1YMMD

Tcr/hla-dr2b/mbp-peptide complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
96
structure length
96
Chain Sequence
QALSIQEGENATMNCSYKTSINNLQWYRQNSGRGLVHLILIRSNEREKHSGRLRVTLDTSKKSSSLLITASRAADTASYFCATDTTSGTYKYIFGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Unconventional topology of self peptide-major histocompatibility complex binding by a human autoimmune T cell receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 12
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2005-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ymmD00
1IGJA 2FIKA 2JJWA 2X89A 3L3DB 5I0ZA 2DQIL 3TBWA 1HOCA 3UJJH 4X8XA 4W6YB 1U8KB 1JHTA 3BDYH 3TPUB 1LHZA 4J6RL 1FYHB 3IU4L 2GJJA 2AP2A 3L1OH 4XXCA 3TBSB 1EFXD 1CLOH 2X05A 4GS7B 3WDJA 5T3XL 3IRZA 5DA0B 3GHBL 2D7OA 5B38A 2KPNA 2UVEA 4NRZB 4ONFH 5DJ6B 1G9ML 2GSGB 2YMXL 4ZS7L 3HB3D 4S1RL 4ZUTA 3QHZL 4WHYH 4Z0XB 2CD0A 5L0QB 1JPTH 2UWEB 5IHLB 2D31A 4QOKB 3KPSD 4JREC 3F62A 4YHKH 1UJTA 1DQLL 1BMGA 1JGVH 1T1WB 1EMTH 1MVFA 3G6AB 4JFQB 3WIIH 4ENEC 3SE4C 5IEKA 2JF1A 1UH3A 2P8MB 3PQYD 4OLZH 1LO0H 5HDBF 5F9AC 3QFDB 2OL3A 1IEBB 2BDNH 4N8VG 4APQA 2DN7A 3SOBL 1K5NA 1PKQA 1EDQA 3QFJD 4JPWH 4PRPD 2G60L 4HJ0D 3G5YB 2DLFH 4WO4D 4JO2H 1CDBA 2PW2A 1TJHL 2A0LC 2ZUYA 2BSSB 1YMMA 3O2DL 4QXGH 2YD8A 5C0JA 5D8JL 3QNZB 5EO0A 3KPMA 3HLAA 3RX7A 1ND0B 5DS8A 5AZ2H 3IDXL 5DJ8B 4LQFH 4LVEA 3WHE0 4HS8L 4HC1L 5E03A 5J3HD 1FFOA 1HWHB 1QA9A 1HXMB 4YIQA 4N8VB 1NCUA 3LKSB 1TLKA 4UB0L 1DJSA 1WFTA 3ROLB 3KYOA 3S5LA 5DQ9A 1BJ1H 4LLWA 3ZSSA 2E7CA 3V7AE 3V5KB 4C56B 1RJLB 4IOFC 4DTGL 2BRRH 2ITCB 3WNPA 3CFBB 1HK6A 5H94A 2I5YH 3JTSB 4LHUG 1P6AB 3L7FB 3VFSA 1BFVL 1CK0L 2R0ZH 2HVJA 4GMSH 5E8EA 3T09A 4KAQL 4XCFH 1JGDB 3ARGB 5ISZD 4OJFL 2W65B 1KGCD 4N5ED 3QJFA 4OT1L 5GS0H 3EO0B 4FQ2H 4Q9RL 4JFOB 3R0NA 2NW2A 4E0RA 1KB5A 1LE9B 3D0LB 1K3IA 2GTZA 3KLDA 3L3IA 5I1JL 5F7EH 3GSVA 2VXSL 3GSXA 4ISVA 4JEGB 2XIDA 3FFCD 2A74B 2V2TB 2AI0H 1KTLB 5IUSA 4UIKH 5IW6A 1S7VA 1I9IH 4RFEB 4M5YL 1A9EB 4PJ5B 1WV7T 2ID5A 3QNXB 4KZEL 1MAML 1NCBH 3GSRA 4LHUB 5I1CL 4U05A 2PYEB 2YA1A 1NCWH 4NRYB 1P4IH 1R5WA 1OLZA 3AXLB 1PVHA 2QEJA 1XZ0A 3NCEB 4K3GA 3LS4L 3RVVD 3E2HC 4AEFA 4PJIB 5TPWL 3K7UA 5BS0E 1ZE3C 3FRPG 1AO7E 4HBQA 3LMJH 4KXZH 2ERJB 1YPZB 4NM4H 5JO5A 5CGYC 5KANG 3RY5A 4XC3L 1E4XI 1LD9B 3HC3L 5D7LA 4ZSOE 1BBJB 1YDPB 1DEEB 3CZFB 1DQML 5IJVB 1T22B 2XI9A 4OCRL 5H2BA 1J8HA 1AGDA 3SCMC 1MIMH 1W72B 4WY7L 1BP3B 3C5SB 4TUJA 1HNGA 4F15B 4YHOH 4H25A 4QNPF 2VSDA 4OLXL 3DI3B 2DM2A 3HR5B 4UBDC 5TQ0H 5F7LB 4I3SH 5CJ8A 1R5VA 2NXYC 1MRFH 5A3IC 5FGRA 4J3TA 3IDGA 4JDVA 3VXMA 1H3XA 5D71L 1YYMH 4NUJA 4HK3J 1C8PA 3KYKH 2QQKL 4CNIB 1Z9SA 3OMZA 1BQHA 2AJXL 5C0AB 3LEYL 2WWMD 4X98A 3AROA 1OGAB 4LLDA 4B7IA 2VO5A 2X44D 3ZO0A 1AGFB 3ALWA 4TVPH 4GQPH 3MRDA 3C6LC 3EOTL 1IQDB 3MLYL 4JRXE 3UYRH 3U2SA 1J1XL 3AGVA 1TVHB 4JZOA 2BNQD 3HE6A 4QT5B 5F1NA 3D85D 2W1NA 4M93B 1LNUA 4KJPD 1RD6A 1XCTB 1KYOJ 3FKUS 1CBVL 4RWYL 4HV8B 2W0KA 4N0FA 3KWWB 5AD0B 3CFEB 4MA7H 4KRPD 4RAVA 3LQAC 2Q3ZA 1LE5A 2XNAB 3K2MC 5E6IC 1FO0L 5IBTL 1CL7I 5FYJU 3NGBB 1JPFA 4X6CB 4M03A 2YD6A 5IVXB 1K85A 4U49A 4GRLA 5J6GB 1HE7A 4LLYA 3N9GL 4M7LH 3KPRB 2C1OB 2WIMA 2ZOLB 4XPAH 1JHLH 2X40A 4HWBL 3PL6D 4YDJA 1A7RL 1SBBA 3GBLA 4R4ND 4I2XE 4S2SA 3RWEA 3EOBB 4HUMB 1DQJB 2PW1A 4JQVC 4FG6D 4MQXD 1XIWB 3KPLA 5EORL 2XQBH 4PJDB 4ZO8A 2HKFL 3QEQA 3E6HA 3EYSH 5GGRA 3OKOB 4F37F 5T5FH 3ZKQD 3VXPA 2G75A 4W81A 2ICEA 3MLSL 4ZQKA 3B9KD 1HQ4A 4HUUB 3SKMA 2WBJB 1IAMA 2ITDB 1ZHKA 4IEFB 5T1KD 5GGSY 3GMPB 2X4OA 4HKBA 3MRKB 2EE3A 4AYFA 4CVUA 1OGTB 5EOQL 1NGYA 2VR5A 3U0TA 5I73B 4KJYA 3BQUD 5ITFA 2PR4H 3QQ4A 4TQEL 4HWZB 4YDLB 4KFZC 4DVBB 4LVOB 4KK6C 3HI5H 1Z5LA 4JY5L 4V1DB 4OZIB 1UENA 4TRPH 3QDHA 1MEXL 4G6JH 3EDKA 1CLYL 3FQWB 1H5BB 15C8L 3VH8A 5HY9B 3IU3B 3RWHA 1U58A 5IVNA 3C8HA 3QULB 3JWOL 3MR9B 5GGSB 3P30H 4LFHD 4UT7H 1J87A 3P0VL 4JG1L 2VKXA 4YH6A 4FXGA 4YHNA 1DBBH 3TO2B 2ZG1A 3ZDXE 5JPMA 3MYZA 1A7NH 5D6CB 4G6ML 4XHQA 2YPKB 4YZFF 4G42B 1ZT1B 3MLZL 3N1MC 5T33L 4U1JB 2XN9A 3SHSA 3G6JF 1SY6H 2CLVA 2HWZH 1FVDA 4L3CA 3C2AL 3OXRA 1CE6B 5AWNH 2FEDD 3O3EB 1Q9OB 2N7AA 5HHMB 1IAIM 3B5TA 1A6WL 4FA8A 1JJUA 3I9GH 2AXJA 4JKMA 2V2XB 5DLML 1YEGL 1WEJH 3D5OF 5DD1L 4DKFH 2AEIT 1FE8H 3UDWC 1LEGB 3LIZL 2AK1L 2HRPH 2BY0A 2BVQA 5GJTH 5JHDB 1C08B 4JPVL 3IVKB 4Y16B 5J1TC 1G7IB 1MJJA 1CYGA 3PWLA 1LO5B 4G9DB 1LILA 4M6OH 5FYKD 1ULVA 1PY9A 3BT2H 5CHNA 1JV5B 5D1XD 2R29L 1AKJB 4DN3L 3B8SA 2J3SA 1KCVL 3M45A 4OAWA 1UB5A 4QXUL 3H3PL 5LGJB 4NQEE 4IDJH 1OQXA 4Q9QH 3VA2C 4HWEL 2J12B 4PLKC 1P7KB 1YNTB 4L3ED 1EO8L 3OB0K 1UQSA 3F8UB 2NY2C 1IC1A 3VFVB 4F58H 4KI5C 5EWIL 2IG2H 2A9NH 4EIZC 4GKNB 1XGRA 1FYTB 3NCMA 1ES0B 1EFXA 5T3ZH 4UDUB 4YFDB 1AI1H 4CVWA 5D7SL 4WFHE 5ACLA 1AE6L 4ONHB 4WV1C 5JPNA 4HX1B 3KXFD 3U6RB 1AXTH 4GOSA 3W82A 5JW5A 2BERA 3BHBA 3KPTA 1S3KH 4QTHB 2DQFB 5J6HB 3KPSA 4LSRL 2YD3A 5FHBL 3HPJB 3MGOA 4I0PD 3R1GL 1JWSA 5ID0A 4OKVB 3VFWB 2DKMA 3RP1A 5FHAL 4X7CC 4NO3B 3PQYA 1QPPA 4HIJB 2W9DL 2OL3L 4NBXB 5CBEA 5LCVH 1UYWH 4FQXC 4Q2ZB 3QFJA 4PRPA 8CGTA 1A7QL 1JP5A 1RZFH 3ILPA 4WO4A 1WIUA 1C7TA 5D1QB 1FN4A 3QXVA 3QH3A 3QQ3A 1X4ZA 1E6JH 5I1KH 1P7QD 5IGXL 5BZWB 1X5YA 12E8H 4LLAA 3QRFM 3BPOB 3QCTH 1A2YA 3V5HB 1EBAA 5FDWA 2VDRH 3QG7H 5E9DE 2FX7H 3QIBB 4R4FH 2I25N 1IC4L 5CINL 2M2DA 4OF5A 4ZPVB 2BVUA 1I8KB 3I2CH 4BYHA 4Q7DA 5KSAB 3GIVB 1KIPB 1TZHA 2VZUA 4NNYA 3DHJA 3MV8E 5F7DA 4NHUB 1CLCA 2ZWLT 3WXVH 4BH8A 4GW4A 4J12A 1T04B 5EB9A 1BD2E 4AMKH 4PRNB 4EXKA 4PJEB 4OLYL 4HKXA 1F42A 1GZPA 5EU6B 5JIPA 2P24A 4NC1E 2B7DT 4M61B 1EAPA 3J7HA 4HG4J 4QRRE 5DD5L 4DZBA 5T1LB 1CTOA 1H9VA 3RIAK 3RU8L 2EC9U 3MGTB 2X4UB 2C7UB 5FO7A 5J13C 5E2UL 4X6BA 5ISZA 3OJMB 3DX9B 3FB7A 5GGTL 2P48B 3HZVB 2HLAB 3DUSA 1U8IB 2I9TA 3ZYZA 5KSVB 4GW5A 3FO9B 3ISWA 3UTQB 3UTSE 3FFCA 4KKNA 1K8IB 4ZTOH 4CMHC 4QHMB 5DT1H 3IJSA 1CU4H 5GGUB 4KMLB 2BNRE 5KOMC 1DANU 2MOVA 2IBZY 1PFCA 1JPTL 1C1EL 1HEZA 1KLFA 3GFUA 1AFVL 3HG1B 4PYGA 2WP3T 3KS0J 4YHKL 1HSAA 3CSPA 2GHWB 3MBEB 5I76B 4J2XA 2UUDK 1FL5B 3D18A 5IKCB 3WIIL 5IOPB 2IH3A 5HHNA 1QBLH 4RIRB 3SDCB 1U2CA 1LO0L 2OX5A 1IM3B 4BQBA 4QHNA 5FUOL 1ZTXH 3IJHA 3E3QC 3ZE0F 3DRQB 4EIGB 3ZT6A 5HYJB 2H8PA 1UXWB 3UAJC 4JO2L 1F45A 2QADD 5CP7A 1L6ZA 4X0KB 3R8BB 2KL6A 3MC0A 3WO3B 1A7OH 4U1HA 1TTUA 1VADA 3UTTB 2QL1A 3DX7B 4HKZA 5AZ2L 3G5XA 1ZLVK 4PRIB 3LKNB 1FRGH 1IGYB 5JOFB 2EZ0C 1UVQB 2E7LC 2C1PB 2Y36H 4LQFL 4JCLA 4X7TB 3MRCA 4L8BA 5E8NB 1NAMA 3RWCA 5HHOB 1MF2L 1NCAH 4J4PC 5KTEL 1UZ6E 1Q1JL 3QIWD 4GAYA 4K3JH 5IBLD 1WF5A 2FJGB 4L4TD 3VWJD 2D03H 4YDVA 2IBGA 1S7SA 2FX8L 5BQ7B 3VG9B 3PP4H 1G7LB 4PY8J 1YQ2A 3ALPA 1DP0A 2I5YL 3ARVA 1FFPA 3H9HA 3VGAC 2BNQA 3D85A 3O6KL 3HAEA 3R06A 3CNKA 2R0ZL 3DLQR 4XI5C 3P4NA 3HKFA 1MFBH 2RFXB 4XCFL 3ZYOA 2MJWA 1W0WA 3CLEH 2EDXA 1J1PH 2A77H 2KQNA 1RZ7H 4YFLF 2AEPL 5ALBL 3B3IA 4ZUVA 3KG5A 4C83B 2F54B 4XNMA 1TPXC 2AI0L 3FQTA 3FT4B 1UJ3A 3PV7A 2GKIA 3D39B 4DJMA 4F7CB 4QRPB 3BIKA 2OR7A 1IGCL 5FCUL 2XZQL 5DD6A 2WZPD 2ADJA 3PL6A 1MCBA 2ZUXA 5JW3L 5FYKH 3ZKMD 1BZ9A 2OTWB 5K93A 1Z9OA 1ORSA 1KLGB 3OB8A 3QDMB 4X8JA 3U36A 3BMVA 3IJYA 3BMWA 1E4JA 4M7JH 1N7MH 4G8FB 4ELMB 2CKBH 1RI8A 4FQHB 2C26A 4NJAH 4OV5A 4A6YH 1PZ5A 1IC5H 1G0YR 1QBBA 3B9KA 1MIML 4U1KB 4BSWB 4L8DA 3T65A 5K9QG 2BVPB 4LARH 5T1KA 5CUSH 5EIVA 5TQ0L 4G8EB 4YQXL 4I3SL 3BQUA 1G6RB 1MRFL 5CEXB 1QEWB 1J0JA 4PJXB 5C08D 4IRJD 3QR2A 4KJQC 3TNNB 2VH5L 4JPKH 3VWKC 5H35A 1J1OL 1SBSH 4MD5B 2Y7QA 3DX6B 3C5ZD 2EYRA 2ICWI 3MRPA 4LVNB 5DFWH 3ECBB 4JFED 3PWVA 2IMNA 5SWZB 3ROOB 1BIHA 3KR3H 4G43B 4QWWC 3UYRL 5LAXB 1T7ZA 2VLJD 4U0RC 1XR9A 3GUTB 1DE4A 2I07A 3FZUC 1MHEA 2D0GA 4E41B 1HYRC 5GS3A 5BCAA 3KPPB 5KVMC 3OV6A 2ED7A 1EUUA 2AJZB 4G6FB 4HIIA 3QO1A 4A2LA 1BEYH 4EDXA 4MAYD 5EZOH 3OJ2C 4X4XB 2E6QA 2BOCA 5C07B 5CS7A 3O11B 4K9EC 4LCCA 4Y4FB 4PS4H 3DBXA 3MV9E 2A6IA 1U95A 1NC4B 5F1OB 3L5HA 3Q6FA 1JN6A 1AR2A 1ZVYA 2FEEL 3W81A 3VI3F 1I7ZB 4XPAL 1JHLL 1J05A 4NWTH 2SEBB 4RAUA 1KC5L 5EO9A 2PO6D 1CICD 3MYJA 5D1XA 5ETUB 1E4KC 2Z93B 3NPZB 2RQ8A 1NGQH 4JVWA 1IC7H 3TBVB 3QIUC 2Z31C 1NFIB 5IROC 5FUCE 4U1GB 3EYSL 3LPWA 3QXAB 3GI8L 2CGRH 3LHPL 1FBIH 4XPFL 1Q9WA 2CKBA 5HYSG 2DWEA 4C4KO 1KELL 3HI6H 4L3EA 2R1WA 3FB5A 1A3LH 2EE9A 4QGYA 4A6YA 1G84A 4PJHB 5I8EB 2D7MA 1A6VL 1D5MB 2J1KA 2EDDA 2NY0D 4FQCH 3O3DB 2XTJB 1MHHA 4HMEA 2YD4A 4X7EC 4HH9B 5D9SA 4DKAA 1QLFB 3L3JA 4X6FB 3QNYA 5FGBA 2CXGA 3RDTB 4P23B 4CADA 3EFFA 3TESA 1NUNB 3KXFA 1RZ8A 3HI5L 2O61A 4X4ME 3VFUB 1SYSA 4HHAB 4TRPL 5HYQA 4RFOL 5HYSB 4WW2F 4W6WB 1JGEB 1NAKH 2OZ4H 3G9AB 4LSVL 4GG6E 4LK4A 4EI6A 4PG9A 4I0PA 4YHIB 3L6FA 1XCQB 1F2XK 3U9UA 3QQ9C 1A0QH 5BVJA 4JG0H 4UT7L 1KN2L 1OTTC 3O41A 5FYLE 4ZFGH 1HH9B 1ETZA 1DBBL 3WS6C 5DDHA 5TE7H 1ACZA 4M43H 4ZFFB 1A7NL 2ESVE 4W4NA 5D2NC 5IMOB 5E7FA 2AJSL 3OXSB 3IAPA 3GSNA 5DJ0B 4MCZA 1SY6L 1P7QA 4HXAH 5HYFA 2HWZL 3FT3A 1Q9KB 5AWNL 1HI6B 3Q6GH 3QHTC 4HUNB 2OK0L 2VOTA 1F3DJ 5AG9A 2L7UA 3QEHB 3D48R 2GJ6B 3I9GL 1RK0B 1ZVSA 3S37L 5EC2A 1IMHC 2DIJA 4DKFL 1FE8L 4PB0H 4LSSH 2NY3D 1FH5L 4DFIA 1B6UA 1JVKA 4FFWD 4G3YH 3IGAB 4KZDH 5GJTL 1WITA 1P2CA 1H8SA 3FQXB 3MJ8A 1KBGL 1AD0B 3KPOA 1P1ZB 4M6OL 4RAHA 1RUAH 4X6DB 3PWUA 3H9SD 4DOHB 2BRQA 1FNGB 4KWUA 5F70A 4BUGA 4OGYH 1FZKB 5DEFA 4OM1L 4Q9QL 3T2NL 3VFPA 1Q94A 3ARBB 4ODUB 3EJZD 1QP1A 4U31A 4XMLH 4RFNB 1IRAY 4HWUA 5DFTA 4ELKA 5TFSH 5GRVK 5F21B 4F58L 1NDMB 3QUXC 3DJ9A 3D69B 3S4SA 1U0QA 4ODXA 1OARH 3EYVB 5BRZE 4RRPA 3TFKC 2ARJB 5T3ZL 4NKQB 1F6LL 3NFNB 5IK3B 3HZKB 3BH8B 3TWCL 4C58B 4RA3A 4HJGA 1B0GA 4EOWH 5IF0B 3RNQA 1BWWA 5IFHL 4IOIB 2B0SH 1AXTL 5JW4R 2E9IA 3HRZA 4XMKH 1Y0LB 5IB4A 3CC5B 1S3KL 3MPCA 4ZSOA 2JIXB 2YBRA 1NLBH 2V7NB 4P5MA 2GJZB 5L2KE 2B5IB 2EEAA 4ACPA 4BH7B 3O2WH 4JZJB 4ZAKD 5IEHB 4LEOA 1QFWI 2AEQH 5DJDA 2DQTL 3VXRE 1SJEA 1SJVA 5FA4A 4YWGH 1OD7A 5DF0A 3MNVA 3TZVB 1BJ8A 2VDPH 1RFDH 1CVRA 4PJ7B 1MLCA 3PGCB 5IJKA 4R4BA 2J6EA 1RZJH 5J1AA 1E6JL 5I1KL 1WGOA 3L9RB 3C6SB 3JZ7A 12E8L 3HCVB 5I6XB 3QCTL 1FQ9C 4UDTA 3MRNA 5CSZB 2F8XC 7FABH 3MUJA 4R4FL 5H8DA 1KTDB 2HTKD 4XP5L 1NPUA 3NACL 5GHWH 5F89B 1BOYA 4Y1AB 1GAFH 4LSUH 3O3BA 2OBGA 4O2EA 5I8OH 1SJHB 2WIIA 35C8H 3QIWA 4G80B 3DMMD 3L95A 3X17A 2DTSA 5TF1H 1K4DB 3GSUB 4L4TA 2B1AH 3VWJA 4ZXBD 1JI2A 5I30H 1I8IA 1FZOA 2AXHA 3HZMA 4XTRC 3EFDH 3MODH 3AM8C 3QI9B 3PHQB 3X3GL 5ESQB 5ABDE 1FNSH 1S78C 1I85C 5TDOB 3RFZC 1A6ZB 3MBXH 1AQDB 5LQBL 3ARDD 1N3NB 1OW0A 1XH3A 2PTTA 4KKCD 4ZOAA 1F13A 4JO4H 3EIFA 2GUOB 1UH4A 2VDQL 1MRCL 3CSBA 1NJ9B 3CZJA 5EO1B 5C9KA 4MSWB 3OR6B 1YJDH 2FZ3B 4GO6B 2AK4B 4ZTOL 3OBAA 5EC1B 4GMTH 3WS3B 2Q86A 4YHPB 3PABB 3QDJE 4JFFE 1RMFH 4AENB 1TJGH 2PUQT 4JN1L 2W0LA 5JA9A 4Q9CA 4JKKA 1G9NC 1MJ7H 3P4MB 5ACZB 3MLRH 1H8OA 5F3HA 4RGMC 3VRLF 4D94A 2FLBT 4QYOB 1EJOH 4YEFA 1HKFA 2IFFL 3S8WA 5DC9B 2JLLA 5DC0A 4QKXB 2DQCL 4XWGL 5I1HH 4OZ4A 1DEDA 1ZTXL 4IBLT 5M7QA 4Y5YA 1NL0H 5C8JB 2P5WE 3PWNB 3QUYB 1BQLH 2VABB 3OKKB 5EDXA 5CKAA 1VEOA 3RVUC 2H3NA 1KPVB 3REVB 3V4PL 1RURH 5GIRA 3EOAB 3BRFA 2QQNH 2QR0B 1NEZG 4HIEB 3GM0A 2CDFA 3HN3A 4JAMB 4XB8A 1NMAH 1A7OL 4NQXB 5IQ9A 5MEPB 1B4JL 1TCRB 2LTQB 1IGIH 4XH2A 3T0WA 5L8KB 5C08A 4IRJA 4OTXH 3VXTB 2X4QA 1H15A 1KJMB 2ZOKB 3T4YB 4NWUH 5INCA 4OD1H 1PEWA 3TVMB 1FO0B 3C5ZA 3WV0A 1V5JA 3PWJA 1B88A 3GKWH 1AHWC 5I0DA 4WWKB 4K3JL 4JFEA 2Z9TA 2PYFA 1R0AL 5F9OH 1FDLL 2P5EB 1OL0A 2VIRA 2VXQH 2VLJA 1NEZB 3BSZH 2O5ZH 2WQRA 5DVLA 4BZ2L 1EVTC 4KROB 2NNAA 2CLRA 4PTUA 1MFBL 4OSUH 1B2WH 4AEEA 1WBXB 4JHAH 3MV9D 4L5FH 5IBUG 4HPOH 4P57A 3SGEH 3JV4B 1CDUA 4RZCB 3TH2T 2WW8A 4K2UL 1BQSA 4WRLA 2VN7A 1I3RA 4WI8A 4QOKD 4YHML 4K3EH 5ANMA 4TUOB 4MAYA 3RWGA 2EKSA 2X4SB 4IOSD 4OZGE 4YO0B 4MNHA 4IDLA 1G7PB 4XP1L 3O4LB 4RSVA 5C0FB 5C9JA 3PJSA 4U1LB 1XF4B 4AIZB 4YXHH 4FNLH 1T4KA 2XTLA 1F6FB 3VCLB 2WINB 4GUPB 1K2DA 4LSQL 1IQWH 6FABL 2PO6A 4PV9B 4RGNC 2DD8H 4U6TA 1CICA 5IBUB 2HAZA 4I18A 4FTVB 3VMPA 1U93A 1TDQA 1SMAA 3RWFB 4K8RD 3JWNC 3MJGX 5IFAH 25C8L 3KYNA 4NPYB 3HNSH 3RPKA 3WFEH 4LOUD 5DVOA 4PJGB 4LVNC 4NSKA 1TETH 2DB8A 1IC5L 1UWGH 1GPOL 1FG2A 5HGBB 4KGLA 4LARL 2FR4A 5CUSL 3W0WE 3GSQA 3KJ6H 5KJRH 5J12B 2MKLC 1NGZA 5GRUH 1S7TA 4C56D 3IAQA 4PJ8C 2YD9A 3BWAB 5DJXA 4AL8L 4KRLB 1HHIB 5C86A 5KVGH 3CDFA 4JPKL 3WBDA 2AS5M 1SYVA 2P47B 2E7MA 4NKIL 1IE5A 2G9HA 2FJFB 1MCDA 3SDXF 3ARGD 2DQUH 1QG3A 3VW3L 3F7VB 1WWCA 1GGCH 1YEFH 2JJSA 9CGTA 4K7PL 4XWOD 3EO1A 2MHAB 1MPAH 5DUBA 1F3JB 3O3AB 4N5UA 3K46A 4KK9C 4HGWB 4NNXB 1I1AC 5FOBA 4WUKL 3P9LA 4AG4L 4Y5VA 5C0ND 4PJ5D 1G7QB 3ARFC 4LHUD 1D5IH 3EGSB 3BPCB 5C0RL 4ZFOL 1UZ8A 1F5WA 1ZHLA 5JDJA 1JK8B 3H9YA 3TCXA 4ETQB 3LS5H 4DQOL 1IGJB 2O5YL 4LCIL 5GS1C 1SEBA 1G7HB 4I0CC 1ZLWK 4DGYH 5E94A 1I7RA 1MCLA 1HOCB 5AAWA 1WIPA 2J8UB 1GGIL 1JHTB 1K9TA 2BMKA 3QWRD 4M8QA 1BM3L 5K59F 1CR9L 2HN7B 4WDIB 2J8HA 2AJYH 1RHHA 3HZYA 4I9WD 4XCNB 2Q7NA 2ZUTA 3I3BA 3SKOA 4Q6IA 4HDIA 3H9SA 3IFPA 2DICA 4ZUTB 3GJFK 3CLFH 1NGQL 1R3LA 1VFUA 5KVFL 3BVNA 5GS2D 1ORQB 2CGRL 1FBIL 1T0PB 1XGQA 3QUZD 3FO0H 3OAYH 4JR9L 4YHLH 3SE3C 2CH8A 5A2LH 5C0AD 1TTGA 4G8GE 4P4KC 1OGAD 5KSBE 2OL3B 5IB2A 2XWBA 2DQHH 3LCYA 2HJFB 4UT9L 3RUGB 4XCEA 4PG2C 2NXZB 4ZUUA 1S7XB 5C2BH 3SQOH 1YMMB 5E00A 5EN2A 3EHBD 5L2KD 2CRZA 1G7MA 3KPMB 3H0TB 3MLXH 5TE4H 5JXED 5J1SC 2OM5A 5F9JA 2DJUA 2UWEF 5IT2L 4HUVB 4I0KA 2OZ4L 1C5DB 1CZ8H 4H1LH 4R0LA 3K3QA 1T03H 1ZAGA 4FXKB 1FFOB 4XT1C 2G5BA 3MRRA 1QA9B 1A0QL 4YIQB 1LP9A 4ZAKA 2H32A 4AM0B 5IIEA 3EYOB 3KYOB 5TE7L 4Z78A 2NY4B 3S5LB 5EBLA 4KQ4H 3MNWB 1EGJH 2VAJA 1GJIA 4HQQL 5E08H 2C3WA 2OJZH 3NMEA 3FB6A 3FQNA 3O9WD 2Q8AH 2J4WH 1F8TH 4WHYG 4UILH 2Y23A 3Q6GL 1ZXQA 4FHBD 1T1XA 2HT3D 4KGJA 5FECA 1XIWD 4FQLH 2DM3A 1MH5B 3OQ3B 3BP7B 2OCFD 4R2GC 3AFLA 3SE8L 5L2JA 2GTZB 4WENB 4TUKL 1CD1B 4ISVB 5IW1A 1AGEB 5EZJA 1P4BH 2EXYC 3LRSA 4KZDL 3DMMA 4OFDA 3PNWA 4LSPL 4X6EA 3O6FD 5IW6B 2HLFD 5GGQH 2AXGB 4NZUH 1GOGA 2FL5A 2WBJD 3QJHB 4ZXBA 1RUAL 3OTTA 4PP2A 3MRLA 1J0IA 1Y18A 4GG6F 3K2UH 1R5WB 4FQIH 2B39A 3IDMA 4S0TD 3UTZA 4JB9H 3V7MA 2J7LA 2H26A 4WI5A 5EU5B 3ARDA 2EDFA 4G7VL 4GLRI 2QV2A 3BP6A 4JFFD 3SDXA 3U83A 2X4RA 3TF7C 5JO5B 3VFNA 4O02H 1JWMB 3U4BL 5D7LB 3WXWL 2Y9RT 1DDHB 4Z76A 4LCWB 5D1ZB 1WIOA 3GB7A 2IADA 4TUJB 3TZVC 1KG0A 2EDRA 1J5OL 1GIGH 4H25B 1WVZA 4EOWL 1VKXB 5J4MA 5DZLA 3PG2A 5E7BA 3X11B 1CXEA 4LPCA 1FPTL 3VXMB 1QQDA 2P5WD 1NLBL 4NUJB 5GGVL 2FJHB 2XXMB 1DBJH 3DV4A 2VITB 2JJVA 3RWIA 3O2WL 4LLDB 1HZHH 2VL5A 3FTGB 2HMID 4LDLB 5L6YH 4UQ3B 2F9BT 2AEQL 4N8CH 4H8WL 3T0XA 1PJ9A 3DNKA 3DTXB 4QRQB 3V52H 1URLA 3UO1H 4KKLC 4PGBA 5IESL 4ESKA 1EGJA 4HCRH 3WNKA 3U2SB 1RFDL 4PRDB 4OD2B 4NQDE 5DJ2A 3AU1A 1I1YB 1JTOA 5JHDD 4Y16D 4OI9A 3HE6B 4D3CH 1LNUB 2FGWH 3SGKA 4D8PB 1NBYB 5ESVA 5D70H 4G7YL 7FABL 1I8LA 3ZSTA 5H37G 4LIQE 4CU8A 5F8QC 3VXSE 3U48A 2VLMD 3QA3A 1GAFL 1UEYA 1VACA 5KZCB 2MCPL 3LZFH 1IAOA 3QCUH 1EO5A 5I8OL 3K81A 4PJCF 35C8L 5EUOE 2EICA 3Q3GB 4RISH 2EDNA 4MVBC 5TF1L 1U8KA 4KHXH 3TPUA 2B1AL 3U0WL 5FO9B 1A5FH 1FYTD 5I30L 3TBSA 4N68A 3MODL 1YNLL 4GRWB 1FC2D 1VEPA 4MS8D 2ZPKH 4WU7B 1WCQA 2CJUL 4YDJB 4OD3H 1RU9H 1UM4L 3N85H 2UZXB 4LLUA 3Q48A 4S2SB 4NRZA 1YN7B 3WJJC 2GSGA 5LGHH 3MV9A 2AGJL 4Z0XA 1KCLA 4TOYH 2UWEA 4WFFD 4Y0GA 3QEQB 3A6CH 1U3HD 4NBYB 4QOKA 3B2VH 1LQSR 2MFNA 1IAIH 1WC7A 4HK0B 4ONOA 4C57C 1KLUA 2N1KA 1ZMYA 3BKCL 3TV3H 1YJDL 2G75B 3BYTA 1CTNA 2WUBL 2Q7YA 3G6AA 4JFQA 1WT5C 4X6CF 1ZHKB 5IVXF 4L8SB 1IEBA 1H8NA 5D2LF 4LPUA 4IMKC 3U0TB 2A1WL 2DTMH 3UZQA 3G5YA 1KULA 1W72H 3E6FB 4JN2B 1MJ7L 5E2TH 4B50A 5D1QD 4PUBL 3FMGH 1AQKL 4X99A 1ADQL 3OGCA 1Z5LB 3QNZA 4U7MA 3VFRA 3MO1B 4YXKH 3TN0B 4FFZH 1BVKB 5GS2H 4CJ0A 4K55A 1HKLL 2CUHA 5I1HL 3THMH 3NN8B 5DJ8A 3QIBD 2FX9L 1OSZB 4JM4H 3WL9A 3C9NA 1BQLL 4X9BA 5KSAD 4OCWH 3KAAA 4HCRA 4N8VA 1MFAL 3OJDB 4YHNB 3LKSA 1RURL 1AIFB 3EYUL 4X4ZA 4F9LC 4XBGB 2QQNL 1RIUH 2Y06H 3BGFB 4FABL 5ADPL 5CGMA 5HVHC 4J23A 5JPMB 2F74B 2ZUVA 4UINH 4JANA 3V5KA 1C5BH 4C56A 1RJLA 4L9LC 1IGIL 4GG6A 3B2UD 3CFBA 2BVEA 3O8XB 2XN9B 5A2JH 5GRXG 2XWJB 3VU2A 5J06A 2IAMC 4NWUL 3L7FA 2NY5C 3RBSA 5T1LD 4OD1L 3AS2A 5IHUH 4GG8A 1N5AB 1JGDA 3ARGA 3HPLB 4Z0BH 5C3LD 3EO0A 4JFOA 4G9FB 1UCBH 5KW9L 2FNBA 2BVQB 1MCSA 2P45B 3D1MC 2A74A 2V2TA 1S5IL 4BQ8A 2D7TH 1KTLA 1BX2B 1HHHA 1ZEAL 2A2QT 4RFEA 4PJ5A 3LH2H 2NR6C 2IWGA 4XAWH 4LHUA 1WAAE 1HYSC 2FH6A 1T6VN 4JHAL 3UZEA 4NRYA 1UB5B 4NZJA 3AXLA 4HPOL 2VAAA 1T20B 3BUYA 4BK4A 1MCWW 2OMNA 2APBA 3HG1D 3RVXD 3ZKND 3ULVL 4XGZB 4XHJC 1O0VA 4PJIA 3MBED 3QEUB 5EZLB 3RY4A 1Q9LB 3WIHH 3DIFA 1F00I 2OSLB 4KTYA 1WFOA 3SDCD 3QWRA 4LL9A 2NY6C 1LD9A 1QFUH 1JZ5A 3L3GA 4MZ3A 1YDPA 1DEEA 1JRHI 3CZFA 1T22A 4Z7WB 2B4CH 1EJ6A 2DMCA 1W72A 3C5SA 3CU1A 2DD8L 4NN5C 5JUEH 1QSFE 1N6UA 1GHFL 3ARXA 2B2XH 2HFFB 4LEXL 2HTLD 3VXQA 1FSKB 4G8GD 4PBWD 1I4FB 2IEPA 3ULSB 5D72H 1CXKA 3UTTD 2K3TA 3RI5K 4OCXL 1T1ZA 4PRID 2NYYD 1YC7A 1XGTB 3QUZA 4OIIH 2PCPB 3FRPA 3AC0A 4MJIE 1S7UB 4POZD 3F12B 1TETL 6CGTA 1X5HA 5C0AA 2YK1H 4MNGE 1UWGL 3OG6B 5HHOD 1OGAA 4PJCA 3AUVA 3KJ6L 3PDDA 5FM5O 4PRPB 1TZIB 3CFCL 4MJ2A 3D3VE 1IQDA 3ILPB 5HHQB 3O3UN 3FAXA 1FN4B 5F7MC 1HXYB 3KDMB 3QQ3B 3IDYB 5KVGL 1QBAA 3JWDH 4MNQB 5L2KA 3RL1A 2DQGL 4QT5A 1N6QL 1A2YB 1A7PH 1DZBA 3U9PH 3T0EC 5JXEA 2XKSA 5ITBH 4HV8A 1U8MA 2DQUL 3KWWA 4EI5B 5AD0A 1ZSDA 2OJEA 3G6DH 3WO4C 1GGCL 2FHCA 4KK8D 4NNYB 1IM9B 5F7DB 2CRIA 2QLVB 4WTWA 5E0QA 4BH8B 4GW4B 1S9YB 4XXCC 4KI5E 5BV7H 4D9RD 1YY9C 3EJYC 3VJ6B 4LKXB 4X6CA 3OAZH 5IVXA 2W0FB 3D39D 5FB8A 3ULUD 5DJAA 3C09C 1ZGLM 3FOLB 4GJTB 5D2LA 5IWLA 1RUPH 3SDYH 2P24B 3GEWB 5E4EB 1D5IL 2ZNWA 1OAKH 1U8PA 2CPCA 1EAPB 4QO1A 1H3TA 4LVHC 3O9WA 2ZOLA 3MROA 1KXTB 5TGBB 5C7XH 4HUXA 5CIPH 2OQJB 1DQJA 2CK2A 1YMHA 3QDMD 5E5UB 4DGYL 1XIWA 5IG7A 2IQ9L 2R0KH 1AH1A 3VA6A 3ZTNL 2Q6WA 4HF5H 3IXAB 4X83A 2VDLL 4PJDA 5DK2B 3BXNB 3OKOA 4XBPB 5C92A 5K9OB 5MENB 2AJYL 3NZHH 2A0LD 4APQC 5I1IH 1BGXL 5FDYA 2X9YA 3T77A 3O6FA 5DVMA 3VRJA 4HUUA 5DFVC 2WBJA 2ITDA 1YN6B 2W92A 1A1NA 3RIFF 3MRKA 4XMPH 3ARZA 2RIKA 1OGTA 2R0WL 4UIMB 5DRXB 3UEZA 1UT9A 1L7IL 2DLEA 5I8KH 4N90E 3G6JB 1CXLA 1MJUH 4JM2F 4UT6H 3M8OH 3INUH 3FO0L 3KJ4B 4HWZA 4DVBA 4YHLL 3BPLB 4JFFA 4DEPB 5F1SA 5HY9A 1H5BA 1QPXA 3IU3A 3IJHB 5JZ7C 4M6ML 3QULA 2EEBA 4CAGA 3MR9A 4I13B 2H8PB 4G6AD 5SWZD 3LQZA 3H42H 4J3WA 5C2BL 2NX5E 2AJ3B 5CP7B 3SQOL 4YBLB 4U33A 3S35X 3TO2A 2DYPD 4F9PA 1CFVH 3ELAT 3S3JA 3SGDI 5IW3A 5D6CA 1QSED 4E41D 2R9HC 3BFOA 2YPKA 1S5HB 3H7LA 3CX5J 4U1JA 2NZ9D 1Q0YH 2P5WA 1A3QA 1CZ8L 1T03L 3MRCB 5HDOA 4G6FD 1SVCP 1CE6A 2PTUA 3O3EA 5ACMA 1Q9OA 3RWCB 5I1GL 4NQDD 2R69L 4KV5E 1FHGA 2CQVA 3HC4H 3F7YB 4XP4H 3VGBA 5T1DH 4PLJC 5HHXH 2DQJH 2GAZB 4GAYB 1D5XB 5C07D 5FAAA 2V2XA 4Y4FD 2RHEA 3C60C 1CDGA 1RHFA 4KQ4L 1NC4D 4YDVB 4F8TA 1C16A 1LEGA 2ZSVB 4QRTA 4U1NB 2F8OA 5JHDA 1C08A 5IM7A 5GZNC 4Y16A 2OJZL 3IVKA 1G7IA 3H9HB 4PJ9B 2BNQB 1LO5A 3R06B 2J4WL 4G9DA 4R26H 1RUML 3ME0A 5FXCH 3BZFB 2Q8AL 3U1SH 5M94B 2MTPA 5KSBF 1PLGH 5IVZB 5IVOA 1W0WB 2Q87A 4FQLL 5A16B 5LGJA 1JZ7A 5AZEL 1GC1L 3B3IB 4NDMB 1P7KA 2DM4A 1JIBA 1IGMH 1P4BL 5C0BE 4B7LA 3CFKB 4UOW0 3VFVA 1UJ3B 5D7IE 5GGQL 3ULVC 3G08B 4R3SB 4U7KA 1YECL 1DSFH 3E3QE 1ZKAA 3TO4B 4GKNA 1FYTA 4P2YA 1ES0A 2VNCA 1NKRA 3S88H 5I19H 4UDUA 3WFCH 2ZG2A 4FQIL 3PL6B 1BZ9B 3GHEH 4MHHG 2PNDA 3RDTD 2VLKE 5HI3C 1CGSH 4OCSL 4ONHA 4HX1A 3U6RA 4KUZH 4HEPG 3SKUD 1I9JH 2KDGA 4QTHA 1U3HA 4X9GA 4J8RA 5J6HA 1MCHA 3HPJA 3JSSA 4YC2C 4PGEA 2JKXA 4WGWB 4OV5B 4NO3A 4POUB 4L8DB 3T65B 1QO3B 4HIJA 1M05A 4N0UE 3G04B 2NTSP 1U8LA 4OZFG 4NN7C 1JF1A 2X9XA 3L3KB 1A9BB 4Q2ZA 3SJVB 3V2AR 3FJTA 3HE6C 3WSQH 1V7NH 4JGMA 5C6TH 4O5LH 5D1QA 2VXVH 1JZ4A 5E6ID 4RX4D 4DN4H 5BZWA 3V6OA 3GMRA 5GS0C 1B90A 1DBJL 1KIRA 1RIHH 3N1FC 1N59A 3JV6B 2X4PB 1HZHL 2NY1B 4CW1A 1WZMA 3KLAB 3QIBA 4N8CL 4PR5A 4ZPVA 5DUMH 3RHWK 1UFUA 2V5SA 1I8KA 5J7CC 5KSAA 1B6DA 3GIVA 1A14L 1KIPA 4GRLC 4OZFB 2ZKHH 1DE4B 5HSFA 1FLRH 3IT8D 1T04A 4QF1A 1MHEB 4K71B 3SKNA 4PRNA 5T3XD 3CXDH 4DGIH 3V95A 2FGWL 5DQJB 1DVFB 1Z6JT 1QKZL 2BCKA 2E6PA 4J3XA 4M61A 1ZK9A 5HVWA 2BJMH 5CILH 2R39A 1N64H 2P1YA 1VGKB 5T1LA 4EDXB 1V8HA 2EYTA 5FYLL 3LZFL 3FFDB 4IIQA 2C7UA 3V0WL 3QCUL 1LO2H 1T21B 5BMFH 3DX9A 1JWUA 1L6XA 3HZVA 5DR5H 4Y8DC 2A6IB 2HG5B 3BP5B 2IANB 4KHXL 4UV7H 3FO9A 1FAIH 3DVIA 3Q6FB 1XAUA 1A5FL 1MNUL 3IDJB 4RMTA 5EZIH 5EU3B 1G9EA 3O6LH 4KUCF 4JKPL 4LU5H 4P2QE 3T4AB 2XRAH 4OD3L 2H2PD 3N85L 4HGMA 2VTFA 3OPZH 4QGTA 1S8DA 2ZNXA 5EG6C 4X5LA 3TYGH 4TOYL 1U6AL 3A6CL 4XNXH 3NOIA 2JIXD 4D0CB 1MCNA 2CKBB 3HG1A 4YBHA 4AT6B 1IAIL 1D5ZA 3UXFA 5KVEH 3TV3L 1NH6A 3MBEA 4N0CC 5GJSH 5I76A 1FL5A 4LRNH 3O4OB 4K7PY 4MJ4A 3SDCA 3CPLB 4PRHE 4Y5XA 1EEZB 5JOEA 1IM3A 1MHHB 2VDOH 4S1SL 5D7JC 2CKNA 4JFXB 1M7DB 3BGFC 3DRQA 3RJQB 4PV8A 2YC1A 5D9SB 2DTML 3L3JB 4OUOA 4XPTH 3MOBH 3QDGE 3NABL 5E2TL 1I8MB 1EHLH 4O00A 1A1MB 1NFDE 3FMGL 4LSTH 3T2OA 2J5LC 4FOMA 4KK5D 3WUWG 3QSKB 4G8GA 4NO5A 5KSBA 3PWPE 3UTTA 1R5IB 3DX7A 2NMSA 1F4YH 4PRIA 3LKNA 3THML 1IGYA 5JOFA 1UVQA 5ICZB 1KTRL 2C1PA 3D3VD 5EOCL 2VKWA 4EI6B 2IJ0C 4PG9B 3V7AG 5E8NA 1PY4A 4OCWL 2HH0H 5HHOA 2L4OA 4G5ZH 4B0MM 4GH7B 1ETZB 5GSRB 2Y06L 2E27H 2FJGA 5DJYA 4XCYB 1CD0A 4PY8I 3X14B 1OLLA 4KKAC 5BQ7A 2J2ZA 1G7LA 3WUWB 2R2CA 2MNUA 3Q0HA 4ZFOB 4PJAE 4H0HB 1CVSC 3CFJB 5HVFB 3TJHD 4KI5D 3DETD 2RFXA 3OKNB 1MHPH 3KNBB 4M9PA 3OKDB 3T1WA 1T89A 5EC2B 3ZHDA 5F88B 3OZ9L 3GSWB 1DBAL 1LO3L 3S3SA 1DBKL 3S4SG 2G5RA 4HW6A 4C83A 4M7ZC 3BJLA 2D7TL 4XXDB 4I3RH 3FT4A 3NCJH 3D39A 4F7CA 1LMKA 3EYQD 4LIQH 4XAWL 2VZOA 2V2WA 3HB3C 2YPVH 1ZLSH 3FO2B 1MCOH 3OL2A 2R2EB 1VGEL 4KHTH 1Q94B 2VXUL 1BAFH 1MQKL 1KLGA 5BJTB 4LDEB 1V3KA 3LEXA 3QDMA 4OB5H 1W0YT 2DL9A 2QQLL 3WIHL 3RTQC 4G8FA 3S4SB 2GFBA 4ZD3L 1YYLL 1OSPL 1QFUL 3FB8B 4FQHA 4PGDB 3QUYD 4UTBH 4HJ0C 2B4CL 4LRIA 4F7EB 4WO4C 4G6KH 1QRNE 2NLJA 3C5JB 4HJGB 4LBEB 5BS0B 4GQ9L 1AO7B 5D2NE 2B2XL 3WLWD 4ODTH 4G8EA 4MXQD 3PP3K 3RGVC 1YNKL 1MJ8H 5IB4B 5D72L 1G6RA 2XZAH 5CEXA 1QEWA 4ZSOB 1VA9A 4PPTA 3MTRA 3K1DA 1FZJA 1CFBA 3RX5A 2YWYA 3TNNA 1OCWH 3G5VB 4MD5A 3DX6A 5J3HC 2YK1L 3TVMD 4P46C 4Y4HD 1WAAF 2YUWA 3TT1H 1C5CH 3U0PB 2C3VA 1D6VL 1WTLA 1IKNA 3MNVB 5IMMB 1KEGH 5SWZA 3ROOA 3AREC 2P5ED 5LAXA 1CFQB 1ZANH 4XNUL 4R4BB 2DYPA 2D7PA 5J1AB 1QHOA 5E4EC 5B21A 1CE1H 3NPSB 1IFHH 1QSEA 4KROD 4E41A 4O2FB 2ZCKH 5C0IB 4OF6A 1J18A 3UX9B 4N5EC 4JRXB 1W8OA 3G6DL 3TJEH 3RPIB 3O3BB 4NQDA 3OR7B 3CVHL 1OTSD 4P5TD 5C07A 2PF6A 3HS0A 5BV7L 3O11A 4Y4FA 5FUZH 3O4LD 4JLRA 1NC4A 4J6RH 3NCYS 3UPAA 1WSST 3AY4A 2IQAB 3IU4H 5EIQA 2X1PA 3SDYL 1FZOB 2JCCE 3HZMB 1SEQH 3UROR 2R23A 3IS0X 1VFMA 2OI9C 5I75C 4AIXA 5T3XH 2SEBA 3GHBH 4QHKI 1ZHBB 2DBLH 2M26A 3RVVC 1L9MA 4S1RH 2Z93A 1XH3B 5CWSA 2R0KL 4P4RB 4QEGA 4WW2B 4IMLB 1JTPA 1NFIA 3PIQB 5CEZL 4L3AA 3QXAA 3UAJD 4OKDA 3NTCL 2V5RA 1Z0NA 5IMKB 2DKSA 1RJZB 4PJHA 5I8EA 4I2XB 4U6HB 1D5MA 2Q86B 3O3DA 2PXYB 1FFQA 4YBLC 1VDGA 3HRPA 4XMPL 4XNYL 3LOWA 5CP3H 5DI8A 2G60H 4PJEE 2W9EH 1RY7B 4HH9A 2FB4L 2X4TB 4X6FA 4LSDA 3FAWA 3O2DH 3RDTA 1P4LB 5F3HB 3M8OL 4KI5F 5D8JH 1K6QH 1UWXK 4J4PD 2OTUB 3C8KB 4FMKA 3FCTA 4E5XA 4W4OC 2BHYA 2X10A 2J8OA 2WWMC 5HYSA 4EN3B 1XGPB 1Y6NR 1T5WB 1OAZL 2HYMA 4WEBL 4YHIA 1KENL 1KCUH 2JELH 3QRGL 1E28B 4HPYH 4UB0H 5SX4I 1HH9A 3MV11 1IKFH 2XFXA 1CFVL 1EH9A 3MACH 5AG8A 5IMOA 4DTGH 4KJPC 3OXSA 1P7HL 5DRWB 43C9A 5DJ0A 4YFEA 1Q0YL 1BJ1J 5E6IA 1JUFB 4RX4A 4X9FA 4KRPC 1CK0H 1EO7A 1Q9KA 1EHXA 1NLDL 4WU5B 4KAQH 3QEHA 3PWJB 4OJFH 2DQJL 4YHZL 1CDHA 3K4ZA 4OT1H 1RK0A 5E6YA 1RJCA 3VXOB 1UJ3C 3NCBB 3Q5OA 4XPGL 5I1JH 1X5GA 5J11C 3DO7A 3ARRA 1FVCB 1RPQA 2VE6B 3FQXA 4TTDD 2XWTA 1AD0A 1LDSA 1P1ZA 3W5NA 3PL6C 4M5YH 3U1SL 4X6DA 3ZHKA 4R4NC 1MAMH 2DIBA 5I1CH 2E7BA 1FNGA 1J12A 4FG6C 1T2QL 4MQXC 3F6LA 5MERB 3MCG1 3U79A 2EDYA 4XNQB 5L8JB 1I3RB 3LS4H 4OLEA 5ANMB 3WIFB 1PEZA 4HS3B 3RWGB 3P9WB 4Y8AA 2YUXA 4M4RA 4ZYKB 4UU9B 4JO3L 1IGML 5TPWH 2YRLA 1FIGH 1WBZA 2HKHH 4UOW1 1NDMA 3B9KC 3PJSB 3M1BA 1WAAA 3D69A 4XC3H 4D0DB 1T4KB 3EYVA 3HC3H 5CP3A 1FFRA 4NQEB 2ARJA 4P9HC 1DQMH 1ROWA 3ZLQC 5I19L 3RKDD 5DEZA 3WFCL 5DK0A 4F7PB 4DAGH 5FGSA 3SO3B 4OFIA 2NXZD 3BQUC 4KV5F 3MNZB 3HZKA 3BH8A 3O2DA 3LRHA 4I4WA 1CGSL 4OLXH 1PQZB 4I18B 1VHPA 4HH8A 3O0RL 3KHQA 4IOIA 1BQUA 1YEEH 1UA6L 4K23L 4PRHD 1N26A 4UUJA 1I9JL 1Y0LA 3OWEA 3CC5A 4YNYB 4LLMA 2JIXA 2BHUA 4JO1L 2LFGA 5D71H 2V7NA 4HC1A 1MWAL 1CGXA 4NSKB 3FZUD 3LEYH 4NOBA 3S35H 4OFVA 4JZJA 3ZE2E 3LDBB 2F54E 1DUYB 3ZDZF 3BZEA 4G8IB 2NY4D 4DUVA 4RMSA 1HSBB 1NGZB 3EOTH 3WSQL 1V7NL 4P2OC 4Z7UE 5C6TL 4O5LL 1L4IA 2R2BB 4PJ7A 3PGCA 3I6KA 4DN4L 3L9RA 4LPVA 3C6SA 4FQJL 3QEGL 4MNGA 1GCFA 2FEDC 4OQTL 3OKMA 2G9HB 1TQBC 4RWYH 4NUGH 5MHSD 4GSDL 1IGFH 1YUHB 3D3VA 1X9QA 1KTDA 1DQTA 5DUML 5FM5M 1VEMA 4LCCC 5F89A 1PBYA 4LMQI 3D9AH 5DUBB 1G7JA 1M71B 4KI1A 5IBTH 1R3IH 1SJHA 2ZKHL 1D9KB 5FOBB 4XB7A 5DHVH 5I9QC 4BSVB 5AYQA 1K4DA 3GSUA 1Q72H 4DGIL 3S37X 4RMRA 5D1XC 1F3RB 2PTVA 3BZDA 1UZ8B 3PHQA 2BJML 4RGNE 3MV8B 3BGAA 5D5ME 1VCAA 2COQA 2P46B 1UWEH 1H0DB 1S9VB 3LRGA 2YXFA 2D3VA 1N3NA 1BD2B 1LO2L 5BMFL 4Z8FH 2ILLA 2YS4A 4JVPA 5EA0H 2HKFH 2GUOA 4OM0H 1MLBA 1J7VR 1NJ9A 2DL2A 5EO1A 4JFZH 5D96C 3WHXB 2GK0A 3OR6A 3IDNA 3S98A 4LCWD 5D1ZD 1U3ZA 3O6LL 3STZB 4AEHL 2APXA 3MLSH 5LKNA 5EC1A 3SKOB 4YHPA 5FGBC 3GGWB 4CVXA 4LLVA 2CRMA 3UJTH 1II4E 1R3LB 5CSBA 2AV7B 5D93C 3ARYA 4Z95H 3UTSB 3BVNB 4EDWL 4XNXL 3P4MA 4TQEH 4BJLA 5ACZA 1S7WB 3AMLA 1LK3H 1IZKA 3NBNA 4HT1H 5HDQH 1HCVA 4UTAL 2QTEA 4TVSa 2R15A 5GJSL 3I50L 4I0PC 3M07A 1KOAA 1MEXH 2BNRB 4OFPA 2Q1EA 3U7WL 4L9DA 2VDOL 1GGBL 5C8JA 2E8ZA 3QUYA 2VABA 3MOBL 4JG1H 1KPVA 2ZCLH 2R4RL 1EHLL 5KANI 3BESR 4LSTL 5E00B 4Z6AT 2ENYA 2QR0A 4HIEA 1ZT4B 5GZOD 5JA8B 4G6MH 4NQXA 1KFAH 4CN4A 1T6WA 3DYMA 3IKKA 3MLZH 5A2IH 5MEPA 4MLIA 5ENWB 3VXTA 1S7QA 3VG0H 2OXHA 3C2AH 3OB0H 4P9ML 3DROA 5KZCD 3TVMA 1FO0A 1U8QB 3FONA 4MD4B 4NFDA 4G5ZL 4Y4HA 3A6OA 4Z78B 5DLMH 1YEGH 2Q20A 5EBLB 5DD1H 5EBMA 1O7VA 4NN6C 4MMXC 3LIZH 2P5EA 4H0IA 1NCCL 3SDAC 4CUCA 5HYEA 3FQNB 2BSRB 3Q1SH 3RIAF 4HWBA 5F44A 3I02B 3UTPE 4DW2L 3BW9B 1T1XB 2ORBL 2VWEC 3P3YA 2R29H 4B41A 5FECB 1WBXA 4DN3H 1A8JH 2HFGL 1KCVH 2EDJA 4WUUD 3H3PH 4DGVH 3JV4A 5L2JB 4HWEH 2YPLE 4HG4K 5HDLA 3WLBA 4TUOA 1NFDF 1WK0A 2QQQA 5CZVH 5IW1B 4P5TA 5EZJB 1CF8L 3LRSB 1LVEA 4YO0A 3PNWB 4NCC2 4X6EB 3C08H 4I3RL 5J56B 5EWIH 3O4LA 4EQ3A 2FL5B 4U1LA 1SM3H 1XF4A 3CMGA 4AIZA 4PP2B 3K74B 5JLZB 2DJ4A 1OWRM 2FYYA 1Y18B 4LIQL 3VCLA 2WINA 1ZLSL 3SDDB 3HUJE 3IDMB 1G1YA 4GUPA 1MCOL 3RL2B 2JE8A 5JNYB 1BAFL 1MCCA 3ARDB 5B8CB 1RZKC 2H2SD 4OB5L 3RWFA 4H1LG 4OZHE 3SDXB 3TN0D 4HS6A 2WWKO 4ZUSA 4LSRH 3VFNB 5C70A 4NPYA 2VQ1B 4PJGA 4Z76B 3R1GH 4PJAF 5CJQH 2OMBA 5FHAH 4UTBL 3GB7B 1U3YA 3MRQB 1KG0B 1QVOA 5EU4A 5HGBA 3RZCD 3S7GA 2W9DH 4DKEH 2QADC 4AK1A 4HLJA 2BSTB 5IJKC 3DX8B 4EVNB 4ODTL 5ELIA 1A7QH 1IBGH 3UBXA 2WLYA 2XZAL 1WQVT 1OP3K 3MRBA 3BWAA 1QQDB 3O8XD 4KTEH 4J4PA 4H1LB 1NANH 5IGXH 3EDDA 4Z7VE 3MJ7B 3U30C 1OP5K 4N0UA 4LP4A 2FJFA 3ZDYF 3CUPA 4PGJA 1IL1B 5CINH 3QIWC 3F7VA 4HJJL 2XQYG 5DK3A 1X6NA 5KBNC 4PGBB 4G9FD 3TPKA 4XTRD 1I9RL 5CEYB 3VWJC 2MHAA 3E0GA 1S78D 3AU1B 5JIIA 2CIKA 5DHYA 1P9MA 4NNXA 2BXZA 3CFDB 1CE1L 1IFHL 3W11D 4OLYH 4OBSA 3LQAL 3P73B 4M3KB 2ZCKL 3TH4T 4BQ9A 4HEME 3BPCA 4K07A 5DD5H 3TJEL 1JK8A 4ETQA 2UUDH 2JTDA 4JFDE 3RU8H 1BIIB 1J86A 5E2UH 4L1DA 1G7HA 2PETA 5GGTH 1G0XA 2J8UA 2YD1A 5FUZL 1FG9C 4PREB 2R8SL 3HNVH 2HRLA 4LP5A 2HN7A 4WDIA 5A1AA 4XCNA 3M17B 1SEQL 1GZQB 1RUKH 3K80A 4RMUA 4LLUB 2DBLL 4KVCL 3MCLH 1MCKA 1M4KA 1ZLVH 3MV9B 1OF2A 1TVBA 1C1EH 2A73B 3ZT7A 2NZIA 1AFVH 3MCKB 1ORQA 3AMKA 3BN9C 1WC7B 2E9WA 3LKQB 5DJCB 1KLUB 1YC8A 3TBYB 4Y5YC 2Q7YB 3MLWH 4I3GA 2L7JA 1IGTB 5EBGA 5FUOH 1RZJC 2F5BH 2HJFA 3RUGA 2W9EL 2D7NA 3KYMB 4X9HA 5IR1B 5CAYB 4GRWF 3LPFA 1S9XB 1BFSA 1Q38A 1S7XA 2W0PA 4F7TA 4X99B 5TE6L 4IRJC 3OGCB 4MNQD 2DLHA 1K6QL 5IMLB 3VFRB 3H0TA 4H20L 43CAB 3RRQA 4HUVA 2X09A 3C5ZC 3VMNA 2JCCF 1SVZA 1C5DA 3WL9B 4EI5D 3C9NB 2AVGA 4FXKA 4Y19E 5CJXA 3ZTJH 1KCUL 2JELL 3V6ZB 1MF2H 1ZA3B 1IM9D 4HPYL 5KTEH 1Q1JH 4MCYB 1IKFL 1V05A 4AM0A 4U3CA 1SMOA 3EYOA 4JQXA 5KG9B 2FCBA 4JANB 3MACL 4Y4KC 1U8HA 5C71A 3MNWA 2FX8H 4GG6B 2EIDA 4K7PX 1EIBA 2IH1A 2JK5B 3HI1B 1VFAB 3O6KH 3SBWA 3MV7E 2LU4A 4JRWA 1CXFA 4Y89A 1BFOB 1EK3A 5C6WH 4GG8B 4MAYC 1RJYB 2ZP0T 2ESVB 3F58H 3N06B 4JRYD 5GGTA 3TA3C 1MH5A 3MA7B 1DLFH 2AEPH 3BP7A 1PKOA 4OIAA 1RVFH 5ALBH 1KN4L 3HA0A 1CD1A 3ZYIA 4X7SH 1EFQA 1AGEA 5MEND 4PJAA 4YBQD 5T3ZD 3STLB 1E4KA 1HHGB 3DV6B 1HHHB 2AXGA 2BVYA 3QJHA 4B53A 2PO6C 2NW3B 4L4VD 4PB9H 1IGCH 1CICC 5FCUH 2XZQH 4GKOA 4NQSB 1JZ6A 4GRWH 4PJBE 5JW3H 3OX8B 1LGVA 3L5JA 5A2KH 3BUTA 2VAAB 3K8MA 3BUYB 3RWJA 2R1XB 5B4MD 2A6JA 5EU5A 3W9EA 2MWCA 3KLSA 4WEMB 3SY0B 5H37H 4CVZA 2FHFA 1FIGL 4CRPA 2EDEA 3DIFB 3ZZ1A 2HKHL 4DZ8B 2NY0C 4NQTA 1JWMA 3LDBC 3B5GA 4U1IA 3L3GB 5F6IB 5MI0C 4C54A 1DDHA 1A6UL 4LCWA 5D1ZA 1TMCB 3RAJL 4HKJB 4U0QB 4DAGL 2CR3A 2HJKA 4O4YL 4UV4H 1VKXA 2X5PA 3X11A 3VXQB 1YEEL 3DRTA 3MJ9H 4YQXH 3FN3A 2C5DC 1A3RL 5BRZB 1T1ZB 3QUZB 2Z91B 3DPBA 2VH5H 2FJHA 3HC0B 1J1OH 4PBVC 1P5UA 2VITA 4FQ1L 2ICES 2JJSC 4IRSC 3S35L 3V9FA 4PJCB 2P44B 3FTGA 2Q8BL 1CDCA 3B9DA 4UQ3A 4CU7A 4QRQA 3DTXA 2AAVA 4Y5VC 4OCNC 4Z7WF 4PRDA 4OD2A 3LAFA 1I1YA 1RAMA 2FGZA 5L2KB 3RL1B 1X7QB 4PJ9D 2Q76A 5JQ6H 1CFSB 4WTXA 4MAUL 1A1OB 4D8PA 1NBYA 4OV6F 2YD5A 3I6LE 5DXWA 4NUGL 3VXRB 1U8MB 1PG7W 1ZSDB 1IGFL 3QCVH 5C09E 2OJEB 4Y2DB 5CD5C 3I84A 1FGVH 4OCMC 3D9AL 4N0RA 5IQ7H 2EXWC 2NY3C 4M1CC 1D5BB 4MX7B 1R3IL 2VLRE 4FFWC 3EZJB 3Q3GA 1ITCA 3OSKA 4S1DC 3VD7A 1U3JA 2BOBB 5GRZA 1Q72L 5FB8B 4TNWK 5DJAB 4Q6IC 4GKZA 1A4JA 4KJWD 5D2LB 5FO9A 1O7SA 3TO4D 3T2QA 1E4XH 1U8PB 1B3JA 3LQMA 4YPJA 3O9WB 3RZWA 3MROB 1TITA 4WU7A 5HD8D 1ZHNB 5MEQB 2ZSWA 1KC5H 5I71B 4HUXB 1AR1D 1UWEL 4KDVA 3FQRB 1YN7A 3EJZC 4IM8A 1YMHB 5IG7B 4WUUA 3WN5B 4HXBH 3T1FB 4Z8FL 4JHBA 2Q6WB 4Z7UF 1OT1A 5EA0L 2F53E 3GI8H 3LHPH 3GNML 4OM0L 4XPFH 1RZIA 1IT9H 1KELH 4HK0A 1X4YA 4JFZL 4XNZB 4OLUH 3J8F7 5JMOC 3UCRA 1MCPL 3T77B 4GW1A 3O6FB 2HJLB 3VRJB 1A6VH 1EEQA 4ZOCA 4NJ9H 1EHNA 4FRWA 1G9NH 1A1NB 4L8SA 5LJYH 1AP2B 3UJTL 1ZGLA 2GI7A 2GIYA 3SJVD 3I3DA 3WNNA 4H26A 4Z95L 1MELA 3E6FA 4JN2A 1HH6A 3K0WA 5DZNA 4P3DB 4ZTPH 1LK3L 4HT1L 5HDQL 1WUNT 4L1HA 3T0EE 5EPMB 3SGJA 4R0LC 2H6PB 3MO1A 3QDJB 4ZODA 4JFFB 4RFOH 3TN0A 4U7SA 3TT3H 1BVKA 1OTUD 2NY1D 2UZIH 4ZAKC 4D0BA 2VDML 5TQ2H 1MY5A 3NN8A 4LSVH 1OSZA 2W07A 2VR4A 5D5MF 1F4WH 3ES6A 3VRIA 3LQZB 4F3FB 3QPQC 4UAOB 1KN2H 3OJDA 2ZCLL 3RZCA 1D7FA 1AIFA 2HT4C 4C59B 4XBGA 1CL7H 4J3VA 2A6DB 1KJ2H 1OT2A 2F74A 3IXTB 1CFNA 1VB9A 4TPRL 1KFAL 2AJSH 1DVFD 5HPMA 3DYOA 5K9QI 3O8XA 2OR9H 2P5WB 2XWJA 3VG0L 3MOAH 2XZZA 4BQ6A 5FF6A 1DL7H 2OK0H 2YSSB 4P3CH 4HLZH 1N5AA 2WBWB 3HPLA 3QG6B 5BV7B 1HHJB 3DMMC 3S37H 4EXPX 5DYOB 4XVUD 4G9FA 2IAND 1C16B 1FH5H 4ZXBC 4WGVB 4QRTB 5L9DH 1PKQE 1I85A 3R8QA 5IM7B 5F7WC 3VGDA 3MJ6A 2EDBA 2O93L 4PTTB 3Q1SL 1BX2A 1KBGH 1CQKA 3ZL4L 5JDSB 4EEEA 1NUFA 1YMME 5CIPB 1MFEL 5LBSH 4KKCC 5CSGA 3STBA 4DGVL 5FGCE 4OM1H 5IB5B 3T2NH 1T20A 2AV1B 5ALCL 5JOPE 3FO1B 4FP8L 4H0GA 5CZVL 2AEWA 4C55A 4XGZA 3AB0B 3MRJA 3QEUA 1A47A 5EZLA 3C08L 1Q9LA 3WFHB 3TYFB 2H45A 2OSLA 5F9WC 3NA9L 1SM3L 3QUML 5JIKA 2EECA 4Y7MA 4Z7WA 2GYSA 1T83A 4FFVD 3TWCH 3T2PA 1JGUL 4KQ3L 5IFHH 4ALAL 2HFFA 3MXVH 4O58L 2C4FT 3W2DL 1I4FA 3ULSA 2BZDA 1U3HB 4J8RB 3WKML 4KKLD 4YR6A 1NBVL 1XGTA 3I3EA 2KZ1B 4PGEB 1I9EA 2PCPA 3GO1L 1S7UA 1X44A 5CJQL 3F12A 1MVUB 1YY8A 2Y5TB 1S7RB 5E4IA 1M05B 4DKEL 2DQTH 1U8LB 1JF1B 4M7KL 1TZIA 2GCYA 3GMOA 1IBGL 5HHQA 3HMXH 1DQQB 3SGKC 2Q3AA 4ERSL 1HXYA 1MAKA 3KDMA 2V5TA 1SY6A 1I8LC 4MNQA 3D25A 3JV5A 4KTEL 4Y19D 3GMRB 5E8PB 1MCJA 1KIRB 5EH1A 4HK3N 1BLNB 2EDTA 1N4XH 1N59B 3W0WB 4GXUN 4KY1H 1LWRA 4CW1B 1OB1B 4JGJA 4HBCL 4EI5A 2BXYA 1NMCB 4Y88A 4PR5B 2XG5A 4XP5H 3HUJF 3NACH 2HP4A 5DO2C 3X3FL 1XR8A 3MRGB 3Q5TA 2IPUG 1IM9A 4YDKH 3B9EA 1S9YA 4LCUB 1J8HE 2UY6A 3ULVE 1LO4H 4QF1B 3SKNB 3VJ6A 4LKXA 3L5IA 1OM3L 5GSVB 4OZHF 4GS7C 2UY7A 2W0FA 3QXDB 3NIDF 3T0BA 1PDKA 1FJ1B 3FOLA 3T3PF 2BCKB 4MWFB 3CH1B 1IILE 3H7BA 3NIGF 3X3GH 4WTZG 4LCYA 2YN5A 5L0QC 1U92B 2EYTB 4JM2B 5TGBA 4K9EL 5B3JE 4IIQB 5LQBH 2OQJA 4M1GL 4NZTL 3LN4B 4GBXB 4JRYA 2E6JA 1JWUB 4IJ3B 3IXAA 2VDQH 1MRCH 5GXBB 5DK2A 3BXNA 5FYJE 2CUMA 3HNVL 4XBPA 5K9OA 5MENA 5D5MA 2VLLA 4Z7VF 3CIQA 1RUKL 5E5MB 2CO6B 2F5AH 5F7FA 1MSPA 1YN6A 4L4VA 5BS0D 2FATL 3MCLL 1AO7D 1S8DB 4JN1H 2FRGP 4HIHB 4UIMA 5DRXA 4MQ7B 1KXQE 2LAGB 4K8RC 2GSIB 3S34H 3ARWA 3BE1H 4Z9KB 3G6JA 1TQCB 4RQQB 2R56L 1D5ZB 4YHYB 2FWOB 4WFGE 3NH7H 2IFFH 3GI9L 4XVTH 2DQCH 3MLWL 4XWGH 4Y5XB 1Z9LA 3PGDA 1I3VA 1PGRB 5DSCB 2F5BL 4PV8B 2YC1B 4ONGH 3DUUA 3HMXA 4M6NH 2VERN 4NC0B 3V4PH 2AJ3A 2E7HA 1KEML 4ORZC 4XX1E 4FZ8L 3IRPX 4R97B 1MCEA 4OUUB 2XACC 4G8GB 4MXVE 4NO5B 5KSBB 4TSAL 4UI2A 1B4JH 1S5HA 5A40E 1QRKA 2VUOA 5CZXC 1F97A 1BJMA 3ARGC 2FIRT 2FECL 4M6AA 4JRXD 3HE7B 3QEQE 3WHE1 3D2UD 2A6KB 4XWOC 1EV2E 4OFYD 3F7YA 4GXUM 5L7XL 1JFQH 4XVJL 2GAZA 1D5XA 1KSRA 1M1SA 3HNTL 5DJYB 1YQVL 1R0AH 3OG4B 1FDLH 2K9UA 5ICYA 5A2FA 3P9MB 2Y07L 2ZSVA 4M00A 4L4JA 3W39B 4OZFH 4U1NA 5C09D 1UACL 1N5YL 3LKPA 1DFBH 3CU7A 3P0GB 1VERA 4PJ9A 5DMGD 4BZ2H 5HGDB 5B3NA 2RAMA 3BZFA 3VGGA 3MX0A 2APVA 1MFDH 4H5SA 5IVZA 2EYSB 3S3PA 3F58L 1MUJB 1HNFA 5A16A 1IAKB 1DLFL 4K2UH 3LV3B 1R3KB 2D0HA 1BHGA 5D6DC 1RVFL 4YHMH 2ERJC 4NDMA 2EO9A 5DVNA 4X7SL 2P8LB 5F6IC 4MA8L 3WDIA 2H9GB 1KPRB 4EUPH 1ZOXA 5F7UA 3CFKA 4XC1L 4XP1H 4MQTB 1QACA 3G08A 4R3SA 3QQNA 4I5BA 5CJBA 2PXYD 2GT9B 4PB9L 4NRXA 3TO4A 4F15C 2V2WB 2ZZUT 2F53D 4BFIA 4LSQH 3SE3A 6FABH 5DTFA 5JQHC 2YRPA 3QZWG 2X42A 1FIEA 1FVEB 1FGNH 3LEXB 1QLEL 4U1SB 5I18L 1X5IA 25C8H 2YD7A 4DCQB 2GFBB 2ADFH 4IS6B 4EN3D 4NCC1 1CLZL 4NCDA 4ORGB 3CFIC 4HUKB 1GPOH 1QO3A 2P4AB 4UV4L 2NLJB 5F9DC 3G04A 4UQ2B 2WUCH 3L3KA 1A9BA 4N1CA 3SJVA 3V79C 3MJ9L 4M93C 5EIIA 1JMZA 5JXEC 3QZWB 4AL8H 1FZJB 3PDGA 1T0MA 2A9ML 3QXTA 1ZLWH 1WWAX 4K94C 4NKIH 4QTIL 4Y2OA 3JV6A 2X4PA 5I1LB 1EEUA 1HCFX 3KLAA 3VW3H 2C3VB 3NGBC 2GTWB 3BZ4A 1NCTA 2VDKH 4K7PH 3AVEA 2BY2A 2DM7A 4OZFA 5IWLC 2DYPB 1G6VK 4WUKH 1J10A 5JQ6L 4AG4H 3GJFH 1QSEB 4O9HH 1OAQL 5DQJA 1DVFA 1UGNA 2HFEB 2VZVA 2G2RB 5C0RH 3QCVL 4ZMAT 1XIWC 4EBQL 4RBPK 3A6BH 3KPSE 1FGVL 1RZGA 5BW7C 1VGKA 4NQDB 5IQ7L 4DQOH 5HHPA 3FFDA 3FHQA 2O5YH 4LCIH 3RA7L 4S10A 2VISB 1T21A 3HS0B 4X4YA 2VB5A 3NVQA 3CMOH 1QD0A 3PQYE 1GGIH 4JLRB 2HG5A 3BP5A 2IANA 3DURB 4WNQB 1BM3H 2IALB 2WBJC 5ECJE 3RIFK 1CR9H 2N4IA 3QFJE 3VDAA 3IDJA 4FXLA 3L5WB 1E4XL 4NQED 3VXSB 1ODAA 3E2HB 2R23B 5EU3A 5CMAB 1QBMH 5I73C 5T1MA 3GMQA 1BBDL 3T4AA 1HILB 5CFHA 2VXTL 4PP1C 4PD4J 4QHKJ 4YDLC 1VESA 4LVOC 3RJDA 5CWSB 4HXBL 5KVFH 3VGHA 3GRWL 2OTPA 4D0CA 5I15H 4AT6A 1IT9L 1H5BC 2IPTL 4JR9H 4OLUL 4AY0A 1F2QA 2YEZB 4WFHD 5IV2B 4NJ9L 3CPLA 1XF2B 4M02A 1G9NL 1EEZA 4JHZA 4KDTA 4F9PC 3JWDC 4I1NB 4JFXA 4UMGA 4UT9H 5DI8B 1M7DA 2VRAA 5FYKU 4N8PA 4M4PA 4M62H 1I8MA 1A1MA 4ZTPL 1MCRA 2Z92B 3FCTB 4E5XB 4M5ZH 5FKAB 4M9OA 5IT2H 1R5IA 3TT3L 5ISZE 3C60D 3C6LB 3KPQB 1KGCE 2UZIL 2HMIC 5TQ2L 1FNFA 1XGYH 5ICZA 4IHOA 4ODVH 2A83B 1F4WL 4Q97A 3N1QC 3FFCE 3CX2A 5CD3B 4OBRA 4BZ1H 1D9KD 5GSRA 3VXNB 1CL7L 1CIUA 2XFXB 4Y16C 1KJ2L 1MREH 3T0AA 3WEXA 3BAEH 4XCYA 3X14A 5E9DD 2HFTA 3EOYG 2NY5H 4HQQH 43C9B 4NP4H 3WUWA 2OR9L 2MQCA 4YZFE 5E6IB 4ZFOA 1ZLUH 4Y19A 3WFBH 3MOAL 1DL7L 3MV8D 3CFJA 5GRVL 4NOFA 3ULVD 2LV4A 4P3CL 1BD2D 3OKNA 3KNBA 7CGTA 3OKDA 3AB0C 3SE8H 5JR1L 3C8DA 2W60B 5F88A 3GSWA 1T2XA 3DYPA 4TUKH 3DO7B 2ZUQB 5L9DL 4QRRD 1AXSB 1ED3B 5DUPH 1O5DT 1RULL 4LSPH 4XXDA 2XWTB 5C2UB 4MS8C 5FV2A 4U6XB 3QPXH 4LF3B 4R7NA 4A2MA 1T1YB 2R1YB 3FO2A 1P84J 5LBSL 3BKYL 3I6GA 2R2EA 3GZKA 3UTSD 4ZO6A 1XF3B 5BJTA 3UPRB 4G7VH 5C0EA 3HTLX 4BK5A 3ZDXF 2XYCA 1YEDA 4WHCA 5I16B 1WBZB 4IMKA 2BNRD 3M1BB 1MCIA 1X5FA 2VZ3A 3U4BH 3DSFH 1KV3A 4MA1B 5GQBA 3WXWH 3CDYA 3FB8A 4HMCA 4PGDA 4RGOH 5DK0B 2WK2A 1QLRB 1ONQB 4P2RE 4F7EA 1J5OH 4P3WA 1FCGA 5D1QC 4GXVL 4I4WB 4J1UB 3C5JA 4LBEA 4NO0B 5BS0A 1AO7A 4NHCH 1PD6A 3SPVA 3MXVL 5D4QA 3ESVF 3V6OC 3BPOC 4UUJB 1FPTH 4LLMB 4WI9A 4BZYA 2XKNA 2OZ4A 5GGVH 2CDGB 3QIBC 3MZTA 2EIEA 3VDCA 1NMCC 3G5VA 5KSAC 1QSFB 4R90L 5F97E 1CS6A 3BZEB 4ZDHB 4H8WH 3U0PA 1DR9A 3WNLA 2R4SH 5IESH 5IMMA 1F4HA 3HMXL 2DI7A 4MJIB 1CFQA 1MIEL 1CDYA 3JV0A 2KZWA 3I6KB 4MNGB 3F65A 4JVUA 3W9DB 1N4XL 3H8NA 3OKMB 4O2FA 4KY1L 4G7YH 5C0IA 3FT2B 4BA8A 4QRSA 5E95B 2GITB 3D3VB 4JRXA 4IJ3C 4KKBD 3D2UA 3MUZ1 3GSOA 3RPIA 2MCPH 1G7JB 4GAGL 3OR7A 5SWQB 4OFYA 4YDKL 4JQIL 3BRDA 3H6JA 2O5XL 5L88L 1LO4L 5FIEA 4JJHA 5C3TA 3U0WH 3OAUH 2IQAA 2YR3A 1INQB 4ZFZB 1F58L 5C09A 2MSPA 2P7TB 4ZNEE 3SDDD 1YNLH 3C2SA 1LDPH 2CJUH 5ADOH 1UM4H 2NY2B 1ZHBA 4FN0A 3F7RA 3RVXC 2AGJH 5I1DA 3MBEC 5D7JD 4P4RA 4WW2A 3MQIA 4IMLA 4KMQA 3PIQA 4JKLA 1MLBB 3SDCC 2WBKA 4Y5XC 2BVOA 1NBZB 2AQ1A 3EDEA 2GK0B 3BKCH 3IDNB 2WUBH 5IMKA 2J88L 4WV1B 1CIDA 1RJZA 5E99H 3DGCR 4I2XA 2IGFH 2F5AL 4U6HA 4MB4A 4HIXH 4M3JA 3RY6A 2PXYA 1CXIA 4CVXB 4QY8A 1QFOA 2C4XA 2EDHA 4LLVB 4YXLL 1JBJA 3RI5F 1D6EB 2A1WH 2F53A 3L7EB 3V8CA 1LK2A 2X4TA 1TIUA 1TENA 3FQUB 4LAJH 4PUBH 3S34L 3BE1L 2LVEA 1AQKH 1P4LA 1ADQH 2NYYC 4JGUA 3ULVF 4D9LH 4RNRB 2OTUA 3NH7L 3C8KA 5FCSH 2RBLA 4FQXB 4ETYA 4XVTL 1NQBA 4URTB 1HKLH 3S96B 4EN3A 2FX9H 1XGPA 1T5WA 1FL3A 3V0AC 4AEIL 2QSTA 4ONGL 4XPHH 4M6NL 1MFAH 1E28A 2GK2A 2DQEL 3EYUH 3VG9C 5ADPH 4FABH 3LB6D 4R6UA 5FYKE 4Q0XL 1T80A 5DRWA 1KB5H 1PYWB 3FOMB 2YRZA 1S7QB 4OGXH 1JUFA 4M7LT 1T89C 1JPGB 3DROB 2NX5B 1PX3A 4WU5A 4KK8C 3FONB 4L3EE 3S6CA 1JFQL 4Y4HB 4JY4B 2AXFB 4BKLA 3K4AA 5DHVB 5AYUL 5F71A 4NQCE 2XKUA 5EBMB 1X5XA 5B39G 3VXOA 5KW9H 3GK8L 3ULUC 4JZNB 3NCCB 5CEZE 4NM8H 3TP4A 4WHTA 1S5IH 5BVPH 5J13B 1DFBL 1FVCA 2VE6A 5HJ3A 3T0DA 4TNVK 1FFNB 1ZEAH 2M8XA 5BXFA 1E6OH 3KXFE 3RTQD 1MFDL 5KAQG 3BH9B 3ARQA 1MRDL 5HTSA 5MERA 5C6PB 1OVZA 2X41A 4LASH 5LWYH 3EUUA 4XNQA 1IEAB 3WIFA 3WLBB 1AY1L 3JTTB 4HS3A 4CMHB 3ULVH 4P5TB 4ZYKA 4UU9A 1DQDH 4QHUB 2QSCH 5B39B 1NDGA 4MXVF 5DMKA 1WCBB 4LRIC 4FS0A 3RGVD 4KXZI 4OF8A 4D0DA 5FOJA 1JNLL 2FYYB 1CGWA 1U8NA 4NQEA 3CAFA 2WQ8A 2YKLH 4F7PA 1ITBB 3EDJA 1EZVY 3MNZA 3UBXG 3V5DB 5C0BB 1GHFH 2AABH 1UZ6F 2X2YA 1ADQA 1PQZA 3DHMA 1FGNL 4LEXH 5D7IB 1MFCH 4P46D 2GY7B 3VFTB 5FYJH 4HS6B 4PJFE 4YNYA 4OCXH 4ZUSB 4X5WB 2ADFL 3ARED 5EOTB 5AAMA 4JPIB 3U46B 4AQOA 1BZ7A 3NZ8B 4G6AC 1IKNC 2VLKB 5EU4B 1QVOB 5JMRA 2EC9T 1DUYA 1U9KA 2KQMA 4G8IA 3WD5H 2WUCL 1QR1B 3CFCH 1HSBA 5JHLH 2DQDL 2DAVA 3UBXB 5HYIA 3MRBB 2R2BA 5C0CE 1HIMH 1I7UB 1KIQA 4AH2B 2X1QA 2NZ9C 2DQGH 3F5WB 1N6QH 2VWEE 2EH8H 5DURD 4N0UB 5FYLD 3C60A 3QO0B 4OCYL 3CUPB 4M1DH 1WJ3A 2R0LH 1CGTA 2ESVD 1YUHA 3CX5K 1DANT 1OY3B 1HQRB 4Y4FC 2VDKL 3VGAB 5E6ZA 2QKIA 3AY4C 2WMPA 1M71A 2CIKB 5DHYB 1ACYL 1D9KA 5SX5K 4DVRL 1A6PA 1OWWA 4BSVA 3RVTD 4O9HL 3I75B 5E9DA 3L3OA 2UYLB 1E4WL 5HPOA 1S9KC 3IFNL 1HINH 1HDMA 3FL7A 4TTGA 2FEEI 3MV8A 3A6BL 5DMIL 1TPXB 2XY1A 4P0DA 3CVIL 4U1GC 1H0DA 1S9VA 3VXUE 3F7PC 1OHQA 3SEPA 4OI8A 1BD2A 1KJVA 3UC0H 3MXWH 3MA9L 2IQ9H 3D0VB 3ZTNH 3CMOL 1JNJA 2VDLH 4MD0B 3ILQC 2I9LB 3QUMB 2XTJC 3WHXA 4QRRA 3EKCA 3BD3A 1BGXH 4TN9A 2V9TA 1QBML 3STZA 4OGAD 4BUHA 1WBYB 4NGHH 1RUQH 3VI3E 1JYVA 3RDTC 4JY6B 4P23C 5I66B 3GGWA 1V7MH 2DOCA 1OF2B 2R0WH 1TVBB 2AV7A 4WW1B 1L7IH 1RQ5A 4GFTB 5BRZD 3UTSA 1ERNA 5I15L 1S7WA 4MA3B 5DHXB 4CKVX 4I77H 4P2QB 2E8YA 4P2RD 3V6FB 4QXWA 3RQ3A 2BNRA 1GL4B 3EBAA 3MUGA 3NAAH 1UG9A 4AJ0A 2MPAH 3I85A 4M6MH 4L4TE 5KS9E 5DD0L 1XMWA 1FZMA 3VWKB 4M62L 3KLHC 4F7TB 2X9WA 4UZGA 4UNUA 3MSPA 4Z5RA 1ZT4A 4XP6L 4PRHB 4M5ZL 1WZLA 4N1HB 2XPGA 3CD4A 5INDB 1PW3A 3RHWF 3VXRD 1VFBB 5ENWA 1AC0A 3P2TA 1XGYL 2Z35A 3MRMA 4U0RB 3WUZA 2Z8WC 4Y2DD 3QDGB 4LNRB 4PRAB 4ODVL 1NFDB 5I1GH 5I1EH 2R69H 1U42A 4F57H 3WKNA 1U8QA 3CK0H 1J8KA 4MD4A 5E8OB 2ZUQC 3H3BC 4BZ1L 5IFJB 3HMWL 5TJWK 4UNVA 4JJ5B 1F02I 3PWPB 1HHKA 1MREL 3BAEL 1U8HB 2Y1VA 1U41A 1DLHB 2PKDA 3X13A 2NY5L 2IH1B 3S36L 1G9MC 1QNZH 2QHRH 3MFGB 4NP4L 5JW4N 3WFBL 2BSRA 2APFA 3SE9L 3OHXB 4QCIB 1RUMH 4S0SD 3I02A 3BW9A 5DQDL 3DXAE 3ARBC 1AGBB 4JDTL 4RFNC 5F6HJ 3A0OA 4XCCL 1EUTA 2BC4B 4JFHE 5AZEH 1GC1H 2UZYB 3TH3T 3BIAX 3MRIA 1JE6A 4PJAB 5DUPL 4MA1C 4MGXA 4GKSB 4NT6B 2D4FA 1L0QA 2IF7A 2ZCHL 3QPXL 1YECH 2H2PC 3BEVB 3QIUB 2Z31B 4KRMB 5JLZA 1JNHB 4W68A 1B0WA 4U1MB 3SDDA 2JB5H 1KCRL 2WAHA 3MGAA 3RL2A 5C08E 3RWJB 2FD6L 3LKOA 2A6JB 2RGSA 5FKPB 3W9EB 4YX2L 5JNYA 4WVRA 4TSBL 4OCSH 4CVZB 5B8CA 1A64A 5D7JA 4NFBA 2CSPA 1QSVA 2YWZA 3LEVL 3QDJD 1R3JB 2B5IC 3HFMH 3ZTJG 1CFTB 2VQ1A 4JZJC 4P2OD 3DSFL 4U1IB 1UH2A 4JFEE 2EKJA 2VZTA 4RGOL 3JVGA 5A43C 2VLJE 1IJ9A 4DWHA 2HJKB 3MRQA 4Z7NE 5GISH 1YEIL 2BSTA 4NHCL 3DX8A 4KK5C 4EVNA 3DRTB 3MLPA 5I6XC 4RMVA 4I8DA 3LVEA 2AERT 4H1LA 3MJ7A 5ANME 4NYLB 1QRNB 3RX8A 3O45B 5D2NB 3D6GA 1BFTA 3PV6B 1IL1A 1KCSL 3WCYA 3P4OA 2R4SL 1A14H 5CEYA 3L3HB 4WWID 5I2IA 4V2BA 1CGYA 3CFDA 3CH8A 2Q76B 1J0ZA 3QI9C 4MYWB 2VL4A 2WSKA 4MB3A 2VDNL 4LGRB 3TJHC 1NGPH 3QWOB 2XA8H 3BKML 4ZS6D 1A22B 1QKZH 3P73A 3DETC 4UNTA 4NQCD 5JW4M 4XVSL 2QJDA 5CEZD 2HT2D 5FYLH 2XZCL 5CGTA 1EA9C 4MMZC 1BIIA 3DVGB 4GRMB 3V0WH 5HGHB 3BPNB 4YLQT 5I17B 5FFLA 1W2KT 3ETBF 4XBEL 4GLRH 4JFPB 4PREA 3OAUL 4GKZB 1A4JB 3EYQC 3V4VL 1MNUH 4X7DC 3T3ME 3M17A 5KVDL 4JKPH 1GZQA 2UV3A 1JPST 1LDPL 1EEYA 2ZSWB 5ADOL 5DMYA 1F90L 3RTQA 3UYOD 3QUXB 4I48A