1YMHA

Anti-hcv fab 19d9d6 complexed with protein l (ppl) mutant a66w
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
220
structure length
220
Chain Sequence
DIVMSQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLAWYQQKPGQSPKVLIYWASTRESGVPDRFTGRGSGTDFTLTISSVQAEDQAVYYCKQAYIPPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab 16D9D6, light chain
publication title Comparison of the crystallization and crystal packing of two Fab single-site mutant protein L complexes.
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Immune system
total genus 42
structure length 220
sequence length 220
chains with identical sequence C
ec nomenclature
pdb deposition date 2005-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ymhA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ymhA01
5IFAL 3LDBC 2A83B 3H3PH 3V7AE 5D9SA 3S88H 5I76B 2G9HA 3B5TA 2H9GB 3K1DA 4RNRB 4YBQC 1ZMYA 1W8OA 4K3EL 3L3JA 1X6NA 3OGCB 3GDBA 1WLHA 1L0XA 1N8ZB 1S9WA 1H5BC 4PJDF 3SJVE 1NUGA 3RZCD 2P1YA 3WN5A 4D3CL 1NANI 1GGBH 4NRXA 5DJYA 4FFZH 3SDAC 5D1XC 1FGVH 3BP6B 4RMTA 5DURB 4DGYL 1EDQA 5E00A 1HYSD 3ULSA 3WFEL 1KCRH 1LEKB 3S3SA 2HP4A 1G6VK 5EA0L 5DT1L 1GYAA 4PBXA 4KRNA 3GSNH 5EN2B 3IDMA 4P48A 5J7CC 4AEIL 4NOBA 5F1KC 4H8WC 5E2UL 5FFLA 4G8IB 1FFNB 1CDIA 3DYPA 4LVHC 3MOBH 5EOTB 2XTJE 3L9RA 1HIML 2ZSVA 4HSQA 1A6AB 2E9IA 1EV2E 5F71A 1AI1H 4NQSA 5CLTA 5EUOF 3UZQA 4K94L 4FTVB 4AZ8A 2RGSA 4YDKH 4O2CB 5F1NB 3BAEH 1CFBA 4UT6L 3TGXA 5FDWB 1AJ7H 3WIHA 3TCXA 3G5XA 2RCSH 2YA2A 4OIIL 4CL7A 3H3KA 2OR9H 4A6YL 5KSBF 5JR1H 2JJSA 2YWZA 5DK0A 3OR7A 1MJUL 1A47A 3KXFD 3VXME 3O3EB 3D39A 1B6DA 3RDTB 3KDMA 4ZFGL 3BGFC 3EFFB 4FXGA 4U1JA 4L4TB 2OP4L 1K8DA 3TT3H 3GSUA 4FHBD 4JCLA 4BSWB 4YDLC 5IB2B 1PYWB 1UH4A 2O5YL 2XQYK 5FUOH 2ATPA 3MJ6A 3FQUB 1NGYA 5JNYB 4Y1AB 3MBXH 3RVUC 4YWGH 1NCAL 5B39G 1I1AA 3AS0A 3U30C 4F58L 4Z8FH 1PEWA 5DURD 1JZ6A 4UQ3A 4BH8A 4HJJH 3QP3A 4H26A 4HKXB 2PTUA 2ZCLL 4TN9A 3REVA 4NBXB 2CJUH 4P23A 3QCTL 4PY8J 2BP3A 1L4IA 5D2LF 2R4SL 4XMLL 4YHIB 5DEFB 2QR0A 3DBXA 1BFOA 4BKLB 1MCOL 3DVIA 4J3WA 4M48H 2HFGL 4UIKH 2V7NB 4G43A 2E7BA 2QQLL 3NCMA 4N8CH 3GKZA 2B4CH 5DMIL 4JFYB 4FTVD 35C8L 1LO5B 2ENSA 1LO4L 3MBEA 4KUZH 4YGVB 3MPCA 4WFHD 1A3LL 2QQNH 5GS0L 3C5JB 2IBZY 1QSFA 3AS3A 3WUZA 3FFCE 1JV5A 5EU5B 3GMQB 3QUKB 2B1HH 5MI0C 2ZJSH 4OFVA 3C08H 1M7DA 4DEPB 1MFAL 1P2CA 2P46B 4S1DC 4IOFD 3RDTD 2Z8SA 3RA7L 1W0WA 2HLAB 4OFYA 3VH8B 1MELA 4L4TD 1CGWA 1MIMH 1CGTA 4HIXL 1UM5L 3LN9A 2V5MA 4NC0B 4IOIA 4PJFB 1YQVH 2VDQL 4H1LH 2CO7B 4PJEB 4Y1AD 3A6OA 5IEHB 3OKOA 4JN1L 2DQIH 3VGGA 3O2WH 5F9WC 5GRUH 1FIGH 4PJAA 4LAQH 4KH2A 1TJIH 3QQ3A 5FXCH 4RMVA 1SY6A 5DS8A 2BJML 3OAZK 2DJ4A 1HHJB 2PYEE 2IFFL 1G0DA 1XGUB 2ITDA 3AY4C 1P84J 1MLBB 4F7EB 5LGJB 1OPGL 4KUCF 1F4YL 3N1QC 1S7SB 1WBXA 5EDXA 4NT6B 1FV1A 2HVKA 5E0QA 1F4WH 3ILQC 3CC5B 4HEME 3V5DB 4XNUH 2XWJB 3LEXA 4LLQA 3CLFL 5IMLB 2R0ZL 4ZDHB 4Q9QH 2YUVA 4PYGA 1ZLWH 4RFOH 1CFTB 3HMWH 4DKDC 5GGSB 1DSFH 3G6JB 5KSAB 3FT3A 2BXYA 1EMTL 1IBGL 1N59A 3QDHA 4U0RC 2CDFA 2D7MA 1I3GL 1T5WA 4H1LG 1WJ3A 5DC9B 5BVPH 5I17A 4TVPD 5DLML 2XTLA 3BVNB 3EJZD 1MEXL 3FQWA 2EDFA 3QUYA 1OLZA 4XMKL 4FQXB 5IBTH 3CLEL 4GMSL 3MACH 4MJIA 5IUSA 1NC2A 5IMMA 3BQUB 5IFJA 2KKQA 2XKNA 4M9OA 5GGRB 5J89A 4LSQH 4PLKD 1OAXH 1A7NL 5H35A 4WY7H 4IMLB 2ZUWA 5D2NB 4HGKC 2BOCB 1CFNB 1CLYH 3MX0A 4KHTH 1Q0XL 4EDXA 4KMTL 1QRNA 5JA9A 1PX3A 4BFEA 1JHLH 4UT9L 3SBWC 5D5ME 1JMZA 2C3VA 3NCCB 2VXUL 3QHFL 4M03A 1KCVL 5JDSB 5KSBE 1DBML 4JM4H 4CKVX 2NX5A 1JK8A 4X6CB 3IDIB 3M17A 4APQC 2X89D 3WLWD 4JPVL 5B8CA 2DQDH 5EBWA 4LPVA 5KSAD 4PJCE 1T0NB 3VXTB 1LILA 5A2FA 5I2IA 3RWGA 4FQHA 5J13C 5DYOB 2DJUA 2VERN 5I1LB 3FO0L 2EIDA 2X9YA 3C60B 3FCTB 4XNQB 2HAZA 4U6XA 2VDRL 5IW1A 3MRRB 1OT1A 3SGDH 1BD2B 2BY1A 4F8QA 1A1MB 4HKJB 2XA3A 3Q3GA 3RWFB 4U6HB 4U1LB 5BQ7A 4J6RH 4FQXD 3FN9A 1MVFA 2NYYC 3QDME 1L7TL 4XAKE 3BQUD 5HGAB 1CBVH 3UYPA 5D2LE 3U7WH 2D3VA 2PO6C 3V5KA 1MLCB 2XNAA 1R24B 1LEGB 4WGWB 5F1IB 1MCCA 2VZ1A 5DRWB 5IOPA 2X4QA 4TTDC 4R0LB 2DI9A 3HE6C 4Y4FC 3K7UA 1OP5H 1UZ6F 1NGXA 1FDLH 1XIWB 3CDGB 4OGAD 2ADGA 4S10A 3E6FB 1NCTA 1R5VA 15C8H 3WFHB 1KEGL 3JUYA 2VITA 5DK3A 1LK3H 1J1PL 5FHAL 1DDHB 4X0KA 1RUML 3ARXA 5EO0A 1NFDB 4QYOB 1Q9OB 3C2SA 2EDKA 1U95A 2OJEB 1YPZF 3IKCB 1XR8A 2W9EH 5F9JB 5CEYB 3WL9A 1FFOA 2VZ3A 5HYSG 3U9PL 1VFUA 4F7PA 1P69B 4XP5H 3UC0H 4U1SB 2Y25A 4X4MA 3LAFA 5DD3H 3TT1H 3GHEH 2BSTB 2IGFL 2NW2B 2CUHA 1XF2B 3QEHB 1I8IB 3C60D 5L6YL 3LD8B 4GAGL 1KB5A 2C26A 5EIQA 3VRJB 2EYRA 5K9JH 1G7MA 1BD2D 5IM7B 3O2VL 5HI3D 3MLSL 1NUFA 4M5ZL 3QI9A 2LU7A 3WXWH 4JN2A 1U42A 5BW7A 3TNNB 3OL2A 4Z7WA 2OI9B 2BVPA 3ZTNH 5IV2A 5LWYL 4Z9KB 1RPQA 3SPVA 1K8IB 2X4PA 3B9AA 4JO2H 4NQEE 1CFVH 1BZ9A 4NZTL 3H9SB 4PTTA 5E99L 3V4UH 3BI9X 1MRCL 1HKLL 3PNWA 3LKSA 4V1DB 3DUSA 2F8VA 4UDTB 3B5HA 4XH2A 3P9LB 4NFCA 2DBLH 4O51B 2E7HA 5ICXB 1TZHB 2YXFA 1XIWD 4WUUE 3RPKA 4HFWA 1U41A 5J6GB 3HUJE 4YHYB 1DQQA 3BT2L 4JZJB 2VABA 4PV9A 3OJ2C 4D0CA 3UBXG 3U79A 1W0VB 4OCSH 1JN6A 5KSVB 3EDEA 2OX5A 5C0CA 3BUTA 1XCTA 4DTGH 1RIUL 1EJ6A 1I1YA 1CN4A 1HHGA 2Y1VA 1SM3H 1S9KC 1JRHI 1RD6A 3CXDL 1UXWA 5CBAA 3JTSA 4IRJB 1MWAA 2XWBB 4ODVL 2J2ZA 4F7TB 4Y7MA 2DQTL 1FZKB 3IDJA 1VEOA 1MCLA 1G6RB 3FQXA 4QF1B 5F7FA 2MKWA 5DGRA 4GRLA 4QRUB 1IGCH 4JDZB 4PRPB 3DO7B 3AVEA 3SJVA 3HLAA 4GOSA 5K33A 3WE6A 4PRAA 4KK6D 1EGJH 1P4LB 4BFBD 4L9DA 4GRWH 2LAAA 3B2VH 1C1EL 4XBGA 2V6HA 3QUXB 3GIVA 3MA9L 1U3HB 3GIZL 1NLBL 2O5ZL 2A2QT 2BNQB 2V9TA 2ERJB 3H9SD 1GC1C 3JUZA 3TWCL 5EWIL 2IAMA 4MA8H 5DHXB 4V1DD 2JIXB 1CICB 1PLGH 4ZPVA 4GQ9H 1HDMB 3ZE0F 2JELL 4CVUA 1KLGA 2Q86B 2HT4C 1OAZH 1CIDA 4M7JH 1JHTB 5I1DA 4NKDB 4CDGC 5JW5B 3BZFB 3W39A 2DM7A 1AIFB 4RDQG 3MREA 3GMNA 1IRAY 2B2XH 4ONHB 3GB7B 5CIPA 4DZBA 3NOIA 2R0LH 3EFDL 3VXMA 2LVCA 4M3JA 1YDPA 1UJTA 5GGVY 1UENA 2HJLB 2ENYA 4IRJD 4P4KD 3UTZA 3P73B 4YX2H 2HT3C 5HHVH 2GK0B 2Y07H 4JLRA 5DQDL 5ADPL 1EJOL 5C0EB 3QHZH 5DHYB 5HD8D 4RAHA 3FT4B 3FMGL 1AXSB 2DIBA 2F74A 2FEEI 4PRPD 4X98A 3N1PC 4U6TA 5CSZB 4Q9RH 1B0GA 1ZV5A 5E8OB 1T1ZA 4WFGD 5D7KD 1B3JA 1B4JH 2FIKB 4JVPA 1JWSB 1G7IA 1RUQL 4E0RB 4PGDB 1OAQH 3QUXD 4NQCA 3TO2B 1RZFH 4PBVC 1RUKL 5DSCA 1U3HD 1S9VB 4MS8C 4J4PD 3VFNB 2I5YL 2IALA 1T20B 4N5ED 2XKSA 4KV5E 2BNQD 4QHLB 4TSAH 5D6CB 4GAJH 2XIDA 2Z8WC 3V0WH 5DD0L 4TSBL 1BX2B 3AC0A 2FX9H 5I1IH 4HIEA 2FL5B 2JIXD 4LQFH 1CICD 1JNHA 3OKMA 4EUPA 3QULA 2GAZA 4OQ1A 1VACA 5MP6L 1A0QL 2NW3A 5CGYC 5DHVA 4M8QB 4YBHA 3U0PB 3NZ8B 3MO1B 4ONFL 4P0DA 1Z6JT 5CEXB 12E8H 2XXCB 3PWNB 1LDPL 5TQ0H 1VFAA 2N4IA 1BEYL 4LVEA 3MCLH 4H8WL 2Y7QA 2G5BB 5FUCC 1I8MB 2HVJA 2Y72A 3EYFB 4PP2A 1LO2L 3FKUS 1A7QH 3MLXH 3HI6H 3NCFB 4EI6B 4JREB 5DJAA 4JQVC 3D25A 3RX7A 2P48B 1EO8H 1V8HA 2OK0H 4RWYH 1FORH 4U1IA 2AQ1A 1BFVH 2LVEA 4XVTL 4S2SA 1IM9B 5C0GB 3MRBA 1XT5A 2V2TA 4KJWD 4ZNCD 4YC2C 1EXUB 3HZVB 3CPLB 1ZWIA 4PJHF 4PRHB 4NQVA 4N0UA 5HY9A 3WEXB 1CDCA 2OL3L 2JCCB 3NN8B 2X4UB 1RMFH 1SYSA 2PYEA 5KG9A 3OX8B 2H1PH 2WM0A 3GBNL 5BMFH 3W9EB 1U8OA 1TFHA 5HGBA 3RHWK 5L2KB 4YPGA 3GI8L 3NZHL 1G9NH 4OT1H 3GNMH 3OKNA 3BH8A 4NO5B 7FABL 1FRGL 2APWA 3BP4A 4IBLT 3ARBA 4N0FB 4ZO6A 5ICZB 4MA7H 2C4FT 3QDJA 5F96H 4KGJA 1ZKAA 3TVMB 4HIIA 5ACZB 5GSVA 1D6EB 3C6LA 2AV1B 4JQIH 3FRPA 3A6BL 5ITFA 4NUJB 4QTIL 4I5BB 2Z35A 3QFJA 1WBZA 5DO2D 2RAMA 2DMKA 1CLOH 1E6OL 1MCPH 3D2UA 2FRGP 2FCBA 3QWOA 2BNRB 3NA9L 3KJ4B 1FYTE 1R0AH 2J5LB 2CDGA 1J1XL 5DJYB 4ZTPH 1PQZB 4P5TC 3EYQC 4JM2F 4RFEA 1XZ0B 3P30H 4Z7OF 2DKSA 4YK4B 4ZUUB 2H6PA 2WBJA 3DOSA 3WN5C 5HVHC 3ZHKA 4L1HA 4JG1H 5BZWB 1IM9D 4JFPB 3ZDXF 1KELH 4XBEL 4RISH 3IDMB 4FOMA 1I9IH 4X99B 3FONB 4Z95L 5EUOA 3AXLA 4PRHD 1CCZA 5T3XL 1A6WL 4KKNA 3ZE0E 4OGXH 1JBJA 2A6IA 2E27H 3L9RB 2ZSVB 3O2DH 4OTXH 2IPTH 4IMKA 3MLUL 3FFDB 3HR5A 4X6EB 3MRQA 5KSBA 2NY1B 4YIQB 1BOGA 5JQ6H 5L2KD 3ILPA 4P5KB 3LZFH 5DUMH 4YDJB 3G5XB 1D5ZB 3L6FB 5H2BB 5CMAA 3VI4F 3MRDA 3MRJA 4JPWL 4YUEL 4M4RA 5DK0B 1FVDA 3BD4A 2ITCA 1RZ8B 4X9BA 2W59A 4AM0B 4MJ4A 5FYLD 5C6TL 1M05A 3TVMD 1KJ3H 3D39B 5DRNA 1C7SA 1CD0A 2EDQA 4WI4A 5IMOA 4U1JB 1PZ5A 4Q9CA 5ADOH 1TQBB 4TNVK 2JJSC 5DJZA 4HKBA 1MHPH 3MNVB 1QACA 3HNVH 3QISA 1MCKA 3IU3B 2X4NA 4WW2C 3T08A 3GSUB 2WUBH 2AXFB 4OLYL 1K9TA 1NKRA 5EPMA 1WAAE 5BO1L 2ORBL 2BNRD 4LLWB 5J11C 4TUJA 5KANG 5EOCH 4XP9L 2YS4A 5ICYB 1I1AB 3QDMA 3RY6A 3WFZA 1KT2B 4MB3A 1KTDA 3QCUH 4FA8A 2D03L 3ARZA 4XAWL 5D2LA 4BH8B 3F7PC 1GCFA 3REVB 2LTQB 5JPNA 4IJ3C 4UTBH 1AXIB 4LRNL 1DBBH 4KQ3H 3HZMB 4PJIE 4JFDE 2EKSA 2V2XA 2R15A 3MV9A 4AG4H 5HI5C 5AWNL 3RIAK 1BZ7B 1R5WA 5B4MD 1B4RA 2ZCHL 4PB9L 5GS3A 3P77A 4RRPA 1GGIH 1KYOK 4KKAC 2NY1D 2APFA 3EGSA 2FEDD 2P8PA 2VSCA 5DMJB 4Q9BA 1NFKA 4LPXA 3QJFA 1MFNA 2X4OB 3Q48A 3MBEC 1CL7L 1BREA 2HH0H 3MNZB 4G9DA 1DBKH 3D39D 4FQJL 3T0EE 3EO0B 3V4VL 3KLAB 5BS0B 1ZHLB 5JHLL 5EUKA 3QG6A 4QCIA 3CCHB 3QIUC 4YNYA 1JPFA 3GMPA 4PJ7B 4WDIB 1KSRA 2JLLA 4PRDA 5I6XC 5GGQL 3OKOB 3L3GA 1I1AD 4AEEA 2A6KA 2ZG3A 2Y5TA 2YPKB 2C5DC 4P2RE 3MLYL 3TH2T 2ZUYA 4X5XA 1P6AB 4DQOH 1JNJA 1WFOA 2M26A 2Q7NA 3L5WA 4Y16A 2QADC 1FJ1B 3MR9B 1HZHH 1K85A 1XR9A 3QQ4B 4KDWA 3OAYK 4D8PA 4I3RL 5FF6A 1MCNA 1WBXB 2YRLA 3KPNB 4M7ZC 2APVA 5JHDE 2DTML 2EC8A 3HE7B 2AKRA 2EDDA 4KJQD 4OZIF 5HI4D 4NZRL 4MNHA 2OQJA 4XPTH 1IQDB 2DMCA 1KEMH 2FIRT 4K3GA 3S36H 3CFBB 2VDLL 1M7IB 4YHML 2ARWA 5I1HL 3WS6A 2AJ3A 4QWWC 3PGDB 4KDTA 4ZFOA 3QWRA 1JNNL 3G5ZA 1N59B 3WDIA 4O58H 4XHJD 2CDFB 1Z5LA 1A9BA 4OD3H 5A43C 3TEUA 3T4YB 3IVKA 5I17B 1GXEA 4XPFH 1IM3B 1WFUA 3D9AH 2CLVA 4YDVA 1VGEL 3AREA 3QUZC 4DGVH 4Z7OE 2VZUA 3VXSB 1OP9A 3K74B 2JK5A 4IOSD 1JF1A 5BS0D 1FNLA 3JV4B 4OFYD 1P7QA 4LCYA 4NSKB 4MJIB 4H20H 4XVUC 3ZDXE 4XI5C 5GRYA 4Y2DC 2YPVL 3RWJB 3BSZL 1WBYB 3QIBC 3AAZA 3QUYC 2WWKO 3DTXB 1I7ZA 5GJTL 1JNLL 4GXUN 5F44A 3X13B 1IGTA 2C3WA 1FPTH 4JEGB 3IT8D 4X4XA 1F97A 4HBCL 5JW4Q 5D7LB 3SY0A 2D7QA 4QXTB 3T4AA 1ZGLA 4QOKB 2ZP0T 1A3RH 3BGMB 3EYVA 2H2PD 5KVDH 1U2HA 3ETBF 4NO3B 1CTOA 2X09A 3VI4E 4WFFE 2VZOA 3MUY1 5EZIL 3G9AB 4BZ2L 2HKHL 3H2WA 3HE7D 1HEZB 2NX5B 1CK0H 2FATL 1JK8B 4LLVB 1WV7T 3VXUE 1CDGA 5D72L 1A7PH 2R9HD 2N7AA 5CSGA 4CJ0A 3TO4A 1BJ1H 1Y18A 4D9QE 3GK8L 1ZA6A 4Y8DC 1G7QA 4OCYL 4HX1A 5BV7B 5GHWL 1H0DA 4FQHB 3LY6A 4WJ5A 4YE4H 1G9MH 2DQFA 5B8CC 3DUUB 4G6FB 2JB6A 1SEQL 4MAYC 4QY8B 1RIVH 3D69A 1F3JB 4OM0L 3WNNA 1Z9LA 4KI5F 1U8MA 5LCVL 2KQNA 3VXSD 1K5NA 2DDQH 1I9RL 2I9LA 2G5RA 4MA1C 3S4SG 4OZGF 3A6CL 1HHKB 4LNVA 4WW1B 5DRXA 2ZOKA 4MJID 1ZHNA 3BWAB 1WCBB 1Y0LB 5ALCL 2YD3A 1UVQB 5E1AB 5FAAA 1LK2B 5IB1A 1RHHB 5HDBF 2AK4B 3WDJA 3NGBC 3Q1SH 3RWIB 1XH3A 1ZVSB 4BZ1L 2X4QB 1RK1A 1JWUA 5C0ND 4LLYA 1KJ2B 3KPOA 4OZHF 4MB5A 4NIKB 4HDIA 4ONGH 5D7LD 1UM6L 4XZUA 3RZCC 3VFUB 2GITB 2R23B 3IGAA 4QOKD 1NGXB 1LP9B 4LMQI 3H3PL 3PHOB 2ADGB 5KSUA 3S88L 1BQLL 2EE2A 1YPZA 5A2JH 3L7FB 1R5VB 3E8UH 3T1WA 4YEFA 2C4XA 4X0KB 2BRQA 2DJSA 3FJTA 43CAA 3P4MA 1CXLA 1HH9B 2NX5D 1U36A 4NQTA 3RY5A 4LDOB 5KVGL 1GGBL 4PGJA 3WL9B 2PTTA 4FFZL 4HC1H 1FGVL 3O81A 3OKKA 2YD8A 5BZDA 1T6VN 3TV3H 5HHME 1EEYB 1ZLVK 1KCRL 1MCDA 4L3EB 4HF5H 1RK0A 4WU7B 4ZAKB 4I9WE 2X10A 3OF6D 3X14A 1X5FA 3GSNL 4NRZA 3TA3A 4OF8A 1S7WA 4G6FD 1YEKH 1JI1A 1C5DA 4ODSH 2BNUA 5IR1B 4GG6B 2ZPKH 1R3IH 3MOBL 4P2YA 1E0OB 1AI1L 5F89B 2FR4A 4MSWA 4R9HA 1CD1B 3ZDYE 1H8OA 4YDKL 3WJLC 4GJTB 1W72A 5E6IC 3RWCB 2AK4D 2BVPB 1Q72H 1G6RH 3BAEL 2V2WB 3ULVE 1AJ7L 1WEJH 3KPLB 2RCSL 3QI9C 1I1CA 3RVWD 4PTTB 3GZKA 2OR9L 3L7EA 5EOQH 3RZWA 4OZIE 4JO3H 5JR1L 1YEGH 3ZKSD 5M94B 5KTEH 3TCLB 5GZND 4JE4B 1NGWA 3UTPD 1DQJA 4K8RC 5DGQA 1UB5A 1B6UA 1PJ9A 3GSQA 5IT2H 5IWLA 1IQWH 5DMKA 4Z0BH 4HFWB 1A7OH 5C9JA 1MUJB 2L4OA 4HCRH 2VABB 4AT6A 4D0CB 5T3ZD 3MFFB 1H8NA 3TT3L 2R1WA 4U1NB 5C0CB 1G9NC 1XCTB 3MLZH 3VD5A 5FUOL 3BZ4A 1F45A 2YSSA 5E2WH 4O2FA 1JGUH 3MBXL 4NBZB 3PP3K 1U8IB 4YWGL 3JTSB 4Z8FL 3S35L 5FM8A 4BSVA 2QL1A 1YYLL 4Y5XA 1JPTH 2Q3AA 3FQXB 4HJJL 1S7QB 4L3ED 4UV7H 3SOBL 3KJ6H 3ZYOA 2GJ6E 4ZAKD 3LQAH 4ETYA 3QG7H 2CJUL 4PRNB 5A1AA 3SJVB 2P44B 1E6JH 3V95A 4DCQA 4AK1A 1HNFA 3S3PA 3QDGA 3BGAA 3ECBA 3MSPA 4GRLC 1H3WM 3OKYA 4BK5A 4MQ7B 5DI8A 3RQ3A 4XBGB 4N8CL 1FNGA 2B4CL 1FNFA 3L3DA 3RUGF 3GIVB 4HG4K 1AGDA 3RDTC 3U0WH 4KI1A 1WGOA 4KUZL 5E95B 3DGGA 1T6WA 3TBSA 4UBDD 3GUTA 2QQNL 5HGHA 5F72S 4MVBD 4KJPC 3WS3A 1OLLA 2AEWA 2XTJB 1XGPB 1HXMA 1YNLH 3C08L 2EDTA 1INDH 1BJMA 4EOWH 5J12C 3VFGH 4JDTH 5T1MA 4ZPVB 5CGMA 1J05A 5L8JB 1V7NH 5HPMA 1MIML 2YD6A 4JY6A 2NY3B 2EDOA 1BWMA 2IAMC 2F8XC 2P5EA 2Q6WA 5C0CD 3MREB 2UYLB 5B38A 2HA1A 1VPOH 1M71B 3LIZH 1FHGA 3MRFB 3UTZB 2YK1L 2DQIL 1Y6KR 1OGAA 3O2WL 5GRUL 4BQCA 1FIGL 1TJIL 4MX7A 3IFPB 1TTFA 4HMDA 1BGXH 3KPSE 2VDPH 4GLRH 4XCFH 2VL5A 4XC1H 3SJVD 2PW2A 4ZYKA 1Y6MR 5FYJD 1L9MA 4LVOB 3DVGA 4MJ6B 4IRSB 5C08A 1N5YH 4OZHE 3RHWF 1SJHA 2QHLA 1F4WL 4JO4H 4M1DH 3VRIA 3ARWA 1N7MH 4XNUL 5C6PB 2MKLC 2Q8AH 5C3TA 5FYKH 3WSQH 5C92A 4Q9QL 3BUYA 4DFIA 4RFOL 4GKOA 3HMWL 3FB8B 1DSFL 3FO1A 2R2BB 5TE7H 4OLZH 5FA4A 3VGDA 5CSBA 2XRAH 1RZGB 4XNYH 4ZS6D 2AJZA 4JFDA 1NGPH 4H5SB 2Q8BH 3G5YB 3ELAT 2DD8L 4J3SA 4PRIA 4P9MH 1MAKA 4C56E 2XTJD 5BVPL 5LAXA 3U0TB 1V7ML 1KTLA 3HZYA 1TCRA 1JNHB 3OKMB 3VXQB 3QULB 5CJXA 1CR9H 2R56H 5GSRB 1AQKH 3VMNA 2NY3D 1BOYA 5DVLA 3FFCB 3BZEB 2VLLB 1WWWX 3V2AR 5T33H 4N90D 2E7LA 3FOMB 3O4OB 2EZ0D 4ESKA 4LSQL 1YYMH 3VD3A 1OAXL 2NY7H 2VAJA 4QTHA 4WY7L 3WUWA 2IH3A 2Y7QB 1WC7B 1OARH 5CZVH 1CLYL 3T8XB 1JZ5A 4MQXD 2X1OA 2X4SB 5FYLH 5K9OB 1JHLL 4KKBD 5E8PB 4FRWA 4V2BA 4ZXBA 2R2HA 1A21A 4F2MB 2XQBH 4PJHA 3CX5J 2AGJH 1YY9C 1RZIB 3AM8C 5KSAC 3MRBB 2N56A 4IRSD 2V2TB 4JM4L 4HEPG 1ND0A 1NJ9B 5IBLC 3CNKA 4NQVB 4UUJB 4RBPH 2I24N 4P2RA 4Y5YC 5HY9B 1D5MA 4U1HB 3TNMB 4YFLI 3ZT6A 2AV7A 1NCCH 1I1FA 2DQDL 4G9FE 5I1GH 1LNUA 2W60B 5INDB 5FDYA 3NH7L 4ELKA 1OB1A 5I71C 2DRUA 4ODUB 4PRBB 3CDCA 4TNVF 2B5IB 5I1KH 4BSJA 1EA9C 3T0BA 3FQRA 3BP5A 3U36B 3ZT7A 3D3VE 4UINL 2QQKH 4Z7VE 1G7PA 4PJ8A 3EYOB 4HIIB 5GSVB 4J6RL 1UZ8A 5ILTH 1VEMA 3DI3B 2VZTA 4HW6A 5ITFB 2KUTA 1QQDA 5D1ZA 3FFCD 3ARBC 1CBVL 3AB0B 5FGSA 3U7WL 3C6LC 4JM2A 1MNUL 1AHWB 1VCAA 3HCVA 4P99A 3WIHH 1U6AH 3O6KH 4JKPH 2Z31C 4I0KA 4TUKH 2CDGB 1U93B 1PW3A 3RUGE 4ERSH 3LMJL 3OKLB 4KXZH 3RPIB 1FDLL 2H2SD 1QR1B 4NKQB 4HUXA 2XZCH 3RIAF 4P5MB 1MCIA 1QLEH 2PF6A 4UOJA 5E5MA 5HHOE 15C8L 5SX5K 2WIIA 1LK3L 5I9QC 2J7LA 3WIFB 3UJIH 4TQEH 1HILB 1IGJA 5EU6B 4EN3B 3D87B 5DQJA 2WBJC 3C60C 1WTGT 5J9PB 1QLFA 2W9EL 5D5MB 4GT7A 1IAOB 3HAEB 1MCFA 3CFDB 4Q58C 4XP5L 3UC0L 2IBBA 3I6LD 3BRGC 1OGTB 1MVUB 1QBMH 1QG3A 2XN9E 5DD3L 3WO3B 3TT1L 1BAFL 4OZFA 5CD5C 3ILPB 2QEJA 4WHTA 4NHCH 3IS1X 1EERB 4KZDH 1PY4A 1S7RB 4PJGF 4C4KO 1EBAA 4IMKC 5ALBH 3MRDB 2VIRA 3MRJB 3E3QE 5K9JL 4PGBA 2ITCB 5I1CH 4BA8A 4PJXF 1ACZA 3JWDH 2J8UF 3PJSA 4PJCB 5HYQA 3HNTH 3WXWL 2E9JA 1PZ5B 2GEEA 2FWOA 1SMAA 4HKBB 2GW5A 2P5WE 1EZVY 3E0GA 1TZIA 3ZTNL 1LO0H 1XIWC 5HGGS 2ADJA 4RMWA 4JO2L 1FZMB 1CDJA 5EPMB 5MEPA 1YQ2A 1QPXA 3V4UL 4K7FA 3INUH 4TUJB 1UEYA 2W0KA 2R4RH 5C09E 1KTDB 4M6MH 2VN7A 3SE4A 2DBLL 3W82A 3PGCA 4DN3H 1QO3B 5JPNB 3OG4B 2W65A 2J4WH 3QUML 2AXGB 2OMBA 3TJHD 1WZ1H 4X4YB 3RY6C 4AENB 3PHQA 1ITCA 1MHEA 4PB0H 3RVVD 2WLZA 4U1MA 1P9MA 4NQDB 5EU6D 4DTGL 1KGCE 2EKSB 1ZLWK 4EN3D 1FLTX 3UDWA 5ELIA 3QEUA 1SM3L 4ETQB 1HSBB 4KK6C 4NHUB 5C86A 5KVEH 2EDRA 4UU9B 2DB8A 3REWB 3P77B 3WHXB 4BM7A 1JHKH 4XCNB 1IGCL 3LSOA 2XG5A 3MNWB 2CKBL 1FFPB 2P8PB 1JFQH 2ESVE 1BLNA 1OTTD 4L3CA 4PYHA 1EGJL 1N6VA 2NNAB 2CIKA 5IVXE 4DK3A 3B2VL 3VCLA 2ZOLA 2D0GA 1U3JA 2Q3ZA 1A6VH 1XAUA 1H9VA 1IL1B 2GCYB 2UY6A 1M6OA 4JVUA 4QCIB 2D31A 2A74A 1J5OH 4JZJC 4NDMA 1LEIB 3DWTA 1NDGA 4B53A 4LCCC 5C07E 3N1GC 2C7UA 4NN7B 1C16A 2VLRB 2R8SH 3QRGH 4KK5D 4GS7B 3NFPA 4XAKD 1PLGL 2HT2C 4LLMB 3MV7E 1NEUA 4R97C 4Y4KB 4M3KB 4P4KC 3RTQC 4R8WH 3L5WB 4AIZA 5F88B 1OAZL 4JFOA 4NQEB 4M7JL 1CXFA 3I75B 4LPCA 5IEKA 3ARDA 3VWKA 4OB5H 4OZIA 4G3YH 5IHZB 3LPWA 4DKEH 3CVHA 2B2XL 4NQDD 3RGVC 2R0LL 4HZLB 4L8DA 3RRQA 4Y16C 5TGBB 2GHWB 4WWKB 2NY2B 4WUUB 3HUJB 3ARGA 1UCTA 3HPLA 4C83B 4NKOB 4OF7A 5HHVL 5BVJA 1E4JA 2Y07L 1II4E 1IARB 2VE6B 3QHZL 3UBXI 1YNKH 5F6HI 3T3PE 3WO4B 3G5ZB 4CN6A 2OLDA 4KKCC 4Q9RL 2IANA 2FJGA 4J4PC 4PD4K 4XVJH 5FA3A 1ORSB 2QSTA 2ERJC 2CLVB 1IT9H 3AREB 5FYKU 2IQAA 5FK9A 3STZA 4YR6B 1YEEH 3HNSH 2VWEC 3CFJA 1WK0A 4G42B 2XWTB 1OAQL 4KROB 1RZFL 4LCYB 1CICC 4YHPB 5ECJE 3WNPA 2R0KH 4XNZB 4E9LA 2PW1A 4TNWK 4E5XA 4TSAL 4GAJL 2HN7B 5BV7H 2KH2B 3AAZB 3V0WL 2VKXA 1PGRB 3LKRB 1OP5K 2VQ1B 3BKML 2H32B 2J8HA 5HVWA 2FX9L 5I1IL 4ORGA 4RGNC 2VLRD 4LSUH 5F1OB 5MENE 5AUMA 1OL0A 4ZUWA 4LQFL 2BCKA 4Y4KD 3PDOA 5IB5B 3Q5OA 5DUPH 4D9LH 1WT5A 4Z7QE 4NQED 5ANMA 2R1XB 4UIMA 12E8L 1EPFA 1OCWH 2DKMA 5EBLB 2DL9A 5D7JC 1ZT7A 5TQ0L 3BH9B 1B0RA 3F6IA 4OFPA 5JUEH 1IAIM 4WWKD 2AEIT 3MCLL 3AFLA 5SWSE 4WUUD 3GHBH 1N3NA 5DMGC 3WNLA 1KJ2H 3SDCB 2FZ3B 1A7QL 3MLXL 5KS9F 2CSPA 1T22B 4EIGB 3FRUA 4HX1B 4LASH 1CXIA 3X12A 1QPPA 4JR9H 1EO8L 2ZUQB 4MLIA 3QNYA 5KZCB 2OK0L 1H0DB 4RWYL 2ZUSA 5E8EB 1FORL 1SJXA 5DJ8B 4CVWA 2YN3A 1BFVL 1IZJA 2DQFB 3ARPA 4I18A 3TO4C 5FM5O 4P46A 5T3ZH 1Q9KA 4OZGA 2GT9B 2UWEE 3O45A 4KAQH 3DX8A 3ARED 1KG0B 1JTPA 4IHOA 3KPSA 2I9LB 4PGCA 4KROD 1RMFL 3SGJC 5C0JB 5C8JA 1DE4A 5BMFL 5TE6H 3VXOA 4P9HH 2P8MA 1SBSH 3B6SA 4UDUA 3IDGA 5ETUA 1AO7A 3NFNB 5J06A 4OZHA 3O4LA 3O3BA 1NBYA 3VGAC 3WJJA 1F4XL 1UT9A 3DLQR 4OT1L 3GNML 4URTB 4EQ3A 1FVEA 3MJ8A 5DJ6A 2ADFL 3KPOB 1R3KB 3HI1A 2ICEA 4MA7L 5F96L 1FZJA 3QWQB 3T09A 4AEHH 4OCMC 4HLZH 1I85A 4CRPA 4JQIL 4XGZB 3GSRA 3ESVF 2Q20A 5GRZA 1AFVH 5C0DA 2PXYA 4JREC 2QBWA 1CLOL 1KN4H 1MCPL 1O5DT 3KPMB 2ZZUT 4XXCA 1R0AL 3IU4H 3VFPA 2PTTB 5ESQA 4ZTPL 2E9BA 5FO7A 3SDCD 3OKKB 1T4KB 2P7TB 3P30L 2FNBA 4MD4A 1KNOB 3MROA 4NP4H 5KZCD 4CVZA 2F58H 1RK0B 3GMMA 3MRMB 3OXRB 4N9GA 5DT1H 5GGUB 3L3IA 1KPVA 4FXKA 4W6XB 4JG1L 3TA3B 1H3VA 1KELL 4RISL 3EDKA 1I9IL 2H8PA 1JP5A 1C5DB 4PLNC 1B90A 3N50A 3HI5H 5T1DH 1I7UA 2BVOA 4OGXL 4QRQA 2E27L 3B9KA 1Z9MA 3DHMA 4W6WB 3O2DL 4HLZG 3MGOA 4QT5A 1OVZA 4BZYA 2IPTL 2FR4B 1T3FA 4MSWB 4O2EB 5FKPA 3STLA 1OQXA 2XICA 5E70A 1MH5A 2YD9A 4Z18A 1T1WA 4ZSOA 1QSEA 1QTYT 5I74B 1I3RB 5JQ6L 1J0HA 1DANT 5TPWH 5AYUH 3LZFL 4MZ2A 3EOAA 5DUML 4W6YB 4XTRD 1P7KB 4A6YH 1DBAH 5F3HA 4UQ2A 2V5RA 4MXVF 5FYJH 3SDDB 4L8SA 1MY5A 3T3ME 3P9MA 5IIEB 1NGWB 1ZXQA 2UY7A 1J8HA 1KJ3L 2AERT 3GSQB 5DEGA 4IS6A 5DMKB 3O9WB 1TQCB 4CU7A 1HHIA 5C9JB 1FZOA 3C9NA 4JANA 3F7RA 1IGYB 4AT6B 1MHPL 3MLTA 3CU1A 2WUBL 4Q6IA 4NO2A 3VDBA 4Z7VA 1LWRA 1ORQB 1AE6H 3NA4A 1AGFB 5F6IB 3MUGB 4POYA 4XPAH 4O2FB 1OOAA 2VOTA 5EOCL 2VKWA 4JFFE 2GUOA 4AYFA 4J1UA 3QCUL 4TVPL 2HFFB 2AEPH 3BPNB 5F9OH 3V7AG 2YOCA 4OFIA 5B4MC 4YHOH 5IK3A 4JZOA 3B8SA 3TA3D 1J10A 1P5VA 1DBBL 1FYTB 4PREA 4Y5XC 4KQ3L 3RIFK 4G8FA 3ECBB 3RUGA 1YUHA 3O6FB 3VFRB 2CLRA 1X4YA 4GW4B 4AG4L 5DI8B 1A9EA 2R0WH 1FNGB 4HIJB 5JORB 1AQDA 3W11C 1FL5A 3O41A 1RZJH 1JJUA 5HGDA 5GJSH 3ARFB 2CIIB 1VEPA 4W68A 2Y6SD 5I1AA 1S7UB 1K4DB 5HGHB 4WU5A 5TF0A 3SKNA 3F62A 1S7VA 3WS3B 4KMLB 4AIOA 4XMPH 3SDDD 1Z0NA 1DUYA 2QJDA 5EO9A 2VO5A 5F7KC 1DBKL 1FSKB 1CT8B 1VA9A 1MHHB 3TPUA 1F58H 1HQRA 5KN5A 1J05B 3O9WD 4JY6B 2JJTC 2YPLA 2I27N 4NRYB 5A16B 1SBBA 4L9LA 4HG4J 3ZE1F 4CN4A 1KIRA 5IESH 5I8KH 3VGFA 4K23H 1N2RB 2K9UA 4QKXB 2LTQC 3F5WA 5B38B 4LGRB 1NGZB 1CE1H 5C3LD 1Q0YH 1KENH 4JN1H 3PL6A 4RFNC 2J8OA 3BPOB 3NTCH 4MX7B 5E08H 4RQQB 2P5WA 3RNQB 4LMQE 1I3UA 4DQOL 2NR6D 3S35X 4JFXB 2DQEH 2VL5B 1ZSDA 3KPRE 1HZHL 2PW2B 2GSIB 1FYTD 5AZEH 3B2UC 3KS0J 3O6FD 2XV6B 5C09A 4NN5C 3FB5B 2Z91A 4AQ1B 4FQ1H 1KEML 5DDHB 3S36L 2EEAA 3UAJD 1NGQH 4Z76A 1L7IH 3ARFD 1FAKT 4EXPX 5FA4B 1W2KT 5ENWA 4MCZB 2QV2A 4PJIB 1EVUA 3VWJB 4JFDB 1PVHA 4O58L 1RJLA 4R3SA 3KWWB 4OD3L 1OD7A 5AEAA 3B3IA 2CLZA 2PYFA 2AEQH 3IAPA 4XPFL 3D9AL 5FOBA 2WWMD 4HK3J 4DGVL 3L95A 1KJMB 3OB0H 2Q1EA 5CGTA 4X80H 2R2EA 4H20L 4I4WA 5FKAB 3UTOA 2BVQA 1A7NH 1MRDH 2H2PC 3T0EB 3IJHA 3FHAA 1KPUA 1FPTL 4I8DA 5DFVD 2E7LC 1Q0XH 4HWZB 1MHCB 4OFKA 2Z4QB 2BSSA 2GFBA 3NCYS 3EW3B 1GJIA 1HHHA 3K0WA 5DJ2B 1CI5A 1CE6A 4KHXH 4ZXBB 3OXSB 4H25B 5DTFB 1OF2B 1A3RL 3MYZA 5T1LA 5KVDL 2AJVH 1DN0A 1D5XB 2R1YA 5EC2A 4QRPA 4KQ4H 3DMMB 1TNNA 4OKDA 4Z78A 4P2RB 1CK0L 3RL1A 4JFZH 4HQQH 4JPVH 1TPXC 1A7PL 1NCDH 4JZNB 2W9DH 1GPOH 4WHCA 5GISH 1TJHL 1IGIH 3VWJD 1T2QH 4JFDD 5MEQB 1IAIL 5JHDB 1AD9A 2VLJB 1XF3A 1JI2A 4YE4L 1G9ML 1KIPA 1RIVL 3EOTH 4LCUA 1FNEA 1G7PB 2DDQL 4C59B 1UZ8B 3MJ9H 3EOBB 3RWDA 3QNXA 5DC4B 3R0MA 5J0BA 4FFWD 4R2GB 3HAEH 5CUSH 1INEL 4I0PB 4WNQA 1J88A 1MIEH 3H3BC 4W4NA 5JIKA 1TTGA 3MRHA 1WUNT 3NBNA 4J2XA 3X3FL 3LV3A 3Q1SL 1G7JA 3HCVB 2F19H 4XP1L 3T0ED 5HSFA 5C9KA 3I3EA 3HC0A 4ONGL 5AD0A 2X4TA 1C08A 1H5BA 5E9DA 2DYPA 2ED7A 4ZXBD 4HUXB 4ZOEA 4OM1H 3QEQB 1U0QA 4XCCH 5E5RB 3SDAA 1KEGH 1JZ2A 1NMCB 5D1XA 3VD4A 3U9UB 3E8UL 5IB3A 1PG7W 5MENA 5DR5H 1IGJB 1JCKA 3T1FA 3DMMD 2GTZA 4M62H 4P2RD 1T1XA 2DLGA 5CWSA 1BQHB 3H0TA 5I66B 3MUHL 4HC1L 3BIKB 3NAAH 2CUIA 2ZCKH 3TV3L 3WFDH 4PJGA 3ZE1E 1MFCL 5J1AA 3HAEG 5ESAB 1ZLUH 1OD9A 3MCKA 3BISA 2X41A 3CMGA 3ROLA 5JHDD 2VLJD 4PJXA 1E27A 2J8UA 5SWSA 2IPKA 3VXUB 4JQXA 1YEKL 4ODSL 1LE9B 1FG2A 2ZPKL 3MRGA 4M5ZH 4NPYB 1R3IL 3DSNA 2IWGA 4NFBA 4R2GD 4R4NC 4KKLD 3GRWH 4I0PD 1KV3A 1NEZG 1DQLH 1Q72L 1TZIB 2OL3A 1G6RL 1VENA 1I7TB 3L5IA 1BP3B 2UWEA 3EO9H 3V52H 1WEJL 1QLRA 4AQOA 2APTA 5MEPB 5EOQL 5FYJU 4K7FB 4NYLA 3QBTB 2A0LD 1YEGL 2I9TB 5KTEL 4QRTB 1LD9A 3QCVH 4XRCA 3KNBA 3RL2B 3PWPB 3LHPH 3PGCB 1IQWL 1HOCA 5IT2L 3BT2H 4DVBB 1A7OL 1AGBB 3PXHA 3QEQD 4HCRL 3MLRH 2XZAH 4K9EH 3PHQB 3V0VA 4CU6A 4MWFB 3SE4C 3UX9B 3MLZL 2X7LA 3O3DB 2NY5H 4GBXB 5F7NC 5FO9A 3QAZC 5SX4H 2MHAB 3D48R 5E94A 5E2WL 2MPAL 4L29A 4U31A 2HWZH 4X7TA 4MNGA 3HN3A 3VFSA 1R3LA 3IDYB 4GQPH 1DQMH 4MD5A 1P9MC 4JRYA 5SWZE 4HT1H 4D9RE 4UV7L 3F12A 3KJ6L 1YA5A 3L1OL 5DUBB 4OQTA 2X6MA 3C8KB 3LQAL 2GQHA 4FQLH 2KZ1B 1S9XA 4LSTH 1E6JL 3VXUD 2IMNA 5F3BA 4L3CB 1ZA3A 2EE6A 4OGYL 4TNWF 4Y89A 5CEZD 3DETC 4UBDC 4D9QD 1U8QB 5HDQH 4MVBC 3VCLB 5DD6A 5H94A 3ROOB 4LBEB 4JFHD 4LKCB 2F8OA 3MA9H 3GIZH 3LEVH 5TH2A 1A1OA 1ZANH 3U0WL 4OUOA 5FB8B 1E4XI 3K80A 4LEOB 3RKDD 4NDMB 4PJ9A 5FUCE 1MCQA 1CDBA 1YNLL 4KFZC 4M00A 1C16B 5F8QC 1ONQB 1INDL 1BVKA 3MZTA 4EOWL 3VFGL 2IG2H 4JDTL 3GMOA 3LS4H 3N85H 4XVSH 4Z7UF 3DECA 3PWPD 4K94C 5C0RH 3QEGH 1V7NL 2MQ0A 2F53B 2P8LA 3VFVB 4PJ5E 2FO1A 3SKUD 3U4EB 1IC4H 3ARDB 3IJSB 1Q9WB 1S8DA 5IBUB 4OZIB 4M8VA 3WHE0 3CVHB 5LGHH 4R6UA 4L8DB 4GBXD 1VPOL 3LIZL 3VW3H 3S37H 3FAWA 2H32H 4X9IA 5IROC 2LQRA 1BIHA 1FO0A 2Q7YA 3FTGB 1BGXL 4FQQA 5LBSH 3EDDA 3V7MA 3EJYC 4F7MB 1U3ZA 3L3KA 4XCFL 2HJKB 3SN6N 4XC1L 4QO1A 5IG7A 1H15A 3KPTA 1BPVA 2FJGB 5E4EB 1N5YL 1T04A 4BFGA 2EIZA 4ZS6C 4JO4L 1N7ML 4R7NA 4A2MA 2Q8AL 1QZ1A 4G8EB 3BKYH 2IH1B 3V8OA 5FYKL 3WSQL 2GJ6B 3CFJB 5F7UA 1CQKA 1HQ4A 3UTSE 1EHLH 1H3GA 1F11B 5TE7L 1AY1H 2BHUA 4OLZL 4RAVA 3NMEA 2XRAL 2E6JA 1XCQB 4XNYL 4I3GA 1NGPL 2Q8BL 2NY3C 5KVMC 4KK9C 3BP7B 4P9ML 2NLJA 4CADA 3UTQA 5AUMB 4ZUWB 4R7DA 3T65A 4L8CA 3VFOB 4YZFF 2ZNXA 5CINL 1CR9L 3ULVD 4U3XA 2F53D 2R56L 1AQKL 4UTAH 3RX5A 3IETA 3QQ9D 3ARDD 4MQXC 4FG6C 5GS0C 5T33L 1KB9J 4CNIB 1J86A 4RDQF 3FB6A 1ED3A 5HYIA 3ZT5A 2ZG2A 4CUCA 1B0RB 1YYML 3SBWA 5KBNC 2NY7L 3TN0B 5KS9A 1WT5C 4WUKH 4GRWF 4WV1B 3QFDB 2HLFC 2WINB 5CZVL 1OARL 4X4ZA 4J7RA 3GJEB 4ZO7A 5FYLL 5HHQA 1Z3GH 3QNYB 2XQBL 5E8NB 1YY8A 3SCMB 2AGJL 4APQA 3PHSA 4EI5B 3W9DB 4MNQE 1A6UH 4I18B 2DI8A 1Q9KB 1PG7X 2H3NB 4JKKA 5EU3A 1SYVB 4U6YA 3SDXF 4CMHC 3BHBB 4KI5C 4IHOB 3KPSB 3RVXD 2GJ6D 5JZ7C 2VNCA 4I1NB 4P46C 2FECL 5F6HJ 5I1GL 3OR6B 1IKNC 3CJJA 3MGAA 3B6SB 1AXTH 5ETUB 1IAKA 4OZHB 2VMFA 3GI8H 1NBYB 4U3HA 2P45B 4LP5A 4HBQA 5I1KL 1F3DJ 5I8EB 1ZLSH 3DV6A 1R3HA 3KLSA 2GY7B 2ATKA 2LFGA 2PO6A 1FZJB 2AJYH 3WJJC 3A6BH 5ILTL 3VXPB 3GSRB 5TDNA 4GW1A 2HJFB 2Q76B 3MMEA 3HE6A 4OZ4A 4Y4HB 3X11A 1EEZB 5C0DB 4C56B 1EFXB 5EZLA 3IJYA 1T7YA 3VFWB 5GS1B 2H2SC 4N0RA 1K4CA 4HK3N 2NTFA 3TN0D 2ZWLT 3ARUA 2HRPH 3DIFB 1YN7B 3WIHL 1U6AL 3AMKA 3O6KL 3BIBX 4JKPL 1EHNA 2PXYC 4M6NH 4QXWA 4S1QH 4X5WA 1NBQA 5C0FA 3RX8A 4ERSL 3RIFF 2ED9A 2ZUUA 3DROB 4MJ5B 1AP2A 2O61A 1T66C 3MROB 3GSWA 3S34H 2XZCL 4N9GB 1X3DA 1QLEL 2VXTH 3SCMD 4F3FA 2A77H 4M6OL 4EI5D 3SGEI 5LXGH 3HPJA 3L3HA 3LVEA 2FYYB 4FQCH 4TQEL 4D0DA 3WMSA 4P3WA 2H8PB 2HTLC 1UACH 1QSFE 2KDGA 2HTKD 3S5LB 1A6WH 4R26L 3KPSD 2X05A 1Z9OA 3V6FA 3TYGH 4P4RB 3IAQA 3EHBC 4QT5B 3O8XB 4N8VG 1QBML 4YAQA 1MH5B 1U8KB 4I3SH 4LP4A 1L9NA 1U8PA 3EUUA 3B9KC 3GSOA 4KZDL 2LU3A 2K3TA 5F3HB 3OJVC 4NUGH 4M93B 1JWMA 5ALBL 3I6KB 1HI6B 1UG9A 4KK8C 5DQ9A 5I1CL 2UV3A 4G9FB 2PCPA 1X7QB 3S8WA 1SVCP 3JWDL 4XP6L 1A2YA 2KPNA 5DF0A 1J11A 4OLUH 3ARRA 3HNTL 4PJAE 4HZAA 1FC2D 3PUCA 3C9NB 4Y4HD 5CHNA 1FC1A 4L8SC 1A64A 4C56D 1FGNH 3MLTB 1EFXD 4C55A 4UI2A 1LO0L 3R1GH 4Q6IB 3D3VB 4C54A 4ODWA 4N0YH 4Z7VB 3UPRB 4BJLA 2HKFH 3ZKXC 3VMPA 5EBMA 5IVZA 2EXWD 3MZGB 4QHUA 3TFKC 2R4RL 3FZUD 3NACH 5C7XH 3OQ3B 4J1UB 5BRZE 5I0ZA 3CIQA 4JRXA 1HN1A 4DN3L 2IADA 2Z9TA 3DSFH 4NWTL 2J4WL 2L0DA 1WZ1L 4JZOB 4AH2A 4Y19E 3E2HB 4PB0L 3NIDE 1NFIB 3RUGB 3NFSH 1CXKA 4Z77A 3MGTB 3QIWC 5CD3A 4HS6A 3UTTE 4LPWA 3WLBA 1A9EB 2VXQH 4PB9H 3BIAX 4G6AC 2BC4A 1AQDB 4Y5VC 3O8XD 4UB0H 5HHOB 3C09B 3UROR 4XX1G 3KPPB 1JHKL 4POZC 5IFHH 5I1AB 2BHYA 1ZS8B 3QXDB 1JFQL 4K71B 4JHZA 4KJYA 5D70L 3ZKNC 3BD5A 3IXAB 4AMKH 2WMPA 3P11H 4G6KH 4G9FD 3QPXH 5EO9B 1DEDA 4NKMA 4CMMB 4LSVH 2I60H 3GSNA 2XN9B 2X40A 5KN5B 1A6VL 1BQUA 1IC7H 4DUVA 2Y06H 3ZE2E 3SKMA 5L8KB 1QRNE 2FGWH 5T5FH 5AAWA 3QXAA 5B39A 3D3VD 2GTWA 5JLZA 1J5OL 2A6DA 3B9EA 3SDXE 3LQZA 4ZOAA 4L9LC 3PL6B 2R8SL 3PIQA 4U7KA 3EAKA 2KQMA 3MLYH 1LE5A 5EC1A 2Z92B 3ES6B 3CD4A 4PY7A 4R8WL 4LLDA 4F9LA 3OJDA 3TZVA 3HB3D 2EO1A 4GUPB 4RBPK 2HMIC 4OB5L 4G3YL 4DKEL 3RJDA 3C5SB 5ID0A 5C09B 1QEWA 5C0IA 1KIQB 4G7VH 4XNXH 1A6ZA 1OTUD 2DOCA 1SEBA 5EU4A 4NJ9H 5HHOD 5H37H 1TCMA 2E5EA 1YNKL 1FNSH 1KULA 2FX8H 2EE9A 1CLCA 4FQIL 4OCLC 3KLHD 2GSGA 4YO0A 3KPQA 2CLZB 4XVJL 4YHZH 2YUZA 2NY5C 1UXSA 1BBJA 1IT9L 4YFEA 5IVOA 4ALAH 3MUZ1 3HNSL 2DM3A 2XN9D 5SWZA 5TQ2H 2B20A 4EJ1C 4GS7C 1YZZA 3F7YB 2ESVB 4PLJC 1Q94B 3BW9A 3U1SH 4WFEE 2OZ4H 2VL4A 3LOWA 5BV7L 3QQNA 4OKVB 2BVQB 5IVXB 4PJFF 3H7BB 3IJHB 1NANH 4R90H 2NY0C 1KPUB 3PL6D 4LSUL 1O7SA 4PJEF 3I6GA 3QJHA 4FQPA 3M1BB 4PP1C 2GFBB 1JPGA 4H0IA 4WWKC 5H37G 5JXED 2X70A 5DUPL 1CE6B 3RI5K 3D0VA 2G2RA 4X4ME 4JKMA 4JFQA 5C07B 3LKNB 1JGDA 4XXDA 1OCWL 1BVLB 4PV8B 3WO4C 5JUEL 4HIHA 2RJMA 5C09D 2V7HA 3MV7B 3SQOH 4LLUB 4ZOBA 3GHBL 2NY6C 3CXHJ 2XYCA 3NPSC 4WGVB 1KJ2L 4H1LA 32C2B 4F33A 4LASL 4WTZG 4JR9L 5SV4A 1NKOA 5C2BH 3G6JF 4MJ2A 4MA3B 4CJ1A 3WDHA 1AD9B 2X1WL 1SEQH 4Q2ZB 2SEBA 5T3ZL 5L0QC 5JOFA 4F15B 4KAQL 4XCEA 5LCVH 2Q87A 4EDWH 5D1QB 2BERA 4RMSA 4PR5A 3GJFB 4RAUB 2F54A 5HHPB 3IXTA 5ALCH 3PV6A 4TVSa 2ESVD 5TE6L 4P9HL 3EO1A 1SBSL 1F8TH 4KZEL 1FNAA 3LDBB 2FBOJ 3TH3T 2O26U 1ACYH 4HAFA 5IW6A 4NZDA 2QKIB 4DAGH 2NMSA 5CEZH 3VXNB 1C08B 1H5BB 4AEHL 1N5AA 2DYPB 3LQMA 3QPQD 1S5HB 4Z5RA 1BQLH 4DKFH 3CSYB 4NQUA 1AFVL 1KTKE 3OAZH 3SDAB 3DRQA 4WFHE 5D1XB 5C07D 4P5TA 1P7HL 2ZUQC 5MENB 4J8RB 1KN4L 5J4MA 3MV7D 2GTZB 2VXSL 4WI8A 3DX7B 2AVGA 5KVGH 5CWSB 5J6HB 1KCKA 3U4BH 3IU4L 2J6EH 2MSPA 4X6CF 1BQHG 3FB7A 4BQ9A 4JKLA 4NP4L 2X1XR 5DVNA 3LPFA 2F58L 3IFOA 3MCKB 4M7KH 4PTUB 2DBJA 4MDJB 4LVHB 3ROLB 2J3SA 1E4KC 4QHKI 2M2DA 4JFEA 1RURH 3GSXA 5D1QD 3HI5L 1YMHA 1QFPA 2A73B 5T1DL 1FG2B 1VSCA 3MRGB 2RBLA 4JAMA 1D9KA 3U46B 5CBEB 5ISZA 5JW3L 4ODTH 3GMRB 5EO1B 3CFKA 1F3RB 3G5VB 4MXQC 4JQXC 3HMXH 4MNQA 1NAMB 2X5PA 1ZHKA 1IAMA 3B9VA 5TPWL 2UWEB 5AYUL 4EVNB 4FQ2H 2RFXB 3BGFB 3D85A 1DBAL 3QO1A 4LHQB 1KCLA 4YBQD 1A4JA 4WW2A 5FYJL 2EC9U 3W5MA 3VRLE 1XGRB 3PWJA 4WHDA 4P2QA 4YDLB 4DN4H 3DNKA 3KNBB 5F7YC 3TYFB 5M7QA 1CGUA 1HOCB 1J8KA 5ESVA 1P1ZB 3FQNA 4OD2A 4F9PA 2WLYA 3MRCA 3SDAD 3U30B 5D1XD 8FABA 3D0LA 1NCUA 5HYSA 5MEND 5A2LH 4X6BB 4JY4B 5F7HA 2CRMA 5FO8A 1MI5A 2EXYC 4HMEA 5FO9B 1AE6L 1NFDF 1SJEB 4XPAL 1OHQA 5E94B 3X17A 4L29B 3MRLB 4X7TB 1DBJH 3BDYH 3S35H 1IEAA 1QYGH 4LHUB 4ZUTA 1YYLH 2D0HA 3S7GA 3D18A 4LIQE 4MD5B 4HUWB 2C4FU 5C0AE 3SOBH 2AEPL 5F9OL 1UWGH 4HGWA 4NQCE 2ZKHH 3RWEA 4YHOL 3ULVH 2AABH 5F3BB 1QFUH 3CAFA 4LNRA 2I07A 4UV4H 3IDNA 1NMAH 2Y6SC 3CVHH 3GBMH 5IQ9B 4D2NA 1CU4H 4KRPC 4GSDH 1KFAH 2R0WL 3SDDC 3V6OA 3C5ZA 1RZJL 2ED8A 2AK1H 5MI0B 4MDIA 4GH7B 2H26A 5GJSL 2BSRB 1D5BB 3NPZB 1QFWI 4QRRA 4HK0B 4K3JH 3MXWH 5F93C 1IJ9A 2WBWB 1DP0A 4MMXC 2QSCL 3O9WC 1TQCC 5I0DA 5JDJA 1GGYA 2XFXB 3M07A 3TIDA 4S0SD 5C0BE 1JZ4A 4UOW1 4Z7UA 1MCRA 3H9HA 2DL2A 4XMPL 1YJDH 4ZMAT 3QIUA 1BVKB 3UBXA 4IDLA 3ORJA 1F58L 4PJ9C 4ZUSB 5T5NG 5J3HD 1A22B 1JGVH 1J12A 1F6FB 3R06A 5IJVA 3RAJH 2JF1A 3W81A 5F9WB 5IESL 3UPCA 1AC0A 4L4VA 5I8KL 1UKSA 4K23L 1NCNA 3T2PA 1GRWA 2OSLA 4U2YA 2CXGA 4KWUA 5IBUG 1DJSA 4XBPA 3JXAA 3ZDZF 1CE1L 4HH9B 1Q0YL 1KENL 3NIFF 2YK1H 4QRSA 4XCYB 4LHUD 4I13B 4N0UE 3O6FC 3NTCL 5E08L 1FO0B 4L5FH 1FH5H 4FQQB 4I48A 2CXKA 2QHRH 3I50H 3TLRA 5ERWA 3DV4A 1B9ZA 3I2CH 1GOHA 2DQEL 3L3KB 4ZOCA 4JRWA 1ROWA 1YN6A 4TOYH 5AZEL 3W0WB 1CFQB 4JFFB 2YMXH 4UZGA 3LKOA 1BJ1J 1MAJA 2EIZB 1I3VA 3MRKA 4Y8AA 5BOPA 2B7DT 3R0NA 3CFCH 5BRZA 3BPCB 1N0XH 3EBAA 3MYJA 2ICWI 4FQ1L 1YNTA 3GO1L 3QDJE 1ERNA 1NGQL 1L7IL 3DURB 4Y19A 3U2SA 4S1DD 3QNZB 3QUZA 4PJDE 1BWWA 1RZKH 4Z0XA 4X6DB 4B0MM 2DD8H 3QFJE 3UTTA 1NPUA 3K4AA 4CADB 3PWLB 1V7MH 2AEQL 3LKPB 4Y2DA 4RA3A 1G7LA 3CDFA 4ZPTA 3QIBA 1S9YA 5HHNB 2VDMH 1EGJA 1WCQA 4DW2H 4X80L 4NNXB 2C1PB 4GXUM 1C5CH 4FFYH 3W2DH 1ED3B 3T77B 1GGCH 5DA0B 1MRDL 4GG8B 4X6FB 1BD2E 2VSDA 1UH3A 4PG9A 5EUOE 4OV5A 3G6AB 4RSVA 2C9AA 2WP3T 1AGCB 4F37F 4XWOC 1JZ7A 3FO2A 3MJ7A 9CGTA 3ILQD 3G04A 4KHXL 3WFCH 4PG2C 4LCWA 3IRZA 2AJVL 4APQB 3SDXA 5I1JH 2VH5H 3W0WD 4O02H 3HA0A 2FJHB 4JFFD 5I30H 4IIQC 3BEVB 3VWJC 4KQ4L 2D4DA 4OI8A 1EX0A 1S7XA 2EE3A 4Z7NF 5J13B 2WSKA 4JFZL 1T5XB 1KOAA 4HQQL 1RUPH 4XNMB 4NFDA 4X8JA 1NCDL 4O9HH 1FAIH 1NDMA 3KPRB 1F5WA 4MAYA 2W9DL 1GPOL 5GISL 1F13A 3NH7H 3HS0A 1IAKB 1IGIL 1T2QL 1U8HA 3O6LH 2FSEB 1JYXA 1HSAA 3K46A 3L3OB 1A7RH 4NWUH 5LGKA 1WZLA 4JDVA 4UINH 3FQTB 3BX7C 3EOTL 5FECA 4CN1A 3ZHLA 2PO6B 1T2JA 1UJ3C 1EEQA 2ADIB 3MJ9L 2WK2A 3OB8A 4HV8A 5CUSL 3LN5A 4YHNA 1MIEL 2OTUA 2VISB 4Y4FB 5EZLB 5DVKA 3RZCA 2A6JA 3GMLB 1MNUH 3TBWA 4DGIH 2F19L 2R2CA 2BOBB 1QNZH 2FHFA 5DJXB 1ZT4A 3LKQB 4X5WB 2ARJA 3LMJH 3GGWA 4XC3H 2C1OB 3MV9E 4K7PH 2XT1B 5DJCA 4MHHG 5A40E 2FO4B 4UT7H 5FIEA 25C8H 4OM1L 3UZEA 4CVXB 3ALXA 4F3FB 4XCCL 4APQD 3ARYA 5IF0B 3AROA 3RWHB 3MRNA 3HPJB 5CP7A 1A6TA 3K8MA 5DR5L 4D0DB 5SWQA 4LU5H 4M62L 3LRSB 2WNGA 1A1NA 5T1KB 3S5LG 3V6FB 3NAAL 4N5UA 2ZCKL 5DRZB 2JCCF 3KPRD 5JMOC 3SE3A 3WFDL 4YAQB 1BAFH 3VE0A 1D5IH 1AGEA 4HWUA 5DZLA 4P49A 4R2GC 4I0PC 3ZDZE 2NYYD 3BN9C 1VGKB 1JWMB 4IRZH 3WJLA 2EKJA 5E6IA 2AXHA 5DQ9B 3SE8H 2A83A 4LARH 2PO6D 4ZFFA 2PCPB 3FO9B 1R3JA 2OTPA 1A2YB 5I76A 3QZWG 2H9GA 4RNRA 1FVCB 4RGOH 3OGCA 2PR4H 3GRWL 1N8ZA 4GKZB 4Y4FD 4OLVH 1DQLL 2F15A 4UAOC 3EO9L 3V52L 2AS5M 3HRZB 3RNKB 1EO5A 3BP6A 3FOLA 4HWBH 1AR1D 1WIOA 4WFGE 4PBWD 3TBTB 1KPRB 1S3KH 2OTWA 1JZ3A 1LEKA 4QHUB 2OM5A 1FP5A 3HG1E 3QCVL 3I9GH 3LHPL 4HUUA 5EN2A 3BPLC 3QUMH 3MLRL 5JO5A 1WFNA 2XZAL 4FNLL 4K9EL 3RVTC 4G8IA 4LSSH 5C2UB 1FFNA 4GO6B 3KYNB 5EOTA 2VWEE 3TIEB 2NY5L 4Z77B 1U92A 4HS6B 4HXBH 4FTVA 5T1KD 3EDFA 2HWZL 1OSZB 1G9EA 5CP3H 5F1NA 1DQML 3SKJH 1YEFH 5FDWA 1X5GA 2GK2A 1CS6A 4HT1L 4JJ5B 2WUCH 5LKNA 2CKBH 5DZNA 4FQLL 4RGNE 3F65A 4XPGH 5K9KA 4LSTL 1I7RA 4KJYB 4P2OB 3OB0K 1OSPH 5J1SC 3RDTA 2W91A 1GGUA 5I73C 1JTTA 4TUOB 5HDQL 3RKDC 2PUQT 4L4TA 3V9FA 1YEDB 2M1KA 4BFIB 3AU1B 4B7LA 3BKJH 3LEVL 2VAAA 4MCYB 1ZANL 1ZT1A 4MGXA 5B39B 2YEZB 2GTWB 5JNYA 4Y1AA 4R4BB 3RI5F 2A6DB 4Z7NE 3PQYB 5AG9A 3T2NH 4HKXA 2P4AB 2IG2L 3LS4L 2G75B 3N85L 4XVSL 1EVTC 2XA8H 1KBGH 5C0RL 3QEGL 4BYHA 4PY7B 4YHLH 1IEBB 3OJDB 4YHIA 3IDYC 5DEFA 2BMKB 1IC4L 1QBAA 2D7TH 4BKLA 4ZODA 3BESR 2V7NA 5LGHL 2MJWA 3VW3L 3JV5A 4F9LC 4JFYA 3TZVC 3S37L 1QEWB 5C0IB 4WI6A 5EG6C 1A6ZB 4YGVA 2P24B 4MXWH 1NBZB 4B7IA 5HBBA 5LBSL 1PG7H 2CRZA 2IMMA 4N0CD 5EU5A 2F9BT 4HPYH 1NAKH 1WVZA 3QUKA 4P2OD 1C5BH 5FYKE 1U91B 2HLAA 1FL6B 1UZ6E 5C0AA 3BKYL 4JY5H 1DLHB 1CFSB 4X8XA 3IDUA 4PJFA 1EHLL 2EYSA 1FBIH 2IBZX 2I26N 2D9CA 1AY1L 4HD9A 1QOKA 4PJEA 5IEHA 1I8LA 4POUB 1I8KB 1YPZE 3BKMH 4P3DB 4PJ7F 2BVYA 2EDYA 2HT4D 3PQYD 4LRIC 5GRVL 3HZKA 4DZ8B 4FXLA 5GGRY 3AUVA 2YBRA 1HHJA 2B4CC 4MZ3A 1XGUA 1XGQA 5LGJA 1MLBA 4F7EA 3GJFH 1AD0A 1S7SA 4UTAL 1TVHA 5C0BA 1RIHH 3JWOL 4NT6A 4RMUA 4X7EC 1EAJA 2HT3D 5FV1L 2XWJA 3BEWB 3RGHA 2UZIH 1B2WL 3BYYA 2VJXA 3MXVL 4OCXH 5IMLA 4ZDHA 2X89A 4WUKL 1CFTA 1HH6B 3AM8A 3G6JA 5KSAA 4NQXB 4PJ5B 4QXUH 3VDAA 4YC2B 4O5LH 1FLRH 1HWHB 4G6JH 5TDPB 3RVXC 1ZVHA 1Z3GL 4Y5YA 1RI8A 2EC9T 4GW5A 3LN4A 3BVNA 1A6UL 5D8JH 1K2DA 3PABB 3PDGA 3CSGA 1OP3K 2BVTA 4HGMA 2C3GA 4WWID 3PF2A 1XF1A 3BQUA 1CQYA 2HG5B 2ARJQ 2BY3A 1UH2A 1GAFH 3QO0B 4U1KB 4NNYB 4L8BB 1RUAL 3OKEB 1AXTL 4IMLA 1F4XH 1F2QA 5D2NA 2BOCA 5CGYD 3E6HB 1CFNA 3NCYP 3TBVB 1ZLSL 2ADFH 1YECH 4FABH 3UTSB 2AJYL 4WV1C 1XGTA 1MF2H 2JJVA 4PJDA 5JDSA 1N0LA 5D9SB 2G9HB 2Z31A 1DVFC 1T03H 1CGYA 3NABH 3L3JB 5I15H 1OY3B 4P5TB 1RZKC 1NAMH 1S9WB 4OIBA 1OTSC 4X6CA 3WV0A 3IDIA 4EI5C 2HRPL 3WN5B 1KCSH 3QDGE 4NRXB 2P42B 3AGVA 2HFTA 5E2TH 3P0GB 4M6NL 4S1QL 4PJ5D 4Y88A 1T0NA 3VXTA 3SKOA 3BDXA 5E00B 2HTKC 1E4WH 3ULSB 1A5FH 2FBJH 3S34L 3C60A 5FOJA 1RJZA 2YD2A 2VXTL 5JPMA 2A77L 1BD2A 1A1MA 2CRYA 5LXGL 4OCRL 3S4SA 5GIRA 1NQBA 2OS7A 4FQCL 3O6MH 3RWFA 4YDIH 4YXLH 4U1LA 4QHNA 1UACL 4LOUC 3AS1A 5HGAA 4NQSB 3TYGL 2VTFA 3CFKB 1MLCA 1R24A 1LEGA 5F1IA 4JO1L 2VUOA 5JIPA 4MNQB 3BMWA 4CW1A 4I3SL 1G84A 5DRWA 4AY0A 1D9KC 4Q0XH 3D85B 2P5EE 4Y4HC 2W9LA 4ZG1A 4NUGL 4I2XE 1ULVA 3OR7B 4GRMA 5GGTH 4WW2B 3UTSD 5GPRA 1XIWA 3KDMB 3QXTA 3CDGA 5IGXH 3TBYA 1IEHA 5IHUH 3E6FA 4FXGB 1B88A 4OLUL 1OGAE 3WFHA 5ESVB 5J11B 3KG5A 3ULUD 1RFDH 1DDHA 1LP9F 3FQNB 3LB6C 4OD2B 3FZUC 1K8DB 2UZXB 1FGNL 1Q9OA 2OJEA 3R1GL 4WO4C 3IKCA 4N0YL 5CEYA 1T2XA 2ATPB 3IDXH 1Z2KA 4HJ0C 1NGYB 5F1SA 2HKFL 5C08E 3MV11 4IJ3B 4F9PC 5AG8A 4U1SA 1FCCA 1OW0C 1HK6A 4UQ3B 2BSTA 4TVPH 3NACL 4LSPH 5BS0E 5C7XL 1XF2A 4P57A 4H26B 4LHUG 4HS8H 1I8IA 4P23B 3DSFL 2Z93A 3VRJA 4PJ7E 3MOAH 5IM7A 2QR0B 3DBXB 2I07B 2EDXA 3ZL4H 1BFOB 3IDNB 3NFSL 4OBRA 4PRIE 4G43B 3KVQA 1U8LA 4N8PA 3WKNA 3TNNA 3PWUA 4GG6F 5LJYH 2VXQL 2GYSA 4MB4A 4RCAA 5D96C 1QP1A 4UB0L 1UKQA 1K8IA 4MMZC 3MBEB 4MNQD 1FO0H 3H9SA 5GRVK 5IFHL 1KLUA 4HC1A 4QHKJ 3GKWH 1QSFB 1UWXK 3D85D 1JV5B 4HUKB 1OM3H 3V6OC 3C5ZC 1QHOA 4V1DA 4AMKL 4NOFA 4UDTA 3MUJA 3P11L 4G6KL 1M7DB 1P2CB 2IBGA 5ICXA 3QPXL 3QIUB 3UBXB 2NXYB 4JZJA 4LSVL 2I60L 1W0WB 3UYRH 3ZLQC 2CK0H 4LCCA 5I6XB 1W0VA 5KSVA 3K3QA 1IC7L 2Y06L 3PV7A 1H3PH 2KL6A 3VH8G 2FGWL 5T5FL 4IOIB 2OSLB 4PJHE 4R96A 5JTWA 2MMXA 1C12A 4IRJA 4P4KA 3RTQA 2XWBA 5D6DC 4BQ6A 4F7TA 2QADB 1RAMA 1FZKA 4QRSB 1G6RA 3VXSE 4PJAB 3WXVH 3QQ3B 2XZQH 4QRUA 3RGVA 5DS8B 4JDZA 4M7ZB 3DO7A 2NPLX 4P23D 5HI5D 3J8F7 2ITDB 5F7DA 3F8UB 2W0LA 4LKXA 4U05A 1OAUH 1P4LA 5JIHA 4A2LA 4RGMC 5I75C 5L9DH 2EYTA 1ZEAH 4KKAD 1FV1B 2HVKB 3F58H 4WEMB 5E1HB 3IFLL 2NXZC 3HG1A 3DJ9A 3LEXB 3QUXA 4LLQB 5D7LE 5F8RC 1MAMH 3KLHC 2EDBA 4G7VL 3MYJB 4EBQH 4XNXL 2GY5A 4J4PA 4QOKE 1OAKH 4NJ9L 3MODH 2BNQA 3MBED 4Y19B 1MSPA 3FT3B 3JWNC 1VERA 2YRPA 4QGYA 3QUZB 1FNSL 4NC1C 1IVLA 2FX8L 2YZ1A 4LF3A 1QSFD 1T5WB 3LCYA 2YR3A 4Q7DA 2JIXA 1CICA 4NN6B 4YHZL 1KF9B 1HDMA 3QIUD 3TP4A 4NZJA 3FQWB 2Q86A 3UCRA 1X6LA 4RZCA 2NXYD 4ALAL 3QUYB 5TQ2L 3MRPA 1JHTA 4NKDA 5JW5A 3BZFA 1NC2B 5IMMB 2JKXA 2WQ8A 2AJSH 1WQVT 3DYOA 4PFEA 5IFJB 4ONHA 5MEOA 2XKNB 5EB9A 3U1SL 2OZ4L 4S0TD 4MD0A 1BZQK 2HJLA 3TH4T 5H35B 2D7OA 3P73A 2QADD 2GK0A 4R90L 1KC5H 4B5EA 4HULB 5C0EA 5DHYA 2IEPA 3FT4A 4EDXB 1AXSA 3BYTA 5D7JA 1QRNB 1WWAX 3MJ7B 5D71H 2C3VB 5CSZA 5E8OA 1P53A 2FIKA 4QWWD 1JWSA 3ZKQD 4PGDA 4K07A 2F5AH 3TO2A 4K2UH 3CSBA 3EYUH 2V9QA 3SQOL 3M17B 1B0WA 1S9VA 3VFNA 5B8CB 1T20A 5EBWB 1LP9E 4QHLA 5D6CA 4MAYB 1TJHH 3QUZD 5I2IB 3RWGB 5C2BL 1IAIH 1FIEA 1QUNA 1U8HB 5T3ZE 1KIUA 1HSAB 4MA1B 2FL5A 3SGJA 1CL7I 5INCA 4U6XB 5JW4R 5IW1B 3B8YA 5KW9H 5ID1A 3QH3A 4XI5D 4EDWL 2MNUA 3Q3GB 2ICWJ 2WW8A 3NGBB 3QUYD 5BQ7B 3U0PA 5JXAH 3MO1A 1NC2D 5CEXA 3PWNA 1INEH 1UCBH 1T7WA 3BJLA 1F8TL 3V5KB 3X3FH 2XNAB 3P4LA 2G5BA 3TBWB 1I8MA 4XP1H 5IOPB 1KN2H 1NSNH 3B83A 3EYFA 3KS0H 3VG0H 1ACYL 1ZT4B 5IW3A 3OZ9H 3TJEL 4EI6A 2EDNA 4PS4H 4DAGL 2X1PA 5KOMC 4PLOB 5CEZL 1QRND 5E7FA 1Z9SA 1IM9A 4CU8A 4FS0A 5C0GA 4S11A 4DKFL 1CGVA 4OSUH 1EXUA 2JB5H 3HZVA 1HYSC 2IF7A 1P6FA 3CPLA 2VITB 4PRHA 2E3VA 5EO0B 3WEXA 2JCCA 1U95B 2EDJA 3OX8A 3MQIA 3H9YA 2JE8A 1XR8B 4U6VH 3T2QA 3JVGC 3U4BL 1A1NB 1FFOB 5LG1A 1XEDA 4F7PB 1X9QA 1OWWA 2J6EL 2FD6H 5D1QC 5L2KA 1MFCH 4MAYD 1IGFH 4M7KL 1J0ZA 4NO5A 1AGEB 1MCJA 4YBLC 1LMKA 1LQSR 3F7VA 4N0FA 5ICZA 1KB5B 1IZKA 2PETA 2EYRB 3SE3C 4WEBH 1G7MB 3TVMA 5ACZA 5E6IB 1RURL 1D6EA 2AV1A 4ZFFB 1R3JB 2FB4L 2H41A 4OFDA 3QI9B 4NUJA 4I5BA 4ODTL 3K8KA 4JN2B 1MREH 4Z7WB 3HMXL 5IV2B 3B4NA 3SPVB 2X4PB 2BNRA 4N9OB 5FYJE 1BZ9B 4FQ2L 4LPTA 1K6QH 1PQZA 1T89A 1IMHC 4UNVA 3FOLB 1UYWH 1XZ0A 3PNWB 3LKSB 2OTWB 3DUSB 4ZUUA 4XH2B 4FN0A 3TPKA 4DN4L 3TESA 4N1EA 3OHXA 2DQHH 4WFED 5BZWA 1N6UA 4HUUB 1DQQB 4JFPA 1X5YA 5HTSA 2AI0H 4PV9B 3BN3B 5JO5B 4YFDB 4X99A 3FONA 1GC1H 1JN6B 3DX9A 4LAJH 5ITBH 1XGYH 1I1YB 1HHGB 1IC5H 2B0SH 1U92B 4KTDH 2IANE 2MPAH 1UXWB 3FFDA 5CBAB 1MWAB 1DBJL 3BDYL 4X6EA 1QYGL 1ADQH 2YHGA 3LRGA 4YIQA 3IDJB 1T7VA 5D5MF 4DWHA 4P5KA 3L1OH 3ZYJA 4GRLB 4YDJA 1UWGL 3L6FA 1D5ZA 5H2BA 2ZKHL 43C9A 3ULVL 3HLAB 4N90E 4ZFZA 2AABL 1RZ8A 5K9KB 1I7RB 4AM0A 4OGYH 3WE6B 4PRAB 1QFUL 4UV4L 5E6ID 4WEUD 1NMAL 3GBML 3CVHL 1RSFA 2LE9A 2MCG1 1CU4L 4GSDL 1DEEA 1KFAL 3QI9D 1DQDH 5GRJH 1GH7A 3MNVA 5IMKA 3IU3A 1P4BH 2X44D 4PJCF 2AK1L 4IOFC 2AXFA 2VAAB 1ZT1B 5J12B 4K3JL 4K8RD 3MXWL 5J3HC 1YMME 2AJXH 4LLWA 3PWVA 1JYWA 5ICYA 5ANME 3HFMH 4KVNH 2JJTA 1KT2A 3EOYG 1YJDL 3WCYA 2IAMB 4WIQA 1MFDL 4NM8H 1MRFH 2WANA 1CVRA 1KLGB 1WZKA 1JGVL 4ODXA 4ZO8A 5EFIA 3RAJL 3HZMA 5I1DB 4TRPH 4ZNEE 2YKLH 3W39B 4I2XA 3THMH 3GM0A 3GMNB 5CIPB 4DZBB 4KI5E 3VXMB 3IF1A 3CDYA 5SX5H 1INQA 1DANU 1BZ7A 5K9QG 4OJFH 1YDPB 3P4OA 2XZZA 4JPKH 4OZGE 1JF5A 3AMLA 4IDJH 1QHPA 3DHJA 4JLRB 4L5FL 1FH5L 5HDBE 2E7CA 2VR5A 4GRLD 2QHRL 3I50L 3K2MC 3T0VA 1AH1A 3VA6A 2F74B 3I2CL 4X98B 5K93A 5GS2D 1PDKA 1SQ2N 2X4OA 2OMNA 4TOYL 1AO7E 3MNZA 2APBA 1B0GB 3OV6A 3O4LE 2YMXL 1T1ZB 3EO0A 3KLAA 5BS0A 1ZHLA 4YEEA 3ZYZA 4GMTL 1AKJA 1G7IB 3CFCL 5C0AB 1RU9H 5HYJE 1N0XL 4NQCB 4KJPD 4DEPC 2AQ3A 2EIEA 5F7WC 2COQA 1OAYH 3CCHA 3EJZC 3S98A 5DSCB 1YC7A 4WDIA 4PJ7A 2EYSB 5IVNA 2IALB 3L5XH 2QTEA 1RZKL 5GZOD 4U3CA 1K3IA 4NGHH 2YPKA 4HIEB 2IAMD 3LH2H 4PLKC 3HZKB 3PXJA 4EUPB 3G08A 2YBRB 5CINH 2GAZB 3DI2B 5FGBA 1I8LC 3WD5H 1FJ1A 3MR9A 1VACB 4X9GA 3SGKA 2NW3B 1XGQB 3I6LE 3QQ4A 4LCIL 5DHVB 2VDML 1AD0B 3T2OA 4DW2L 1TVHB 5C0BB 3KPNA 4M7LT 1C5CL 4FFYL 3HE7A 3W2DL 1CWVA 1VFAB 1FNHA 3VXMD 1E28A 2BY2A 1GGCL 5AYQA 4PGEA 2DQGH 1IQDA 3CFBA 1M7IA 1NMBH 4JHWH 2HVJB 4PP2B 3PGDA 4ONOA 5DJAB 3HUJF 3S37X 3D25B 3GI9H 1H3XA 3WLWC 3WFCL 4Y5YB 4QLRA 4U1IB 3T4YA 5I8OH 2Z0BA 1TETH 4S2SB 5I1JL 1IM3A 1WSST 4ZSOE 1QSEE 2VH5L 4GW5B 5B3NA 4O02L 3LN4B 3ULUH 5I30L 1K2DB 3VXSA 1ZWIB 4OIAA 3F7QA 4N0UB 3JV4A 5C0AD 5I71B 4NSKA 3U6RA 1SYSB 4NQCD 2PYEB 1RUPL 5KG9B 3RWJA 3WKMH 1WBYA 4O9HL 1FAIL 1J8HE 1KTRL 5FV2A 1U8OB 3DTXA 5HGBB 5ACMA 1RV6X 4FQXC 3RU8H 4YPGB 3O6LL 2C3XA 3X13A 4G5ZH 1IKFH 3CMOL 2BFVH 3BQUC 1A7RL 3OKNB 3BH8B 4NWUL 4ELMF 4YQXH 5EU6E 5D7LA 3BP4B 4HFUL 2VLME 3ARBB 4QXTA 5FGRA 3QDJB 4QOKA 3R8QA 3HC3H 1XMWA 4NZUH 5D2NC 3C6LB 3BGMA 4JB9H 5ACLA 1XGTB 2J12B 4NO3A 4PJDB 3H7LA 5C0BD 2Z31B 2X4RA 2Z35B 3QFJB 1WBZB 5TF1L 2IC2A 1HEZA 4OGAC 4B41A 4LLVA 1X5LA 3D2UB 3DUHA 3QWOB 4DGIL 1YEJH 5HYFA 1DFBH 3TC9A 1QNZL 1JRHL 1YY9D 1GIGH 3IYLW 4XC3L 4RFEB 3SKOB 5I9QB 5D7SH 4K7PL 3ZTJH 3OF6A 3G6DH 5IBLD 3KLDA 3GEWB 2H6PB 2WBJB 4UT7L 3DUUA 25C8L 1IE5A 1RJZB 1CIUA 4M6OH 5JPMB 4CDHA 4QY8A 1F3JA 3S4SB 5GIRB 5EUOB 1QKZH 3AXLB 1EBPA 5CJBA 4QHNB 1QBLH 4R4FH 4ZQKA 4LU5L 3MLWH 1HHKA 4R26H 4WW1A 4M7LL 1DL7H 2A6IB 3BWAA 1WCBA 1Y0LA 1UVQA 2PYED 5E1AA 3ZZ1A 1DUZA 1LK2A 1RHHA 5MERA 4KVCL 5HI3C 1XF4A 2AK4A 5F21B 4MQTB 3HR5B 1CLZL 3MRQB 5KSBB 3V6ZA 3RWIA 1BOGB 4CW1B 5CFHA 1IILE 3V4PH 1D5IL 1MFEH 1ZVSA 1JMXA 2YPLE 3X3GH 4TTGA 5HDOA 1KJ2A 3EZJB 5CMAB 1QRKA 4NQDE 4IRZL 1FVDB 3ARBD 4GRMB 3VFUA 2GITA 2R23A 1WIUA 3QDJD 3SE8L 1M05B 4LARL 1LP9A 2OYPA 4XP6H 5DRNB 3C6LD 3PHOA 4R0LC 3TBYB 3ZTJG 5IMOB 1AR1C 3PP4H 2XXMB 3L7FA 3C2AH 4RGOL 5DJZB 2Z31D 2LU4A 2PR4L 4KV5F 3QFJD 3S3JA 2X4NB 3OG6B 4OLVL 5BOZG 1HH9A 2N7BA 1G9MC 1N26A 3Q6GH 3D2UD 1I4FA 1PBYA 1JPST 2NCMA 4HWBL 1MJ7H 1F6AA 1QSZA 1EEYA 3QDMB 1S3KL 4L3EA 3ZSSA 2Y4SA 4M1GL 4WU7A 5D2LB 4ZAKA 4P57B 5KAQF 3SO5A 3I9GL 2WBJD 4NWTH 2FEEL 2Z93B 4UNUA 3S9DB 5IR1A 4GG6A 3OJMB 4LSSL 1M7XA 4DK6A 2V2XB 1F3DH 5CD5D 1T21A 3MV9B 2VLRE 3LD8C 1GZPA 5F89A 3LRHA 1U8LB 1CD1A 4HXBL 4MHHI 3PWUB 1R5WB 1U8NA 5EORH 3RWCA 1U8JA 2D7NA 1VFOA 2V2WA 3SKJL 1YEFL 3EGSB 3KPLA 2WUCL 1SY6H 1BM3H 1BJ8A 1KLUB 3SGDI 2OI9C 4XPGL 5D70H 3QJFB 3TCLA 4HWEH 1OSPL 1PY9A 4G9DB 4K3DH 1BQSA 4QHMA 1MUJA 1MCWM 2LABA 3ARVA 3KYKH 3MFFA 5EUKB 4LCCB 4FZEH 2IFGA 3QG6B 4U1NA 1KYOJ 2DTSA 3BKJL 5EZOH 4E41E 4YNYB 1JPFB 3GMPB 4YHYC 4NM4H 4R97B 1ZAGA 4M9PA 4R96B 4PRDB 1U8IA 4J3TA 2IPUG 1C12B 4P4KB 3RTQB 2MTPA 2ICWA 2BRRH 3L3GB 3QDMD 3T2NL 2A6KB 3DXAE 2Y5TB 4QRPE 1S7QA 2WQRA 1X5IA 1EHAA 3RGVB 3UZVB 4X5XB 4A6YA 4PRNA 2XA8L 1KBGL 4IRJC