXME 2HTLC 3EJZC 4HFWA 3RA7H 3QIWA 1U93A 2IGFL 3B6SB 5DDHB 4D9LH 1JPSH 1A1OB 2C4FU 3HI5H 5I16A 1JE6A 3K8MA 3PIQB 4MJID 5DD1H 1P5UA 4PJEB 4YHMH 3G5YB 3STBA 2L0DA 2ORBL 3RIFF 3PHQB 3VXUE 3IGAB 2XQYG 3HC4L 1HE7A 1U8LA 1PSKH 2WV3A 4OV6F 2O61A 2DJSA 3HRPA 4LIQE 3E6HB 3L5HA 5C0CD 1GSMA 3NCCB 1T5WB 5C0AD 3LEYL 3NH7L 2HFEA 4EDXA 1REIA 3MMEA 4KPHH 4YGVA 3JSSA 4HLZH 4FQJL 5GRWA 1W8OA 4ZPTA 5D7IB 3LMJH 1I1YA 1NBVH 1NJ9B 2EDFA 3VXUA 3DMMA 3G5XA 3P73A 4L3CA 4AZ8A 4P5TD 4OB5H 2VDNH 2YKLH 3RUGA 2VDML 3QPXH 3GI9L 4XNXL 4UT7L 2C4XA 2XWJA 2GJZB 1I4FB 3UBXI 4M62H 2OTUB 1ZTXL 4DOHE 1AO7D 4UU9B 3ULVF 2MCPH 4NYLB 4JFHE 2X70A 4ZOEA 1ZS8A 4Q97A 2VLME 5JHLH 4XCNB 5H35B 4X7SL 2FR4B 1I7RB 4OGYL 5C9JB 3E1F1 3QCTH 4LHUA 4P2QE 3U2SB 1W0WA 4X7FC 3FTGA 3BGMA 2GSGA 2V5MA 2LE9A 5E94B 4XH2B 3L1OL 3MGOA 4MD4A 1JPGB 1X5HA 4UV7L 4WGVB 1A64A 2AERT 1P6FA 2YD2A 3IDIA 2NY7L 3MJ9A 4JY4A 5ALCL 4LNRB 5DJ2B 4G6KL 2EE2A 3HI1B 2EYRB 1EJOH 1NCAH 2NZ9D 3BWAB 4A6YB 2JIXB 4FFYL 3T3MF 4E42B 5TE4H 4PRPB 2C3VA 4XAWH 4KZDL 3QUYC 4L4TD 3DYPA 1S7SB 4YLQT 1FFOB 4MAYD 4R0LC 1LEIB 1IKNC 3SDDA 1ADQA 1MRDL 4XP5H 4F8QA 1WAAF 2KUTA 5JUEL 3NPSB 4KROD 3C5ZA 1T1WB 1IGMH 4LF3B 4L3EB 4WEBL 3TBSA 3MNZA 4JO2H 2QJDA 5HYQA 1AQKL 4KQ4H 3VRLE 4OIBA 2P44B 1KEMH 5JXED 3DJ9A 1SM3L 5HGBA 1NQBA 4F7EA 2UVFA 2HG5A 3FO0L 4K3JH 5LCVL 1MJUL 3GKWH 2GHWB 1J0ZA 1J8HD 4QT5B 3MROA 1S7RB 2C3HA 4WW1A 32C2A 4BFIB 4FTVB 1FORH 1BVKA 1QBAA 4ZXBB 2D7QA 4O58H 3K74B 4DZ8B 4GW5B 4FQIL 3FB8B 1GCFA 3OJDB 1CXKA 3RL1B 4YDJB 3SE8L 3LQAC 3DPBA 4N5UA 2EXWC 4NGHH 4NBYB 4ZPVA 4LPXA 5IB4A 1T20B 5FYLD 2WBJA 4E0RB 1JNJA 2WP3T 4JREC 3GO1L 1FO0B 3ILPB 1CLOL 4PFEA 2A6JB 4G6JH 4WI8A 2XFXB 1YMME 1I3GL 1MRCL 3QG6A 2W65B 4JGUA 1CFSB 5D9SA 1DQLH 4HX1B 3CLFL 1DQJB 2X09A 3PWJB 2A74A 4WFED 5DO2D 4U1GC 3GSXA 4HF5H 4WJ5A 4RIRB 1QA9A 3IDNA 4MD0B 5IMOB 4YPGB 3BH9A 1T5XA 1D5MB 2GJJA 4MQ7A 1AE6H 2OJEA 3QIBC 3C60C 3MNWA 3BIKA 4ODUB 5IK3A 2MPAH 2H6PA 2IPTH 4K3EH 2DF3A 2DD8H 4CUCA 4UTAL 2NLJB 3MFFA 4PJBE 3UDWA 1J05A 2DI7A 2YHGA 4R90L 2OZ4L 3N1MC 4M5ZH 3G6DH 4OCRL 4EOWH 5I1IH 1AGDB 3O9WD 5EOCL 1KGCE 3I50L 3VE0B 4BZ1L 3X3GL 1DSFL 4ORGB 1RUAL 4PJHE 3GSQA 3T0EB 3ULUF 2CQVA 2VZ3A 2Z9TA 5DZNA 5FYJH 2BJMH 3UTOA 4HC1H 1MIEL 3BHBA 1II4E 3FO1B 3MRQB 1I7TB 2R0WH 2FZ3B 3ARBD 3F6LA 4PJIA 1EVUA 4H8WL 2Z31B 3TO4D 1MCQA 3I6LD 1HKLH 2VISA 5DEFA 1IM3B 1FAIL 3MO1B 4XPTH 4YC2C 5FCUL 5EPMA 5TF1L 1QFUH 4KY1L 4EBQL 2LQRA 1GGYA 1YQVL 1FL6A 5JMOC 4QTIL 2OQJA 1F2QA 4I0PD 1YEIH 4JQXC 1RVFH 2IBGA 2EEDA 1HOCA 3HI6L 1WZ1H 5TE6L 3V6OE 4QNPE 3ARGB 3PWUA 3O4OB 4LK4A 4H25B 2NZIA 2J6EL 3AM8A 4XC3H 5CGTA 1DDHB 5ISZD 2ED7A 1JTTA 1U3JA 3MCKB 5I1CH 1G7JA 2F54D 4X99B 4ODVH 5K59F 3I75A 4U31A 1QO3A 4R26H 1ES0B 1MCOH 5TDNB 3REVA 2MHAA 4P46B 1EEQA 1J11A 3TH2T 3CDFA 2ED9A 3GJEB 5I8EA 5I9QB 3WLBA 4AK1A 5IHZB 2XA8H 5E2JA 1F4YL 4QRSA 3D2UA 4IMLA 3V6OA 3KDMA 5DMKB 5DC4B 4HHAA 1QNZL 1MCCA 2JJWA 1QD0A 3KPLB 3U0TA 4OLYL 1KB5L 2UYLA 5JOPE 3HCVB 4NSKA 4M5YL 3ZE1E 1FNEB 4GQ9H 5KZCB 5JLZA 5B38A 2VDKL 2X6MA 5C92A 3QT2A 1SJVA 3MRDB 4NQDE 4WV1C 3AGVA 5D4QA 4TUKH 2FGWL 1AGEB 3T1FA 4F15C 1D3CA 4NQEE 5D93C 4FXKB 4XMKH 5EG6C 4JPVH 4F7MB 4L4VE 2YC1A 3SCMC 1EEUA 2DB8A 1KIUA 3MYJB 3QFDB 2Z4QB 3EGSB 3RY6A 4A6YL 3S3PA 5DUMH 2JB6A 1VGKA 1LK2B 5EBLB 5F21B 5DVNA 1IZJA 1IILE 3AY4C 2WWMD 1Q9OB 4NQDA 3ZKNC 2FYYB 3L3HA 3DIFB 4KGLA 3VGAB 2JCCF 4MB5A 4NQEA 1QUNA 5D70L 3B2UD 4K94C 1FAKT 1V3JA 1Y6NR 4PRHD 5FF6A 5I1AB 5ITBH 4KKAD 5E8PB 4L4VA 4XPGL 4YHPB 5IFHL 3HZKA 4QRPB 1FFNB 1YYMH 3ARWA 4WHYG 4XPFH 5TQ0L 3VFRB 2HJFB 1DLFH 3WKML 1N26A 1X6NA 4BSVB 2H9GB 3MBEB 2EDRA 4QYOB 5D1QD 4ZAKC 3MV8D 4R6UA 5C6WH 1KTLA 2XWTB 2PF6A 1ZA3A 4GRWB 5T33L 5ID1A 3RFZC 5EB9A 5D7IE 3ULUD 4K3GA 3WDIA 1HWHB 1GPOH 1OF2A 5FGBA 4ZUWA 3CFDA 2YZ8A 3KPOB 3KJ6H 1FYHB 4OLVL 4NQCD 4HS6B 2J5LC 4EXKA 1H3WM 1T7XA 1S9XA 1U3YA 3GB7B 3QG7H 5C0RH 3A0OA 3R0MA 2OTWA 3CDGA 3FT3B 3FHQA 4OZFB 2FLBT 5C08D 2FJFA 1H5BB 1I8LC 3MLWL 1FO0L 3DHJA 2CIIB 3FMGH 3DX6A 1HILB 2DDQH 5K9QI 5IVXE 2LTQB 5TE7H 1CZ8H 3DSNA 1LDPH 1KPRB 4Z7OF 5SV4A 3DLQR 1NGWB 5E1HB 3VFNA 4KMTL 3OB0H 1M1SA 3MREB 4YDKH 1N3NB 4TSCH 3HNVL 5EBMA 1S3KH 4P5TB 5E99H 1EK3A 3GIVB 3JWOL 5E7BA 4OCYL 1K3IA 4IIQB 4YUEH 5ICZA 3VG9B 4G6FB 1QRND 2BZDA 5GS0C 4EN3A 2OZ4A 5J6HA 5L2JB 2ARJB 2VL5B 2P5WE 4IRSA 5DDHA 1AO7B 1G0DA 1S9VB 3CVIH 1MFEL 2G5RA 2YD3A 1X3DA 3P0YH 1VKXA 1RJYB 2VXQL 3ROOA 3RVUD 2HRPH 1XIWA 2Z8RA 3KLDA 1N4XH 1EO8H 3IGAA 4OT1H 1BJ1J 2AQ3A 5GS2H 1J1OL 3MZTA 2F8VA 4PBVC 1A7BA 5JW5A 3WCYA 2JKXA 3E6HA 3RQ3A 2H26B 5E9DD 5D6CB 1H8NA 2P5WA 3H9HB 4CMHB 1A3LH 3FAXA 4U6VL 4LLQA 4CAGA 5JXAH 3BPOC 1LO3H 3HE7A 3L9RA 1PG7H 1R0AL 3CFCH 3EDEA 3ARQA 4QXWA 3OXRA 4JO3L 2M1KA 2AI0H 1NJ9A 1BOGB 1M7XA 1PVHA 4HS8H 5E8OA 4PJGE 3MLXH 1AGBB 1D6EB 1IARB 4BFEA 1RURH 2L7JA 2PO6D 4HXAL 1F2XK 4X6DB 5I1HH 3B43A 5F9JA 5B39G 4M6NH 1IC1A 4U6YA 5A1AA 4HIXH 1I4FA 2CGRH 3HC0B 1TFHA 4JG1H 4JRYA 3L5XL 1KJ2B 4PJ8B 5DI8A 5TDPB 2IANE 1VA9A 4UU9A 4PG2C 5GRZA 4NYLA 4PJGA 3MLVH 4KROB 2IAMD 2NY1C 5CZVH 4OV5B 5H35A 1CD8A 1KB5A 1FNSH 5TJWK 5C9JA 3RDTB 1Z9SA 2A9NH 5HHOD 2OI9C 3OG6B 2ADFL 1RPQA 2FO1A 5AZEH 5BS0E 3RX8A 5HYSB 3HG1D 4ZD3H 3EZJB 1YDPA 1XF3B 5ACLA 4JFOA 5IQ9A 2IANA 1TETL 1TCMA 2G60L 5T5NG 2XTJE 1DQDL 1SEQL 3FRUB 5DHVH 2XKSA 3MA7A 5HYJB 4ONGH 4KU1A 1NC4D 3HI1A 1U8PA 2B20A 3BWAA 4LRIC 2AJYH 4XP1H 4A6YA 3QEGH 4CU6A 1HYSC 1E27A 2R4SL 2PYED 4E42A 1AC6A 4RFNB 4K9EH 1D9KD 1KC5L 1R3KB 1RHHB 5D1ZC 4JFQB 2V2XB 4Z7WE 3GSNH 1LHZA 4DFIA 1CFVL 2HWZL 1OQXA 1FFOA 2KPNA 4DGYL 2GFBB 5GGVY 3W2DL 2B5IB 3AS1A 1AJ7H 3BAEH 1E4XI 4KVCL 1P7QB 3I6GA 4AT6B 5HI3D 2XYCA 4CNIB 1U8MB 3UYRL 4LF3A 5FDWA 2XKNB 1JI2A 3RX5A 3BRDA 4X0KB 3U9PL 5TH2B 4N8PA 1IM9A 3TZVD 3GIZL 1J86A 3PGDB 5F7EL 3WDHA 2W38A 3KHOA 3KNBB 4M1CD 4NJAH 1S7RA 4HKXA 2FHBA 1QYGH 2CIKB 4BFIA 1O7SA 4DGVH 2Q3ZA 1KIPB 1L7IH 2BNQD 4DZ8A 1NUGA 4KJYB 3FB8A 4HPYL 5GS1B 3OJDA 1QVOA 3WFCL 3ZMRA 4LVNB 1SJEA 1YN7B 3EYFA 2IQAA 5EORH 1G7HB 2XT1B 4E0RA 3C8HA 1FO0A 3UTSE 3BUYB 4G7VL 4FQCH 1MEXL 5EA0L 5E2UH 3VG0L 2F58L 3SKJH 5E6ZA 1BFOB 1UACH 1CDYA 3WUWA 3HMWH 4X6CF 3JV5A 4OFYD 5F70A 3FFCE 2V17H 4POZD 1P1ZB 3T09A 2QHRH 4N8VB 5L88L 3PL6C 4PS4H 4D3CL 3SDAA 2FGZA 4ZNEE 1VGEH 1WFTA 1IAIH 2IPUG 4AMKH 4RIRA 1I9EA 1X5IA 2YD7A 1FH5L 5JDSB 5IMOA 3FT2B 3GFUA 3EYSH 4KI5C 4KUZL 4H1LG 2VL4A 2XZCH 3EYUL 2DQJH 3QUKB 4LCCB 1NGZB 4Z7QE 1G6RH 4JKPH 3LKNB 4GBXC 1GGBL 3VXSE 4RAVB 1WIPA 3FFCA 1F42A 1J18A 1CF8L 3ZTJG 4XPHH 1ORSB 2VLJB 1R6VA 3WYRA 2YK1L 5KSAB 3VH8G 4YR6A 8CGTA 2IBZY 2ERJB 3I9GL 4N8CH 4ZNEA 1FYTE 4EVNB 1JJUA 4CW1A 3TCLB 3QUXC 4KHTH 3DYMA 5DLML 4YDLB 5BV7B 5GPRA 1JZ2A 1AGDA 5HHQB 2Z8VC 1C12B 4IRZL 4ORGA 3NA9L 5ACZB 3T0EA 3VXSA 3PNWB 1NLBH 1HK6A 1JGLH 4MQXD 5ITFB 4I13B 1PZUB 4NC0B 1DBJH 1RUPL 3MBXL 1Q0XL 2BOCB 2J7LA 2JJSC 1KCVL 3HPJA 1I7TA 5D7LD 3KS0J 1K4CB 4J8RA 2EYTB 1MCSA 4OZIB 4PUBL 3GMMB 2IG2H 3VXTB 2ZSWB 3G6AB 3UTQB 4MMZC 1IM3A 5I76B 3MO1A 3PGCA 3AMKA 5T3XH 5KANG 7FABL 2CLVA 1K6QL 3C08H 1TQBB 3VI4F 3ARXA 4GAJH 3S35L 3QULB 1NEUA 5ESVB 2X5PA 4LSTL 1LVEA 1WQVT 3MV7B 1KXQE 1PD6A 4U3XA 3SN6N 1YEGH 1QFHA 2PTTB 4JM2D 5CZXD 5DEGB 4LCWE 4Y4HD 3BKMH 5D5ME 2WIMA 5ANMB 4QXGH 2LVEA 1NGQL 2B0SH 4WVRA 2APTA 3R8QA 1ZGLA 5ALBL 1RJZA 4J4PA 5D2NB 3QDGD 4I9WE 4LCUA 4PTUA 2BOBB 1KJ2L 1JGVL 1R5WB 3GJEA 5HPMB 4MCYA 1KSRA 2NY5H 5C0BB 4XP6H 1QLRB 4XVUD 4HZLB 3GK8L 1ZSDB 3KPPB 3MRFB 4Y4FB 5DURD 3KPLA 3DXAE 4G9DA 1EO5A 2ADJB 3H9YA 3QO1A 1YYLH 2O5XL 3B9KD 5CBEB 1MFCH 1ZANH 4P2CG 1FNEA 4ZS6C 4WFHD 3VDBA 4FQ2L 5I0ZA 1NFIA 2HMIC 3MRDA 2EH8H 5CHNA 4LHUG 1A21A 2P49B 1F90H 2BHUA 2VDPH 3KPRB 5FAAA 3SJVD 2WANA 3T04D 1A7QH 1N6QH 3IJHB 4KAQL 4NPYA 1MH5B 3K3QA 1MNUL 1QZ1A 3C09B 3DXAA 3WMSA 4BQ8A 3CVHL 3L5WA 2FB4L 3MYJA 4JB9H 3OZ9L 4IRJD 2H2SD 1AP2B 4HGKC 4NWTH 4Z7UB 4LASL 5C08B 2GTZB 3K81A 4Z0XA 5IGXL 1Q9OA 4P23D 2DM4A 2I26N 5E4EC 3RWHB 2X40A 4QRQB 1P7HL 4APQD 1N8ZA 2ATPB 4JVWA 5I1AA 2V5RA 3T65A 4ZTOL 3CSPA 5CSZB 1JWSB 4QRPA 3TBVB 1FFNA 4KH2A 2Q20A 5KOMC 4JY5H 1A7NH 1V7NH 2EC9U 1MLCA 3LVEA 1FL3B 5IBUB 3BMVA 3JV4B 1I3VA 3PWPD 3TFKC 3W9DA 5HHNB 2ITDB 3DX8A 1S7QB 3Q3GB 2FD6L 2OK0H 2A77L 5CJ8A 1NMAH 3TT1L 4MJ2A 4WW2C 1DBAH 5TQ2L 2ZCKL 1A4KA 1Q0YH 2VXUL 3VWJC 4G8GE 1SYSB 2B8OT 4LQFL 1T3FB 3BW9B 3FT3A 3RVXD 1YEFL 1J1PH 3SDXE 1MAMH 2YUWA 4HJJL 3AAZA 4XXCC 2AQ1A 2CMRL 1EGJL 2D9QB 1OTSD 5DHYB 1DR9A 5TDOA 3SKNB 2ICWA 2FBOJ 3S5LB 2OSLB 5L0QB 1NCCL 2X4QB 1HILA 1EEYB 2DQCL 3DSFH 2Q6WB 3Q6GL 3HMXL 3L3JB 4G8GA 3EOBA 5HGDA 4TUJB 8FABB 1K85A 2YD9A 1UM4L 3UC0L 5KVGH 4WO4D 4XPAH 3MQIA 3SDXA 3MREA 2FEEL 5MEQA 3HUJB 2V9QA 2ZG2A 1IKNA 1H9VA 3ZL4H 3NPSC 4WTZA 1U8NB 3TLRA 3PQYB 1CL7L 2EECA 2E6JA 4LP5A 1DVFD 1NPUA 1PY4A 4N5EC 4GS7B 1VESA 2JJVA 4X5WB 3CNKA 1MUJA 3VCLB 3KR3L 4L9LC 3MXVH 1X5YA 3NZHH 5DWUH 5B4MC 5T1LB 5T3ZE 1C08A 4IBLT 1OW0A 4QKXB 4AIZB 4PBXA 4FQXD 3ES6A 3OKOB 5BV7L 2E3VA 5I1LB 5LXGL 5DRWB 2RQ8A 2WWKO 1EH9A 2OL3H 3THML 1YEHL 1BP3B 4CGTA 1UM6L 3HG1B 1RULL 2H26A 4N0UE 2D4DA 2H1PL 1QSED 4UI2A 1CGSH 1RUKL 3LKSB 4KRNA 2AAVA 4JPIA 4N0YH 1Z2KA 2EH7L 43C9A 1DQQB 4ERSL 2EKJA 1EHNA 4RRPA 5EBGA 4N1EA 5E6ID 1TZGL 3FB6B 4DUVA 3ARRA 4WTXA 3WFDL 4U1SB 1D6EA 3RWDA 3JV6A 1MHEB 4OQTA 1T6WA 4FG6C 4PB0L 2M2DA 4Z18A 4N0UA 3IDJB 5GGQL 4HS3A 4OUUA 1LP9F 4P5KB 4NO3A 5E8DL 3W0WE 5J1TC 5CIPH 1RZKH 3BESR 2NXZD 1KJ2A 4Z76B 5DJCB 1C16B 2QR0A 4W6XB 5J12B 2CDFA 5FYKH 1LQSR 3C60A 1V7MH 5F3BA 4OV5A 3VFUB 2G2RB 3M07A 1YNTA 1YNLH 3RDTA 4EEEA 3OGCB 1IQDB 4MJ4A 2V2WB 3W0WA 4P59L 3P30H 3BO8B 3CMGA 1OAYH 1LD9A 2J88H 4HWEH 4JFZL 5HHME 4U1NB 1F02I 1XF3A 3A6BL 4KRLB 2RCSH 5F6IC 2WM0A 3NFPB 3LSOA 4F8TA 4XI5C 2EDWA 4JPKH 4L3AA 1LO5A 4C83A 1U8IB 4ODWA 2BNQB 1DANU 4G8EB 5I1JL 3MODH 4UIMA 3VMPA 4E41D 3CVHA 4F7CB 1K5NB 2DYPA 1KT2B 3I02B 4WU7B 3WJJC 5IVZA 1DUYB 1R5IA 2OJZL 3WIHL 3V0VB 1ZT4B 1I3RB 5CJQH 2Z31C 5DR5L 5C09E 1R3KA 2EDYA 5B38G 1RHHA 5C1MB 2V2XA 3RA7L 3WN5B 4NT6A 4DZBB 1XR8B 3CZJA 5DFWH 4D9LL 1K2DB 1JPSL 4KJWD 3QUZD 4OGXH 5DD1L 2BVEA 1HH6B 3IFOA 3TVMA 4ZUSB 3ARGC 4YHML 5L6YH 5EU6A 5KW9H 4HBQA 2X9WA 2ZKHH 3LN5B 3O45B 5C09A 1PSKL 3D39E 1XF2A 1NAMH 3C5SB 5DVMA 1T2XA 3X3FH 1UZ6E 3GMQA 3RI5K 3TA3D 4PJAE 4UINH 3PGDA 1I85A 4J1UB 5E5UB 5I9QC 1ZT1A 1KIQB 1OSZB 3BT2H 1KIPA 1MFNA 3LMJL 3M1BB 5GS1A 1UJ3B 2A6IB 4WHTA 4NRZB 3RNKA 5FXCH 3D39A 4TSBH 1QFPA 4DVRH 4G80A 1EGJA 1QBMH 4OB5L 4BH7B 2YKLL 3WUZA 3QPXL 4LOUC 1X7QB 5T1KD 4NDMB 1CU4H 4P2OB 2DQEL 1GGUA 5C07E 4RMRA 3HMXA 1IAMA 2IADA 1MIMH 3QDME 4O2CB 4PJ7E 2MCPL 4GKSB 5D1XD 1GXEA 5JHLL 2CXKA 4L1HA 2FECL 3SCMA 4C59B 5AZ2H 2NY4D 3QCTL 1IQWH 2X9XA 1V3LA 3FOMB 5JDSA 2WIIB 4P4KD 4BH8A 5CSBA 2BHZA 4IDJH 1OTTD 1FZOA 1WV7T 2Y72A 2XXMB 5J89A 1GC1H 2VC2H 3BEVB 1XZ0B 5IW3A 1ZLUH 4PJ7A 3QFJD 5ERWB 1YEDA 5I2IA 5KSAA 1J0YA 4I3RH 1OM3H 3EZ8A 1QQDB 3GRWL 4EVNA 2K3TA 4OF0A 1X5AA 1NCAL 3VD4A 3GJFA 5INDB 3WKNA 4DK6A 5ADOH 5HHQA 5TE4L 4MDIA 5CP3A 1A6VH 4XAWL 3ARDA 3BD5A 4WHYH 4MB3A 4XVTH 3V95A 5LVEA 2VR4A 5F3HB 1FFPB 1DL7H 4XP5L 3SBWC 4ALAH 4FQHB 2EYTA 1ZEAH 1U58A 2DWEB 1G9NC 1PG7X 5I1KH 2AEWA 3VXTA 1GHFH 3G6AA 2WUCH 2FIKB 2SEBA 3UTQA 1EJ6A 3BJ91 5I76A 3OKEA 4JO2L 4OZHB 1MFAL 3IXAA 1EUTA 4KQ4L 4XTRD 1KEML 4P99A 2YWZA 3UTPD 4WIQA 3JWNC 4K3JL 2NXYB 3GKWL 3B3IB 4CN6A 1NGYB 4G42A 3S37X 4LCIH 2Y1VA 3IF1B 5DK0B 1J5OH 3CAFA 1BFTA 1FORL 4GG8B 4GLRH 2PYFA 5ANMA 2CK0H 4O58L 4AM0A 4XCEB 3LKQB 2W07A 3IDUA 1CFNB 4NGHL 3U4BH 2BOBA 1RJLA 4N0RA 4P5TC 3OL2A 5HHXH 1R5WA 4MJ6A 4IIQC 4GRMB 2HTKC 3VG9C 2VLLB 1GRWA 4HZLA 4HXBH 4QXUH 4G6JL 5GJTH 3KPPA 4Y4FA 3STLB 4HKBB 3CFEA 5FHBL 3UTTE 5IW6A 4LKCA 3SGEI 4BM7A 2XNAA 1DQLL 3O8XB 4Y89A 4NQSA 1NAKH 1N6UA 3UPAA 2NR6D 2F53B 1LEGA 4I18B 4UZGA 1CGWA 4YBQD 3TWCH 4M9OA 3WIHA 3ZDXE 3OKNB 1VADA 4U2YA 5EBWA 3KPRA 3VWKB 5BJTA 1WZLA 3O3BA 5EU5A 1AE6L 3B8SA 4DKEL 1MH5A 1OT2A 2R1WB 1ZV5A 3QA3B 3UTTA 1NFDB 4Y5VA 1WT5C 1A2YB 4O9HH 5F89A 3ZKXC 2MPAL 1QFWM 3CXHJ 4XBGB 2IPTL 4HK0B 1AP2A 4K3EL 4W70A 2DD8L 1P2CA 3PDGA 1IGCH 2C1OB 2P47B 3NACH 4ISVB 2GTZA 5IWLC 4I48A 1BQSA 4Q6YA 2NZ9C 5IMKB 4N68A 1T2QH 4CVZA 4OCSH 3RWHA 3SQBA 4EOWL 3F8UB 1BF2A 5I1IL 1J9CT 4AYFA 3MOQA 3QEQB 3QSKB 4XCFH 4YHZH 5C71A 5CSZA 1U3HD 1B90A 3FQXB 4YHIB 5FYJL 5DXWA 1F4HA 1XR9A 2BJML 4PJ8C 2H32A 4HC1L 4MAYC 2R0WL 3VA2C 1FL3A 2W0FA 3DV4B 3JV4A 4PG2A 4HKZB 3X12B 1AHWC 5HHNA 4KROC 4WI5A 4U1LB 4NO0B 2G5BA 1HKLL 5MEND 1YQ2A 1NCNA 5JXEC 2PR4H 4P2RD 1QFUL 5I74C 5KN5A 5I1GH 2MJWA 4LRNH 4NRXA 3BPNC 1NMBH 1YEIL 3BQUB 4Y4KD 1WZ1L 2C26A 5F93C 1M7DB 4V2BA 4EI5D 4P4RA 5J13C 3BW9A 4XC3L 1HH9B 2CLZA 4PJFF 5D8JH 4K55A 1KFAH 5HDLA 5C0EB 1XGRA 4O4YH 3IXTB 1QSFE 4P57B 3SKNA 5I1CL 2UWEB 4PG9A 4MNQB 4ODVL 2OSLA 4R26L 1MCOL 2XI9A 4JFPA 5DJDB 3CDYA 2X4RB 3DRQA 3F6IA 4RFNC 1RQ5A 1WBXB 1EHLH 5EIQA 1CLYH 1H0DA 2XZAH 1K4DB 1U2CA 5D1ZA 4PJ5B 1ZK9A 4H0IA 1T04B 3F7QA 4N90D 3WUWG 1PW3A 1NCTA 4NN6B 3C87A 1QSFA 3PABB 1FDLH 4GQ9L 3GRWA 5DO2C 4GOSA 2BY2A 1U8NA 4Z95H 4PB9L 2DIBA 4PRID 4U6HB 3BIAX 1RMFH 2FHFA 5K9KB 3O3EB 4TUKL 4Y19E 3VCLA 5JW4Q 4KK8D 3BXNA 4I4WB 4XMKL 3ULVC 1RJCA 4YH6A 4OLXL 4JPVL 5ID0A 1UVQB 3GSNB 3GM8A 1C5BH 1NDGB 3RL2A 2W9DH 5C0GB 2P46B 3MUY1 1MCFA 5EO0A 2R69H 5I1LA 5DRWA 5DUML 1AI1L 1CFTA 2PUQT 3U0WH 1ZA6A 2YMXH 5F7UA 1BZQK 4KMLB 4HH8A 2MOVA 3RBGA 3GSWB 3L7EA 3O9WC 4Y8AA 1DQQA 2VAAB 4NZRL 1HNGA 1GH7A 4KI5E 2GW5A 4E41B 1KEGH 1YYML 4OFIA 4XPFL 1DLFL 4PLOB 4JHWH 4RFOH 2VN4A 4QGYA 1O0VA 3H0TA 5FFLA 4D0DB 3ARBC 1MCLA 3PWVB 1DLHA 1MHEA 4PGCB 1N59A 1CLZL 3IDJA 3TO4C 2CUMA 4P5KA 1SBSH 5KSBB 3PP3H 4WWKB 1BFSA 4NM4L 2L4OA 2NY0B 4ONHA 1GPOL 3X17A 2CDGA 4I0PC 2Y36H 3AB0B 1YJDH 3O3DB 3T8XB 1BX2B 2D9CA 4OKVB 4M7LT 2C9AA 1J10A 2A6DB 3VFUA 1ZHNB 2G2RA 2R0ZH 4CADB 2A1WH 5FEBA 3OGCA 4H1LH 3PG2A 4QHMB 2YD1A 3BO8A 5DQJB 2JTDA 5BO1H 1D5BB 1DFBH 1CE6B 3L3IA 5F7NC 2HLFD 4JKKA 1T0MB 4U7MA 4YDLC 3VXRD 3IKKA 5JNYB 4KQ3H 2DDQL 3ZTJH 1XCQB 3TYFB 5TE7L 1CZ8L 1LDPL 1E4KA 2A38A 1U8IA 1A1MB 1G6RB 4U0RB 4V1DE 5FECB 5D7JD 2VKWA 3TNNB 4F7CA 5BMFH 4WUUE 2YPVH 4ZOAA 1KT2A 5IB5A 2EKSB 4H0HB 4L9DA 4GKOA 3RVTD 1ZT4A 1I3RA 5E99L 5CMAB 4YUEL 3QI9B 5FA4A 5K9JH 3BEWB 3GSVB 4FFWD 1FC1A 3WN5A 4FZ8H 1JCKA 4U1JB 4S1QH 1TQBC 2D3VA 1K2DA 3FFDA 4V1DA 3CVIL 3R0NA 4LPYA 5FGCB 3DUUB 3BKYH 1B2WH 4WUUA 3ZT7A 2R29H 1HH6A 4FMKA 1LP9B 3G9VA 3RTQD 2HN7B 3VFOB 1N4XL 1EO8L 3W5NA 4JY6A 4OT1L 4JLRA 1PX3A 1RZGB 4WU5B 4X9GA 4Y16B 1MJ8H 1RUQH 5TFSH 1AD0A 4D0BA 4IS6B 3DGGB 3OKYA 4X98B 4RGNE 3BGFB 2BNRB 1KNOB 3SDCB 3V5DA 4XNQA 3B2UC 1A3LL 4J1UA 1FGVH 5JXAL 4WNQB 1CGXA 1OSZA 4MWFA 5ESQA 1LO3L 3QXUA 4QXTB 1PG7L 1I9JH 4R4BA 1IC5H 4NRZA 4YX2H 1EZVX 1AC0A 1T83C 4LIQH 1P4BH 4R8WH 5MEPB 3RWCB 5I1HL 4JGJA 1RURL 2ADGB 4LEOB 3SKOA 1FP5A 5EU4A 1Z0MA 4M6NL 3BP7B 3ULUC 4C56D 4M7JH 1A47A 1X7QA 1U8HB 4HIXL 2CGRL 3MV01 4NDMA 1XGYH 4P2OA 3GMNB 1JF1B 4HEPG 4U4BA 5E5MA 4UAOB 3MLZH 1FN4A 4H0GA 4O2CA 4WFFE 1U8KB 3C09C 4YAQA 3NBNA 4GKSA 4JRXB 5HHPA 5I30H 3OX8B 1CCZA 4LSPH 4X80H 2KBGA 4QRRD 3MLVL 5CZVL 2CH8A 5DVOA 1FNSL 3KPSD 3DURB 1HHJA 1H3XA 5DJ0A 5FUCC 1MQ8A 5AZEL 4HUUA 4ZD3L 4X7CC 3ARYA 4PJ9A 3EJZD 3O4LD 4ZFFA 3QDJD 1LILA 2UY7A 4ELMB 3QJFB 4J12A 4WI4A 2E6PA 1JNHB 2M26A 3G6JB 3UAJD 1JWUB 4ZSOB 5I19H 3C6LA 5D6DA 2DI9A 1Z9MA 5EFIB 1KENH 3MLYH 4XP1L 5INDA 3QEGL 5I8CA 1CGUA 4K9EL 4YZFE 3QWRA 3QDHA 4XNMB 4LBEB 1IFHL 5T1DH 1JRHH 4LVHB 1A7RH 4P2YA 3GSNL 1X5KA 3ALWA 4ZFZB 1LO2H 3BP6B 4LSQH 4Y1AD 2VXVL 3NIDF 2C1PB 2CLRA 4PJDE 1IGIH 1FFPA 2XZZA 3GI8H 4PGEB 3V5HB 1AJ7L 1BD2D 3BAEL 5J57B 3RVUC 2DWEA 2PXYB 3BZEB 2VUOA 4Z7VF 2FIKA 2XICA 4XC1H 3FQWA 1BIHA 4OZHA 1CTOA 2BVUA 5EUOE 2HRLA 2VDOH 1IMHC 4G7YH 1PY9A 3QNYA 4OLEA 3STZA 3BVNA 2AKRB 3IRZA 3B3IA 2P5EE 2X4SA 4PJDA 5C0FA 5TGBA 4L3EE 1S9YA 1JUFA 3GEWB 4LQ1A 4NJAL 3EHBD 3VI3E 3A6CL 3IF1A 5DK0A 1FVCA 1QYGL 4DGVL 1MY7A 2IBBA 2BVQA 5DQ9B 1EFXB 4RRPG 3LKQA 2BDNH 1F58H 4XHQA 2AJSH 3UO1H 5DRNA 1WGOA 5EORL 3WHXA 3JTSA 4RFEA 1HHKA 4GRMA 1NDMB 2R2EA 4BSWA 2P5EA 4Q0XH 2CD0A 2ZOLA 5FM5O 4MXQD 5E2UL 3SKUD 1A9BB 1UACL 1T66D 4HKBA 1JZ4A 4L5FL 3FN9A 3SO3B 1G7MB 4K8RL 3PJSA 3O8XA 4MD5B 2B2XL 4S11A 4L8BB 3BMWA 4NN5B 2IAMC 3H6JA 4DTGH 3D3VB 4PS4L 4ZODA 4OZGF 3A6OA 2F53A 2VLRD 1VGEL 1OP3H 1IAIL 4AL8H 3HA0A 2J8HA 4MXWH 4P2RB 4W4NA 3EYSL 4MB4A 3VXNB 3NTCH 1TTUA 4ZFOA 1K8DA 2VO5A 2DQJL 2NY2D 5IG7B 1G6RL 4JKPL 3RKPA 1G7QA 1OB1B 3QA3A 4YE4H 2AK1H 1HCFX 3RRQA 1KCUH 4UDTB 3FT4B 3QXAB 3JWDH 3KXFE 3EOAA 4XPHL 4HK0A 3F7PC 4AQOA 2QL1A 4N8CL 5SWQB 3RGVB 1NC2A 2EDOA 3L7FB 4OKDA 5IMKA 3N1GC 2GUOA 4NO2B 1DQTA 4MA3B 5D2LB 1UQSB 1ZLSL 1QSZA 5IB3B 1D9KC 2OL3B 4PYHA 3WXVL 1HDMA 4R7DA 3W39B 4O51B 3NH7H 4L29B 5JA8B 3FO9A 4X4XA 1NLBL 5IF0B 1Q9KB 1JGLL 3KXFA 1DBJL 3DX9B 5LQBH 5J12C 3NN8B 3AREB 3O6KL 3U9UA 3S98A 3X12A 1FNHA 5HI3C 1OGAD 4M7LH 4NO0A 2IG2L 4F37K 5F9WB 5T3XL 2HLAA 3WNOA 2KQMA 3C08L 4GAJL 2VDMH 5AEAA 3JTTB 3TZVC 4XNXH 2YD8A 1EIBA 5JPNB 4PJCB 2R1XA 3CFBA 5CIPB 4LSUL 4TNWK 3TV3L 4CVUA 3LEXA 1F13A 3MRMB 1KPVB 4M1CC 3TN0A 1ZTXH 3P9LB 1YEGL 4QTHB 3BKML 2GSIB 2RFXB 4QXGL 4P57A 5FOBA 2UWEA 4NKDB 4X7SH 3V5KB 3B4NA 4MNQA 4OGYH 2EXYD 4RMQA 2IALA 2P8LA 5DJDA 1CICB 5FYJU 3NFNA 3S4SA 2X4RA 1WBXA 5FM5M 1P9MA 3P77B 3BWUC 1RZJC 3MUJA 4XP6L 3HE6B 3QIBD 5CZKA 4ODHH 1J7VR 1T04A 4UV7H 5JPMB 2AQ2A 4GUPB 3VGDA 5SWSE 3RUGF 4POZC 1YYLL 1Y0LB 2B4CC 3PABA 1MFCL 1W72H 1S7XB 1ZANL 3S97C 2APWA 4GRLB 5DHVA 2BVOB 3DRTB 1SMOA 3SKMB 5BQ7B 2DKUA 1EEZB 2EH8L 4J3WA 2P24A 3K4AA 1F90L 2VDPL 4NHUA 1A7QL 4I4WA 1N6QL 4KZDH 1JHLH 2I25N 1I1AA 1O5DT 3QIUD 5SWSA 5C0GA 1Q72H 1VFBB 1VSCA 4QOKB 2LU4A 5GGUB 4RNRB 2DM3A 5SWZB 4NWTL 1NEZG 1TQCB 4K7PX 2YR3A 2I9TA 3T0XA 2D7OA 3OB0K 3HC3L 4LP4A 3VXRB 5E24E 2OCFD 4Q6IB 1NAMB 4NBZB 2R4RL 1MI5D 1FJ1A 1UH3A 2YS4A 1MJUH 1P7KB 1UT9A 4RA3A 4MQXC 3U79A 5DQDH 3QPQD 5HD8D 3UROR 5F7DB 1VEOA 3ZHKA 4JY5L 1A7NL 1V7NL 5KS9B 4GXVL 1JZ3A 1T89C 4D2NA 2GKIA 4JZOB 1IL1B 2WBKA 3MNVA 3LQMA 5KSBA 4KTDL 3BPLB 5SV3A 1NMAL 4WWKA 4JHAH 4Y2DD 1C7TA 1ZWIA 1DBAL 2HP4A 1CLOH 4G8IA 4QRTB 1Q0YL 4NOBA 3RWGB 1BX2A 2GJ6B 4OKVA 5J9PB 5E1AA 2ZOKB 2A6DA 4WEMB 2NTSP 4Y4HC 4PY8I 4NFDA 3H9SB 1J1PL 5EC2A 1A0QH 3FONB 2Y5TB 2Q86B 1ONQB 4QHMA 1RHFA 1OOAA 3BDYH 5DQJA 4ODXB 1D5BA 1CDHA 3HS0A 4MJIE 4AEEA 4LLVA 2DLFL 3K80A 3JV0A 5JNYA 4MYWB 1TPXB 1F3RB 4UTBH 1XCQA 3DSFL 3QB7C 3V4VH 2ARWA 1L7TL 3E6FA 5BRZB 2ITCB 1A1MA 4XVUC 1G6RA 3WE6A 5C0CE 3OBAA 1NCWH 4KK6D 5C0AE 2DICA 5KVGL 4XPAL 1KBGH 2O93L 3NCJH 4UV4L 4TVPD 3U36B 3B9KC 4RZCB 4UTAH 3MV9D 4LLDB 4XNUH 3QXTA 2HJLB 3ZL4L 4PGJA 1HXMA 4C56B 3QI9A 4R90H 1HHGB 4OCRH 2DAVA 5CLWA 3I50H 3GSOB 1JGEB 1N0LA 3HZVA 4NBXB 3X3GH 2W0KA 3D85A 3D69A 5C0CA 3E2HC 3IDYB 2NXYC 1ZMYA 3MXVL 5C0AA 2BK8A 3ZHDA 3NZHL 5DWUL 1RZ7H 3ZDZE 1G6VK 3BYTA 2HN7A 2EDTA 1G9ML 2H2SC 1NMCB 5DRXA 5GGRA 1T21A 4JGMA 4Y5YA 4WU5A 3QQNA 3EOYG 4Y16A 1S8DA 2OL3L 4R96B 2W59A 3K46A 3RY5A 2Y5EA 1I7UB 4IS6A 4M6MH 4X98A 4P23C 2BNRA 3MLRL 3O4LB 1X5LA 4IMKC 4GAGH 1CGSL 4G6MH 4K23H 4APQC 1YQVH 4N0YL 1G7IB 3LN4B 4JFYA