1YMUA

Signal transduction protein chey mutant with met 17 replaced by gly (m17g)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
125
structure length
125
Chain Sequence
b'ELKFLVVDDFSTGRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHEY
publication title The three-dimensional structure of two mutants of the signal transduction protein CheY suggest its molecular activation mechanism.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chemotaxis
total genus 40
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ymuA00
4MGEA 4KNYA 5HSGA 4PYRA 3QELA 4RXUA 4RS3A 1JBEA 5HQJA 1IIBA 2FN8A 2GBPA 3L6UA 1GCAA 3LUKA 4MS1B 1ABFA 3VNBA 9ABPA 3LUJA 2JVJA 3GBVA 2F8TA 2CD7A 4HNRA 1QO0A 4G0YA 5CNJA 2NT3A 4MQEA 5GOTA 2PUFA 3CKMA 4MLDA 1FFGA 3RVMA 4F8JA 5PNTA 1AB5A 4OLAA 2IPMA 3O2JA 5KC8A 1SD5A 5IUJC 3TMYA 4MR9A 1BA2A 5TPWA 1F51E 5JNSA 2FW0A 4F11A 4F3TA 3GT7A 1JYFA 4RKRA 3FFWA 4EGSA 3O74A 3RQIA 4DN6A 1U2QA 1PUXA 1JLKA 1YMUA 3GL9A 3HSYA 2FMKA 4RK6A 4WT7A 4KK3A 1NATA 4IMIB 3TX6A 1GLGA 3OM1A 1OXKB 5KQGA 5KQMA 2E4YA 1NXSA 2P9HA 2WJWA 3H1GA 4IMJB 4B09A 3N0WA 2B4AA 2LP4Y 3QEKA 4Q6BA 2A9RA 4OATA 1APBA 5ED4A 1E6LA 4L4UA 1JHZA 1DJMA 5CNMA 1RZRA 3NBMA 4KPYA 2LPMA 2PMCA 3RVRA 1QP4A 4D6YA 2A9OA 1D1PA 1Z26A 1DBWA 4ML3A 3SG0A 2NZVG 4W5OA 3HXMA 3TB6A 1QP0A 3CG4A 4KQCA 2JBAB 2PUCA 5T3YA 2PL1A 3D02A 3Q7TA 2M1ZA 2H0AA 3H6HA 4TLMB 4YGXB 4PZ0A 1QO0D 2GKGA 4ZPJA 2PUBA 4MYRA 4MPTA 3O1HB 3F6PA 3QLTA 2TMYA 4GNRA 3QELB 3E61A 1ZGZA 3I45A 4TN5A 4EYKA 4MQFA 2FLKA 1JFSA 1ISSA 3SQNA 4ZMRA 3MA0A 3H6GA 2L19A 5EWLA 4RXMA 1LK0A 3CTPA 3ILHA 3RH0A 2FEPA 4MRMA 1MIHA 1DZ3A 5FBKA 3FFTA 4MQEB 4MS4A 1MAVA 4ZJPA 5KWSA 1SXIA 2MYPA 4Z0NA 4E7PA 4W5RA 1FFWA 1VRVA 2CHFA 3DZDA 1NXXA 1P8AA 3CHYA 1R8JA 1ZDMA 4MR9B 5TPWB 1E2BA 1C0EA 3GRCA 2MSKA 4MLCA 4ZMSA 2R25B 3HCWA 1HEYA 4IRXA 3BILA 2L18A 1RZRD 3IP9A 1I3CA 1RNLA 2R47A 4E7OA 4N03A 3K4HA 2X7XA 1L5ZA 4Z99A 2MYNA 2FQXA 4YCSA 3H5LA 1DRJA 4DADA 4UHJA 3HM9A 3QLVC 1Z13A 3NNNA 5KQPA 2A9QA 1JFTA 5TQ2A 4ZYLA 4HYEA 4RDCA 5TPZA 1QQAA 3JS5A 1JDNA 4D6XA 3M9XA 3DGEC 5FWYA 1TJYA 1M2FA 2IKSA 5E3JA 3HUUA 1JFVA 4YLEA 3IPAA 3L49A 3JVDA 4Q6WA 3LMKA 3CZ5A 4N41A 4JAVC 3OQMA 2MSLA 1SRRA 4Z4CA 2BGGA 3MIZA 2MSWA 1NTRA 4XXHA 1XHEA 2OENG 3LUHA 2WB4A 3N75A 5BRAA 4RY0A 3QEMA 2VK2A 3OLVA 4H3HB 3RVLA 3Q7RA 5FBHA 4RK1A 4L85A 4JOQA 3CU5A 3NNSA 4Z4FA 3OQNA 1ABEA 4F06A 4DQDA 4MRMB 1NXWA 5CNIA 4XLTA 3OLWA 4G0QA 2HSGA 3D8UA 4MS4B 4Z9BA 3BREA 3SNKA 5B3JC 2JB9A 4G0MA 1RXEA 5F64A 2MYUA 1PHRA 4YR7A 3QX9A 2WJAA 4ETIA 4EVRA 2FEKA 3OQOA 1XHFA 1ZGGA 2AYXA 4Z4HA 3OMXA 1LJUA 1PNRA 3E3MA 5I4CA 1DCFA 1URPA 2PUEA 2QVGA 1D2AA 1DC8A 3HDGA 2MYTA 1QPZA 2YHAA 5TPZD 1D4ZA 1Z2EA 3H5OA 3H5VA 4PEVA 3IDOA 5JNTA 3I5AA 3EULA 5KI6A 3TO5A 4YRZA 4RV5A 1F4VA 3URMA 3MMNA 4QYMA 3TD9A 2WMYA 4RK7A 1W9HA 2VUIB 1H9CA 4JB0A 1FFSA 2GWRA 3N53A 4RK0A 5TQ2B 3SY8A 5C5EA 4W5TA 1BDIA 5EWJA 1B00A 4NCAA 2FMHA 1BDHA 4LRQA 4WZZA 5BRJA 5FWYB 5DCLA 3BBLA 3W9SA 1DRKA 3F6CA 4WXEA 3ROTA 4Z4EA 2HPHA 1A0OA 1D5WA 4JP1A 4KZKA 4F12A 5TE9A 1K66A 3MYYA 5TQ0A 3HS3A 5EWMA 4JA2A 1Y1LA 4OLBA 3N6VA 1FSPA 1JL3A 1U8TA 3A3KA 3H5WA 3QEMB 4S05A 3G85A 4EVSA 3HO1A 1ZY2A 1KRWA 1P2FA 3LUDA 4OG2A 3CRNA 1USKA 3RVSA 3LTEA 1YS7A 5ABPA 5KC9A 2WWVD 3C3KA 3C6QA 4MAAA 2VUHB 4H60A 4RWEA 4G0OA 4IGAA 3CLKA 4MR7A 1D1QA 4XARA 2WY2D 3A0UA 2FMIA 3FMVA 5C5CA 4Z4IA 1ISRA 2IOYA 3DLBA 4NCBA 2P4UA 2CWDA 3R0JA 1VKRA 4KRFA 3GA5A 4MR8A 4YS6A 3SM9A 2DRIA 2IPLA 5JNWA 1KMIY 1BDJA 4EYQA 3HK2A 2HQBA 1XWWA 5CHYA 5IUKC 4RZSA 1EAYA 3HVRA 1LJLA 3DLHA 4RK4A 1JX6A 2R48A 3LKBA 4QPJC 3EQ2A 4H3KB 4G86A 3LKVA 5FWXA 6ABPA 2QV0A 4Z4GA 1Z2DA 3OMWA 3HEBA 1ZH2A 3IP7A 3QLVA 4GPAA 3RVNA 2J48A 2PAFA 2Q5CA 4N0QA 2PL9A 1BAPA 3O1IC 1W25A 4HNQA 4Q7EA 4RXTA 5DLEA 2NUBA 5IX8A 2H3HA 2ID9A 2PUDA 2HQOA 5EWJB 3JY6A 1TVMA 3Q7SA 2PE5A 5IEBA 4Y9TA 1GUBA 1NXOA 1DP4A 1TMYA 1JWLA 2HJ9A 1PNTA 4RY9A 4YWHA 3KSMA 1M5TA 1OXBB 3Q41A 2PUAA 1A2OA 2LIVA 1LBHA 3LUGA 4EVQA 1KGSA 1YTUA 2QU7A 1P6UA 4WXMA 3O2QB 2W42A 2RJOA 4LE1A 2L2QA 4P98A 4XFKA 3LUFA 5TQ0B 2N9UA 4EY3A 3EODA 2YHBA 1PEAA 2M98A 1YMVA 2QVCA 2JVKA 3H1FA 4NICA 3CS3A 3O75A 2OQRA 4XASA 2CHEA 5GQSA 3H1EA 4KMRA 3LOPA 1GUDA 3LUCA 3QK7A 2LUOA 3O21A 1YK0A 4RU1A 2IDMA 2PLNA 4O5AA 4MR7B 3H5TA 4QYWA 1SXHA 4IILA 5B3JA 3C3WA 1NY5A 5IC5A 1YS6A 1EHCA 4MQFB 4G0XA 1RPJA 4QICA 4G97A 1L5YA 2L17A 4W5QA 3NHZA 4MR8B 1VPWA 3UK0A 2PKXA 1EWKA 5EWLB 4N0PA 1ZH4A 1Z15A 4LX8A 5KQLA 5HKOA 3EJWA 4LE0A 5JS1A 1QMPA 3T95A 1YVUA 3I42A 5JNRA 5JS2A 3M6MD 4EYGA 2R4QA 2FLWA 3K9CA 4MS3A 3RVQA 7ABPA 1U2PA 5FWXB 3NHMA 2FN9A 3OLZA 4LZLA 2QXYA 4IF4A 4N76A 3KLOA 2RGYA 4TLLB 3C97A 5BR1A 4RSMA 4PE5B 1DCKA 2E4VA 4D74A 3I09A 5IUNC 2A9PA 3QLUC 3CG0A 1SXGA 4RKQA 3KS9A 3N0RA 3S99A 3GYBA 1RXIA 1QNLA 4KFCA 2NT4A 3FDFA 1GCGA 3MM4A 1Z12A 1UDRA 3HZHA 1TM2A 2WRZA 4WWHA 8ABPA 4FE4A 1U0SY 3ILYA 3JPYA 4FE7A 4NQRA 5CNKA 1CHNA 1ZESA 1EFAA 2RDMA 2QW1A 1DCMA 3N8IA 3ROFA 2FQWA 2ZAYA 1DBQA 1CYEA 4KV7A 6CHYA 3H75A 1YK1A 3F73A 1NXVA 5IULC 4LDAA 2IPNA 2JRLA 3EAFA 3RVPA 1KRXA 4YO7A 1JDPA 5BQ3A 3CZCA 1AB6A 4LDZA 4YP9A 1ZN2A 3MQ4A 3OO0A 4UHKA 3UUGA 1U04A 4P1ZA 3GWGA 3GV0A 3Q15C 1ZAYA 3GBPA 3HDVA 3CNBA 3KLNA 3O1JC 3OO1A 1A04A 3A0RB 2KYRA 3BRQA 4KK4A 1USGA 1CEYA 1S8NA 3SAJA 1USIA 4O1HA 4W5NA 4OTZA 2GX6A 2FKAA 2QZJA 3NNDA 1ZITA 1M5UA 2HQRA 5DGCA 1J56A 4KQ9A 4MS3B 5DTEA 2V0NA 2QR3A 3RVJA 2FEWB 3JPWA 5TQJA 1DC7A 2FQYA 1WETA 4KREA 3G1WA 3KTOA 2ZWMA 3M9WA 1M2EA 3T6KA 3N0XA 3EGCA 1DG9A 1JYEA 4FB4A 5IEJA 2FXIA 4EUKA 3KKEA 1Z17A 3QX8A 4N47A 5JNVA 3IPCA 1K68A 3OM0A 5T7BA 1E6KA 3KG2A 5HM6A 4RK5A 1ZVVA 2IPAB 1JH9A 3RVKA 2ID7A 1DBPA 1BVHA 1LBIA 5IBQA 3KYIB 2JVIA 4LE2A 1QP7A 3KJXA 1NXTA 3RVOA 5D2CA 2FSPA 3JTEA 4RY8A 3A10A 3HJFA 3DBIA 4M88A 3F7NA 4Z9AA 2IYNA 1EWTA 3OLYA 2E4XA 3VNAA 1VLZA 4ETMA 2JCGA 2B1JA 1YIOA 1P6QA 2FMFA 4MS1A 4YV7A 1T34A 3HUTA 3HV2A 3KCNA 2AYZA 2FTKE 3LFTA 2VYCA 1NXPA 3FGZA 3CFYA 2QSJA 3MF4A 1FQWA 5EWMB 2XDYA 3KHTA 2F8SA 4EYOA 4TMYA 4JASB 4WUTA 3EDCA 3T8YA 1EWVA 3KYJB 3OLXA 4HNSA 4CBVA 3BRSA 2E4ZA 3IP6A 1QQBA 4O1IA 3Q9SA 1MB3A 1PEYA 2E4UA 3C3MA 3O2SB 4ETNA 2PUGA 1JF8A 3IP5A 4NV3A 1Z25A 1TLFA 2GI4A 4PICA 1MVOA 2RJNA 2PJUA 2O20A 1MB0A 4KVFA 3LUAA 4OBBA 1ZHHA 2JK1A 3QLUA 5JNUA 1C4WA 2NZUG 5DKFA 2I6FA 4G0ZA 2LBPA 2E4WA 1QKKA 3UKJA 1Z18A 3FFXA 2JBAA 4S04A 3H5IA 2FVYA 3DGFC 4XAQA 1E6MA 3T38A 3P9YA 3B2NA 3EQZA 3JVIA 4JB2A 1Z16A 4G0PA
chains in the Genus database with same CATH superfamily
4NZOA 1HDIA 1HRKA 1P9OA 1Z7BA 4P0TA 1TJ3A 2GM3A 3RSQA 1YOVA 1Y6JA 4DLKA 2HBYA 5AP9A 5HQJA 2LNDA 2BFOA 3L6UA 4XCXA 3LLCA 1W5TA 4HS4A 3ZTYA 3V7UA 5IAEA 4O1MA 2GEKA 1Z2OX 2VCEA 1F2DA 1QO0A 2OORC 3LU1A 4HDMB 3K0SA 2PUFA 4LRWA 3VSBA 2GEDA 3ACBA 2IRWA 5BVHA 2QQ0A 2A5JA 3WYGA 3MJRA 4EO7A 5I47A 1KFEB 1TA4A 3ICVA 2O2JA 1Z7YA 3JQGB 5C35A 2XYGA 3PCRB 4EB8A 4TLBA 3RS9A 1YR1A 3GCZA 4DCJA 3GZNB 5CXQA 3AHDA 1YMUA 4K2HA 4K03A 2ZBDA 4L9RA 5F9MA 1U31A 1H6AA 1H65A 4PHHA 4EG6A 3VPXA 3QLJA 1QNFA 3KB8A 1M7GA 1GZVA 2C8LA 3EZ9A 3EVTA 4EELA 2A1TR 1LVGA 3JYNA 3UEOA 3JU3A 5HRAA 2C2HA 1FLNA 2XRFA 1TIBA 4BZZA 3LGAA 2O8VA 3CUTA 4HD8A 2CY0A 2VDRB 1CC1S 2ZIEA 4FFNA 3UICA 5C8XA 1JMVA 3DTYA 1GA6A 3ZBTA 1O5TA 1T9KA 1Y3BE 3DT9A 1HX7A 2C5HA 3SXUA 4CE6A 3BKXA 5JH7B 3HXMA 4Y3UA 1F3LA 1AUQA 1JG4A 4NE2A 1KJQA 2FR1A 3JQFA 4IW3B 2Y4NA 4O4HB 1FEZA 4Y6QA 4Q18A 5E3HA 1E20A 4EGJA 4GOOD 4EUSA 3VZRA 2PL1A 3NTOA 3D02A 3IE2A 2E21A 2E49A 3L8HA 2CDBA 1M10A 4J7UA 1C1XA 4H1WA 1XF9A 4S3MA 2A57A 3STXA 1T4BA 1KEUA 3WLFA 3RBVA 4N5DA 4AYTA 1YA8A 1EZ4A 2OBXA 3U7QA 1M73E 1YRYE 3WA7A 1PZGA 2QN8A 1YZVA 1RLMA 3EHEA 3K2EA 2J5RA 2GS9A 4TWZA 4UHFA 5KNCA 4QT4A 4Y6RA 4R8MA 1CB7A 3O73A 2F8MA 1RXSA 1NR1A 4GF5A 2X6RA 1GPNA 5J9FA 2PKRA 1TW3A 4LNUA 3V3TA 3VSDA 4J6EA 4L0MA 5FBKA 3TZLA 3TF5A 4X6LA 2YV2A 4YN3A 4AW9A 4CG0A 2G36A 3FNIA 4AJ2A 1QH9A 3NRCA 5HKKA 3AR7A 4BO4A 4DIUA 2BDTA 3FCXA 5MGBA 4MW5A 2GEUA 4RACA 2FV8A 2C9ZA 5BV0A 1SUAA 5JSZB 1ZDMA 2G25A 2HNAA 5AJYA 5EIBD 5B2ZA 4GZ3A 4DNOA 1IFXA 3GRCA 5LP6F 1E2BA 1NSYA 1AKUA 1H2RS 4KXQA 4ZMSA 1T6NA 2R25B 3GARA 3X44A 4NONA 2C78A 4WH0A 4P4UA 1XLTC 2YRFA 3GNLA 3LQYA 2RKWA 4QO7A 5G1NA 1M8GA 5EE1A 3GNSA 1I7PA 4PBSA 4GYYA 4ZEWA 2W2OA 4XGKA 3ZNQA 3Q8KA 5H80A 1Z4LA 2CMGA 1Q92A 2QNRA 4DADA 3WGJA 1DEHA 4L7VA 1C3JA 5ITWA 4UPEA 5IG2A 1HEUA 3U16A 1XMOB 3X43A 1Q95A 3U4HA 1DAKA 5AUNB 3PYLA 3TK1A 3SZOA 3QVUA 1U3FA 1VCNA 1ADCA 2CJWB 2GZ3A 1RWKA 1CJUC 1I80A 1KI1A 2IKSA 2PGOA 3BXFA 4NYIQ 4O4IA 4C9BA 5HHTA 1EGHA 1GP2A 2NZ2A 3L49A 3MAGA 4KIFA 1MD9A 4QJBA 2QT1A 2QJRA 4D9CA 1TLTA 1HMYA 1NQWA 2P9TA 1O94C 2QL7A 1CP3A 2XJ4A 4OQDA 4X84A 4EO4A 1EIWA 4NECA 1GL7A 1NJ6A 3FI0A 2BR3A 2VK1A 1JJVA 1XKQA 2DQSA 3OQJA 4HTFB 2FP4B 2P1RA 4RCZA 2JGAA 2HIGA 3H9QA 5T3UA 3LLSA 2O3SA 3KOZA 3D7NA 5I45A 2XZPA 1EP3B 4QDXA 4ZEMA 2R62A 3F7MA 4G36A 3OPXA 1XI2A 1J9EA 1W7AA 1A71A 1V5EA 5K09A 2PTHA 1RXYA 2JLRA 1UJMA 4BNLA 2WNHA 1X14A 3I6YA 4HXFB 3W6OA 4XLTA 2I2XB 3EXFB 1GD1O 5HFJA 4KTVE 4OA5A 3L4BC 5G3YA 5BNWA 1VL5A 2JB9A 3KT0A 2FHSA 3T5DA 3R9IA 3EW9A 3ZDAA 4QWWA 3KXIA 4V0NA 3OCJA 1PJRA 1EGMB 1XHFA 3BB3A 4Q16A 1JJFA 3S1LA 1QH1B 4BQQA 1X1RA 3S28A 3P27A 3NGXA 1X2EA 3DXFA 1Z4KA 3DTVA 3ZLVA 5THQA 2O8FA 1FSSA 2BF4A 2R8XA 3LNTA 2DSTA 1GNRA 1IY9A 3PC8A 4KOEC 3K9BA 1GGFA 4JKOA 2WTNA 3C5WP 2QLTA 1OH7A 3DL7A 3EULA 2BE9A 4QEDA 1SUBA 2CLSA 4C2UA 4MI3A 2OO5A 2ZJ2A 3R23A 3GRVA 2UZ1B 4HB0A 4X41A 2RBKA 3WWZA 5DHAA 4HGOA 2HL6A 5C5EA 4MW1A 3LIPA 2WSMA 4YCDA 4LYFA 5ULLA 2GEJA 3ZWVA 2IVFA 2ZS8A 4JT9A 1FMLA 2EZTA 2NO9A 4LJ8A 3K9QO 3UJDA 1RRMA 4HGYA 4P3OA 3A31A 2FX2A 3I37X 4DMUB 2Y67A 2G8NA 5D5PA 2HPHA 2BR5A 2R11A 1RPZA 2RK3A 1P4AA 3B3JA 3M81A 2ZT8A 1EDDA 4KOAA 4UVEA 2WFLA 1LLFA 2HU2A 1FX0B 4TL6A 5AW6A 1TW2A 1YBAA 2Q5LA 1EJBA 2YC4C 1M2GA 1XA0A 1GCOA 2W6ZA 4JBWA 4D9JA 1PLJA 1LB1B 1Q44A 5U4XA 3U3MA 2ZI5A 3LG2A 2R6FA 2YDXA 3J81A 2I6XA 3DBOB 5AI0A 4AWAA 1TUGA 1PHPA 5A9RA 4CUZA 1CQZA 2I2AA 4MW9A 5CIYA 1PDOA 5EZYF 5E7MA 1HETA 4B6GA 4IVQA 3A6PC 3HJRA 5EHQA 3NHRA 4ND1A 5BSRA 3T1NA 2AGVA 3R5TA 3S44A 5JNWA 1FVFA 1O58A 4FTWA 4C5CA 4KGZA 1XWWA 1F0KA 2QDKA 4EPYA 5MHTA 4MB6A 3RK1A 1ZNWA 4BWGA 1QCZA 3FSGA 2C9MA 4DDMA 3JZAA 1M66A 4Z1OA 1CY8A 1MW8X 2VUTA 1AS2A 3AUYA 4MIKA 3TNFA 3T99A 1YRQA 3WL4A 2QVZX 2BBWA 2I76A 3JYLA 3NXKA 4G86A 3G0CA 4H3KB 2ISCA 5ALXA 1NVBA 1UDWA 3L84A 1UZNA 4ZO9A 3QLVA 1TC2A 2C95A 4RTKA 4JQCA 3LX5A 2ECOA 1YUNA 3MWEA 1RJGA 4LZNA 4CIYA 4DSZA 1MA3A 1ZK4A 5E2IA 1MABA 3DDOA 4TT8A 2H3HA 1KYXA 1Z3IX 4CDNA 4AIRA 3KAKA 1XL0A 2DBRA 4KTTE 3GLHE 3WOHA 2X40A 2B9VA 2GD2A 1ILEA 1JEYB 4Q02A 4LRYA 1TUBA 3A6LA 4LSZA 4L72A 3DOJA 3OFVA 5HE9A 3EPJA 4HLDA 3DL0A 4KQHA 1LBHA 3D3QA 1FRQA 1W85B 2ZZKA 4BFTA 1P6UA 2FDCA 5KNDD 1UC5B 3DEAA 3PRKE 5CA1F 3EIFA 4Z9FA 5F7ZA 1KYVA 2HXSA 2POCA 1QGDA 1PEAA 1R0RE 2J0UA 4R9VA 2M98A 2IPOA 2ZRJA 2EJVA 2HA7A 3U1BA 2OQRA 2BTQB 3PQ2A 1G3UA 4IX1A 1GPUA 3LOPA 2WWXA 1GJRA 3K8OE 2J4FA 2XI4A 3RASA 2JIMA 4ER0A 1J1UA 2F62A 2C97A 3A6KA 4NULA 5SY4A 1I0LA 3K71B 5SYAA 4ND8B 1E32A 2BYTA 4QAQA 2OHXA 4O29A 1EHCA 1XZQA 2WBLC 4G63A 4NZZA 4P31A 2UUBB 1VIMA 1LK5A 3AHGA 4XR4A 3QBDA 4BX2A 1L3BA 1TAGA 1Q20A 5JAPA 3FAKA 1L5RA 4G1FA 4N0PA 1ZH4A 3UFBA 3SKVA 3L0YA 1WSBA 1PRYA 3G8AA 1TO2E 2OV6A 4TLAA 5IARA 3Q2OA 4AD8A 2H2GA 4D9FA 2VTVA 1GNPA 1R0XA 3W8EA 5LJIA 2V9PA 2ZJ7A 5EZSA 3GGDA 2ZIFA 3GUZA 4MKGA 4LQLA 4YA6A 5BN4B 3TW0A 2ZI6A 3AFIA 3EIWA 3HEMA 1H0SA 3L0DA 4HCJA 5KX5B 3OKFA 1UPXA 4FJ0A 1TYBE 4HDKA 3ZLUA 2G5CA 1C4KA 4FGSA 2X58A 3HCAA 4HH4A 2X4DA 2EKBA 4Z86A 3X1XA 3CWCA 1A5TA 1GA1A 1ZGHA 3HBMA 3IIEA 2PT7A 3DWGA 3QWFA 5ICFA 2M6SA 1O4VA 2POQX 2YHSA 5B1IA 1SVNA 1ODCA 3OM9A 1TVKB 4TWAA 2AN9A 4EZBA 1PR1A 1U2TA 4BNGA 3S1AB 4PVCA 4EYEA 2A88A 1SD2A 4QTZA 2JLSA 1LFAA 3DZ8A 1DC3A 3TUIC 1SU7A 2YQ5A 3H75A 3MBKA 5AOVA 5A7FA 2XA9A 3CVOA 4FHCA 3ND8A 4RL6A 1UFOA 1NW7A 1U5CA 4M9XA 4QU8A 3KOUA 2QZZA 3K09A 4Q3BA 1BCRA 1ZN2A 4D25A 1DPFA 3E53A 4KE8A 1JSRA 1I5RA 3JZMA 5BNTA 2YKGA 4S1VA 4HSEA 4WN9A 2OAQ1 3NETA 3WV4A 1HQCA 2F9LA 3DW1X 3O84A 5FBRB 3EXIA 1GZ4A 2C4KA 2I4RA 3HY3A 3OZEA 2Z58A 4KQMA 2J33A 4PPFA 4HLNA 4X71A 4Y1FA 1YQDA 2RHWA 2Q62A 5FXMA 5E1OA 1WUHS 2B25A 2J9XB 4CYMA 1NBME 4XEHA 3ZWMA 2QAJA 3GLVA 4EHHA 5AQEA 2HMUA 2Z8XA 3M6UA 3TJMA 1CUZA 2PANA 3IMGA 4FC6A 3KSDO 1CT9A 2QTMA 3NV9A 2P2SA 1TM7E 1E2KA 2IT1A 2R97A 5K0CA 4DF3A 4LY3A 2ZBUA 4KREA 1P1IA 2GNOA 4G5YA 3JZFA 4LF5B 2QUKA 3KTOA 5TSDA 3OHSX 2XMPA 5AVXA 1HTBA 4MNTA 1P0CA 4YP5A 1YT5A 4AN4A 4BNDA 3PT9A 2OYCA 1TU4A 3JXEA 4GOND 3KKEA 3V1NA 3L7OA 3WOVA 1CSEE 4MCAA 3VSCA 1K68A 3AUKA 1GPDG 5DWVA 3EFEA 5AVVA 1WM1A 1Z0UA 3AHFA 1P2BA 1KKMA 3D8NA 4GE0A 1DLIA 1EX1A 3QWIA 3O95A 4TL8A 2WB2A 1RM5A 2FR8C 2W6JA 3BTSA 4XDYA 1LRLA 3QSGA 4B0PA 4TYQA 4HXEB 1BWQA 1Z0DA 1SD1A 2J3JA 3E9NA 4INPA 1ZD5A 3LCVB 4ZCQA 3ROEA 3RVOA 3ZHSA 5K03A 5EP2A 4Q4LA 4K2AA 1VPDA 4HEA6 1VE7A 4Z9AA 2IYNA 3MYRA 4NJEB 1UMBA 3D2LA 4ZARA 3COJA 1RAFA 3OBBA 3L8GA 3HU2A 1T3SA 4CV3A 5C4MA 4OQQA 1RRCA 1PS0A 2IHKA 1W49A 3DPIA 4RIGA 3NOXA 2OLJA 4WLNA 2D13A 3IAEA 5CGZA 1OCEA 4CRWB 4B3GA 2YCBA 4GBJA 1CJCA 3IEXA 2NUAB 2MSDB 1O6CA 4DV0B 2DPXA 1XDZA 2ZIGA 3GAMA 4TMXA 2CFOA 3CEJA 2SECE 2PLFA 3G49A 1LV7A 5EEHA 1X0XA 3KYJB 4FMCB 3TYXA 2QX7A 1C8KA 3JRXA 3WKDA 1OH8A 4UFOA 3N3AC 1YBMA 1UWKA 1THMA 1F17A 3AOEC 2QLBA 3V8RA 5JE8A 1I7SB 3ZKAA 5GINE 2HW8A 5JFOA 4L2IB 4ZQBA 3NHWA 1GKYA 4D41A 4OQ4A 3HPQA 1Y8AA 1MVOA 1OWLA 2Q5JA 3OTHA 1U4SA 3IS3A 3LPCA 2NSHA 1QQ7A 1ZD2P 2C77A 2D0OB 5C1BA 1UBGA 3LUAA 4H4CA 2AJTA 3OTGA 1L5SA 3TINA 3BYZA 4CL3A 4DFDA 3RJTA 2JK1A 2NNWB 2ZAGA 2NMVA 3L79A 4F84A 2ADOA 3L7KA 2X3UA 1T0PA 1T8TA 2AFIA 2NW6A 4A27A 1U5AA 3M4ZA 1JR6A 4O4LA 3G9XA 1HYHA 3IUSA 1X7ZA 4GOJA 1UK6A 1YRAA 5DBGA 1G19A 3V4FA 4S04A 3AEKA 1QRTA 4Q1BA 3P9YA 1QV7A 3PD0A 3BTVA 3PEUA 5AW1A 4ZIRA 1DG3A 3UT5A 4DLTA 1PR0A 3G2KA 4D4HA 3T4PA 3C3PA 4ZVOA 4HWRA 3AQ4A 4IDNA 4BB5A 3O8RA 1ULBA 4RXUA 2I1WA 1IIBA 1L2TA 1LDNA 1UZUA 1ACJA 1I51A 2GBPA 2IP2A 1FDOA 4ZHQB 2AE2A 1K8RA 2Z4TA 2AJDA 4C3UA 4MHTA 1G1AA 3S2IA 3AM4A 5D7NA 2WTMA 4QHSA 2C5GA 1F7VA 1MORA 1PDVA 5LPNA 3L40A 5IJAA 1FMCA 2CNKA 1G8YA 3P8ZA 1MVNA 1WX1A 1S8OA 1RRVA 2AI2A 2W4MA 3FNFA 3BG5A 3GLIB 5LD2C 1O57A 3D4LA 3ZHTA 4BAZA 2XDAA 4F11A 4MVXA 1ZM7A 4IXMA 5H9VA 5LQDA 1M0TA 2FUG6 3LQKA 3SR0A 4QPNA 1AY0A 2W2VA 1DJPA 1DX6A 1GGVA 2R6AA 1G5PA 3EC1A 3G9ZA 3ZY2A 2NSYA 1P9LA 2FW8A 2IZ5A 2Q07A 3CF4G 3RS3A 5DM2A 4UM7A 2V6FA 2QROA 2GB4A 2WJVA 5EESA 3KJHA 1HZJA 2P9HA 1NXSA 1VJDA 1RQRA 3ADOA 3IO5A 5AKIA 3W79A 4O4IF 5JTUA 1COWA 4EKGA 1OTXA 4WMLA 4DZZA 7AT1A 2GVDC 2CLEB 1RP1A 4M9ZA 4V2UA 5GV8A 1JDSA 4YO8A 3LHDA 3RSFA 2KSQA 2QM3A 4H7DA 1KAHA 2V6IA 1YA6A 1V3TA 2VJYA 4NDNE 2PXAA 2R8PA 2YL2A 5A5VA 2C31A 1AKWA 3U7RA 3WKAA 4E6PA 3FOFC 1KK1A 1Z26A 3LFUA 3JR3A 3CG4A 4QYIB 5LZ5A 3W4KA 1GPLA 5CFMA 3ROKA 3GGPA 1Q0HA 4NMHA 4P7FA 3H6HA 5ERYA 2WF9A 1U4NA 1B15A 2WI8A 2AS0A 4B80A 3ZE7A 1XXHA 3HV0A 2XUDA 3A9RA 4WCFC 5LYJB 3DYVA 3MWJA 2JCSA 2F6RA 2F48A 2IXTA 2QT9A 2ZTHA 4IIJA 1YU9A 5K8UA 2ONYA 4Y0AA 1ECGA 1T9BA 3QOXA 1A9RA 4KKXB 3UNXA 3R9WA 4EHJA 1RQPA 5JYBA 2JCYA 2VYVD 5K0EA 1U3WA 1XDGA 1NF8A 5AKEA 4MRSA 3SG0A 1SBZA 2QENA 4E32A 1FNNA 5EYPA 5ALPA 4BDTA 4G37A 4NRDA 3EFBA 3ZR4B 2XQJA 4HX5A 5KWSA 5SICE 5BV8A 1SU8A 3SIXA 5IJZA 1FXSA 3PSAA 3CIFA 2XKAA 4QULA 5AKXA 2IWHA 3U3RA 4YUXA 2HPVA 5HOEA 1SC3A 3S8YA 3CGGA 1LF5A 5KJ6A 4S2UA 5D00A 3LQFA 4U3JA 3ILSA 3FG9A 4EGFA 1KK3A 4KDFA 1JHYA 4O2AB 5TGZA 2P3SA 1B43A 1V9LA 3HDHA 4A4DA 3VR3D 1JSZA 1XBTA 2C42A 2ZRBA 3R3JA 1I3CA 2Q1UA 3ZE8A 4U7DA 1GSAA 2VRNA 3BA1A 2IOHA 4YMVA 4BEBA 3MMZA 1GU7A 4XJSA 3H5LA 4FOTA 3C3EA 1M1YB 4MH0R 1L4EA 2C5BA 2ZUBA 4NCJA 4B35A 3V3KA 4PGGA 1OHHD 5CB8A 5FNVB 2A9QA 4RQTA 3IAAA 4IDHA 1AQNA 5EUCA 2C1XA 2CCGA 3RYTC 5C18A 1P4RA 4HKTA 5LQKA 1NU6A 4RORA 4L8VA 5TMEA 1QJ4A 3T1QA 4AECA 3ZU2A 4D6XA 1KAOA 3M9XA 3G2PA 3F5SA 2B5OA 3LHIA 1NP7A 4DNFA 1JFVA 3FYUC 3QFRA 4YI3A 2VLBA 2YMPA 1OVMA 3IO3A 4TKVA 3A1DA 4R8RA 3CW9A 5KQRA 4GX2A 4WZAA 3F9RA 2OOSA 2NN3C 4B4DA 1EESA 2Y1LA 1XEFA 1QQ5A 4MWZA 5JAZA 3U4DA 1G2OA 3O7MA 4W1SA 3KNZA 2HXYA 4MLZA 2G9VA 2VK2A 3DEYX 3INRA 1BRMA 1OTYA 1ZH8A 1SXJA 3K5IA 3SQLA 3G9TA 3I34X 1CR4A 2WTXA 3R75A 3VOSA 1JHQA 2HC9A 3NYWA 2FRXA 4P81A 2IYOA 3AM3A 1MOZA 4DQDA 4YECA 2ZG6A 1MB2A 1PQYA 4RFVA 1Z7EA 1NJGA 4PYJA 1NYTA 2O6HA 4KYVA 4R2WA 4C03A 5I9LA 4AKIA 4G0QA 1H2BA 3KZXA 4BNDB 3VNUA 3MOGA 1XB2A 4UEOA 4YP6A 1RPTA 5A9SB 2QSZA 3K1AA 5DGHA 1N7GA 2GBGA 2IPXA 3KX2A 2VH2A 3IERA 1AZSC 3LLVA 2JIOA 3O9VA 5KNCH 2GYWA 1WWKA 3U9TA 3C6XA 1B7GO 4QGHA 4WOCA 1VGQA 1CTQA 3H9JA 3R6WA 2H5LA 3OT1B 1AQJA 1LSUA 4DCNA 4F3CA 1R37A 3OIWA 3BMQB 4X92A 4Z8XA 3N2IA 1PR6A 2QUHA 4OO3A 1ZH6A 1OFUA 1OGIA 2K2QB 4L3WA 3H5OA 3H8SA 4NZPA 4XVCA 1C9MA 1N2XA 2QRHA 3R7WB 1ORHA 2ZBEA 2XF8A 3D3EA 3OC0A 1ENZA 3OZXA 2YASA 4MB0A 3AIMA 3N53A 4URFA 4RK0A 3O4JA 1O54A 2VHQA 3ZDFA 4M0PA 3V9AA 3GVCA 1V71A 4F7DA 1ESCA 4BEVA 5B30A 1K7XB 4PAOA 4HYYA 1OWPA 2UZ0A 3AR5A 2NSLA 4NBKA 3VYVA 2EJCA 1T3TA 3CO5A 3H2ZA 4Y98A 2CUKA 4EVIA 1CEXA 1IOZA 1CR1A 2IW3A 4U7FA 5AWFC 1E0SA 5G3ZA 3T7RA 5BMOA 3RYCB 1WXWA 3TIGA 1J09A 2YJTD 3BXOA 3DEJA 3DDCA 3HS3A 4A10A 2OGZA 3WRYC 4EKEA 2BGKA 5BP7A 4CQJA 1ECFA 2VJMA 3SBDA 3T0GA 4LWQA 1WCV1 5MFZA 1KRWA 4EAQA 5K0SA 4ENQA 2X0RA 3LUDA 1NOJA 3CRNA 3L77A 5A04A 3AG5A 3E9EA 1JQLB 2ZYWX 3N6RA 4D80A 3TGLA 3QVXA 5FUBA 1JSLA 3ZDEA 3BTOA 4R3NA 2IUUA 4DNQA 4ARUA 4GI7A 1ZW6A 1Z5PA 4MI1A 1YE3A 1HLDA 2UVPB 2BFNA 3E9CA 5AM5A 2ZRGA 4DJTA 5CT8A 4ZJUA 1GPWB 1OU4A 4IYRA 5EVJA 3AUTA 3C8ZA 2WM9B 3F96A 3GZ4A 2CFIA 1EFTA 1O95C 1Y3IA 3B20A 4KQ6A 4L5JA 4Q3KA 1ID8A 3IBTA 1F8FA 2HADA 1J1ZA 2WG0A 1U28C 1RFLA 3KJZA 4MA4A 3EDMA 4QSHA 2R8EA 5IUKC 4A82A 5JCXA 4CTMA 1U1IA 2VDLB 5DN9A 4LQDA 4F2DA 5L7WA 1IM2A 1LC3A 4EI2A 1T5TA 1U0EA 2GF9A 2VXBA 3GLRA 2JATA 4LVOA 2G1PA 3LKVA 1A3CA 4AQYB 1SIWA 2FK7A 4QE3A 4UZFA 3REQA 3IP7A 1SPXA 3I28A 2QORA 4OHBA 5F4ZA 3CRW1 1WS6A 3QVJA 2OB1A 5KWEA 2GN1A 4WEOA 3C24A 5A3VA 1CCWA 3FHTA 2WICA 3AI7A 2VT3A 3EJ6A 5FA5A 5A06A 4CU5A 1O97D 3D8BA 3SDZA 5HJ7A 1ZIOA 3A9WA 2B1QA 2ZK7A 3Q0IA 1E4OA 4L95C 2CV2A 1DQNA 3BERA 4X6YA 4ARBA 1Z38A 3JQBC 1N6HA 2CK3D 2Q9BA 1BYIA 2DLDA 2GETA 1RM4A 4CLHA 5BQXA 1FF9A 3MCZA 4ZOBA 4Q3LA 4PNHA 4TKLA 4WXMA 4P8RA 4HAUA 2OFFA 1F2UB 3WLMA 4MV0A 2NO7A 3K0AA 1LI4A 4HRYA 4OIFA 2WF5A 3P4UA 1RI2A 3SDBA 2RGRA 1YMVA 1KEEA 1IEXA 4J0FA 1T3HA 3TJZA 4ZVMA 1NVWQ 3FFAA 4KMRA 3B60A 1XE3A 3C41J 4ZQFA 3Q72A 3CCFA 3GPIA 5J2UB 4M1SA 3OCUA 2C03A 1JHMA 2HIMA 1VCOA 4IIXA 1W4CA 3MWYW 3PJGA 1BFUA 1POWA 3BE5A 3OEHA 4IUCS 5AVSA 4OJNA 4Y9DA 3KTFA 4EPTA 4J1SA 1TQHA 3R9XB 2OP0A 1XRJA 4QICA 4YRGA 2PT9A 4W5QA 3JCZA 1EWKA 3UBTA 4GE3A 3TQRA 2ZP1A 1BHJA 3D1JA 4MAMA 4C05A 5CB4A 5HVNA 5KQLA 2VSYA 1S0UA 3UXMA 4BNNA 3SZUA 1E9AA 3FUWA 3N8GA 1GHTA 3GP3A 4JV5B 1F8YA 3D6UA 2FWIA 1IZ0A 3AVXA 2XAAA 2XB9A 5ALJA 2F59A 2JCXA 4DCCA 1D5CA 4GSLA 4ENVA 4DCMA 3SS9X 2GAAA 5JSFA 4EHIA 4IDQA 4X3CA 1OFHA 2AXQA 1MC4A 2C5SA 2DU8A 3LLUA 4WI1A 4KXMA 1E9BA 2AQHA 2W6IA 4C0HA 1H42A 3C87A 5JY1A 1WAMA 4R4JA 5DU2A 1S01A 1YS2X 3U56A 1JQBA 1A9XA 2ZREA 1E18A 1L5MA 3B6JA 1B3RA 4GSYA 1KL7A 3KS9A 3IULA 3U44B 3UJBA 2YY5A 2QRVA 5DHQA 3R3ZA 4RZUA 3V34A 4ER5A 8ADHA 1P0QA 4DB4A 4KDEA 4M55A 1XPOA 2R68A 3QIAA 4BKUA 2ODAA 5DTQA 5FA8A 3QTLA 4ND6A 1XIVA 1W36B 4I5FA 1Q7CA 3AKDA 4KHPB 2GARA 2YXPX 3PUVA 2QN6A 3EDRA 5HIAA 2YW2A 1F9AA 2BKUA 2RDMA 3FCAA 3ROZA 3QGMA 2DHDA 3TR6A 4JL8A 1KI8A 4M9QA 4X61A 2O8DB 3DEZA 3GRUA 1BX3A 2XTNA 1J70A 1QZ3A 5IWAB 4QXRA 2W2NA 5H82A 1B3BA 2EZUA 1EVZA 1DXOA 2WIFA 1Y63A 2X6TA 4WFKA 2PKYX 2HSWA 2P67A 3FUVA 4MCJA 4PS0A 2X0DA 3U3JA 4MW7A 3V7WA 3PPYA 4LDZA 1JZSA 4G2NA 4EITA 3KV3O 4Y6PA 3I0ZA 5AHOA 4YY3B 2H17A 3BWCA 4AWXA 2B2NA 1OPXA 2EW8A 4MDEA 2W8BA 1ZR4A 3I92A 3L7JA 3N58A 1LX7A 3ZZTA 4LYJA 4ON9A 4RE5A 1JT9A 2ZETA 3SFZA 3K6SA 4WOPA 2HUPA 4NX2A 3GI1A 5CBPB 5MDHA 4KO4S 4Z9XA 1MX3A 2IDKA 2UZAA 3RCBA 2IIQA 3ZZMA 1JS1X 2AF4C 2BGRA 2HGSA 4F4JA 3WP0A 1XMQB 1T6XA 4P4LA 5KHAA 1LPSA 2QE7D 1CJKC 3NYIA 2R6CA 5FLEX 4MS3B 3CJQA 1E1YA 1UBNA 2ECFA 1ONNA 3JPWA 2FUEA 1AKEA 2JS7A 2RKBA 4LDRA 4TUYA 1SG9A 3EG9B 4L5YA 3WRXA 3BSWA 5HCIA 4A8JA 4TZ0A 5FT9A 4O4LF 5FWDA 1X7XB 1E5LA 3DNMA 2FF7A 2VSQA 3EGCA 3PTZA 2BOVA 3PWKA 4DM3A 2IBMA 2E5LB 2H57A 1YDWA 3A4IA 1OLSB 3ELBA 1O8CA 4X1IA 5D3KA 5JNVA 1IZ7A 1JHUA 4Q4HB 2HCJB 2ZYGA 1YDGA 4KWCA 3EIUA 4MRRA 3PFWO 3L8CA 4Q9KA 2HYIC 4OKNA 1VL2A 3EMKA 1Z4OA 2FUCA 1GPYA 1QLHA 2YXBA 1LZLA 3PXUA 4JBGA 4JGBA 4LE2A 5CYFA 4A8PA 3ZDYB 1DJNA 3ZCQA 3A4TA 4JLNA 2VXYA 5C31A 3G8BA 2ZU6A 2SCUA 2OM6A 5PGMA 4OGKA 3DOOA 3VYSB 3MTAA 4ZYZA 1UXGA 2B1JA 2ANCA 2C9OA 2OPBA 3FNEA 4I99A 3HXTA 1S2NA 4OUDB 5CH8A 4YJ3B 5HK8A 5GP1A 4N9WA 3VMFA 3OX4A 2XWJI 3NBUA 2PFSA 1GTZA 1H5NA 5HGJA 1F4PA 2F1OA 2VSNA 5BV7A 2UUCB 5CXXA 1OH6A 1AQYA 2B36A 1RLUA 2BM1A 1QP8A 3IUQA 4I4IA 5ALRA 3T94A 3TNLA 3Q3CA 5D01A 1TT7A 1HURA 1NMSA 5IYZA 4OLJA 2XMZA 3BTUA 2GFHA 1MC1A 2QR2A 3AIIA 3IKLA 2PSDA 3ITNA 4PCLA 3STVA 2V58A 4RFSB 4PO8A 1G7TA 3KBOA 2M6LA 1TPZA 1QPBA 3QE3A 2DP4E 2HRDA 4KSBA 5JRDS 3ABIA 2EGHA 3NALA 1OH5A 1Y5LA 2VWGA 2N42A 3OZSA 4JKYA 4PLHA 3MTEA 1T5IA 1OAAA 2QXTA 4HQFA 4I4NA 3SLKA 1QIHA 4J91A 1U0BB 1A5BB 4FW9A 4ETNA 3E23A 4ITUA 5DLQC 3ETEA 1SBYA 2VNJA 4E51A 1Y7HA 5DI3A 3NJRA 4RIIA 3LLMA 2AOUA 1PJQA 1R8XA 1W34A 2BGWA 3ESXA 2V3CC 2O20A 3CKKA 3IUYA 4HUQA 2R4UA 1OGJA 4MUEA 4UATA 3DMGA 2JAOA 3AV3A 2F43B 4PZ9A 4OGWA 5DKFA 1QQ6A 1WHSA 1N75A 1FK8A 4XLLA 5ESRA 3C2QA 3VR5A 1NASA 2PZFA 1D09A 3MXTA 3O8LA 3PDJA 4DMGA 5G2OA 1EGAA 1Y81A 3MEQA 2J0VA 3M70A 4M1ZA 4BO5A 1Y1QA 4N5NA 3PSHA 5TGDA 3B2NA 1IPHA 3H83A 3RJ5A 3T7DA 1G42A 4LHEA 4US0R 3EEFA 4A1FA 4AKEA 5JDIA 3IE1A 2BGUA 1WXFA 4LVNA 2I4OA 5BMVA 5HNKA 4CMBA 4YJGB 3T1YB 3CLHA 3FYUB 3D3NA 1G8FA 4IHAA 3WLHA 2GVZC 2B83A 2IHVA 5KNBA 4A36A 4RSRA 4PNPA 2CUNA 4UCFA 1CF2O 2OVBA 4PGAA 3GBVA 5TMPA 3KZVA 3PXEA 4JUAA 1M2OA 4P4NA 3I9OA 3MMXA 5CLQA 1GT6A 5CNJA 4Q7MB 4JYCA 3B6IA 1JHXA 1B14A 4CV1A 1C9YA 4WLEA 3ZY4A 2ZYTX 4DILA 1GQOA 4C06A 4ABTA 5TVKA 4R98A 2IPMA 1F12A 2YFQA 4Q1VA 1E4EA 1FU4A 4O2BA 4JOBA 5FO1A 1QGYA 3QMMA 5KYWB 3T5BA 5C7OO 5JNSA 1IY8A 1OFGA 3PIDA 4FFRA 1JYFA 1NBAA 2FPPB 1JDZA 3VKWA 2HWKA 4WDQA 1IDOA 1IG3A 1LPNA 2GEBA 3OFSA 5THXA 4C4OA 3G2NA 4BGEA 3RIMA 4BFZA 4AF6A 3F6SA 1NATA 2R8YA 4IGIA 1Y0BA 2D5BA 3ZY5A 4Y2YA 2C7QA 2J45A 2B4AA 3BL6A 2P5YA 2APJA 1ZNXA 5DRYA 1Z7WA 4ZPXA 3ZHVA 3G2OA 1CNMA 2NSJA 1IHPA 4G65A 3IVXA 2P2NA 4XRRA 3RC9A 4CR8A 3NPMA 2NU9A 1P4GA 2B1GA 5A6SA 4GL2A 3W6UA 4ZGGA 1NFQA 2HCRA 1TK9A 4E12A 1WV1A 4ECEA 1WP9A 2W58A 2O2CA 2XZTA 3O7WA 4LHWA 1QV6A 3BS4A 2OBLA 1DBWA 4ML3A 4MGYR 1KH1A 3BBPA 3TPZA 4BMXA 3DPUA 2PSJA 3KE9A 4KPUB 3KVNA 4FT2A 2BMFA 1TK3A 3NUZA 2VRCD 4NESA 2VA8A 3L4EA 4N01A 1JR2A 4MJ7A 1WMEA 3UC9A 4G1MB 1MRNA 2ISSD 1M67A 3A1CA 2ZJYA 1LI5A 1OLUA 2IK8A 2X8JB 2O8CB 1COZA 4P38A 1Z5UA 3VR4A 3OJOA 1QIMA 4FDLA 1BJTA 3E22B 2P9YA 4KQXA 3DTVD 2QTRA 4D8VA 1WCYA 2XUFA 4TN5A 4EYKA 3THXA 4K0KB 2A2ZA 2Q9UA 3ANYB 4TYMA 1RHKA 3SQNA 5KZMB 5J4YA 5IK2A 3WBJA 4DCPA 4MUKA 4D0NA 4YRDA 4DHEA 4FCVA 4NZMA 4YDRA 2WG1A 1EVIA 2XXJA 3IA2A 4KV9A 1M6YA 1QUFA 3FFTA 2O54A 5CD9A 4EB6A 4KXXA 3VZPA 5CURA 1FFWA 3GLGA 4IR7A 1RCFA 1P8AA 4ZI7B 5TLSA 3F97A 4QU5A 5IAAA 5JOQA 5H8WA 1SWWA 2X76A 1QAOA 2H7XA 1XZBA 3PXXA 3HCWA 3O31A 1VPEA 3SR4A 3CC8A 1Q77A 1PR4A 2XAUA 1P33A 5BSFA 4P7JA 3S2EA 5FPHA 2FSFA 2WEKA 3E1SA 3G68A 2XDQA 3PFBA 4URHA 1DRJA 3MS7A 1VJGA 1T5HX 3E70C 2CKDA 4FGWA 4GRDA 2JL1A 5EOVA 4G8BA 2AZMA 1K88A 2NUPB 5TQ2A 3RV4A 3FLAA 1G64A 4NCKA 3IELA 1ZJJA 2Q2WA 2XV1A 1DZIA 3PDHA 3SCZA 5AOBA 1J23A 2P75A 4BGUA 4P08A 1QF6A 5J2TF 3ZJ4A 4G01B 2FWNA 4YXWA 2ZYSA 4J3JA 3ZGOA 4NTZA 3KJGA 4HRXA 1UWCA 4WTOA 1B0AA 3PENA 1PFGA 1WCIB 2FPGA 3GJ6A 4Z1MD 1SCKA 2CNOA 2HZ7A 2I67A 3LDUA 3W2TA 3LGSA 3AI1A 4XXHA 3RF7A 4C07A 1DEKA 2QTVB 1RQLA 4ARAA 4NCXA 3RAPR 1TF2A 4KVZA 1F4LA 4E46A 1A4IA 3FDZA 3LWBA 2ADMA 3NWEA 3TIFA 1QUEA 3VYWA 3WLAA 1D4FA 1OZFA 2PA0A 2Y92A 3NNSA 1F8UA 2YTZA 5FFFA 2UYGA 4E09A 4XIFA 1U7TA 4DZRA 3W0LB 4EHBA 4YRLA 4L8GA 3V33A 4CFSA 3OLWA 4S24A 3OJCA 2X1HA 2H4WA 5B3JC 5K99A 2G0TA 5JARA 3DF9A 1DTSA 3ECAA 1W2HA 3G13A 5LQRA 4WESA 3CY6A 2VR1A 3KOMA 5CCDA 4DWOA 4EVRA 3IR7A 3V4LA 1C30A 2PMBA 4E5MA 2VCYA 3BD9A 5BQFA 3AQIA 2WQ6A 2NU8B 3V4VB 3GA7A 4NU5A 1CF4A 4W9MC 2RMKA 3I23A 4E08A 3MLBA 1BX0A 2XTJA 3DD5A 4RLSA 3PICA 4XLZA 3UQZA 1UPBA 4I8IA 3MGCA 5TF4A 4EABA 1QAQA 4U7JA 2VTBB 4GWKA 4YRZA 2C94A 5L3VA 1PNQA 1OX4B 4MYHA 4D6PA 2XJ9A 4LSWA 3RT1A 1E2PA 1VKJA 3SLRA 5HJEA 1JECA 3VKHA 3JR7A 1B00A 1F2TB 3TFQA 2Y0EA 3QVSA 4HH3C 4LRQA 4Y30A 1XCLA 1GSIA 3DVSX 2AFVA 4LJLA 1TJPB 2ZBFA 1QIFA 4LJSA 5K20A 4IZIA 3ANMA 4C4ZA 4Z49A 3FCYA 1CS4C 2VJBA 5BN5B 5AHRA 3L6RA 1XDSA 1UK8A 3OAAD 4MWEA 3E03A 1CUYA 4AP9A 2F1KA 2JFUA 1C3OB 3FNBA 2GASA 4OQLA 1I6MA 4DY4A 5BXYA 1WB6A 3RNOA 2HDWA 2ZXUA 4XJTA 1O6GA 1BKDR 1N5RA 4PRYA 5CX4A 3A3KA 4W9NC 4MV9A 1FSPA 1GV0A 4R1SA 1ODTC 2PS9A 5IFLA 1BS9A 1E8NA 5KJFA 1P2FA 4UDXX 2ANBA 3ER9A 3HCBA 3UC5A 3RIHA 4HGPA 1TEVA 3I1YA 2XQIA 3OJXA 1L8XA 3CNOA 3R7DA 3DDUA 2Q8NA 2JEZA 4J0QA 4ZGBA 5CB4F 1Y5IA 2WAOA 2E48A 3V1YA 1VIVA 3ZDQA 5FTWA 1X8JA 4C5BA 3WGMA 1MEOA 3S2GA 5JANA 1PR3A 3RGWS 5DN6A 3OPVA 1W47A 1GSOA 2ZGVA 3QNMA 5DMXA 5LZ2A 3DNPA 3BA6A 4K9SA 1X1DA 3P19A 1T1IA 4B6PA 1BW9B 3ICOA 4H6XA 3VTAA 2BMDA 4DIBA 3H5RA 3NJ8A 4FVTA 2ZANA 1KYQA 5I7EA 1OBFO 4A1OA 1JX6A 3CLRD 1X3SA 1GQQA 5EHGA 1SKMA 2O8BB 4A0RA 2XYRA 5A2GA 1OREA 1AN9A 3K6RA 4MYCA 3U9LA 4DDTA 3FJ1A 4D0SA 5BYJA 1QYWA 1QVRA 2X77A 2B30A 1GM5A 1W25A 1N2HA 2FRDA 2VKTA 4HNQA 3A6HA 4QREA 4RF4A 5IX8A 2WP8J 1S6YA 4IL5A 2PE5A 4UQPA 4N1AA 1JE0A 3I9FA 3RR2A 2QAGC 2ZLBA 4HDOB 1GYRA 3Q2KA 1ZMXA 5AK5A 1GFWA 2YFYA 3BCHA 4I50B 1TKAA 1WNTA 2IHBA 3VPDA 3WYBA 1UOQA 3NRBA 4K9LA 3OLQA 5HF8A 1I4TD 1KGSA 1B6SA 1RC8A 4L8YA 4LE1A 2FN3A 2PMKA 2H1HA 1AKTA 3GEBA 1VHQA 3I01M 4XEUA 4Y0NA 3UA3A 4BMDA 3F5MA 5HUJA 2GUWA 2IH2A 2O6LA 1CG6A 3WY9A 2A5LA 4PR0A 4G1VA 4CQMD 4DM7A 2NADA 3THWA 2HDNB 2I4MA 1G9TA 3PIIA 2A58A 1E3JA 1YK0A 1E9VA 1RWOA 1SNYA 1V37A 4OGLA 1FRVA 4LPSA 3WQHA 4YPVA 5HJ5A 1PGPA 2CFCA 2K6GA 3GG2A 5LCXA 2BVNA 1N5LA 2CLOB 2QLLA 1OW3B 1Z6TA 4ZRDA 1G8JA 1K5GA 1GPAA 4J07A 4IMRA 2PJRA 2FWMX 5TX7A 4AC9A 5CVCA 3GX1A 4TSRA 4XUGB 4JT2A 2CF6A 1LC0A 2BV3A 2W6JD 4HX9A 1RMYA 4V3BA 1MR3F 1NONA 1M7HA 1TF7A 2B2XA 3I64A 4KFTA 5IVDA 1ZWKA 4DRXB 1HO3A 5B7QA 1YR2A 1P18A 3TDKA 4CCAA 3BRWD 2H7CA 3G7NA 3NHMA 4AKTA 2FN9A 2DE0X 4HF7A 5FADA 5JLAA 3OFNA 2Y05A 2QPTA 2JZNA 3ESYA 2VNKA 3O1LA 4Q9HA 3H8WA 4GM4A 4TZKA 1IHOA 2PX0A 2E4VA 3K70D 2VYQA 3WZMA 1JBQA 1YZ3A 3U13A 2X13A 2VH5R 5BW6B 3S99A 3O3CA 1J5PA 4U02A 2XA1A 3FM9A 1P29A 3FZNA 3OZVA 4LYDA 5DEIA 3CCCA 1OYOA 2R3SA 5I5EA 3I72A 1UDRA 2CXHA 3HZHA 1KFBB 4I19A 5FPQA 4R0NA 4ZVLA 1R6XA 3FI9A 3PUWA 3P0JA 1XAHA 4G5QA 3L07A 1C2YA 5IYZF 4EJSA 2Q3LA 3GB9A 4ZU6X 5JUWA 4ZU3A 3ANLA 4RX1A 4Y2RA 5LBIA 3ABSB 2PH1A 1NXVA 2Q6LA 4E2WA 4OSPA 2ALJA 2FG7C 1SN7A 2CXPA 4WJZA 4CJXA 1WZ2A 2AN4A 5TY0A 3GFBA 3WBFA 3ZHOA 9LDTA 4HQOA 3P9QA 1XMIA 1K6XA 4R3WA 3SKYA 2KQUA 2PSHA 3KJFA 1KZ9A 1SCDA 1Z88A 3PR3A 5AXAA 4RNDB 1FDWA 2EERA 3AUUA 2IODA 3Q15C 3O4HA 4NCNA 1E1CB 1LSSA 3CNBA 1XNQB 4BE4A 5MGNA 4FINA 1E98A 2WU1A 4INJA 3BQMB 5AKHA 4TYPA 1R0BA 3B48A 1GRRA 3F8TA 4EJ2A 1Z2CA 3WJAA 1EVJA 2QQFA 3LHSA 2FKAA 1AGRA 3A14A 1ELOA 1QZZA 2FPIB 3NNDA 4GLOA 2OHHA 2VL7A 4UUPA 4JI6B 1KAEA 1R0SA 5DGCA 4ZRNA 3WAJA 3V8EA 4HLUA 3R74A 2PNFA 5KBYA 2PUVA 4IHQA 3HDYA 5DK4A 4H1UA 3BGSA 4PXAA 2VPYA 4GH5A 5ETJA 1WY5A 3H0CA 3TEFA 3ANTA 1W8IA 4OJQA 3G02A 5C51B 4EUKA 3MMPA 1CFZA 4UD6A 1JFLA 2IA5A 2Z6VA 3KJNA 1KMCA 3QMPA 4IMPA 4PU0A 1N6PA 5IWCA 4ZZ0A 5JR3A 2WFAA 5BMVF 4FYPA 1TJ5A 1SCUB 1WKCA 3KRTA 3O8QB 4CDGA 1HNWB 2VAVA 2G7ZA 2XXBA 4OXKA 1DO0A 4R6WA 2PWYA 1KQPA 5DHUA 5A4KA 4UXJA 2RC5A 5JSHA 4NYJR 2VDQB 1MW9X 3IIIA 5F76A 3HJFA 3VPBA 3OIFA 1DGQA 1E8MA 5D84A 2QNBA 4YRSA 4LGVA 2Q2NA 1KPIA 2CJFA 3DBLB 4TQAA 2YJ6A 3UUEA 1JLSA 3JATB 4HWKA 3SQDA 1CS0A 3QP9A 4J8PA 3AX6A 3BSSA 3PHBE 1D6SA 3LA8A 4MW0A 1FFBA 5E9QA 3VOBA 4NE7A 4O2BF 4LWOA 5B4VA 3CLUD 3TM4A 3LFTA 2VYCA 3A06A 3HBAA 4KPFC 1UC9A 4AS1A 1FPQA 3FMGA 3PNMA 5CVDA 2HSEA 4X1YA 1DUVG 2YY6A 2Z04A 4HAZA 2PZBA 3QKTA 5DCWA 1TA9A 1F14A 3ZGZA 4S1OA 4UOQA 1EDEA 2EKQA 1NF9A 1MN6A 2WPDA 3AGPA 4JC8A 4DG5A 3DV0A 3PE4A 1SOMA 2CBGA 3GRRA 1RZVA 2J30A 4DMCA 2OQVA 4F4DA 2WIGA 4LJ7A 4Q0MA 1JDBC 3ZN2A 4NDZA 1G8SA 3DOCA 3IEKA 2XA2A 2PIAA 3PQ7A 4M36A 4P2BA 2XOKA 3FDIA 3LBIA 4PANA 3ROQA 3H97A 4D5GA 4DLVA 1MB3A 2NVUB 4TRJA 1PL6A 5E4TA 1ULUA 3WLNA 1WB5A 1TE2A 2LCQA 3PK0A 1TO1E 5ECDA 1JIKA 1SOUA 2GLXA 4IJKA 5TEWA 1IATA 3KJEA 2AL7A 2QPOA 3ITDA 5L7TA 3ISVA 2GI4A 5LA6A 3C6BA 2HHCA 2ILVA 3ZY3A 4BO9A 4NK4A 3TAHA 5H9WA 1DBIA 2B69A 4QUKA 2XZLA 3RTGA 3OOEA 3PJEA 3EPLA 2P9JA 1ZHHA 3QQPA 2QRJA 3DO6A 1PZXA 3K1JA 3G7UA 3V48A 3FR8A 4CIBA 1X1CA 4G0ZA 4NSNA 1UKYA 2FMUA 3Q1KA 1WDKA 4IKEA 4LVCA 3ZZ0A 1DMSA 2R85A 2XSZA 2OBYA 2ZE7A 1U7ZA 2JBAA 8AT1A 3NDJA 1UWLA 4D96A 5T4HA 5EUMA 5LDDC 4LYHA 2ZAIA 3Q7QA 3BXEA 4FGKA 3DH0A 4M1TA 5DI9A 2ENWA 4P22A 5LMUB 1HRDA 1QC5B 4CDRA 3SZGA 1WL8A 3PFNA 3E5HA 3QUTA 4G0PA 5AW8A 2WLTA 3B1ZA 2HO4A 2HQ1A 2O57A 3D3WB 1RI4A 3N2KA 3QELA 4K1XA 4KXNA 4MV8A 4RS3A 5DYTA 5LQJA 3ZZ1A 3LPMA 4ZAZA 1N0HA 3HYTA 1QK3A 3O9ZA 4MS1B 1WDWB 5K51A 1JU3A 4RGVA 4AZWA 5CB0A 3SVTA 3DUFA 4YEDA 3WRVA 5K6AC 5ALGA 5A5EA 4BRSA 3SEZA 2AG5A 2YNMA 1GR0A 5KOYA 1MQSA 3UXEA 2P65A 4BQPA 2Z09A 4FZVA 4MV3A 5K8CA 1UBCA 2DJ5A 3A05A 3K0FB 4JYBA 5EG5A 1Z8NA 1YSCA 1MO2A 1MPXA 2DWUA 2OCGA 1AB5A 4Y6SA 5ES3A 1HDYA 1I6WA 2DPYA 3N2ZB 3NFYA 4WNYA 4NBWA 3NUGA 3TMYA 1BA2A 2BEVB 5TPWA 5J40A 3RJZA 2NVOA 2ONCA 1X9HA 4V1CI 1QDLB 3NM6B 2VYND 1JJBA 4ZVPA 3QU4A 1C7ZA 1V6CA 1KZ6A 4QX6A 2XGJA 3DAPA 4KODA 4Z7NB 3GW8A 3NX4A 5BSHA 3M6AA 1W8DA 1DRWA 4FCWA 3WIBA 3PLAE 1GAJA 4B09A 5K0JA 2WJWA 4AJIA 1YFJA 2PYZA 2ZITA 3MCAA 1KY3A 4X7RA 5EHIA 4PLGA 4BMZA 2Q0HA 3TPFA 3W9UA 4AY6A 5C53B 1O89A 2WYVA 3OQHA 3N2GB 3PGXA 4HEJA 4UBJA 3UCEA 2PSEA 2R86A 2ZT7A 3UIEA 1XALA 1ISJA 3NC4A 3I9V6 1E9FA 4KXUA 1R9NA 2WYOA 3AR3A 4FQ5A 4FC7A 4YQYA 5ALYA 5TGTA 3COWA 2H0RA 4BO2A 1KMHB 1F20A 1T9GS 4QRIA 2O5VA 3T7SA 4CIDA 5IH7A 4ND3A 4WGGA 1VHJA 4HEQA 1MUUA 3WIVA 4DRZA 1VE9A 3TL3A 1SOWA 3GY0A 3PQ6A 3AL3A 3NTLA 4LI0A 4L8WB 4LJ4A 3SYMA 2ZFUA 421PA 4NFYA 3QSYA 3ZXXA 4MPTA 1GARA 3CUSA 1SQ0A 1JRLA 1ZGZA 4QKQA 3HA7A 3QNWA 2FLKA 3VR5H 5ERGB 2VN8A 4KAAA 1N0UA 3K0CC 2R5WA 1SH7A 2L19A 5CG2A 1L7QA 2BFEB 5HEKA 4EGCB 1LK0A 4YJ2A 4AJEA 3JQ7A 821PA 2XE4A 3EGXA 3IHLA 1NW9B 4LDNA 1QFZA 3K1YA 4J3FA 2W6QA 2IW1A 4ZZ1A 4RPGA 4ZJPA 1UODA 5A02A 5LP1A 5KTMA 4UUBA 3CLSC 1K4MA 1LA2A 1TECE 4UVDA 2QP4A 5KNBH 2P2GA 3LC0A 2RAPA 3EEIA 2VDWB 1A88A 1QFYA 4IHJB 3OEEA 4N7JA 3BD6A 2D4HA 1JSCA 1SZJG 1DXHA 3M6FA 4G41A 1LTKA 1EP2B 2HU5A 3FTDA 1BMDA 1FLVA 1DTWB 1P1KA 4WKNA 4PNEA 1N2CA 2W71A 3F78A 2MYNA 3LT0A 3STYA 1UDBA 3EQ8A 4N54A 1T2NA 1WR8A 4BO8A 1QCDA 2OEPA 3GK3A 5JBQA 2TMDA 3IVGA 2J5KA 2ZJ6A 3RKSA 3QVGA 3R0IA 1UFRA 4I1RA 1UEIA 3W77A 3JYPA 2P91A 2C4MA 4B84A 5K45A 1CUJA 1JE1A 3DMPA 3WIOA 2LR0A 4W9RA 3BMOA 1KJJA 3DVAA 1BN6A 3GOHA 1NV9A 3ZI0A 2IITA 1DAEA 3TW8A 5LQNA 5C4IA 2DAPA 2WFZA 4GGMX 2VDOB 1QM5A 1Y9ZA 4PC7A 4JI0B 1DAPA 4MULA 2BGGA 1OFTA 1XD9A 2I55A 2O1SA 1Y7LA 2VZLA 4FOPA 5E3IA 3FCCA 3L0IB 1Q0RA 5F12A 3LUHA 3I73A 3ADKA 3UB4A 2QJFA 3WSWA 4EA9A 1MZPA 3ESBA 1H2FA 4NV1A 1XAGA 2XCLA 1SVWA 2J09A 4NPCA 1H05A 3WXBA 1T35A 3WXMA 4MWTA 3TECE 4DSNA 4M6WB 3SR3A 3LRTA 2PSFA 1F0PA 2UKDA 2AV6A 2WJJA 2GHIA 3ME5A 2Z30A 2I7TA 3WFZA 1R3UA 2X42A 3GJ3A 3WP1B 4US2R 3ZBPA 2FSVA 4CCYB 1QOQB 2DYKA 1JEQA 4E4RA 1LDMA 1TOAA 3D8UA 3FJOA 4UCWA 5DHSA 4PWZA 3TM5A 2WQ7A 1BWPA 2H1LA 4DANA 4LGYA 3VR4H 1K86A 4JROA 4QU9A 5DM4A 5CRIA 4RZ3A 3S2UA 3G5UA 4MINA 4D3SA 4RKYA 4S0XA 3D5EA 2VEDA 5DOVA 4RCVA 2ZSDA 3VV3A 1DCFA 1HNNA 4D46A 3STHA 1RJDA 4RMJA 2XB6A 3BICA 1D2AA 3V1LA 5J1SB 4MVJE 2MYTA 4J94A 1EI9A 1OAKA 3E5MA 3HR7A 4EW3A 5B7NA 2WMNB 5CEEA 1TTQB 1T1EA 1JKXA 1B93A 3R0XA 4PEVA 2WYIA 3RT7A 4TYNA 1Q3KA 3AEXA 1F4VA 1UBMS 5AVUA 1J7KA 4H7EA 3U0BA 2RD2A 1H9CA 1BEUB 3PR1A 5K8TA 1DNPA 3AEQA 5DLYA 3PA8A 2P7IA 4FUTA 1PVOA 1MX9A 2OQIA 3UUFA 4UTRA 1Y1SA 3CZMA 4TV8A 4F3YA 3GEMA 4NFSA 1H2YA 2GCEA 3S2ZA 4C3VA 4NU6A 1W36D 3ETLA 5ILOA 2F9MA 2CVFA 3FPLA 1K3FA 1DAMA 4L57A 5IDVA 4OI0A 2QNIA 3CUEF 4O8ZA 2MSCB 1C29B 4CMKA 4C1BA 1RAGA 1XPUA 3HR4A 4JBLA 4P6VF 1JB9A 5EWMA 1G291 1NP6A 1Y1LA 3N6VA 2YINC 4L1KA 2BP7A 2WZDA 3QEMB 3OF3A 1U7HA 3BMXA 5IVIA 4WERA 2F2TA 2V97A 4WVLA 4P4SA 2WWIA 1XVVA 2H1SA 4KPEC 3PQ5A 4TXMA 3WICA 4EG4A 4TRMA 4KSYA 3KKKA 5KTOA 1UDAA 2NYRA 3P2KA 2FOXA 3C3JA 5SZIA 1Z34A 3ENNA 3WSTA 4CKWA 5JCZA 2Y27A 1Z0KA 2O2IA 1NBIA 1XP5A 4B6OA 3RSCA 2EX4A 4B6JA 1MTOA 4NJMB 5C5CA 4JLJA 1MJFA 5IMBA 1GKLA 2R1TA 1O9HA 1ZEMA 1MEJA 1I7NA 3AF2A 5EKDA 1LDGA 2JJ8A 4W7HA 1P7WA 4CMEC 1L5WA 2ZYVX 3LECA 1UJCA 5CDSA 4KWIA 4ZP1A 2FZLA 3F74A 3HZOA 4IF6A 4U6NA 1PTJA 5T64A 4AMVA 4W1RA 2XGGA 5FI3A 1UDXA 2XW6A 1S4MA 1U8ZA 4A6DA 4QPJC 1Z0AA 4RZ2A 1S96A 3ZJ5A 4XWWA 3D6JA 3DR5A 4Z4GA 4X5OA 1OV4A 2O2ZA 2J3QA 3V8NA 3A3PA 4NOKA 5CUQA 4A0GA 1U2ZA 3D3JA 2Z9CA 4EPXA 5GZ1A 3W6ZA 1V8OA 1RZ3A 2BFDA 4EX7A 2GPJA 2PL9A 1VIAA 2BJVA 4IZ6A 3LPLA 4KE6A 3EA5A 3BCUA 3MJDA 4XJXA 4J2HA 3D6AA 5DSZA 4TVBA 2FPOA 1JTVA 4KR0A 3RU3A 4CG1A 2I78A 3H0EA 1OJ7A 1P9NA 2G5GX 2PVPA 3JWIA 3CUVA 4NYMR 2EYQA 1Q16A 3NCHA 2EHDA 4IS3A 4LZWA 4WLVA 3VAYA 4CM5A 3SSMA 3BWYA 2J0SA 4MV7A 2OZKA 4OXYA 1U80A 1YJXA 2QTLA 3RSGA 4GRIA 1V96A 3LHKA 4OP3A 2JFVA 3NQ41 4P98A 1E3QA 1GRNA 2JHCA 3LXUX 1NDUA 5ITZB 2EBWA 3AF6A 1PK8A 5NULA 4TXHA 5C1IA 1CBUA 1OA0A 2NO5A 2YYSA 5D8DA 3CIOA 3L05A 4F8YA 1PL8A 5A3JA 2J7KA 3WIUA 3OKPA 1P61B 1V0JA 4YDHB 4LNAA 4A7PA 2O2XA 4L3VA 1T2AA 3FPKA 4JI8B 4DR2B 5LYYA 1DWUA 3LVBA 4MKHA 1CUGA 4X44A 1AQLA 5A0FA 2X14A 3RWBA 3WQRA 4U39A 4ZKDA 1WVMA 2JIPA 3M6LA 5FWNA 4CQMB 2FWJA 2VVTA 1J0XO 4BLUA 1H6BA 1Z39A 1VPWA 5FEUA 4DG9A 2G83A 1AUPA 2VTDA 2J8ZA 1T2EA 3SOPA 1SCBA 1H8EA 1W93A 1X1QA 3RK4A 3CBQA 4LX8A 4C29A 2VZ9A 4D9HA 5HKOA 5I01A 5FBZA 4DVJA 4LOLA 1JWAB 3KOYA 3A6FA 3NR2A 1E4YA 4QHYA 5TEVA 3ND9A 2B61A 2JNWA 4LMBA 3V6MA 4RETA 4X95A 2O3UA 3ZCPA 2R84A 2GK4A 3O03A 3Q6IA 5BT8A 1NPYA 3JRNA 1XTSA 4X6UA 4RO0A 1J00A 2XUKA 4LC9A 4HBZA 2PR2A 3F0TA 3ULKA 3R3YA 2HCFA 4DJFC 4FHDA 5JAHA 3TLZA 1IUKA 3GEPA 2J67A 2XT0A 1GKIA 5AJXA 2OPHA 2C4UA 4DC9A 1E58A 4FE3A 4QGFA 4D4MA 3Q8LA 1V95A 3DKVA 4RKQA 1V7CA 1RWNA 3CZQA 3KOXA 3N0RA 2DLNA 4K9MA 4P36A 5K0FA 4KFCA 1ZOIA 4KMOA 2LGJA 1NNSA 1ZCJA 1XNRB 3TNDA 1KJNA 3IEIA 1LNQA 4H0FA 1SBTA 2A67A 5LOVA 4RTJA 3PHHA 2YHIB 3K70B 3AVQA 1U0SY 3B2EA 1W0KD 3FTFA 5H3CA 3A6ZA 1NT2A 1Z37A 3F90A 4PG5A 5IMSA 1DBQA 3PTAA 2D0PB 4G0NA 1NW6A 3EMBA 3D6VA 1L5HA 3RU9A 1YK1A 4PSKA 3KBBA 4QOSA 4FYVA 1XU7A 4BMOB 5IAJA 1Y42X 3LDHA 3OOSA 5HF9A 4CFZA 3R76A 1UFKA 2HSZA 1EVKA 1QV9A 2NVBA 2P41A 2ZI3A 2XR1A 1EHIA 4LEIA 3QXXA 4I9HA 1JIVA 2C2GA 1X42A 4CG2A 3GDOA 3DOIA 2IF0A 4QXPA 4LJAA 2OCXA 1U0TA 3GWGA 2VCHA 2HU8A 1YQXA 1H5UA 4MHOA 2JKYA 1QHFA 5EAIA 1I4DD 1ZAYA 1M0SA 1UBOS 4K6HA 3MINA 2WIAA 1FDSA 1M34A 2ZRMA 2W98A 2CCJA 1V7PC 4W5NA 1XAJA 1FNDA 1KY4A 2N75A 2B35A 1NJSA 1WF3A 4L4SA 1E2JA 1UWVA 3RUCA 1DTEA 4DA8A 4DR1B 1Z5ZA 5H5JA 2P2LA 4EI8A 1P7PA 4MK4A 3KR9A 4N5HX 1IB0A 2W2XA 4XD7A 1G9SA 2FEWB 3QVVA 5D3ZA 3WK9A 3I0NA 5F7OA 3FTPA 5FIUA 4ZMBA 3M9WA 1A9YA 4RLFA 1RU3A 4MWOA 5AJUA 5JJKA 1Z2AA 4DMFA 4Y6LA 2HJGA 1ZUHA 5KSZA 3VGJA 4J1NA 4NZNA 1QJCA 1JR3E 1W5SA 1U3TA 4FQ8A 1EWYA 5T7BA 5DBEX 1U02A 1P1RA 5C8VA 5LMNB 1O96A 4UTNA 1A96A 2B8TA 3HVIA 4DV4B 2B5VA 1M3SA 3PC2A 3H1AA 3PUKA 3A6EA 1TZKA 1U7WA 3QYPA 2JVIA 2XNHA 4O8CA 4MJ3A 3P9ZA 5EQJB 3UANA 4URVR 3BQNB 2YWFA 2WOOA 1WDLA 2FEOA 3JTEA 2W6MA 2AFHE 4FHFA 4WNAB 4ZQHA 3UY4A 3CINA 3K2QA 3CH7A 1HXHA 1OZHA 1T4DA 1P2SA 3DFMA 1GFZA 1Y9DA 3ZD9A 3LZ6A 3UHJA 4GO1A 1Z7GA 2DOKA 3YASA 4Q4AB 1WZUA 1XZCA 2FB9A 3FOAA 4GXNA 4F0JA 3V1MA 3C6KA 1LQUA 2ZPAA 3RVBA 4AF8A 1TAQA 3KB2A 4U2CA 4DQKA 5A4JA 5B6IA 2RG1A 3QJGA 5KDOA 4J16C 4FZ5A 2NXCA 4N40A 1LQ2A 1T8UA 3HRHA 4P32A 4HDMA 3GDFA 2VLIA 2OFPA 3E1GA 1N34B 4PX9A 5TT1A 2YBEA 1Z6ZA 1NNLA 4PRLA 4X60A 5EKXA 1Y4UA 4YP7A 3QYFA 5TS3A 1RVV1 4OYLA 2GPBA 1M7BA 4LBYA 2QP9X 2Y0DA 3TWOA 3EDCA 3JQGA 3GLSA 5LIRA 3CBGA 4OCZA 3BRSA 1NG1A 5ESDA 2QLFA 4PYOA 3ZQ4A 4W5OA 4BMYA 5HUQA 4DT1A 3GZNA 5CFRA 2Y0BA 1P1FA 1XCJA 3KSBC 3M3HA 1Q3HA 4B31A 3DSRA 1JA0A 4FI3F 1CUDA 5HBRA 1SA0A 2C99A 2DTXA 1OZGA 2ONKA 3L6OO 1I0ZA 3QHQA 2BBTA 3Q85A 2C7RA 3K6JA 4JLAA 3F49S 1DBRA 3SJAA 3TUJC 3ZE0B 3IL2A 2PJUA 4M0DA 2OCYC 3I5XA 4GUAA 3PNSA 3ZXYA 4KVFA 1JAIA 3LY9A 1J0EA 1ADBA 1AZLA 1P60A 1PG5A 2OY0A 3HC7A 3ASUA 1XWFA 5JNUA 2IBTA 3AETB 3A2LA 1DOHA 2J6BA 1KTIA 6Q21A 3BIOA 3CLTD 4MPJA 4MWDA 3GH1A 4OIMA 5JH7A 3ZCVA 2YXNA 2QB5A 2I0FA 2EFGA 3PKJA 1SCJA 4GKBA 4O4HA 1WZCA 3HJNA 2WABA 4G5SA 4EG5A 4ZOLB 3JVIA 4ZCMA 4DB2A 3BHJA 1YJ8A 2KS6A 1CXZA 1E1QA 2Q5OA 3E8SA 2Q6IA 2UU9B 1NE7A 2FLVA 4TV9F 4G26A 3KKQA 1OFIA 4BO0A 5INTA 1QHHB 2QPLA 1XQWA 1R1DA 1XZPA 2ZR7A 2YZMA 3DO8A 3RTBA 3UYLA 3K6SB 4CQNA 3KQPA 2RGCA 1RM0A 3V97A 1IQUA 5BVGB 2JH9A 4KYUA 3QQ5A 1BE1A 1X7YB 1L5KA 5LVAA 3K7EA 1WJGA 5BOVA 4UEQA 1PEKE 4BGDA 5BWCA 1WXGA 2JK0A 3ESQA 4E3ZA 5CLFA 5CCBA 3WR5A 1L9XA 3WYDA 1IUNA 1RVDA 2ZE5A 5BSMA 5DX1A 3C48A 4XX0B 4TTVA 3UATA 1A27A 2PN1A 1M54A 4WK2B 4U0JA 3RS4A 4GLBA 1R15A 1Q1BA 3TQHA 5JSZA 3EA4A 1FTNA 2NXEA 5ALFA 4MUBA 3UXHA 4C6TA 4I6JA 4L7QA 4MZXA 3DLPX 2XKJE 4F3TA 1JGTA 2JHPA 3FFWA 4RH3A 4HT3B 1VMDA 2O0HA 5L3SB 1V47A 2FMKA 1YZQA 1ZGCA 4WT7A 2ZJ5A 1PR9A 4DYDA 4IOJA 3IXQA 5ALDA 4MUGA 1DI0A 4WECA 1KKLA 1Y6RA 2FXVA 2G7MC 2IEAA 2Y68A 1PO7A 1UIRA 3CJTA 4KLRA 4B3BA 5LP6C 4NATA 1JQKA 4JFAA 5JI3E 3K15A 1U94A 4QBKA 4R01A 4DDHA 1HDCA 4JLPA 3RVRA 1N8TA 2I4NA 1C1DB 3N59A 1UKCA 1YDMA 1YUBA 1E4VA 1L1RA 8OHMA 5DRTA 3WYFA 1G5QA 2CJWA 2G6BA 2HFJA 3FWPA 3K9GA 4HY3A 3I76A 5I48A 5ESXA 1N33B 1M2JA 3KVYA 4KQCA 5AM4A 4ZAGA 5JCJA 4YCMA 1WKVA 4AQDA 1XCPA 4QXMA 1U63A 3W5VA 4F6RB 3PDIB 1GUYA 1F6DA 1BNCA 1M6HA 3IJPA 2HHHB 5JXIA 1PFUA 5FBLB 1NN5A 3BWEA 4HTFA 3LT5A 2FP4A 1DT3A 2QR5A 1K7CA 3F7TA 2TMYA 1J2TA 3K16A 4PX5A 3KSRA 3ZE2B 3H2JA 3ESCA 1PJTA 1ZQ1A 1I7QB 3E48A 1J33A 2Q2QA 3M1IA 4HDCA 5FI0B 2MSEB 3LI2A 3W9BA 3Q10A 1Y3CE 3ZK7A 3WISA 1VP9A 4CN8A 3ILHA 3Q12A 1X7GA 4JLUA 1CIJA 2ORED 3NWOA 4ZAXA 4BGVA 1BWSA 5MN5A 3WWYA 1A8SA 4IH9A 4UM9D 2V3VA 3RIXA 4PY2A 3U49A 1FIUA 1XTIA 1RACA 1WTCA 3EAGA 1UJ5A 2QTTA 2Y71A 3RFXA 1OB5A 3D4BA 4J1TA 1NKVA 3CHYA 1KEWA 3QPVA 2IYWA 4ZZ3A 1I94B 4GP9A 2I6SA 4QAJA 3WGVA 1PZEA 1JJIA 3O3MB 1C3LA 1QH1A 4JVMA 1A8QA 1RWVA 4N6OA 4F3NA 2QVXX 1V1RB 1TDJA 4LZAA 3L46A 1X13A 3MS4A 4YNBA 1RZRD 3K73O 1YZKA 3F4LA 2AZTA 2ZIWB 5JSKA 5EJ2A 1VZ3A 2V4UA 1FMTA 2V5UA 3PVZA 3O4VA 5AXDA 1GGKA 3O47A 1NUAA 1G41A 1QSGA 4TV8F 1L5ZA 4D56A 1P72A 3CF4A 4KXWA 3UM9A 3BVPA 1XA4A 3ZXIA 3VAZA 3N76A 3R5HA 3C1OA 4JK3A 1AMNA 3ZHRA 3B9BA 2UZ1A 3ZXUB 3FOBA 1ULZA 2A78A 4QSMA 2DR0A 3ORSA 4PYKA 2O5EA 4G81A 3AH8A 1ZHFA 2XUOA 3ND7A 4P92A 1B42A 3RS0A 5TPZA 2I6UA 5ICCA 1XVIA 1GITA 4UU7A 3R8CA 3QG1A 3QJYA 4EG1A 5HX7A 4HGNA 3I05A 1P44A 5EP4A 4YP0A 5J58A 1SXQA 1MDFA 5E3JA 1NZFA 1V4NA 4F60A 1U3UA 4Q6WA 4HNHA 3WADA 3LMKA 2NV6A 1O3YA 2ZR9A 2C5FA 3AEUB 3W7BA 3A2KA 4XTRA 3TOZA 3I04M 5IT4A 1I2ZA 1AKRA 1FX0A 1VE6A 3N75A 5JD5A 4RY0A 4JP3A 3VVBA 4H3HB 1NW4A 3HL4A 3ZG6A 1DELA 4D4LA 1PU2A 2EU8A 4P84A 4DLWA 2AMVA 5DYYA 1P5RA 2O8EB 4FEYA 3KP1A 2QN7A 4Q1AA 1BHO1 1ABEA 3K20A 2JPDA 4DUGA 1GQRA 1I7LA 1ZUD1 2IUFA 3OQVA 2XIJA 4IGEA 4FR5A 4WA7A 3MCUA 2XNDA 4J6FA 4F92B 3E58A 4MUXA 4AKGA 2QVBA 4K46A 4G0VA 2IXGA 4FFMA 5J5VA 2O1EA 4P58A 2PD4A 1RYNA 2YV1A 1N6NA 2XNSA 3FGOA 4PF1A 5P21A 4FYHA 3QKUA 4YC7A 4JI2B 2Q3BA 3PNKA 3MCWA 3N8KA 2JH3A 3M1YA 1CUWA 3R7BA 3E3MA 4GZ6A 4BRZA 3H2HA 1P0PA 3FVWA 1AVTA 3GZJA 3HXKA 5ALSA 4XZ3A 4BJ3A 1QORA 3NXSA 3VXKA 1ADJA 2HLDA 1HDRA 2J3MA 4KBGA 3USZA 1W73A 4BMPB 1B6GA 4HL6A 1FTYA 4RPLA 3DYBA 2FFQA 3TCNA 4INOA 5ADWA 4WBSA 1TADA 5F5LA 3TL2A 3ODGA 5GGXA 1P8JA 2BM9A 1GXSB 1X7HA 1YR8A 2VBIA 3FBGA 4H6VA 1RRKA 2I66A 5DIFA 3BHIA 1VJCA 1BXZA 3IQWA 4TSFD 1AURA 1CKEA 4NYMQ 3ZBUA 4YT4A 2JH8A 1J20A 1PD0A 3GPBA 2P7HA 4X8MA 1CNEA 4KRXA 1JEYA 4RLHA 5AKKA 3JQRA 4YAIA 4AI6A 1CJSA 3NWPA 2Y9MB 5CLJA 4WXEA 1TD9A 1VHWA 3N6XA 6REQB 2HEGA 1TGYA 3QVMA 4M8LA 3QU7A 1DJOA 4MITA 4O33A 1W85A 4A5OA 3L7IA 1QDEA 3MK31 4RJJA 5EIEA 1XP8A 1YHNA 3A1FA 2OBBA 1ZIYA 1EINA 1QKJA 1T24A 2BFCB 1L6IA 5EFOA 4EJ6A 1MZVA 2HDHA 3L4JA 2BTQA 2XWPA 3AV0B 4JX8A 5C4GB 4I1SA 2RSLA 3UOGA 1FP6A 5KC9A 1DAOA 3PKIA 3C3KA 1EA5A 3ZX4A 4D82A 3IIKA 5LLDA 5TQVA 1RBYA 1SRQA 1Z6AA 3CLKA 4FEGA 1Y1KE 4PPGA 4C7KA 2FMIA 3A4VA 3DE4X 4ND8A 1TQDA 4QQ8A 1WVGA 2GRAA 2HT6A 1I4OA 3CT6A 1QGUB 4GT1A 3J7AC 4IEFB 2IX9A 1V41E 2NM0A 1XR3A 1P39A 3GAFA 4IV5A 1X74A 3GUUA 2HM7A 3DBVO 3ND5A 1PT7A 1M6WA 4BVAA 2VDNB 3TRJA 2N1BA 4ZQCB 3C8MA 3C4QA 2NTNA 4BYMA 2W2QA 4RK4A 3DKRA 2ZI7A 2RIPA 3DWFA 1SC9A 3AHCA 3CZAA 1RYEA 1RYZA 4DCOA 4ER6A 1O9BA 3NYQA 3OMWA 7MHTA 3R7AA 1DSSG 4HDAA 5A71A 2YV4A 2YJZA 5BN4A 4RMNA 1WY7A 1GVNB 5KX5A 3HLYA 3H84A 4D9IA 4DLSA 5JQGB 3AILA 1TZCA 4R51A 2NUBA 1QHXA <