1YN6A

Crystal structure of a mouse mhc class i protein, h2-db, in complex with a peptide from the influenza a acid polymerase
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
273
structure length
273
Chain Sequence
PHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Lack of prominent peptide-major histocompatibility complex features limits repertoire diversity in virus-specific CD8+ T cell populations
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
total genus 71
structure length 273
sequence length 273
ec nomenclature
pdb deposition date 2005-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yn6A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1yn6A01
3O2DL 4O2CB 1YEEL 1KC5H 2DTMH 1MCOL 5E00A 4G5ZL 3CLEH 3BEWA 3OR7A 4ZXBC 3HFMH 1HEZB 4KVCH 4KKAD 2WY3A 2VN4A 3FFDB 3QQ9C 4R3SB 5MEQA 5MI0C 1CXKA 5CUSL 1SJHB 3IXAB 3LEXB 1NAMH 4K3DL 3SE9H 3VCLB 2W0KA 3BT2L 2WBJA 1ZT7A 2EEDA 1E4XI 4OZGE 5TQ2L 3GHBL 2WP3O 1OAUL 3NFNA 2HMID 1XF5A 1A5FL 5IEKA 3D6GA 1AO7D 2L7JA 5B8CA 4NN7B 5ISZB 1BZ9B 3QDJE 4Y5XC 1IM9B 9CGTA 4V1DE 1XGQA 1AXIB 3SE3C 1XGQB 4Z8FH 5BMFH 3F7VA 1ZHLA 1MSPA 2HT2C 4EUPG 4MAUH 3TIDB 4MQXC 5FUCC 1QLEH 4NO5A 1PG7X 5A2IH 2OI9A 2BJMH 5ESQB 1JI2A 3OX8B 5FDWB 4Z7OE 5IV2B 1WC7B 3BSZH 5J11B 3FMGH 3T0DA 5CGTA 4CVWA 1U8IB 5E9DA 5CEXB 2YPLD 5IQ7L 1CK0H 5HDBF 2NX5A 2JB6A 4OBSA 3T0WA 5DFVC 2ZG2A 3HAEB 4Z7OF 1P4BH 2P4AB 1AGCB 3DX9B 3FQNB 3HMWL 5JIHA 1ND0A 1WIPA 5JHDE 5JW5B 3CX5K 2WUCL 2ZUQC 2XQYG 1EBPA 3CH8A 4NUGL 1LK3L 4HKBB 4ORZC 4W6XB 5F7EH 1KTLA 1NDMA 4U6VH 1AY1H 4TSBL 5L8JB 1QR1A 2CDFB 4NN5C 3DURA 4XPTH 1OQOA 5F72S 1R3IL 2AEPL 4KJPC 4RWYH 1MHHA 3BKML 4NZUH 2APBA 1NGQH 2HLFC 4H0IA 5IW6A 1RULH 2ICEA 2Q1EA 2G60H 1H5BA 3S36L 5DT1L 5EU6D 4RNRB 4M6MH 4YO0B 4Z7QF 1JZ6A 3PGCB 4XI5C 5MP6H 3WUZA 3JXAA 5F9AC 2HKHH 1F3JB 3U0TB 1C08B 4Z7VB 1YY8B 5DDHB 1CU4L 3SHSA 4P2QB 4EIZC 2LFGA 3CK0L 3RVWD 4ZOBA 4Y1AA 1JGLH 3NH7L 4GRLD 5FF6B 5C09E 4PJIF 4D9RE 3ULVD 3MACL 3FQUA 1FYTA 2QKIB 3H9ZA 5FEBA 1KJ2B 3S34L 4U1LB 3SDCD 4JRYD 4MDJB 4PRPB 3RWHB 1F4WH 3A67L 3LN4B 1HQ4B 1BLNA 1TCRB 3EW3B 2EE6A 3PIQA 4PP1D 5FUCE 3JWNC 1AGFA 4WU5B 3RIFK 4ETQB 4WRLA 1CFNA 3KPSB 4GQ9H 4MAYD 4XP6H 2GUOB 2EIDA 1UQSA 2YXMA 4JKKA 4NQDB 1UEYA 3VXSA 2NY5H 3U2SB 5AG9A 4FN0A 1OF2B 3T65A 3WKML 4KI5C 5KS9A 1IGIH 1CICA 4F33A 1I4FA 2PXYA 2JJSC 1KELH 5C0CD 3EO0A 3T4YA 1VACA 4IMKA 5E6IA 1JHLH 1W8NA 1IGCH 4AMKL 4FZEH 5EORL 4G7YL 4B7LA 3KXFA 3C2SA 1MWAA 1U8PB 4I4WB 4ETYA 5IMMA 2BZDA 4Q9BA 1A3LH 3QA3B 3QFJA 4I1NB 1A7PL 5IJKA 2ZPKL 3QWOB 5IOPB 3L5WA 1S3KL 4Z7NE 5KW9H 1A1OA 1TZGH 3EYSH 2IAMB 4JG0L 4S2SA 3T1WA 1XGUA 3I75A 4I77L 4PJ9B 2ESVB 1KN4H 1BD2B 3O2WL 4GS7B 1D5MB 5B38A 4HS8L 4M61A 4DEPB 5F7UA 3B9EA 1A0QL 2O5XL 1BJ1J 1TZIB 4XVTH 1PYWB 2P8MB 3HUJE 2I9TA 4JHAH 3MRHA 4JO4L 4RAVB 1F4WL 5GS3A 4PLKD 3R8QA 4I9WE 5FECB 5DWUL 3OKOA 4Z7WF 3PWNA 2UUDK 3RX5A 3V6OE 4N1CA 3BOVA 2E27H 4D8PB 1P7KA 3RWEB 4HIEA 4JPWH 4DKDC 1CLYH 4AL8H 1TPXB 4PRNA 1PGRB 1A6PA 3TPUA 1CU4H 4WWKC 1MIEH 4YGVB 5DTFA 1EMTL 4GW5A 4NT6B 1F00I 5E5MA 4PRIA 4X83A 4PJFB 5EUOE 4WUUA 4HXBH 4CADA 1X7QA 1YMHA 1K8DA 4DUXA 5IW1B 3UO1H 4JDTH 3TCLB 5CBEA 2XACC 4FQCL 3BWUC 1IRAY 4NZUL 5JOEA 4MA7L 2L0DA 1NCTA 3OKKA 1MCBA 2DM2A 4JO2L 1JNLL 4U7MA 4HCRA 1N5YH 3RNQA 2DBLL 4IRJB 4PY8J 4UIMB 1KCRL 5D1QA 1I8MA 4PLOB 1INQA 3JVGC 3E6FA 5B39G 1EMTH 4Y5VC 5KVFL 5DMGC 3S4SA 3MJGX 1RV6X 5E2VH 4QGTA 1T2QH 2R1WA 3T2NH 1LQVA 1NGQL 1RZGA 3QZWB 5E8DL 1ZA6A 1H3WM 4NUJA 2VZ3A 5JIKA 1G9MC 1XFPA 3IJHA 3PWJA 4CNIA 1MRDL 2FD6H 4OUUA 4RBPK 3QUYA 4U6VL 2IGFH 1AKJD 3CFDB 3RHWK 3VFGL 3GBMH 3HC0B 4EI6A 4FQ2L 1S9WB 2G2RB 3VXOA 2V9TA 1I7ZA 3ZYJA 4JFFD 4ODVL 3TBVA 4NDMB 1HOCA 4OCXH 3VD5A 5EU7E 3L3HB 1QBML 5GGQH 3U7WL 2WQ8A 3QDJD 3PWNB 3G5YA 2OTUA 1NMAH 5BRZB 2QQLL 2PXYD 4X98B 1VFUA 1L0QA 4YDJB 4JEGB 3W82A 3TO4A 3KLSA 2VLJE 3LV3A 3ECBA 4GW1A 1RIVL 1CFSA 1Z0NA 4M93C 1YMME 4XCEB 3GRWL 3N06B 1FVEB 1FZJB 4LSSH 1XGTA 2ZSVA 1AD9B 3RRQA 3K2UL 3U1SL 4XMKH 5IJVA 4S0UC 4DN3H 3FT4A 3LEVH 4K7PX 3G5XA 2F5AL 5B3NA 4JQVC 2H1PL 4KUCD 2OJEB 1A1OB 1JHLL 5EIQA 1J0ZA 1NH6A 4J1UB 1BJ8A 3SGKC 1NDGB 1UEMA 4K55A 3I6LD 2NY2C 4PJIA 3V9FA 4B41A 3TO2B 1OAUH 5I6XC 1L8JA 4PUBH 1K8IB 3STLB 3O2DH 4NSKB 5TF1L 2RBLA 4OD2B 1CG9B 2JB5L 5F21B 2QSCH 4NRYA 4RQQA 4NNYB 4ZO6A 4NYLA 4UBDD 5IMOB 5MENA 1F58L 3W11C 1HQ4A 4P2RD 4V2BA 3BW9B 3FKUS 5FYKH 5GGRB 3VFPB 3TBTA 1NL0L 1W72B 2AV7A 2E9BA 4RMTA 3FQUB 1FH5H 3UP1A 3C5JA 3N1FC 3QUXC 4JAMB 1UZ6F 3LVEA 4OCWL 4KKLD 5DYOB 3R1GL 4MA8L 3WXVH 4GJTB 5FA3A 3OKEB 3GI9L 2F54D 3CSPA 2W91A 3FFCB 1Y0LB 1P5VA 3L5JA 1UWXK 4L5FH 4P46A 2OL3L 3TBYB 3WCYA 2OSLB 4KAQH 1QQDB 4ELME 3CFJA 3DRQA 3MRBA 1T2XA 5IFJB 1M4KA 4QXGH 1AQDB 3ZLQC 5FOBA 3H7BB 3RVXC 1NGZB 2RFXA 4XMPL 1QRNB 3STBA 5IFHH 5K9JL 5EZJA 3ESUF 4JY6A 4H1LH 3FCTB 1EEQA 4ACPA 1R3JB 3NIDE 3VH8B 1F6FB 1I8LA 4MQ7B 5C0ND 5I19L 4U6HB 3RU8H 3ULUH 5T1LA 4HJGB 1N64L 3BD4A 4TQEL 5C09A 5T5FH 2QSQA 4R4FL 3GSOA 4JFDA 4LVHB 2R0KH 4L8DB 3T2QA 3ZSSA 2OZ4H 5HGHA 2Q6WA 3GJFB 2WUCH 3QZWG 3STZB 3O2DA 4M3JA 2CRYA 3U7YH 1HCFX 1U8IA 4GRMB 2IPKA 5E9DB 2A9NL 3QEGL 4OF8A 4OFDA 5D72L 5E2WL 4J1UA 3RDTB 3VMNA 4Y16D 1V7NH 1GGUA 1ADQA 2P5WD 3T8XA 5FYJL 4ELKA 4FNLH 3H9SA 5IWLA 3V52L 3DSFL 2E7HA 2VRAA 2Z35B 4FHBD 4KV5F 1QVOA 5DVNA 1NEZA 2C7UB 4CMMA 3BP5A 1SMAA 3PGFL 1QLEL 1HHKB 3KWWB 4NQEA 1RMFH 5GHWL 1FGNH 4DGVH 5IW6B 4PV8B 3L1OH 1QPPA 4OKVA 2ATKA 1UJ3C 2ZOKA 3O6KH 1AO7B 1A02N 4LSUL 3WL9B 2R2HA 4HKJA 2YUZA 2EC9U 4HC1H 3C87A 3GRWH 2R1XB 5K59E 1L9MA 4Q6IB 1ZS8B 4WFFE 2EYRA 3AVEA 4LHUA 5BJTB 5D7LA 1MNUL 2QQLH 4RAHA 4NM4H 4U1HB 1AGBB 3ZZ1A 2Z92B 4N8VG 1YJDL 2DKMA 3PWJB 2FJFA 4LPVA 3FOLB 2VN7A 4DUVA 4R6UA 4O2CA 2F58H 3BD3A 4DVBB 5J6GA 5DD0H 4O4YL 1MCOH 2YD5A 1A6WL 4LLDB 3GSWB 5E2JA 5ENWB 2FGWL 4F80A 2OK0L 4DGIH 1QEWB 4UINL 4UQ2B 4YUEL 3F7YB 1TDQA 1HH6A 4FFYL 2K7QA 4IRJD 5TE6H 4FTVE 5HJ3A 5LG1A 3V4PL 2H9GB 5CZXD 3W2DL 2IADB 2KZ1B 2P5EA 4OZHE 5T33L 2A9NH 3QEGH 1ZK9A 1MCRA 3STZA 4P2QE 2XWTB 4NHCH 2W0FB 2BY2A 4PJBA 2VXUH 2ICES 1T2QL 1D6EB 3MRJA 4HK0A 4M7ZC 3O45A 1DJSA 1JVKA 3VWKD 1BZ9A 2A6DA 1JRHH 1XCQB 1IEBA 5CEZH 5DK2A 5L2JB 3NFSL 1JF5A 4P2QD 1PJ9A 4HUVB 2WINB 4DFHA 1KEGH 3ARXA 4OCYL 5IB2A 1NMCC 1CXLA 2DWEA 5BS0D 3O3BB 4HLJA 3MR9B 5E95B 3ARSA 2DQEH 5GS0C 4EVNA 1NGZA 2OQJB 3G6JB 2GAZA 4DGYL 3KPSE 1KPRA 1MJ8L 2NXZD 1MHEB 2XKUA 3QEUB 3W5NA 4BUGA 2NXZB 2H6PB 3FO9A 3ULSA 3GMQB 1FORL 3MV9D 2C7UA 3BZEA 4W6WB 3VFRB 4M7LH 2RR3A 3CVHH 3I6GB 4M62H 1FFOA 3DARA 3TBSB 1IFHH 2AJYL 1N7ML 3CJJA 2PF6A 1K4CB 2FX8L 2IBGA 4QHNA 4PRPE 2WSKA 1ETZB 1J0YA 3S9DB 5F88A 1FN4A 4HWEL 4RCAA 2UWEB 2NY5C 4G8GB 3AGVA 2FDBP 2AV1B 1I1RA 3MV7B 1OGAE 1IAOA 1UCBH 4PGCB 1SBBA 4YXHH 1FHGA 1A14L 5CCKH 1NLDH 2FGWH 1MCSA 3WNOA 4YR6A 3TZVC 5IB3A 1BPVA 5D6DC 2ATPB 5JR1H 4NO3A 1Q1JL 2BNRD 2WWKT 2XY1A 3BP7B 5EO0A 1HWHB 2R0LH 5GGSA 4KI5D 1KOAA 2C1PA 5IB4A 5T1KD 2VR5A 4BZ1H 2NW2A 4YHYB 2NLJB 5MEPA 4YWGL 1ZVSB 5DD6B 2PTTA 1WFTA 4Y4FA 4G7YH 3IDXL 3DRTA 4JZOA 3DV4A 2X4OB 3FB8A 1KPUB 1FGNL 2ARJQ 3EJYD 2D7MA 3X12B 2OBGA 3GGWA 2NTFA 3VWJD 2YPKB 2WNGA 5D2LB 5ACZA 5FAAA 4JFDD 2CDEB 2WBJC 4KZEL 4GSDL 1KIUA 3L5HA 1KLGB 4YQXL 1D5XA 4UIKL 5DFVD 3G6AA 1HHHA 5IBUB 1DLFL 2HJFB 3AY4A 1MI5E 2R2BA 3EZJB 1LP9E 4HGWA 5CJOH 1I7ZB 2Z8VC 3TJEH 4OLYH 1AHWA 3VXME 1XR9A 1FVEA 1FZJA 5I1EH 4LSTH 4W4OA 5D1QC 4I48B 4QXUL 3B4NA 1I9IL 1E6JL 2HAZA 3VFGH 2BOBA 5EOCH 3VFRA 3UAJC 5TDPB 4YHZL 1SHMA 4KJPD 1MIML 3IJSA 2KUTA 3PNWB 3NZHH 4Y1AE 1PKOA 4RFEA 5IVXF 5E24E 4APQC 2HT4D 3LKPB 1BF8A 4M1CC 4NNXB 4EJ1C 4M03A 2CDGB 1DQQB 1D5ZB 3C6LC 4QRTB 1AD9A 1U8LA 3TF7C 3PWUA 3HLAB 1IC7H 1QRND 2Q86A 5GZOC 5HHXL 3DETC 4KAQL 1RHHA 3MRNA 5EBLB 1A7NH 4FQXC 5GRUL 2Z0BA 4AEHH 3SDCC 1IGFH 3K2MC 3CIQA 4E5XB 1FZOA 4RISH 4YGVA 3TNMB 4JPVH 1S7XB 1MY5A 1S9VA 3SDXB 2YN5A 1HZHL 1IAKB 2C3HA 2FECI 5FHBH 1G6VK 5FYKL 4X80L 3K0WA 4KKCC 1WWWX 1F58H 4W81A 3AMLA 1YN7B 5GS0L 5CGMA 3G6DL 2J2ZA 4EN3D 5LGHH 5C7XH 5IM7B 1FGVH 4XX1E 3AREC 3RY6C 2ZUUA 4JPIA 1UCTA 4L29A 4JKPH 4OM0L 5KZCD 1I8MB 1N2RA 5MEOB 1OAXH 4IOIB 1WIOA 1AD0A 1RUQL 3QHZH 2DLIA 5IGXH 2C4FU 3P4NB 3MFFB 4NKMA 4JM4L 4LLUA 4UILL 5GGVH 1ORSB 4XPAH 5CEZE 2OJZL 3MRRA 3LH2L 1PDKA 4Y5YB 5I1HH 3U1SH 3PHQA 5C3TA 5FKPA 2FL5B 2VUYA 1AJ7H 3QQ3B 1OL0A 4PR5B 4XPFL 4NHUB 5DLMH 4Y88A 1A3LL 3L3IB 1D5ZA 3RZCB 1CXEA 1NSNH 4U1SB 4S2SB 5D9SB 2VLME 1JUFA 4MB5A 1UVQB 1HHJA 2DYPD 1H9VA 2O93L 1ZV5A 4PGZA 4QEGA 1F45A 3Q1SH 4ELMB 5D6CB 4QRTA 4RAVA 1PSKL 4FRWA 5DQJB 1KJMB 3L3JB 1ZWIA 3WFCH 5CEYA 5BVPL 1P5UA 1EFXA 1TZIA 3QRGL 1MFCH 3F12B 2B20A 2FJHB 2AJXL 4JO1H 5LAXB 3AXLA 4IBLT 3IKKA 1BHGA 2NY6D 3CDGA 5KJRH 2DYPA 2BCKA 4ALAL 1OAKH 5DFTA 3THMH 5JDJA 2Y1VA 2EH8H 1OSZA 4F7TA 4Q9RL 4PS4L 3WIHL 3BDBA 1N4XH 2YC1B 5F93C 3U4EA 1A1NB 3HE6A 1R3LA 1FSKC 1EAPA 3OB8A 3ZTJG 1D9KB 3PQYB 3VFTA 4S11A 4YNYB 1ED3A 3PE9A 1P2CA 5E5RB 3QFJE 1OT2A 3RVXD 1SJEA 4HIXL 2OM5A 4HIHB 5KAQF 1SEBA 4RNRA 4J7RA 3FB5B 4ISVB 4Y5VA 1PG7L 4OLWL 4UOW1 3KNBB 4HBQA 4OJFH 2J88H 4K3HA 2FATL 3DOSA 2XFXA 4LRNH 2Z4QA 4LOUD 3QNZA 5AWNL 2K7PA 3BDXA 1QFWI 3ARZA 4ELMF 3F58L 1I1AA 4LSRL 3L7EB 2VXVL 3VXSB 1UM6H 2VMFA 2J7LA 1FNEB 2GK0A 1CFTB 1MFCL 2OX5A 4G9FB 1XCQA 2R0ZH 4QLRA 4XBEH 5DEGA 4D94A 4MJ6A 4J3WA 1X5FA 4Z0XB 4F9PC 3T2OA 4QXTB 2IPUK 4KXZH 3U30C 4HLZH 4XAWL 5KSBB 1MFBH 3K8KA 5DJZB 4OF6A 4JZJB 4LGRB 4WDIB 4L3EE 3TZVB 1YEGL 4RAUB 2P5EB 4JFQB 4OGXL 2FZ3A 1ERNA 5C9JB 4I0PA 4NBYB 3V0AC 2DQFB 3ULUC 1TQBB 4EI5D 2ENYA 1F11B 1LNUB 5BZWA 3GKWL 4JFOB 4UIKH 2FX7H 1U3HC 1MEXL 3WD5H 1B0RB 3UTSB 3SQBA 4XPFH 1EBAA 1A7PH 3WSQL 1L4IA 2ESVD 5KSUB 4LLVA 3VFSA 1U8NA 2G9HA 4P23C 1K2DA 5L7XH 1RIHH 4B0MM 3A6BH 4WEBL 2AJVL 2F8OA 5GGTA 5C08E 1LE9B 3L3OB 1A22B 4UB0H 5E4EB 3CPLB 5GGVY 1G9EA 1E28B 5EWIL 3TBSA 3L9RB 3L3HA 5K9QI 3O41A 5DJXA 4E41A 4Z7VF 3I50L 1FNLA 4I13B 3HA0A 1S8DA 1EXUA 4OZIA 3V5DA 4ONGL 3WJLA 4PJ5E 3N85L 4JDVA 1EO8H 2ZUQB 3TNNA 1HHKA 3VG9B 2YSSB 4PDCE 4HF5H 3VXMA 4CVZB 4G42A 4AT6A 3RVVC 1U42A 1RUPL 1FVCB 2PYED 4H20L 1JBJA 3D3VD 4IRJC 3NA4A 5DURD 4NO2B 3WL9A 3IFOB 5D1ZD 5F1KC 3ARFA 3X3GH 2ARJA 1JV5B 2YD7A 2X5PA 3NA9L 5D2NE 4J8RB 5C0IB 1EJ6A 3VWJA 1UM5H 4WI3A 2VDPL 2XOTA 4TRPL 1DLHA 4N0UB 4X9IA 4OZFG 1I3RA 5J57B 1QHPA 3ZTNH 3NFPB 3O8XD 1W2KT 1QFUH 4U4BA 1DQDL 1RZIA 3QSKB 3CXHK 3AM8C 5GS0D 2UWEE 4G8GE 1C7TA 3CFBB 1QEWA 4UQ2A 1YZZA 4BM7A 1KYOJ 5MP6L 2HLFD 3EOAA 1J86A 3AFLA 4XVJL 4IHOA 3P77A 4OKDA 5KZCB 2R29H 1ZXQA 4I3RH 3IDMA 2NXZC 5HHMD 5C0AA 3G5ZA 1ZT7B 2X9WA 1G6RH 3SBWC 4I18A 1F4YL 5I15H 2HJLA 5IFJA 4JKWA 1YEDB 4MD0A 4LPXA 1U6AL 2AABL 1AY1L 4TSBH 5ICXA 3S96A 4IM8A 2GK0B 3WUWG 1RZKC 3EHBD 5F7LB 3MGOB 4NUGH 3VRJB 5GGSY 3T0VA 2DJSA 2R23A 3ARGA 5ESVA 1M05B 2OL3B 2PYFA 4OLUH 3DGCR 1LE9A 5FOBB 2B4CL 1CLOL 2ITCB 5K9OA 1OLZA 4WFED 3TZVD 2CJUH 2FLBT 2NY3D 4PJHE 3ILQD 1A7OH 3FMGL 1URLA 3ZDZE 5JPNB 4DWHA 4UINH 4X6DE 5GSVA 4YFDB 2Z8RA 1JN6A 4GSDH 4O4YH 2X4PA 3QDAA 3NGBB 5KANI 4Z95H 3ARYA 5C09B 2PTVA 1CFBA 3TLRA 2CO7B 5CMAB 1N8ZB 3MBEC 1GGCL 5F6HJ 3C5SB 1N59B 5EUKB 1A8JH 2FEEI 2DICA 3IU3A 1WCQA 5BMFL 5DVLA 2WIIB 2HN7B 5GSRA 3BZFA 4F58H 1GRWA 5KVEH 2VL5A 2BHYA 1X4YA 4FFVD 4X4YA 3I3EA 3MLVH 1C16A 2J3SA 4QT5B 2Y4SA 2NZ9D 1ZWIB 4JANB 3LKOA 4NNPL 5F9OH 1NBZA 5FV1L 4MD5A 4QTHA 4ZNCD 5JMOC 7FABH 3WLBB 1J1XL 1GGCH 2NXYB 3G6JF 5EC1B 5E2UH 3SKJL 4G6JH 4P3DA 4BFIB 1MI5B 4NZDA 3N1PC 1I3UA 4G59A 4F7PA 1H3PL 3BO8A 3MOAH 1BVLB 3P4NA 3LKSB 4RAUA 1MFDH 1OP3H 1J8KA 3U9PH 2XRAL 3D2UB 3FOMA 2JIXD 5DVKA 4YNYA 5DQ9A 4NYLB 4HKXA 3RTQA 5DD5L 2AJSH 3UXFA 3U7YL 1MQKL 4P5TA 4P2RA 3B3IB 5I75C 5I71C 3CVHL 4ZXBA 1DEEA 4LSQH 2GTZB 3KPMB 2V2XA 3MA7B 1LO4H 3BWAB 3RUGB 1DDHA 4WW1A 3A6CH 1J10A 2CGRL 3JUZA 4R8WL 2R1WB 4OSUL 2YRZA 1B3JA 5E8PA 3MUJA 3WNPA 3C6SB 3SOBL 3QEQD 4D0BA 1TVBB 4QHUA 3FQWA 2N56A 4XMPH 5IFHL 3IXTB 1ZT4A 4JHBA 4QXWA 4XPBL 2SEBA 4QXGL 5EZOH 2BC4B 4FQXD 4OFKA 2FL5A 2VLLB 1NDMB 3QUMH 5H94B 3BRGC 4ODXB 3T3PF 5TE7H 1DQDH 2VDRH 4L4TB 4JZNB 4L4TA 1RVFH 1F5WA 3K8LA 4NJAH 1NGWB 1TVHA 2D9QB 2NY3B 3HS0A 1G0DA 2DLEA 5BOZG 4F9LC 4WEUD 3C8HA 4HS3A 5D9SA 1DP0A 1VA9A 4WJ5B 4M1GL 4Z7WA 5DRWB 1ITBB 5I1IL 4K3JH 2PW1A 2X9XA 1FRGL 1FZKB 5HY9A 4ZQKB 3MJ7A 1AXSA 3OSKA 3RWCB 5F3BA 2A9MH 1NGWA 5DJ2A 4RFEB 4M43H 1KJMA 3DX7A 2X4NA 3JWOC 3QG7H 4A6YH 5HYEA 3FHQA 1HWGB 2GSIA 4YHNB 3MRQA 2QHRH 4KK9C 2XQBL 4YBLC 5ESAB 3VE0B 3PJSB 5EO9B 5K59F 1ZEAL 4X6EA 1FNGB 1CE6A 3LKNB 3O6MH 4P2YA 4NQSA 5AAWA 1CN4A 4D0CA 5TPWL 4KU1A 4KK9D 4BJLA 2ZZUT 3BPLB 2PR4H 4GBXD 3DXAE 4JN2A 1P7KB 1SVCP 3VE0A 15C8L 5E9DE 4WW2A 1UJ3B 3MRQB 1DDHB 4JRXA 2WBJB 2HLAA 4WW1B 3ZDXF 1FL6A 4ODWB 5BS0E 1KTDB 2DDQH 3PDDA 5SWZE 3P9LA 3NCYS 3FO1B 1B4JL 2C9AA 3FO1A 4PJAF 2BP3A 3VXUB 5JXAL 2ZUXA 5T5NG 3MZTA 1J8HB 3FN3A 1RU9L 4GRWB 4XCCL 4X0KA 3VMPA 4WW2B 1CDUA 4BZ2H 1DANT 4JHWL 4ZODA 3QT2A 5EIIB 4QOKE 2WAHA 1KJ3L 1V7NL 1DVFD 2CQVA 3MXVH 5JPMB 3BRDA 4XXDA 1QBMH 5GGQL 3U7WH 3S8WA 1TQBC 1UXSA 3PQYE 2Y5TB 5CHNB 2GHWB 3WFBH 1DVFC 2R4SL 2J5LB 2HKFL 1RK0A 1UQSB 1A1MA 1MFBL 5HYSA 1DQQA 2FSEA 4RDQF 2AABH 3NN8A 3E8UH 3MLRL 5DFWH 6FABL 1RZJL 1WFOA 2MPAL 3SJVE 3TN0C 4ZS6D 5DRWA 3F58H 4KKLC 2FLRT 2UWEA 4G8GA 4X7CC 4OM1H 4IMLA 3J7HA 4LF3A 4L3AA 2YOCA 2YD6A 3IDIA 3WLWC 5IG7A 2PO6A 5DEFB 3MRHB 2R15A 3P73B 2CMRL 3QA3A 3QFJB 5H35B 2F74A 4NO3B 5DDHA 3DX8A 4KK6D 4TNWF 4MA7H 1YQ2A 1A3RH 2CUMA 2V7HB 3PWPB 4IJ3C 5A40E 4PGCA 3NCCB 1C16B 1KJ2A 4OCWH 1GGIH 5IB5B 5I1GH 4OFVA 2R2EB 4FQLH 4HUMB 1JK8A 4FOMA 4XHJD 4Z0BH 4S1QL 1JGUH 3L3DA 1XGYL 1G0XA 2I5YL 2CDFA 4TTDC 2YEZB 2IBZX 4OUOA 4YHLL 2C3WA 4P9ML 4W68A 3IT8D 2CIIA 1A6AA 1S78C 2JB5H 5FHAH 3VXSD 4ODUB 1MFEL 3WN5A 5C0AD 5I1KL 1ZHBA 4J4PA 1BLNB 5KSVA 5LQBH 2X4TB 4PRPD 4GKZA 1KGCD 2VERN 4Y16C 1U93A 2R39A 3TT1H 5GZNC 1S7RA 3RZCC 1U3HD 1CLZH 4TSAH 4OCRL 5ACZB 3L5XL 5DJAB 1JPGA 1T7YA 2GJ6E 5ESQA 1P4IH 4OV6F 4P23D 3PV6B 4YEEA 4PJBB 4CDHA 1DLHB 1BAFH 3S88L 1L6XA 4NBXB 2GJ6D 2PTTB 4QHKI 1AIFA 4OQTA 4PY7A 2H9GA 2VE6B 3L5XH 5I1JL 5D5MB 1DCLA 3BN9C 3QXAB 2E8ZA 3O3BA 3ZDXE 3A6OA 3WJJA 4MXQA 1KELL 2HA1A 4NKDA 1G7LA 4NRZA 4WO4B 3VRIB 4EEEA 4YH6A 7CGTA 5KBNC 1X5JA 3BH8A 5IVOA 3BN9D 3O4OC 1JNNL 2D9CA 3VWKB 1WBZA 4QKXB 3UTQB 3CCHB 1U8OB 2BHUA 3TP4A 3D3VB 2HVJA 4LLWB 1K2DB 4YHPB 3RWDA 1BQHG 3G5VA 4N1HB 1FZMA 3UYRL 1S9XB 1JF1B 2J8UF 3MV8A 3MYJB 1P9MC 3MCLH 3U9PL 3GSQA 3RBSA 1ORQA 1HXMA 1JNJA 3N1MC 3MOAL 4CW1B 1CQYA 3L9RA 4KHXL 4HV8A 5T3ZH 1MLCA 1KFAH 2ZSWA 3QH3A 5AWNH 5FHBL 1MLBB 1L7IL 2W0LA 4HUVA 4UMGA 1QSFD 3OKLA 2VDNH 4OJFL 1V8HA 2YPLA 3WDJA 4JPVL 3KPTA 4GMTH 5AEAA 3SO3C 1VB9A 1N5YL 2EDLA 1TJHH 4OZFB 4U6XB 5A16A 4JO2H 2MKLC 2VDOH 2XN9E 3HG1B 1OOAA 2Z35A 1U3HA 3SDCB 3UTPE 3MV11 1VGEL 2XKNB 1ADQH 1C5CL 1NCWL 1JV5A 3PP3K 3O3DB 5D7JD 4GG6E 1QRNE 4ZTOL 3FQTB 2Q87A 3PHOB 2H8PA 1U93B 1XF1A 1XCTB 1MIEL 1FYHB 3VFOB 1YEFL 3OGCA 5D7JC 4JZJA 1MCHA 5TH2A 2BERA 1PX4A 2YPVH 3IDNA 3LQMA 2BNRE 3JV6A 1SEBB 3MCKA 5MHSE 3UTTB 1UJTA 5SWSD 1QQDA 4MJ6B 4ZNEA 1BVZA 1NFDE 1ZGLM 4M7LT 3GI8H 5EOCL 2VL4A 3GIVB 5HBBA 5SWQB 2H32H 1GOHA 4JHAL 4JFOA 5BVJA 3L7EA 4HSQA 3OKEA 2HG5A 4QRRE 1JPGB 5EZJB 2XXCB 1I1FB 3Q0HA 4YGAB 3HMWH 3KNBA 3QIUB 1T7WA 2WBWB 3LN9A 4GRLA 4AG4H 3MUY1 4XMLL 3SEPA 1S7WA 1RUKH 4X6FA 3JZ7A 3MRBB 4X4ZA 1RJLA 5F9DC 1HEZA 1WBXA 1NKRA 4OZ4B 4KUZL 1FAIL 5J6HB 1AGBA 1B0RA 1M71A 4O2FB 3T04D 5DZLA 3K46A 3KG5A 2DQTL 5H35A 4MLSA 2GCYB 3V6OA 3MJ9A 5F8QC 1QR4A 4MQ7A 1TMCB 4NC0B 4FABH 5F6IB 2VOTA 4FQJH 4XPAL 1KJ2L 4RRPG 1VADB 2AXGB 5D7IA 1DQMH 2LU4A 3FT2A 4GO6B 5CINL 2HMIC 3K80A 2YMXL 1OW0C 2P43B 4FQHA 3U79A 5FO7A 3V0WL 1GC1L 1C5CH 4QYOB 1JPFA 3UDWA 2Q76A 4KZDH 5HHNB 1MJUH 3UTSD 1QFUL 3QIBB 1OHQA 4ZSOA 3CVIH 3P0VH 4P23B 3LHPH 3WO4C 4HJGA 3CFEB 5E0QA 2AJZB 5CWSA 3PWPA 5HDOA 3OAZK 4OZHF 3DSNA 4QRUB 2YEZA 4K9EH 5CD3B 1QACA 2GSGB 4HK3J 3V95A 1JZ8A 1V3LA 3OMZA 1IGML 3BX7C 2VC2L 1UXWB 4JQVA 4LIQE 1OPGH 3TO2A 4R7DA 5GRJL 1ES0A 1HHJB 1T1WB 4X7EC 1A1NA 3ETBF 3TO4D 1U3YA 1YN6B 2BVQB 1FDLH 2FJGA 3OV6A 1HZHH 1UCBL 2JELL 4HUUB 4FTVB 4LNRB 4AQ1B 1WLHA 2DYPB 4WENB 4M48H 3ZHDA 4MA3B 4XCFL 1NANH 3TO4C 2FYYB 5IMOA 1JI1A 3E2HB 5D2LE 2CIKA 1YEKH 4PLKC 3WFEL 1Y0LA 4LRIA 3RUGE 3U6RB 3ILPA 2VUOA 1DZBA 2CRIA 4MMZC 3DROB 3M1BB 4JFDE 3DVGB 4JHZA 3R8BB 1PQZA 2CD0A 2DL2A 2ADJB 2XG5A 1B0GB 1F02I 3DPBA 1UXSB 2R4RL 3QIWA 2J6EA 4FQJL 4UNVA 3VXTA 3E6FB 3BKCH 5D71H 3DRQB 5J9PA 2FB4H 3ULVL 1G7JA 1R3IH 2KQNA 1KLUB 2W9EH 3HPJB 5EN2B 5IR1B 1Z5LB 3KPPB 1YN7A 3SQOH 4JRYA 1V3JA 4TSAL 2NY6B 3O3EB 1FG2A 2VXUL 2NY3C 4Y19E 4G80B 5I8CB 1K85A 2C3VB 1YPZA 3CFKB 1T0MA 2JK5A 5DMGD 2DKUA 3QWQB 5HYQA 4XNUL 2YK1H 1OAZL 4XAWH 5B4MD 4WFGE 4NQXB 3HMXL 3C2AL 1U41A 2LTQB 1BIIA 2DM3A 4PGBB 4O58H 1K5NA 4MAYC 3MBEA 3Q3GA 4FQIL 2BSSB 3MRIA 3T0AA 4P9MH 5EBGA 4DZBA 5HYSB 2B0SH 3BI9X 2Y06L 4UQ3B 3SKJH 2IALA 5C0FA 5CSBA 5IG7B 5FM8A 3QCVH 3MGTB 5I8OH 4G7VH 4L8SB 4XNZC 4EUPA 1BQUA 5CHNA 5C0GA 1PZ5A 2K1MA 4PB0H 3SBWA 4LRNL 3UYPA 1ZT1B 1JUFB 1K5NB 4WFHE 3GHEH 2IC2A 1CFQA 2FIKB 4LL9A 4PGBA 3SKNB 2LAGB 2NZ9C 1S9WA 2M2DA 3MJ7B 4NQCD 1N3NB 3HRPA 1UB5A 2ESVA 3GHBH 4AQOA 2W9LA 4NHUE 1FCCA 1YQVH 2WMPA 1T0NA 5HD8C 2CKNA 4F9PA 4GQPH 3UJJH 4G3YH 3L5WB 1G7MA 3MROB 1QNZH 2BY1A 3ECBB 5I1AB 4YX2H 1Q0XH 2ADFL 3U6RA 1XIWA 4KRNA 5HD8D 5F3BB 3SE8H 2VDNL 3RTQB 3CLEL 3NCJL 3O8XA 4CRPA 4NWTH 1LDPL 1X5XA 1S7XA 3PUCA 5FUZH 1Q72L 2DN7A 3O6LL 2NY2D 1JFMA 3LKSA 4JB9L 3P2TA 4HWEH 1OVZA 5D1ZB 2V2TA 1TZHA 1MREL 1NCAL 4S1DC 4PJHA 1FC2D 1SM3L 3KXFE 4P3DB 2Z93A 4Z7UE 5IM7A 4N5EC 3GGWB 3NIFF 4WUUB 1IEAB 4GG8B 3MNWA 4P4KC 2RB8A 1JFQH 1J5OL 4KQ4H 1UJ3A 4F37K 4MDIB 4GBXA 2X4OA 5E08H 3TN0D 3DRTB 4JZOB 4QHLB 1MWAH 3QO0A 3S4SB 1HI6A 3DJ9A 3RGVB 4YBQD 3MRGA 3SGEI 3HB3C 3QHFH 2YRPA 1CDBA 3KHQA 4NWUL 2YUVA 1F2QA 1FVDA 3C6LD 4G9DA 1C1EL 3JTCA 3AS1A 4Z18A 3FO0H 4XVJH 3TA3B 4GW4B 4M9PA 3BZDA 3FHAA 3KJ6L 2OJZH 2Y23A 3BP4B 3MBEB 5DK0A 3B3IA 5SX4H 4CJ1A 1NMBH 3T77A 5EN2A 3DVIA 2BVOA 5F70A 5CSZA 3VXRE 4H88H 1ZSDA 5C2UB 2BNRB 3MO1A 4LEXH 2H6PA 4FFZL 1HHHB 3T4YB 3H9SD 3LKPA 3LOWA 3TT3L 1WWBX 2C3VA 5IKCB 4KKCD 4QRPE 4JREB 2RIKA 3OPZL 4HIJA 3PNWA 3V4UL 1JZ2A 4HGMA 5TQ0L 4HD9A 1I85C 2GYSA 4JFFB 4M6OH 5EIVA 1T20A 5LGKA 4XAKD 5I18L 5A2JH 1Q9OA 3ARED 4LFHG 4LCUB 5TFSL 2AW2A 4DAGH 2EXWD 4M43L 1DBJH 3FL7A 1ZAGA 1XF4B 4PRBB 2APTA 2J4WH 1U36A 2D03H 1IKNC 1BD2A 5DUML 5J7CC 3C9NA 5DMJB 4NFBA 4MZ3A 3D39A 2JIXA 1C5DB 1HSBB 1R5VB 1YN6A 2BVQA 5E70A 5IW3A 1LP9A 1G7IA 3O0RL 2NY0B 1RVFL 5DEZA 1ITCA 3C5SA 3T09A 2VDQH 5KSBE 4PJBE 1BZQK 3VW3L 5TE7L 1Y6KR 1TNMA 4CN6A 3AROA 3IDJB 3X12A 5C92A 1U3HB 3SCMC 4OIIL 4DFIA 1YEHH 2CKBB 1EUTA 4R4NC 4Y4FB 4P59H 1FFQA 4LNRA 1I85A 2VABA 5C0IA 2G5BA 1AP2B 1RZJH 5TH2B 2VZSA 3L3KA 3QUZD 1BQHB 1G7PA 5E2WH 4MMXC 3HMXA 5J4MA 3FZUD 4OIBA 5GS1B 5IVZA 3BZ4B 3ZT7A 2RCSL 2I26N 2HTLD 1U58B 4OLZH 1GAFL 3QUZC 2COQA 1Z9SA 3CSYB 5T1KA 4C54A 3PDOA 5HGGS 1RJYA 2AJSL 4ERSL 1T4KA 4HK0B 1BFSA 4F57L 3L3GA 4MXVE 4UDTA 1ND0B 4U1NB 5D1ZC 3VGGA 1WBZB 3UTQA 1T80A 2EKSB 4MXWL 5E2TL 3WFHA 2X4UB 3DI2B 2Y07L 4U1KA 4X6FB 5I30L 1J1OH 1DQTA 1RD6A 1PY9A 3GMOB 3EOAB 4XCCH 1IM3A 2XZQH 3GEWB 3OG6B 3IGAA 4PY7B 3S4SG 1J1XH 2P42B 2DBJA 4OAWB 2V5MA 4G3YL 3CMOL 4IDLA 2VQTA 4TUJB 1F42A 2VDQL 1S9XA 2D7TH 3DXAD 1WCBB 4DKAA 4L5FL 5HPMB 1IC4H 2XT1B 3BPNB 4JDVB 3FONA 1UM4H 5CIPB 1YJDC 1U8OA 5EBWB 4XHJC 3R1GH 5E8OA 4D9QD 1PD6A 1N4XL 1MLBA 3OXRB 4X4ME 1R3JA 1MCIA 3CSBA 2IPKB 2AS5M 4J6RH 1EUUA 3IF1B 3HTLX 3JWDL 4KTEH 5C0AE 3GSQB 1SJXA 4JZJC 3L3OA 1X44A 4LARL 5CIPA 1AKJB 2VABB 5TE4H 1NAMA 3V6FB 4UT7H 2AQ1A 1KCSL 2G75B 2HTKD 4LASL 3K74B 2XZCH 4QHMB 3ARWA 2JCCA 4PJGF 1IBGH 4YDVB 1J1PH 1NEZB 4XGZB 4J3XA 3IFNL 5GZND 4Y8DC 3BIKB 5IFAH 3UMTA 4TOYH 1TQCC 4N1EA 1A4JB 4JQIL 4X7DC 2ZKHH 3TEUA 5ITBH 3ULUD 5ELIA 1EGJH 4ZD3H 5D7SL 4M1DH 4WHDA 4LEXL 5CJBA 1ZOXA 4JVPA 2W9DL 4LDLB 2G5BB 1CGSH 5SV3A 2J8OA 3RJQB 4NO2A 4ZFZB 3WFDL 3MLTB 1AIFB 3QRFM 2ADIB 1DTUA 4U3XA 1V7MH 3X3FH 3EYSL 2OSLA 4M7KL 2LV4A 4QNPE 4JKMA 4ZMAT 4TUKH 1S5IL 4LEOB 3VFMB 4BK5A 4JLRA 4NOFA 2B7DT 4Q6IC 1EAJA 3G04B 1BF2A 1KN2L 2ITDB 4OCNC 5C9JA 3UC0H 1W72A 2AV7B 1Z9MA 3HN3A 2W60B 4HULB 1MFAH 2FH6A 3G9VA 4H25A 3W39A 1I1CA 5JOPE 1PKQB 4WNQB 4XWOC 4L8DA 3ARTA 1QPXA 3QHTC 2IFFH 2VLJD 3TBYA 4TN9A 4NQEE 2XPGA 1MCCA 3Q6GL 4LCUA 1A1MB 3VH8A 4DW2L 4LPYA 3IAQA 4NKDB 4X9HA 4M7JL 1LNUA 25C8L 1R0AL 1KB5B 4RX4D 3CPLA 4PB9H 4ZTPH 4HIIB 1LDPH 4HFUL 5GS2H 3A67H 3FRPA 2F58L 2G9HB 3H42L 5I66A 2X40A 5E2UL 3QAZC 1U8HA 4WHTA 5ECJE 4L8BA 3AXLB 5DXWA 5HDQL 3HPLA 4X6CF 3GSOB 4JFDB 3VFTB 1GXEA 4NRYB 4RQQB 5FM5O 4AEHL 5IEHA 3L3JA 5DJYB 5EZLA 3EYFA 3QJHB 3W81A 3QFJD 4PRDB 5GJSH 2BX5A 3U9UA 4JDTL 1Z9LA 4J4PC 4YDLB 3QEHA 1YYLH 3GSNA 3WN5C 1BFVH 3TBTB 2P47B 2BXYA 3EDJA 2MQCA 3CDGB 2XFXB 4IRSA 3VXPB 4J4PD 3OGOE 2XWBA 3QXDA 4G7VL 2ZWLT 4LHJB 1IARB 2NTSP 4RMQA 4U1IA 4P46B 3H3BC 3O8XB 1X5HA 3V52H 4PJGE 3TV3H 1MHCA 3O4LB 1NEZG 5FGBA 3O4LD 3MLTA 3D0LA 5T3XE 4RGOL 2X4RA 5JA8B 4M8QB 4JFED 4GW5B 4I77H 4NT6A 1P2CB 2OXHA 2X10A 3GMMB 3TV3L 2P49B 1TZGL 2Y36L 4KHTH 4OB5H 4K7PH 4LLMA 3EBAA 1CDYA 4X9GA 1WSST 4GAYA 5F1NA 3OHXB 5I15L 1IC5H 1LO3H 2A6KA 3GK8L 3SN6N 2IEPA 4MAUL 3MGAA 3LKRA 1K4DB 2YWZA 4WW2F 4K8RL 5GRZA 4EDXA 4JPKH 1H8OA 3REWB 3OBAA 4QHUB 3U83A 3WXWH 1INQB 3GB7B 1KJVB 4QHLA 2EH7H 5ITFB 5CEYB 2QEJA 3G5XB 3VD7A 1V3KA 1T1XB 4QRQB 1T0MB 1YPZB 3CFKA 4MCYA 4BZ1L 3SGJC 3LD8C 1XR8A 1X5KA 2A6IA 2AAVA 2CRMA 2HJKB 4G6MH 2HRLA 5E4EC 5D1XB 5F7HA 4I48A 5DUPH 1I8KA 1R5WA 1WICA 3SY0B 4I0PD 5KG9B 3KPOB 2ARWA 1KG0B 4PJXF 3THML 1NC4A 5FK9A 1B88A 2DQIL 5AZEL 1HHIB 4OCLC 2R0WL 3I75B 5JHDD 5I1DB 3FQWB 3ARGD 2VJXA 1WT5C 3UEZA 4N5ED 1JHKH 2GT9A 4U0QB 2C1OB 2NY1C 3SY0A 4XCYB 1E4WH 3UJTL 2ZCHL 4P9HL 4K7FA 3MV01 4PJDF 5SWSA 4QGYA 1RK1B 3MLYH 3UAJD 3N85H 3MROA 3O2VH 4ONGH 3VFUA 4U2ZA 2NY1D 3RL2A 3HLAA 3DVGA 3U82B 3HNSL 1A64A 4MZ2A 1KLUA 5E5MB 1KLFA 1U8JA 3RPIB 1JYWA 1KEML 2FBOJ 3CH1B 5EOTA 4K8RH 3QIBC 3V8OA 3EFFA 5DD6A 1H3GA 4ZQKA 3S36H 5HI5D 4JFZH 5CD5C 3KPNA 1CICC 1JPTH 1NGPL 2NX5E 2VLKE 2HFTA 4B7IA 1HNGA 1S7TB 3ROOB 2ZOLB 1J0KA 1SY6A 1AJ7L 2VLJA 1G1YA 3QAZB 4ZSOE 5JUEL 2CDEA 5IMKA 1QFWH 2MKWA 4KJQD 1Z5LA 3S37H 4KI5F 4K8RC 1LEGB 1XF2B 2EDXA 1CT8A 5DJ0A 1QUNA 4QNPF 1WISA 2BSED 5KSAC 3LN4A 5E6IB 3SJVD 4NN6B 4EKXA 1BZ7A 4Y16B 4Z77B 3ARUA 4JFFE 4AH2B 3EYOB 2XY2A 3QIWB 1VFBA 4LNVA 3O9WB 3ARDB 1I8KB 2V2WA 2IGFL 4JRYB 4KJWD 3X11A 3G6DH 2E9WA 2M8XA 1CGTA 4KJWC 2UZIH 3RL1A 5FB8A 4W4NA 1KJVA 3UTTE 1LWRA 2QQKH 3DVNB 1NCBH 1JN6B 4FQLL 1R3KA 4POUB 4LSPH 2Y25A 4S1SL 1IAOB 2LVCA 4M6NL 3DXAB 3KYOA 4HIXH 5F3HB 5GRWA 1VEPA 2B1HL 5K9QG 2GKIA 3EKCA 3EJZD 1DBKL 3FN0L 2BFVH 1FYTE 3ZYZA 3R06B 4R7DB 4R4ND 1A47A 1SBSH 3BP6B 4DCQB 4Z7UA 4L8CB 3DIFB 4UTAH 2AGJH 1BVKA 4X5LA 1MHPL 3DWTA 2VQ1A 3DTXA 1EK3A 1OSPL 5ICYA 1CD1B 5DA0B 4HUWA 4DKFL 1I9RL 3BHBA 1OAKL 5I2IA 2JJUA 3HI1A 5IQ9B 5D1XD 3V6ZB 1BVLA 4ZFZA 2V5RA 3IDNB 3QPXH 1MAKA 2GK2A 2BSTB 4Y5YC 3DGGB 3EFFB 5HYJE 3QFDA 4U6YB 3SDAB 2XQYK 2FBJH 1A6VH 2EO1A 3C5ZD 3PHOA 1TETH 3ARBD 5KS9E 4K94H 5SWQA 1C08A 3O3AA 4X6DA 4XGZA 4N8CL 5EO0B 2D3VA 3PWLB 1BGXH 4NKOB 5GGSB 4ZO7A 3B2VH 1DBML 4YBQC 4U1MA 3VXQB 2MCPL 3WIHA 4U1JA 4WFGD 5J1TC 2V2TB 3IB4A 5CJOL 3MXVL 5I19H 2P48B 4H1LA 3OF6A 5GJTL 3ULVF 5FCUH 4P57B 4PBXA 4MNQD 5KW9L 1N5AB 2EDDA 5IESL 4BZ2L 1MAMH 2GCYA 4QCIB 4MB4A 2J6EL 4LEOA 3VFMA 2X44D 4N8VA 1D6EA 3FFDA 5IVXE 5TDOB 4JPKL 1QO3B 3BGMB 2YHGA 2Z92A 3DX9A 4L9DA 2VAAB 4L4TD 4TULL 1KB9J 1PY4A 2W9DH 1RUQH 3QEUA 1SMOA 4NRXB 3EFDH 4R90H 3E0GA 4S0SD 3SDXE 4FG6D 1PG7W 2VLRD 4QCIA 3EOBB 2EE9A 4YIQA 5CJ8A 3SKNA 3BH8B 1CXFA 3NFNB 1FH5L 4N0YH 5I1KH 5HHVL 3ZTJH 1AFVH 1VFOA 1CF8L 3RWJB 3C6LA 3W9DA 4EUPB 3RDTD 1S78D 5JHLL 4N90E 3INUH 3GMQA 1FZMB 3RWDB 5KSBA 4ZUTA 4MD0B 5I18H 2BSSA 2KDGA 5EO1A 2DQCL 3VWKA 1IGTA 4I2XA 2NY4D 1FE8L 1OCWH 2BY0A 2FR4B 5I0ZA 3RZCD 4GAGL 5EDXA 4Y4KB 4EI5C 4F2MA 4R2GD 1IGFL 3RDTA 2XKNA 2EDOA 1NCDL 3HC4H 4BH7B 3WV0A 2QSVA 3UJIH 5L0QB 5EBWA 4DN4H 3FAWA 2P8PB 2JF1A 4JGUA 4N9GB 5I2IB 2ED8A 3QUYC 1Q94B 3H6JA 4NQUA 5DSCA 2DLHA 4ZPVA 4Y4FD 3VGBA 5DRXA 3I2CL 2CLRA 2VSDA 1J1OL 2E3VA 4BUHA 3EGSB 4HCRL 2XWBB 5BV7B 3GSWA 5C0RL 4MXWH 3LRGA 4HPOL 2F19L 4JY5H 3G9AB 1OY3B 3L95B 1CCZA 4P57A 4NQTA 2ZUVA 1QP1A 3BW9A 3LMJL 4Q9QL 3VXMD 5ADPL 1R6VA 2X4TA 2UY6A 3U0WH 5I6XB 1YMMA 2XA8L 4LSQL 5LBSH 4NN5B 4Z0XA 1F4AA 4NNYA 2WW8A 3PDOB 1JWMB 4CMHB 5C0CE 3PWLA 4NKOA 3LIZL 4J3TA 5JHDB 3BISA 1T22B 3DUUA 3GSUB 4OV5A 3RWJA 3QUZB 1TTGA 2VH5L 1T03L 1MPAH 1R3HB 3T0ED 3QNZB 5J13B 5LKNA 5DYOA 2Z4QB 3HZMA 1NBYB 4JAMA 5CZXC 2E6JA 4S10A 1BD2E 4E41E 1YNLL 4DQOL 1JYXA 4JFYA 4LCWE 4OD3L 3LS5L 2P45B 4LCYA 4PV9B 3SE8L 1OP9A 1BZ7B 4Y16A 1KB5A 3DXAA 4XT1C 3TZVA 4XXCA 2H2SD 2RQ8A 3QUZA 4EUPH 4YX2L 1UWGL 4JRXE 2FWOA 3PV6A 5FDYA 3LPWA 4U31A 4YHIA 1YYML 3OR6B 5BZWB 3FN0H 3DUSB 1FO0H 1CGXA 4DCQA 1UH4A 2FSEB 4X6DF 3I9GH 1IM3B 2R1YA 3MV9B 4OFPA 3SGDI 2PO6B 2MHAA 1G9ML 5DEFA 5D6CA 5HHME 3IDIB 2FZ3B 4M5YH 2JJSA 1RUMH 5FYKD 3OJMB 4JFHE 4NN7C 2J4WL 1I7TB 2QQKL 3M17A 4KFZC 3QEQA 5LVEA 3BE1H 1I7UB 2WUBL 2X7LB 3VGHA 5C0DB 1WVZA 2CLRB 5BS0A 3EHBC 3UTPD 1XAUA 4KGJA 1WTGT 5ICZB 3JV4B 5HPOA 4LBEA 5IJVB 4C56A 3ROLA 1INDL 2UY7A 2NX5D 3BQUB 4HWBH 1P7QA 4HX1B 4R9HA 3MUHL 3WBDA 1U9KA 2IFGA 1JMXA 4TVPE 2FO4B 5GGTL 1CGWA 4MJ5B 4HKZB 4BFBD 4FQ1H 3SKOB 1LQSR 1YPZE 1YA5A 4HIHA 1RUAH 4L9LB 4JN2B 4BFGA 4KRMB 3UTSE 4ZAKC 4Z7QE 1D9KA 1T6VN 5C07B 5HXMA 5JUEH 4J2XA 4Y19B 5IUSA 2CRZA 4L1DA 3KPLA 4IOSD 4U0RB 1QSEA 2WZPD 3NIGF 4RGNC 2B5IB 1CR9H 4GG8A 5B3JF 1HSBA 4YC2B 1G6RL 3FB7B 1FBIH 5GGRA 1LK2A 5JQ6H 1FO0L 4JFZL 1CDJA 4NWUH 2VXSH 4AY0A 1QD0A 4GBXC 1RURH 4NQDD 4P4RA 4PJ8C 4PJHB 3S3SA 2CR3A 1KEGL 3OJDB 2GJZB 3SDAC 1K3IA 2D7PA 1FAKT 5E08L 2XWJB 2LVEA 2ORBL 3VXNA 4IIQB 3J8F7 4NQCB 1HE7A 2ESVE 1NGXA 3P30H 4HH8A 3CLFH 4XC1H 2BSRA 4UNUA 2UWEF 5IK3A 3ZTNL 1AC0A 4P5KB 4OZGF 5FCUL 3SGDH 3SDDC 1WEJL 3ZMRA 4TRPH 12E8L 4N8VB 4YDIL 3ZSTA 4LIQL 4UTBH 3TO4B 3Q3GB 4DZBB 2HYMA 2JCCE 4XXDB 4URTB 4LLMB 3ARGC 5F71A 1NL0H 2HFEA 3LPGA 5L88L 4JVUA 3QH3B 3AS0A 2BSRB 3IDGB 1D5MA 4N0FA 5DS8B 4UOJA 1CE1L 4NNXA 4HWBA 1DSFL 2H2PC 1OP5H 3KPOA 4LSVH 1UZ8A 5C70A 1EHNA 3BPCB 1DANU 3ELAT 1X5GA 5DC9B 2YBRA 5LWYL 3F5WB 5E94B 3MRRB 1DBKH 3KPPA 1LO0L 1KB9K 1G9NL 2ZG1A 4DKEL 5TDPA 4GAJH 2BOBB 3WUWA 3MRIB 2CDGA 1MJJB 5IVXB 5JIIA 5C07A 4XPHL 3O4OB 4PJAA 2IQ9L 3TPKA 1F8TL 2H1PH 4NQSB 3QXDB 3TNMA 3ARDC 3O9WC 4OCSL 1RMFL 1ZT1A 1RZ8B 4KJQC 1LO3L 1NUDA 1ZTXH 1A6TB 2X4RB 4I8DA 4YEFA 2F53B 4NZRH 2CLVA 1UA6L 3U48A 1C12B 4LSPL 3HI6H 5DJYA 1MF2L 1OAZH 2DOCA 1UGNA 4GH7B 1FP5A 3ZKMC 2CIKB 4MAYB 5FYLE 4AG4L 3E2HC 1R5VA 3PL6D 3FOMB 3RI5K 1FJ1A 5TFSH 1P4BL 1MRFL 3MQIA 4ODVH 5ETUB 5A3IC 3EDKA 5J9PB 3INUL 4M8QA 4RGOH 3IFPB 4N68A 3LRSB 1QSFE 4HJJL 1JF6A 3BSZL 1IQDB 5A3ID 3T4AA 4BSVB 3GZKA 3VXRB 5C0JA 3QCUL 1YMHB 4L4JA 5IB4B 5FFLA 1GPOL 5I1CL 4OI9A 2XPGB 3REVA 3AREB 1CFNB 3KPSA 4OFYA 4NC1C 4OLVL 2PW2A 5I74B 3GMRB 3T4AB 4BSVA 1CD8A 3LCYA 3GO1H 1VEOA 3TC9A 3C6SA 4XPHH 2YS4A 1VENA 3NTCH 2VIRB 3EYOA 1QFWL 4QYOA 3OKDA 1BBDH 2V9QA 5HSFA 4J12A 5E7FA 3FO0L 1TJIL 3G6AB 3TF7A 5CLTA 5GJSL 1I9JH 2B5IC 3E3QE 4RFNC 1IQWH 2IALB 4B5EA 2GTZA 4ZXBB 3G04A 5FYJE 4NBZB 1JZ4A 4I0PC 3UO1L 5I1LB 1E4XH 2A6DB 1NFIB 5I1LA 5IMMB 2IJ0C 1OGAA 4MNGA 4NQXA 1OP5K 4C83B 4YHIB 4M61B 5DJ6B 4HGWB 5FCSH 1U8HB 5DQDH 5B22A 4GG6A 2DQIH 2A6JB 4XTRD 3BEVA 3N0PB 2YA0A 2IAMA 3QI9D 3MA9L 1KPRB 1KNOA 4KDTC 2E8YA 2FO4A 1U8QB 1QOKA 3QDJB 1JPFB 4JO1L 3VG9C 4M7JH 3A0OA 2PYEE 3QWRA 4XVUD 4ZUVA 5HHQB 5GGUA 2B1AH 2Z31A 1P7QB 3H3PH 3FB6B 5SX4I 3WUWB 4CMHC 2D4FA 4X4XB 1OAQH 4UI2A 4F7CA 1DBBL 3H7LA 5CAYB 3SGKA 3ESVF 3QIBD 2ADGA 3HB3D 1I3VA 4XVTL 2Z91A 4KJYA 1RZJC 4OLXH 4IDJH 3NTCL 4LLYB 5IT2H 3TVMA 3MV7A 1B9ZA 1MRCH 1NBVH 2PNDA 3PWVA 3K4AA 4NP4L 3FQTA 2QHLA 1P1ZB 5EUOF 3LEVL 3IU3B 1IC5L 1XGRA 1JRHI 3DROA 2ZCKH 3EGSA 3M1BA 1I9JL 5CJXC 4OKVB 4PRDA 4U3HA 3BP7A 1UG9A 4TUKL 2EIBA 3VXUA 1BBDL 3LEXA 2YXFA 1RIVH 1S5HA 3IXAA 4Z5RB 4ZPVB 3IKCA 4PJ5D 1WFUA 4MWFB 5GGVL 2F53A 1HHGA 1RY7B 4ODWA 2IBBA 4KDTA 3UZEA 1ZLUH 1J12A 4N9GA 3DV6A 3PV7A 4HG4J 5D7LB 2JLLA 4GLRI 4MJ2A 4DTGH 3RVUC 5FF6A 1P53A 3MRDA 4QRPB 5IEKB 4LKXA 5F7DA 3G5ZB 4CU7A 2R1XA 2AK4E 3LZFL 5T1MA 2P44B 4LCWD 1CS6A 3CXDH 3NACL 5IB2B 2BNQB 5IIEA 4RMSA 1INDH 4K71C 3UBXI 3HUJA 2YD2A 4HEME 4PJ5A 3UTTD 3S96B 3UPAA 3WS3B 4WTZG 3MOBL 5E94A 5M94B 4NM8H 2J1KA 4KK5C 3JWDH 2Q7NA 4NGHL 1BIIB 4Z0BL 2LQRA 5DHVA 1FIGL 4JO3H 4JFPB 5FM5M 2Z8WC 3FAXA 3HZKA 3UZVB 3D69B 5HJ3B 1GJIA 4G8IB 1G9MH 1T66C 4ZDHB 1DFBL 2YD3A 4NQVB 2IANE 2EE2A 4KQ3L 43C9B 1QSEE 1S7VB 2MJWA 1MRCL 3GSNH 3QO1B 4NFDA 3B9KB 4ODXA 4QF1B 5HHPB 3BVNA 5HDQH 1WF5A 2HKHL 4XRCB 5KVGL 1I75A 4S1RL 5D93B 5AZ2L 1AI1L 4MJIA 5ANMA 4JJHA 1BFVL 1CL7I 3P0YL 4OAWA 4MS8A 3SGJA 5BV7H 5E1HB 3RY5A 1NAKL 5GQBA 3U0PB 4ODHH 3GUTB 4F2MB 1D5BA 3K81A 1GOGA 1FFNB 4G6KL 2DQJL 5K33A 2AJXH 3WFEH 3X17A 3UTZB 2NCMA 3S35L 1HXMB 1VFAA 2HWZL 4KI5E 3ZE0F 3BAEL 2GW5A 4M4PA 1WEJH 2DTSA 3B83A 4I2XB 5FGSA 1J7VR 1PQZB 4HT1H 2FH8A 4EN3A 4F15C 1I9IH 2DMCA 4NQDE 4U1MB 3VXQA 1NCNA 3Q6FA 4WY7H 2KKQA 1IGMH 1FPTL 4YHKH 4JVWA 1F3DJ 4E41B 3QBTB 3STLA 3MRPA 3NOIA 1JGEA 1L7TH 5C0RH 1EEZB 3C5ZB 2EC9T 5JW3H 2DAVA 1NSNL 2NNAB 3HNTH 5BO1H 1Q9LA 1LP9B 4NQED 1Q9LB 2BVTA 1TCMA 3S6CA 4NQEB 1RU9H 3KPQB 3ZT5A 3EAKA 1PBYA 3MRPB 3OR7B 1A9BA 1NLBH 3ZKXB 2AQ3A 4MHHI 4EDWH 5TDOA 4Z5RA 4PD4K 4RMWA 4X6BA 5C2BH 2H45A 2JKXA 1GIGH 4P9HC 4DK3A 3HC4L 2X1WL 1M7DB 2XTLA 2DQFA 4MS8C 4N90D 3TH3T 3HI5H 4IMLB 5INCB 2P46B 4GAGH 3RDTC 3GSXB 1JGDB 3IAPA 3O6ML 2JJVA 3GSXA 2AEWA 4G9DB 1MAJA 5C07E 3BT2H 4NDMA 5E7BA 4FMFA 4MS8D 2VIRA 4R4BB 1UB6A 3DBXA 4ZAKA 5LGHL 2R0LL 2HVJB 4LLWA 3WNNA 1HI6B 4EOWL 1FIEA 3OAUL 4AJ0A 4M1DL 4Y2OA 4QY8B 3JSSA 3RZCA 1XGYH 5GRXG 2ZKHL 2BVOB 4KRPB 4XRCA 1XGTB 2ZSVB 3TJHC 2HFGH 1CIDA 3QXAA 1KF9B 5JW4N 5ERWA 4C57C 1S7VA 1UVQA 1IEHA 1JYVA 1RAMA 4YDJA 4PJDA 4X98A 2VTFA 2X4SB 4ZAKD 4MNHB 4R2GB 4U1SA 1IKNA 3GNMH 1M6OA 2BNRA 3MO1B 3DO7A 3O4LE 1ED3B 2DL9A 4Y4FC 3VFWA 1F8TH 4E42A 4EDWL 1QG3A 1U8KB 4PRHB 3DX8B 3MBED 1EFXB 2NY4B 3KJ6H 4GUPB 4L8CA 3MJ6A 1EAPB 4QTIL 1CFSB 2XZQL 1R3LB 5I1AA 3MLWL 3VDBA 1MJ8H 1KTKE 4Q7DA 4NJ9L 4P49A 3C09C 3QDGE 4ZS7H 5F3HA 4NZJA 2DQGH 3VFOA 4FP8H 2BCKB 4XNQA 5EU5B 4PRIB 2EDJA 5LWYH 1P69B 5C08D 4K7FB 1A6ZA 1ODAA 1VEMA 2DIBA 1FFNA 4YHKL 4ZFFA 4QRPA 4PRNB 3MFGB 2HRPH 4X6EB 1JFQL 1CTOA 4WFEE 5EPMA 3SKMA 1J5OH 3EO1A 3AREA 4IOFD 2JE8A 4LSTL 5EC2A 4K94L 3OKKB 1I3RB 2EIEA 4FTVD 1A6VL 3L3DB 2Z9TA 5T33H 3VXRA 5C0JB 5JOFB 1UENA 5A1AA 4PJEA 2HWZH 4F8QA 4XP4H 1DVFB 4X9BA 3WIIH 3UROR 4J8RA 4RDQG 5C0EB 3FTGA 3S35X 4ONHB 4KI1A 4YQXH 1UKQA 3QQ4B 3CZFB 2AXFA 2X09A 4IJ3B 3NCJH 1T83C 5DURB 2CPCA 3W0WA 3FJTA 4BQ8A 3QUMA 4MNQB 3HZYB 2CR6A 1A2YB 2IPTL 4K9EC 1KIQA 3BUYB 4UTAL 3RIAF 3IRPX 1BM3H 3O3EA 4YJZL 2VXSL 1K6QL 4WI4A 2DQGL 1Y18A 4PTTB 5SV4A 5IHZB 1NCDH 4JFEE 1A5FH 3KYMA 5HI4C 5L6YL 3DX6B 4GRWF 4P2CG 4GAYB 4PJHF 5CD5D 1IVLA 5F9JA 5TPWH 3T3MF 3PP4L 4LSUH 4AM0A 1S7UB 3EO0B 1MVUB 2ILLA 2XQBH 1JPST 2FHBA 3GJEB 1P7QD 4V3EB 5HYQB 5DMIL 3BEVB 3ISWA 1OF2A 3QCVL 1I7RB 3K4DA 2DQDL 4OF0A 3RUGA 5D7SH 5DD3H 5HVHB 4FQIH 5K9KB 2C3XA 3HE7D 2H3NB 4FFEX 1FG2B 1CF8H 1LEIB 2P7TB 3PL6C 3S3JA 1T04B 4OTXH 1T5WA 2BNUA 3HE7C 4K3JL 5C8JA 4XB7A 2SEBB 1QBBA 3D18A 3MOQA 4Z7WB 1IFHL 1U3JA 2AJYH 5EZIH 4KY1H 4APQA 3O6FC 5KG9A 2X4SA 2KZWA 4KTEL 4YZFE 3MJ8A 5J89A 4M7LL 5KSVB 3S37L 2APVA 3F62A 1UH3A 2EDRA 4U1JB 2CK2A 4XP1H 4KRLB 3U36A 2J6EH 4ZUUA 4RWHA 1KTDA 2I24N 1U6AH 3OKOB 3MODL 3V2AR 3CDYA 5ALCL 5EC2B 3HHRB 1D6VL 4PJ8D 5L6YH 3W0WD 1WAAF 3FB6A 4NQCA 4U1IB 2B39A 1IC4L 4MB3A 2OTPA 5HHOD 4YO0A 5GJTH 1JL8A 2D7TL 3SJVA 4QT5A 2QSTA 1DL7L 3VXTB 4ZOAA 35C8H 2FYYA 2NLJA 3P11L 5TGBB 4D8PA 5KS9F 1JGDA 4YE4H 3SDDD 1LEKA 5BW7C 4X7TA 5JIPA 1NCCH 1U2CA 4OGAD 4KTYA 3SCMD 5C6TH 4JE4B 4NHCL 3AS2A 3WXVL 4J3SA 4PJXB 2DJUA 5HHOA 5HYJB 1JHKL 1X5IA 2A77H 3GMMA 1M71B 2BMKB 3LIZH 1QSED 4DUWA 3D2UA 1UT9A 3DV4B 3B5HA 5AZEH 2HKFH 4ONFL 5AYQA 4PJ9C 2MTPA 2PXYB 1UYWL 1JMZA 3K1KC 3ARBC 3GBNL 1VPOH 4WIQA 5IOPA 1ZLVK 2HTLC 1I8LC 3MLUL 5HYJA 2RGSA 3GMRA 5DGRA 2VXTL 2QSCL 2EEAA 2CKBL 2IG2H 4GBXB 2EDEA 4HCRH 2WINA 3VRJA 3VJ6B 1BX2B 5E1AB 2DQUH 4MA1C 3I2CH 1X3DA 1OAYH 4PJGA 3W9EA 1CICD 4C56D 3BPCA 4S1RH 4A2MA 4DK6A 3I6KA 4O02L 4TSCH 1HKFA 1B0WA 3EOTH 5KS9B 3BJ91 1GGBH 2VLKB 5FO9B 1JZ5A 2F8VA 5D2NB 3ZL4L 5ID1A 5H8DA 1FN4B 2BFVL 4NM8L 3MOBH 2AXGA 5D7IB 2D31B 1KG0A 3LKQA 3SKUD 5CJXA 5E6IC 1FNSH 4Z76A 4G8FB 1FFOB 4ZUUB 3C2AH 3RWFA 2ATPA 1TXKA 4OZHA 3M8OL 5M95B 2YZ1A 1YNTA 1T0NB 1CVRA 3SO3B 1OD7A 4X7SL 4QF1A 3C8KA 4DAGL 4HH9A 2IQAA 5EU7C 4PY8I 2QKIA 3KPNB 4Q0XH 3LAFA 2NY7H 3MRKB 4BA8A 1MI5A 3B8YA 4U49A 4G9FD 5TQ0H 4M5ZH 3RPIA 3U30B 2R2HB 4HKJB 3BGFB 1PLGL 1NBZB 2EXWC 8FABA 3FOLA 1X5YA 3T0XA 5KN5A 1DN2A 1J18A 2WWKO 1OW0A 1ZHLB 4HUXA 5DHYB 1WAAE 4LVHC 2VXVH 3KPLB 1ACZA 1GIGL 4XZUA 3WS6C 4B50A 2ZP0T 3CU1A 5KVFH 1KB5H 1ZLWH 4EQ2A 3BRFA 2CH8A 1KEMH 1NLBL 5EH1A 4H8WC 2V7NA 5DC0A 1FL5A 3HNSH 4BSWA 3JWOL 1BBJA 4GAJL 4G80A 5I8CA 4JRWA 4JM2D 3BUTA 3CUPB 5JORA 1SYVA 5JOFA 3KPRD 1TJHL 2EKSA 3X14B 1KIQB 1QKZL 2BOCA 2BOCB 3H9YA 3MLUH 4IDJL 4KRPC 3E1F1 3IVKA 3WHE0 1T4KB 1PEZA 2R0WH 3NAAH 4R0LA 5T3ZE 3LD8B 1WK0A 3X3GL 5T1LB 4KQ4L 3VXNB 4ALAH 3MUGB 5BQ7B 1TLKA 5DK3A 1TVBA 1H3UA 1KXQE 3QDGA 5DQDL 4NQVA 4YK4B 3QDMB 5J13C 3FZUC 3MV7E 1AC6A 4PJEE 2R69H 5IVZB 4HG4K 5DUPL 1LP9F 5CZVL 4MGXA 2JJTA 4LIQH 4UTBL 4EI5B 5C1MB 3C60D 4XWGL 3VFNA 3TVMB 2QJDA 3ARPA 1EDQA 3RWIB 2EIZB 3MLPA 3TNNB 2M1KA 1XMWA 2BHZA 1Q72H 3D3VA 3ZDYF 4TUOA 1AKJA 4UV7H 3X13A 1I9RH 4PREB 1TJIH 2ORBH 1EEYB 1CGUA 1ZLVH 2G5RA 5C0BD 1U8KA 2ZCLL 5FO8A 5CP7B 1QVOB 4LDEB 4WHTB 4KK8D 4ZFGH 2V5TA 2H2SC 3JWDC 4MJ5A 3MRKA 4XMKL 2ZPKH 4KK8C 3SDCA 1NQBA 4R3SA 5MEQB 2X89A 3JWOH 5HPMA 4WUKH 3QP3A 3DHMA 2XA3A 4EXKA 1FIGH 1KPUA 4JO3L 1X4XA 2DJ4A 5EU3B 3PQYA 4OFYD 3MLZH 2DM4A 1A6AB 1SYSA 3FFCD 5EZIL 1HSAB 2F54B 1P4LB 2V5SA 5H37H 3HE6B 5J12B 2DQTH 2FCBA 5IHUL 2YC1A 5MEPB 3IFOA 2IWGA 4NO0B 3LN5A 1N5AA 1IAIL 1OB1A 3VFPA 1U8MA 4KHTL 1EERB 4OB5L 2Q8AL 4H26B 4OZFH 1J88A 1ZLWK 5MENB 3MRCA 2CK0H 3GMNB 4RGMB 2HTKC 2UVEA 1IAIH 3PWPE 3WN5B 3CDFA 4DTGL 5HHMB 3NN8B 4YDKH 5DMYA 4FQQB 4UUJA 4CVXB 1ZTXL 2W59A 5DEGB 2DI9A 2OTWB 1RZFL 4X80H 4Y2DB 3P40A 1UB6B 3RAJH 3BE1L 3U4BL 3GRWA 2IQ9H 1T66D 2VAJA 4JREC 3OWEA 4LAJH 5FA3B 3B9KA 1RJLB 4R2GC 5HHPA 4LMQE 3EJJX 1BQHA 1G7PB 3BP4A 4PV9A 5IJKC 4JFYB 1VGEH 3B9VA 4NZRL 2E6QA 3ULUE 5JNYB 1JNLH 4OT1H 1UM4L 4Y5VB 1J87A 3DYPA 3RKDD 1R3HA 5KSUA 2AJ3B 1T7ZA 2EYSA 4FQXB 1O7VA 4JG1H 2ZUYA 4PJIE 1K6QH 4Y4KD 3HZKB 5CILL 5HHXH 5HYIA 5I17B 2DM7A 3LDBC 4TSCL 3VXUE 2Z31D 2IF7A 4Y5YA 5L2KA 4ZOCA 1J9CT 4N0CC 1INEH 2YD4A 4N5UA 4CAGA 4GKSB 3P4OB 1HXYA 5D2NC 1A6TA 1UC6A 2CKBH 2IG2L 4GKOA 4P9HH 4K3EH 3TBVB 1NDGA 3BQUD 4ONOA 4FS0A 3TBWA 4WI2A 5DWUH 5E8OB 4CU8A 1P4LA 1E0OB 4WI9A 5E99H 4WO4D 4EIGB 5HI3C 4WHYG 3C8KB 2M26A 2DF3A 2HRPL 3RWIA 3H9HB 4UT9L 1XIWB 4G6AC 4OLYL 25C8H 1R0AH 2DMBA 4WHCA 2XXMB 2Z93B 4PJCF 3VWJB 4XC3H 2F19H 4JY5L 2R2EA 4Q9CA 3BDYH 1KXVC 3MJ8B 2MWCA 2D31A 3LKQB 1BAFL 3TN0A 3PWVB 5FOJA 2EH7L 3CVHA 4ZUWB 1YEHL 5A2KH 3AC0A 1NBQA 3UBXA 3WXWL 3MREB 2JCCB 4XP5H 1YPZF 3MLXH 4MSWB 5D2LF 2YD9A 1QFPA 4HPYL 1HINL 5JQ6L 4U6TA 3BPOB 15C8H 3WE6B 1ZS8A 1CR9L 1KIRB 1ZANH 2ZOLA 5HI5C 2PKDA 3WDIA 3T0EB 1N0XL 3E6HA 3ULUF 3ZDZF 2AEQH 4GKNA 4P3WA 4RRPA 4RFOL 5DI8B 4ENED 4UIMA 5D1QB 1N6QL 2DD8H 5IBLD 1RHFA 4P4RB 1RUAL 1G7QA 4OGXH 4P48A 1MRFH 5D7KE 5D93C 3VI4E 4F3FA 3RUGF 4F7EB 5IHZA 4JRXD 1YEGH 2BMKA 4M6OL 1YEEH 1N6QH 1OARL 1SYVB 4HHAB 2Y5TA 3B9DA 5F6HI 5LQBL 3IGAB 5IR1A 2MSPA 4AK1A 4H5SA 3BUYA 4HKXB 5I73B 1GC1C 1WAAA 2Y7QA 2XN9A 3GMOA 4PLJD 1OTTC 2W0PA 1FZKA 3B6SA 4GRMA 4RZCA 2APWA 3HR5B 3BKYL 2P5ED 1DN0A 3JTTA 4HDIA 1T21A 5C2BL 2HFEB 4OCSH 2Q6WB 4F8TA 1CICB 4WW2C 4F33B 3VGAC 5F44A 2VR4A 2Z91B 4KJYB 4RGND 4WV1C 1RHHB 1UWGH 3MRNB 4XP5L 3RY4A 3OKNB 1I3GH 1GOFA 4U6HA 5DRZA 1XR8B 3GMPA 3D87B 1MAML 1P1ZA 5ICZA 1T20B 5JW3L 3C8DA 4GRWH 3GB7A 5D5ME 4ZUVB 3JVGA 1PKQE 4I5BB 1MWAL 1A6ZB 3F6IA 2IPTH 2NR6C 5KSAB 3EJZC 1S7QB 3PJSA 5EO9A 3VXRD 4WTXA 4WTWA 3MLSL 5FA4B 1CVSC 4OZGB 5ETUA 4FTVA 3B2VL 3RX7A 4G43B 1CD1A 3DI3B 5FECA 1TJGL 3OQ3B 2Y07H 2D0HA 5F6IC 1QSEB 4HT1L 3QDMD 3SDDA 1MPAL 3TJEL 2X42A 5EOQH 5J12C 5ACLA 3WLBA 1EO5A 4K3EL 4XTRC 5EU6E 3CC5A 3W2DH 2CLVB 4RMRA 4ZFOL 3C5JB 3OG4B 5IBTH 3WHXB 4G43A 2BRRL 4MA3A 4AENA 4E0RB 5BZDB 4LP5A 1INEL 3QISA 1NAKH 5BZDA 5CBAB 1RZ8A 2QQNL 2XA8H 4A6YB 5BV7L 4V2CB 4G6JL 3ARRA 5JNYA 2XZAH 4ZG1A 4W4OC 5DI8A 3F8UB 3P11H 1MI5D 4WTZA 4AM0B 1MFAL 2NW2B 1MHCB 5I1JH 4UNTA 3GSNL 3PL6A 2VLMD 1NUNB 3KYMB 1IEAA 4XP9L 4C56E 1LEKB 4PTTA 2VWEE 3LSOA 3MLVL 4K3GA 3ZDYE 1AGFB 1KCUL 4WU5A 4WU7A 2NY1B 5KVEL 3TYFB 3KVQA 2ERJB 2HJLB 5C86A 3KYNB 1H3VA 3WIFA 3LQAL 4GG6F 1WBXB 4MDJA 4PRPA 3RWHA 4RIRA 3NVQA 3RAJL 3O0RH 4KY1L 3BWAA 5INDB 4POZD 3QIUA 2IH1A 1W0VB 5H37G 5IV2A 3OZ9L 4K8RD 5D7LE 1KULA 1LEGA 1MJ7H 3QJHA 1XF2A 4JKLA 1M05A 4HKBA 4M7ZB 5DVOA 5T3XL 5TDNB 1OCWL 2X4PB 3NIDF 4PGJA 2YK1L 5JZ7D 4FG6C 2A6IB 1EIBA 1MFEH 5EB9A 1AGCA 3FQNA 1QSZA 4PD4J 5KOVC 3AMKA 1MHEA 5TE4L 4D0DA 4GOSA 1EPFA 5ITFA 1OTSD 3PDGA 4PG2C 1T0PB 2ED9A 4ZFFB 3ARFB 5I74C 3OAYH 4RFOH 1EEUA 3S5LA 5C0GB 2W38A 3PP4H 4JJ5B 1MCEA 2H3NA 4P46C 5MEND 1FLRL 3N9GL 4JANA 2E9JA 3WHE1 2FB4L 5SWSB 1NJ9A 1TIUA 2I07A 5HHOE 3SOBH 5I75B 1NANI 1BFTA 2VL5B 1HINH 1CL7H 4Q6IA 1H3TA 5IT2L 4BQ6A 4U05A 4XB8A 3VFWB 3MLXL 4ESKA 4JM2C 1KBGL 4JRYE 5EZOL 3IU4L 3V7AE 2ARJB 1RZIB 4Q2ZB 1MQKH 4X5WA 3HC3H 3BFOA 2ZCHH 3MLRH 2B1AL 1HKLH 2R9HD 3HPJA 3IDYC 3QI9C 4U7SA 2XICA 4L3CA 1U2HA 3KGRA 3JUYA 3P4MA 4LLQA 1HIMH 3K4ZA 4GXVL 1FDLL 2OK0H 2LAAA 3DMMD 1FO0B 1K3ZA 3C5ZC 4KROC 4Y4HB 5ENWA 3MRCB 3O3UN 2PYEB 3VRIA 1SM3H 1Q0XL 3B8SA 2Z8SA 1K4DA 1B0GA 1MCWM 3D69A 5KTEH 3LKRB 2YWYA 5AUMA 5H2BA 4HF5L 3DX6A 1LK2B 1E4XL 1OB1B 3VCLA 4BZYA 1MFDL 1WWCA 3WE6A 2K3TA 4QRSB 2ICCA 1YQVL 3F7VB 1NC4D 1M7DA 5GIRB 1UH2A 2B1HH 4O51B 4QXTA 4ZS7L 3QUKB 2IH3B 2J8UB 3DUSA 1LMKA 2FIRT 4KZEH 3UX9B 5D7JB 3T0EC 2OQJA 3G6JA 1ZGLP 3HPLB 2ADFH 2UYLB 2H32B 5GS1A 1QNZL 3MSPA 1BD2D 3FCTA 1XGUB 4ELKB 2AJ3A 4PB0L 2P24A 3NPZB 1LD9A 1NUFA 3OXRA 4NGHH 2AJVH 5EFIA 5EU4A 4EQ3A 4OLVH 4JG1L 4QOKD 4M4RA 5E03A 3U4AA 1CQKA 2XNAB 4Q6YA 3OB0H 2C26A 1QBLH 4F9LA 4LSSL 5D5MF 3GSRA 5FYLD 3QXVA 1PLGH 4PP2A 4HUWB 4R96B 3GJFA 5ICYB 1F2XK 2X4QA 4E42B 5CP7A 3VI4F 3LKOB 2B2XH 5TDNA 2FNBA 3KYAA 3BP6A 3WEXA 3VD9A 2AERT 2EIZA 4WUUD 2Y06H 3ERYA 1OM3L 1EHAA 3RNKA 4OF3A 4O2EA 2ERJC 3PGDA 1DR9A 5ERWB 4XNQB 5EU5A 2AEIT 3GBML 4JCLA 1A14H 3NZ8B 3C9NB 3L95A 3S3PA 3BQUA 1JPSL 2OR9H 3NCEB 3GSNB 5BW7A 1UA6H 2OCFD 4LLYA 1AQKH 4ISVA 3NPSB 3MCG1 4YHML 4XBEL 3RVTD 4KPHL 4ETQA 4LP4A 4TTGA 1H3XA 1O0VA 5D71L 2EDQA 1JPTL 4OF5A 4AIZB 4JFXB 1RI8A 3NBNA 1X9QA 4MCZB 2ZNWA 5ALBL 1FYTB 3BD5A 5ACMA 1UKTA 1OSZB 2KQMA 4F7TB 2AK4D 3QUYD 3C5ZA 4AEEA 1G9NH 4DKEH 1BQLH 1EEZA 1JWSB 2VZ1A 3SPVB 4Z7WE 1O5DT 4MHHG 4Y19D 1ZLUK 4MQTB 2XZZA 1LILA 3UJTH 3TH2T 2OTWA 4HXBL 2E7LC 4FXGA 1JWMA 4M93B 5DK0B 2VNCA 3NA9H 4PS4H 1LO4L 4WY7L 2EH8L 4CGTA 2ICWJ 2V9RA 4L4VD 4LQ1A 4ONFH 3C60C 3BQUC 2QV2A 3MFFA 5K93A 2EICA 1A21A 2A77L 4XWOD 1PFCA 3HKFA 3T3PE 5BVPH 5FV2A 2G2RA 3VXOB 1QSFA 4YZFF 2IBZY 1XF4A 4TNVK 3MA9H 1RZ7L 2AKRB 4KTDH 3P0VL 1CFTA 4GRWE 5EUOA 4I0CC 1H8NA 1EV2E 3T0EE 1RK0B 5J1AA 5FKPB 2MOVA 1BWMA 2WLZA 1YJDH 3ZKXC 3HUJF 1KN4L 1IILE 2EDKA 3H7BA 3LB6D 5DO2C 1KACB 3MYZA 1MNUH 1T1ZA 1T2JA 3CMGA 4OZIF 3TFKA 3WEXB 3RI5F 5ISZE 5FGRA 5LXGH 3S88H 4PG2A 2QTEA 5E6YA 5C9KA 1ZHNA 3F7RA 3Q5YA 1G7HA 4J3VA 3MODH 2VXQL 4QOKA 4XBGB 4MVBD 1NC4B 5FK9B 4Y89A 1IZJA 2Y36H 1T5WB 4YLQT 4K23H 3N50A 3O6KL 3RJDA 5HDLA 5HI4D 4FZEL 3QCTH 5HTSA 3O11A 3U4BH 4LLAA 1ZLSL 3MXWH 1FL3A 1RZFH 3TVMC 4PJFA 4JFEA 5DMKB 5FYJU 4LCWB 1XZ0B 5MHSD 2WLYA 3WKMH 3ES6B 5IFAL 3RGVD 3SDAA 2EC8A 3WYRA 5KANG 1JPSH 2OR9L 4I9WD 1YC7A 2E7BA 2VLRB 4D0CB 5I71B 1AP2A 2FD6L 1P7HL 3RGVC 2NY7L 3TJHD 2VAAA 3KR3H 3MV7D 4JQXC 2FEEL 3RL2B 1BQSA 1ZLSH 5E2VL 4MJIE 5ANME 1D9KC 3IDJA 3MC0A 3D39D 1OGAD 2DLGA 3VH8G 5JPMA 1PG7H 2DBLH 1XGPB 4Y4KC 2VXQH 3H9SE 4JFQA 3V6OC 4Z78B 1FNSL 4XNMA 3WFHB 2I25N 3NMEA 3DNKA 2Q3AA 5D70L 2EDYA 3EIFA 4PR5A 3WIFB 5DJZA 3CAFA 3FRPG 3AB0B 1MUJB 3L3GB 4LPUA 4X4MA 2BVEA 1QA9B 1EHLL 3VFVA 1B2WH 4Y8AA 2LABA 5D96C 5F9WC 1YNLH 4UV7L 4DQOH 3B5GA 1G7LB 5L88H 3X11B 4HWNA 2P8MA 2Q8BH 2XWJA 1AR1C 1U92A 3KPRA 1QRNA 4JPWL 4D0BB 3H3PL 4P99A 5ADOH 1AHWB 4WO4C 1ONQB 5DJDB 1YC8A 2P8LA 3ARFC 1DSFH 5EG6C 4LPCA 2R69L 2HVKA 5F7EL 1CE1H 2VDML 3QB7C 3C60B 2W1NA 4OI8A 4YBHA 1GAFH 4V1DB 5KAQG 4GXVH 1JTPA 3E3QC 5SWZD 1WGOA 3KS0H 1P6FA 2CLZB 2WV3A 4LDOB 4PFEA 3VGEA 1NFIA 5DJ2B 3EYQD 3IJYA 1C12A 1HKLL 1QKZH 4PRHA 3O2WH 1KCVL 4PJ9D 2VDKL 1BOGA 4L8BB 2JIXB 4L9LA 1LO2L 4DEPC 4XVUC 4U33A 5TF1H 1S7QA 3M07A 1G0YR 2XIDA 2X05A 5DD1H 4R26L 1KBGH 1CFVL 5GSRB 4HX1A 4MXQC 3WJJC 2ZUWA 3GO1L 1DQML 3CDCA 2NXYD 1IGCL 4AZ8A 1HYSC 1DUYA 2BK8A 4AYFA 2GTWA 3EDEA 3QHZL 4FABL 3I6LE 3K2UH 5L2KE 5D7IE 3QQNA 1NCUA 1JK8B 4YHMH 1T1YA 5IBLC 4HXAH 2EEBA 1AQKL 1H5BB 3CD4A 4HIEB 5DA4A 3AY4C 4A6YA 4L4VA 1ZEAH 3X3FL 1I8IA 1IBGL 2A73A 4HJJH 3QUMB 5E6ID 3SJVB 5HYJD 2DRUA 4JM4H 4WU7B 2A74A 4XBPB