1YN6A

Crystal structure of a mouse mhc class i protein, h2-db, in complex with a peptide from the influenza a acid polymerase
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
273
structure length
273
Chain Sequence
b'PHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
molecule tags Immune system
source organism Mus musculus
publication title Lack of prominent peptide-major histocompatibility complex features limits repertoire diversity in virus-specific CD8+ T cell populations
pubmed doi rcsb
total genus 71
structure length 273
sequence length 273
ec nomenclature
pdb deposition date 2005-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yn6A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1yn6A01
3AY4A 3I6GB 4NHUA 2W65B 1ZMYA 5FHAH 1LD9B 3HUJB 1N64L 1FZOB 5C07E 5EO9B 3QHFL 3K4AA 4HJGA 1RU9H 4FZEL 1BOYA 3OAZK 3NZHL 3CLFH 4K3EL 3TBSB 1X7QB 1P7HL 1UVQB 4HEPG 4K3GA 2CDEA 3WN5A 3W0WE 3UAJD 1DEEB 3CFDA 5C0BD 2Z8SA 1IC5L 3P0VH 2V9TA 2D9QB 1EEUA 3HZKA 4HS3A 5IHZB 1OAZH 2XN9B 2CDGA 3AB0C 3FFCA 1KACB 4JM4L 1A4KB 5C1MB 4RFOL 2CD0A 1KCVH 1YPZF 5DJ2B 3D87B 3MV01 4XVJH 3C5ZD 1YA5A 1IVLA 1X5HA 3SKUD 3C09C 4U6VL 4JFED 3O11A 2ZUXA 5SWZA 2VDKL 4KK5C 5JDSA 1KEGL 2EDWA 4MDJA 2VDPH 3GSXA 1KCUH 4PBXA 4ZOCA 5SWZD 1IGML 4P4RA 4M7JL 1KN2H 1MQ8A 4AIOA 4OD2B 1KEGH 3CFBA 4X9GA 4HV8A 1J5OL 1SY6H 2APBA 2R0LH 4XNQB 3ECBA 3J7HA 2DQEH 4ETQA 2D0FA 1RIVL 5F72S 1EO8H 3KPRD 5TQ0H 4F57L 5CZKA 3S37X 3U4AA 1UH3A 4CDHA 4XP5H 1MHCB 4CW1A 4XCNA 1VENA 1NCWH 1RZ8A 2BX5A 3OKDB 3P9LA 2VDPL 4JLRB 5GRVL 3QO0B 1T04B 3AUVA 4KQ3L 5I19L 2VLLB 4PJXF 4B7LA 5EBWB 4RWYL 5ACZA 1GZQA 4UINH 4QCIA 2WW8A 5DVKA 3EJYD 1I1AD 1M7XA 1YN6B 3FQWA 4JO1H 1HOCB 4DEPB 4P23D 2RGSA 4OF6A 1CG9B 3SHSA 3RVVD 4ZAKD 3DSNA 3V7MA 3AS0A 4JR9H 3C5JA 4PJHF 1DZBA 3AU1B 3M8OH 3CNKA 4OCSL 4LLMB 3BIBX 2CKBA 5GS2D 1ITBB 1WAAE 5DTFB 3NCYS 5CEZH 5GZOC 2HFTA 2IH3B 1JFQL 3GMPB 3HHRB 2FL5B 4PRHD 1HYSD 1XF5A 2VXTL 3GHEL 1FE8H 1G6RH 2C1OA 4NZUH 2QQLL 4P3DB 5HYJE 1RUMH 1I8MA 2V7NA 1F4YH 5A2KH 3B9KC 2W9EL 4FQ1L 1MREH 2QQLH 2HFGH 4IRSD 3W82A 1FZMA 1GGCH 1Y0LB 1JFMA 1B0GB 1GJIA 4F58L 4G8GB 1AQKH 4ODVL 3MA7A 3DTXA 3U36A 3KJ6H 4R4BB 1FLRL 1OM3H 5IB5A 1PZ5A 3UTPD 4HW6A 3QCVH 2RIKA 1G6RB 2R2EA 1KG0B 3NN8B 3R06B 4ODTL 4GG6E 1OP5K 1B0RB 4NO5B 3VI4E 4U1JA 4DN3H 3WUWB 5DD0L 2A6DA 4HIJA 5GRJH 3HS0A 3K2UH 1OVZA 1ZANH 5GGQL 2J8UB 1WC7B 4KJQD 4RRPG 3FO1B 3QWOA 3KWWA 4NUGH 3X12A 1VGKA 5E9DE 3ROLA 2R0ZH 5FCUH 2ITCB 1R24A 1WQVT 1VA9A 2Y4SA 5DT1L 4R2GC 4G6JH 2BRRH 4P49A 1R3IL 5I1CL 1GOGA 1RI8A 1MJUL 4MXVE 5K9JH 3FT2A 1M6OB 4RAUA 3BPOB 3BN3B 4I18C 1MCKA 2EYRA 4JAMA 4LLDB 4M1DL 4R3SB 4EUPH 3SGJA 1NGPH 1D5XB 1TTUA 4RMWA 3B2VH 4BFBD 4GG8A 3UJJL 1TQBC 3ZMRA 4CVUA 2R2BA 3QDMB 2O61B 4IBLT 2FIKA 4M7JH 3WUWG 5SX4I 3ZDZE 3F5WB 5I73C 4NQCD 4XPFL 4GKZB 4PJHA 4WUKL 2HN7A 4OZGA 5DJCA 1H8NA 4JPVH 4KWUA 5DRXB 2G9HB 4I0PB 2DBLH 2XKSA 2VQ1B 3GMLA 3MOAH 3GM8A 4LL9A 4P9HL 4PB0L 5LJYH 2VXUH 3JWDH 4R2GB 3BZFA 3I02B 5C07B 3CDCA 1J7VR 4OZIB 3L3GB 3MMEB 4OD2A 4OKVB 1CGVA 5IT2L 3KHQA 4HSQA 4POYA 5F9JB 1JGEA 1WBXA 1ES0B 3I85A 2P45B 4FQ2L 4S2SB 3S4SG 4OCYH 4NNPL 4M61B 2PR4H 2DQCL 1WV7T 5IMKA 4PG2C 1ZHBB 2A77L 4NM4H 4UB0L 1AFVH 2VZ3A 3Q48A 1KYOK 2ZJSL 4GSDH 4YDVA 4CW1B 5HHOA 4NWUH 1HH6B 3LEXA 2W0KA 4K07A 4WTZG 4NQCA 2NTSP 3MODL 2UWEE 3O3AB 3OAUH 5D2NB 5ETUA 5FYLL 3L3IB 3V7AG 2C4FT 4JZOB 4G8GA 4YDIL 4HGMA 4LSQH 4QYOA 3TWCL 2F53E 5B3NA 1MNUL 4KI5E 4NCDA 5KOMC 5JHLL 1N6QH 3PWPB 3WLBA 4HKJB 4HUXB 4KVCH 1R5WA 4KK9C 2R2EB 3FONA 4UNTA 4C58B 1JZ3A 2NTFA 1CG9A 2WQRA 1ZA6A 2G75A 2WBKA 1HKFA 1FCCA 2JELL 4X4MA 4AENA 1JZ5A 3QPQD 3KWWB 3EFFB 5T1MA 3Q0HA 5DJYA 1X4XA 1Q9OA 5HHXH 3OAYH 4Z7OF 2A38A 5IVNA 1ZGLM 1ZWIB 5FUZH 1BAFH 4MD5B 4OZFA 1OOAA 2P8LB 5DZLA 4Y8DC 2K3TA 3GSVA 4LF3A 3BRDA 1T21A 4NPYB 4EI6B 1ED3B 2AJSL 1OQOA 3IFNH 1IC5H 4AIZB 2IALB 5ID0A 4HIEA 4KTYA 5DC0A 3SDXA 5IW1A 5F1OB 1BFSA 4HXBH 1IILE 3HE6C 5E99L 4YAQB 3MLYL 4NM8H 4XPAH 4ODHH 5IB1A 4XVTL 1FGVH 2PO6C 3OB0H 2ZNXA 4UMGA 4Q6YA 1CICC 3Q6GL 3NCMA 2D4FA 1G0XA 3O6MH 4WTWA 3TV3L 5KS9B 1QBLL 4HS8H 1IAMA 4Z18A 1AKJD 3GBNH 5I17B 2R0WL 1E0OB 4XP9L 5I1JL 4LGSB 5AUMA 2P24A 4PGDB 4K3JH 4IMLB 2NYYC 2BFVH 1T6VN 4OUUA 5EZLB 3BKYL 1SJXA 3I02A 4EXKA 1EGJL 4Y16C 1XGTB 3D25B 3D48R 4K3JL 2K9UA 2Z4QB 3OKMB 3RPIA 4EXPX 5CCKH 4MD0A 3WUZA 3CVHA 1GH7A 4NKDA 1I7ZB 5HVHB 1N7MH 2NW3B 4P5TD 4NZTH 3Q5YA 1YEFL 4PV8A 3V6ZB 1KNOA 1BJ8A 4FFZH 4FQXC 4NP4L 3QDMD 1KXVC 4G3YH 5GRVK 3FQNA 5SV3A 3MRDB 1IGFL 1ZVSA 3F5WA 4MDIB 5FAAA 1OPGL 4M48H 4RFEB 4MNHB 4YDVB 1NAKL 3HRZB 3DMMD 5INDA 5IUSA 5FKPA 5CKGA 3ILQC 3NAAH 3DUUB 3M45A 5BRZD 4MHHI 1WT5A 3TT1L 4R96B 1AO7E 1Q8MA 2FBOJ 2VZOA 4YBLB 5DD5L 1AJ7H 3RVVC 4YEFA 4HEME 1EH9A 4HDIA 4LLWB 5FGRA 3QI9A 2WLZA 3RJQB 3TPUE 4HUXA 3GSUB 1MQKH 1CXEA 2WWKO 2NTFB 2OZ4H 4Y5YB 5IBTL 5GS0H 3VWKB 3TYGL 1P4IH 4M3JA 4G6KL 3T3MF 1U8QB 5KS9F 2GT9B 2IQ9L 1PEZA 5ITBL 1KN4H 3OR7A 4UT9L 5LWYL 3GMQB 5F96H 4EZMA 4QRTA 1L9MA 2PR4L 5SX5H 4BH8A 2NY2B 1GPOH 3BW9B 1QRKA 4NQDA 1ZHBA 4HAFA 2G60H 4FP8H 2YXFA 3X17A 1YYML 1CDUA 4JZNB 8FABB 4I0KA 2UZXB 5EBMA 1AD9A 3L5WB 4LU5H 4X7TA 3MJ9A 1FDLH 1X5IA 4F9PC 3PIQA 3UBXG 1R6VA 5IMLA 4X6FB 5CJQH 2UV3A 4RGNB 3VGAB 3O6KL 3KDMA 2CO6B 2GJ6E 2FD6L 3OAYK 3IU4H 4PRHB 3ULVL 4KVCL 3V0WL 1C08B 2X4UB 3KXFD 3DVIA 3SQOH 1X6NA 4YGVB 1RZ7H 4P3CL 4LMQI 4PJ5B 5HI4D 1MRDH 2I5YH 1JF1A 2OK0L 1FAIH 2V2TA 7FABL 1XIWC 2GSIB 4LASL 5KVEL 2CO7B 4RZCA 4GW4B 4WHCA 3Q6GH 3G5ZA 1IEAA 4ZFFA 4U6HA 1DQLL 5HSFA 5GS3A 2J8UF 2AJXH 3S6CA 1IC7H 2VIRA 3MBEA 1KC5L 4WV1B 2P7TA 4OLXH 1DLFL 2BRRL 4ZOEA 3AFLA 3KYNB 1OB1A 3WIFB 1RZKC 1DBML 3AB0B 4K23H 3SDYL 1U8LB 5IVXA 3VGHA 3QYCA 3GSQA 4FXLA 3MNZA 3DROA 5TE4H 3DI2B 4H0HB 3WD5H 4W68A 3BP7A 2E8ZA 3E6HB 3QIBB 3QNYB 5KS9A 5KSAD 4L9DA 4LLYB 5BVJA 1DDHB 3IRZA 3O2VH 4BA8A 3QFDB 4AMKL 4XP9H 5D6DA 1S7WA 1V7ML 1CXHA 5FGSA 5FKAB 4BSVA 2NY0C 4XI5C 4M7LL 4PB9L 2FATL 4LIQH 4N0UA 5L88L 1JNJA 4OLUH 3SE9H 1HNFA 1MCPH 3L6FB 5IBUG 1V8HA 1OGTB 2DYPB 3T0DA 2AI0H 4R7NB 3QIWB 4TVPH 1XGRB 4PJDB 1JGVH 1X4YA 4JY6B 5CEYB 3EJYC 3DV4A 1U93A 4HK0A 3SJVB 2WWMD 2GY7B 5AYQA 2ZKHH 4CRPA 2E3VA 4KAQH 3ULVD 4P5KA 4MVBA 1NDGA 1JGUL 3MFFA 3LIZL 4TNVK 5I0DA 1KJ3H 1LEKB 5J06A 2GW5A 1E6OH 2IANE 3IDNA 4P5TC 4YNYA 3ULVC 4JRYB 3WNMA 4EI5C 4PRIE 3GJEB 4O00A 4DVBA 2BMKB 1FO0L 3KNBB 4NN5B 3BUTA 1HDMB 3QBTB 2E5EA 1NGZA 5T33L 4F7MB 4JKPL 4APQC 2I9TB 2IMMA 4Y5YC 1EBAA 4Y5YA 4WY7H 2Y25A 1MLCA 4L4VA 3GRWA 3MRIB 1HI6B 3IDGA 2YK1L 5SWSA 4PJEF 1OARH 5F9DC 1GGCL 3TJHC 3U30C 1N5YL 4JN2B 4Y4HB 1JPSH 1WWAX 4P4KA 1CICD 1P4LA 4XCCH 1FL5A 3WFBH 5C08D 5BRZA 8FABA 4MJIB 4M6NH 4WUUD 3BZEB 3MXWH 1CT8B 4YIQA 3FQUA 1WCBA 1CDYA 3CFBB 3QUKB 2AP2A 1B9ZA 3CDYA 1RMFH 1N64H 3ZE1F 1IKFL 3PQYE 1AHWC 1NBQA 5IMLB 1HHIB 1YNLH 4KJWC 3S5LG 2YD3A 3P11H 3VFSB 2Z91B 1IKNC 4QHNB 1CFBA 4NO2B 1OTSD 3RGVD 4CADB 1IRAY 4X4ZA 4MYWB 4S1DC 4JY5L 3SDDA 2NY2D 2Y1VA 4Y4FC 1UWEL 2X4TB 4HWNA 1E27B 2FJHB 5FF6A 4HT1L 3T4YA 5FECB 3L7EB 3CC5B 4I0PC 1T04A 2RQ8A 4GLRI 2VXQL 2MMXA 1A64A 3PGDA 2VZSA 3WIHH 1T2QH 3L6FA 3KYKL 1F3DH 4OCXH 2BXYA 5FFLA 1F11A 1T20B 4Y19A 3D85D 1RV6X 4NN6C 1IAIM 4MA3A 2NY1D 3MJ9L 5BQ7A 4FXGB 1RZGB 3C8KB 3LEYH 1CDGA 5F7EH 1MSPA 3X13B 5E5MA 4DAGH 4OZ4A 1J8HE 1T89C 3VU2A 1G7HB 2BY0A 5DD1L 1DBMH 1JPGB 3MNZB 1NFDA 4N5ED 2Z35A 4HC1L 4JY4B 4OF8A 1IE5A 5CJXC 3WDHA 1T4KB 1WZLA 1GHFL 1TVBB 4O02L 3HZMB 4PJ7B 1FFPB 5H35B 2ERJC 5M7QA 1YMME 4BSWB 1NCAL 4HIXH 1IC1A 3V4VH 2MNUA 3VH8B 1VESA 1P6AB 3VXME 5LCVL 4JFDE 1ZSDA 4QOKE 4M7LH 1LDSA 1TDQA 3PE9A 4NO3A 4ODUB 1T03L 5B8CB 4Z7QF 3QDGD 3QQNA 4DZ8A 2OI9A 2Y07H 4MQXD 3KYMB 5CZVH 3ARED 1W8OA 1J10A 1FNSH 4RFNB 3DUSB 5F8RC 4O4YH 1T6WA 4K55A 5D72L 3WBDA 4GUPB 3HS0B 1V05A 1LP9F 4XPHH 3GK8H 3W9EA 1D5ZA 5D6DC 3UX9B 1M05B 2MQ0A 1CIDA 4MLSA 3T0ED 2IAMB 1F6LL 2VLKB 4Q9RH 1R24B 1JWMB 1G9EA 4Y5XC 5GGUA 1U3ZA 1ACYH 5FB8A 2FGWL 4G7YL 5H37G 5BW7C 3RIAK 1W0VB 3O3UN 1I9RH 4L3EB 3QUMH 3EHBC 5FYJU 3O6FA 4YHLH 1QBBA 3QAZB 4JPWL 1VKXA 4X6DA 1BJ1H 4KK8C 2NY5C 1JV5B 4LPXA 5T1LD 3VRLE 4NZRH 1KOAA 1BOGB 4PRID 4KK6C 2I5YL 3HCVA 1WFNA 1SJEB 4NZJA 1EHXA 2XZQH 3LMJH 4IDLA 4PUBL 4NO0B 1CS6A 1GSMA 3QEQB 3QXTA 2NLJA 35C8L 4D9LL 1K6QH 2FJFA 3T09A 4N0CA 3QXUA 2YUXA 4DKFL 5FYKU 5D1QA 1MCOH 1KJMB 1QLRB 1RUAL 1V3JA 2VQ1A 3GMLB 4A6YA 4LLUA 2EYSA 32C2A 3PDOB 1MIML 1ADQA 5FUCE 5JW4N 3G6AA 2YSSB 1FL5B 5FGCE 4WFGD 1EGJH 4AIXA 5TFSH 2ZCHL 2YA0A 4X6DF 1AGCA 3GBML 5IWLC 1FC2D 4OZIA 5EUOB 3JVGA 4HUWA 2R69H 3SKOA 4ONHB 4XZUA 3HB3D 1F8TH 4U1GC 4XP4L 3S5LA 3X13A 5GGTA 4WHYG 4OZ4B 4S2SA 4JQIH 5BVPL 3K46A 3NH7L 5JR1H 5DRZB 1MRFH 5CBEB 2IADA 1JK8A 5I71C 4Z77B 4MCZB 4MSWA 3RDTD 3KG5A 1U9KA 4PRIA 1YUHA 1U2HA 3PABA 3ETBF 4RMRA 4ZXBD 2GITA 1QQDA 3BESR 2FHFA 2EEAA 4HF5H 4WI6A 2X4TA 3I3EA 2Q76B 5MENE 1UB5B 4MWFB 3SDAC 3BKYH 1CD9B 1IGFH 5E7FA 1PY9A 4C57C 2VABA 3DECA 4D0BA 4I77H 2R29L 1IT9L 1Q1JL 1TPXC 4LSVL 1FVCA 3S37L 4TUOA 1KIPB 3KYMA 1OT1A 3ZSTA 5KTEL 3NABL 1D5BB 5C0RL 4NQEA 1NMBL 3FN3A 5HVWA 2ZG3A 3IJHB 3BEVA 4XCFH 2F74B 12E8L 4FFEX 1DN0B 1BQHG 1I9IH 5FO8B 3QFJA 1Q9OB 2JB5L 5I8KL 1F90H 3BQUD 4RX4A 3CSYB 4NRZB 5JHDD 5D1XA 1A2YA 3SY0A 2AK1L 3OG6B 1TVBA 1RAMA 2OJEA 5DJAB 3MRCA 3MRBA 2FYYB 4OLWL 1QO3A 2YD6A 3SKJL 4IS6B 1A47A 4I3GA 4NKOA 1GIGH 4I8DA 5CINL 4NHUE 3O8XB 1FJ1B 1U8IB 2DQTH 3K3QA 4GAGL 4LOUD 5CZXD 2VAJA 2XA8L 4WI3A 5JPNB 3OMZA 1QFHA 1WFTA 3L3DB 4GAGH 4WFHD 4JRXD 5KVMC 2XN9D 4X9BA 4J4PD 3EDDA 5DJXA 5IROC 1KIRB 2MCG1 1CD1A 4HQQH 5FDYA 5HI5C 5DJ2A 3PHSA 5DRNA 1CD0A 3EGSA 4KUZH 4WFGE 2GUOA 3OB8A 1H3PL 4JO3L 1HKLL 3M1BB 3DVGA 4PGCB 4XWGH 1OF2A 2VWEC 5KSBE 5IROA 2NCMA 4U1JB 1CLZL 4PRAB 1JZ2A 1IM3B 1OAQL 1YY9D 2A9ML 3MCLL 5MEOB 1QNZH 4HUNB 1FHGA 5HY9A 3DO7A 3UP1A 2J2ZA 1CF8H 2HLAA 4HWBL 1S8DA 1S3KH 4XNQA 1JV5A 2ZP0T 4HUUB 3EW3B 1KNOB 4TULL 3PNWB 2DQGL 1EZVX 3EZJB 1QRNE 5DMJB 4C56D 4ZNEA 1J0IA 5E8EA 2XWTB 5C2BH 3E3QE 4Y5XA 2XZQL 3OKLA 4TVPE 1NCUA 1TENA 1ZVSB 4MDIA 3AAZB 4AYFA 1LHZA 2A6IA 2PF6A 4GMSH 1TQBB 3BDXA 3C2AL 4J3XA 3NCJL 3DSFL 4Z7NF 2XWJA 2GTWA 4FG6C 3FQRA 2FWOA 4JLRA 1NBYB 1OTTD 1VGEL 1D5XA 4WW2F 3K4ZA 3LRSA 3V5HB 4P2QB 5IQ7L 3Q6FB 4ZAKB 4G6JL 2B4CC 3EYVB 5I76A 1HHJB 3KR3L 1KIPA 4ODSL 5BS0B 1U8KA 4KKLD 4HK3J 1ADQH 1PKOA 2R69L 3QJHA 1A9BB 1MHPL 2Q20A 3D18B 3I75A 3C5ZA 1KJ2L 4XPGL 5HDLA 5EU3B 3CIQA 2IFFL 3L5XL 3GMRB 4HD9A 3OHXA 3LSOB 3E2HC 3QXDA 5D7IE 5EU7E 1IMHC 5DJAA 1TZGL 2VISB 4KMTH 5AWNL 4WEBH 3QUMA 3M17B 3U0WL 4Z7WF 3T0EC 4NIKB 4YBLC 1B6UA 3AY4C 1ERNA 1DBBL 4MD4A 1FVEB 3FOMA 3TVMC 3RL2B 3MA7B 2GTZA 1I85A 1D5MB 5GIRA 4XPHL 4NJAH 3VD9A 5DZOA 3VGAC 4PGZA 1O0VA 4YWGL 3UC0L 1UXWA 1KJ3L 3PP4H 1S9VB 4YLQT 3JV4A 2PTTA 4QRSA 3VGBA 4XNZB 4I4WB 5HGAA 2DL2A 4KAQL 3MTRA 3OPZL 5K9KA 25C8L 2MCPL 3E2HB 5IW3A 1X44A 4F7PA 3EGSB 5D1XB 3SY0B 4EDWH 3UROR 4M7LT 3NA9L 5DEFB 4JR9L 2WSKA 5J12C 4G6ML 4NKIH 3OXRA 1K9TA 4OF0A 4EEEA 3SKNA 5FYKE 4PRHE 3EO9H 3N1GC 1XR9B 4GRMB 4GLRH 2X40A 4V2CB 1X5GA 1FN4B 1I3RB 1JYNA 1D6EB 2GJZA 3LAFA 5D1ZC 5JQ6H 1SMOA 1I9RL 3RU8H 2EDDA 1RQ5A 2J3SA 4WVRA 1JF6A 4QRPD 4OV5A 4LCYB 3IKCA 2PO6D 2VXVH 4AIZA 3KPOA 4DOHE 1FLRH 3QDJA 1OLLA 5JIIA 1R3IH 3NFNB 3HE7B 2XWJB 4BSVB 2OQJA 4X98A 4JFEB 1DUYB 3GSRB 1HHHB 3IFOB 2Q3ZA 4F2MB 2WBWB 2NY3D 2A2QT 3SCMC 4EIGB 2IPTH 2AK4D 3LEYL 3EUUA 5EIVA 2HMIC 4IOSD 1NCBH 1IAII 1Z2KA 2J6EL 4M1DH 4RMTA 3VFUA 5D9SB 4ZUVB 2QQKL 4OB5H 5GS0C 1DLHB 4LHUG 2YPVH 3ARDC 4F58H 4XXCA 1FYTB 1OAYL 4FQPA 4HLJA 4E42B 1MVUA 2NY5H 3H7BB 2D7MA 5DXWA 3G6JB 1P4BL 3O6LL 4V1DE 5DLMH 1I7ZA 1BF2A 5KZCB 3ZDXE 4LHUB 5JW4M 2EKSA 4PRDA 3GJEA 1BREA 5D96B 1G7JB 4HWZA 1LP9E 2HT2C 2RB8A 4N8VG 5C0AE 5MP6L 3H9SE 5I16A 3MXVL 3ZZ1A 2I25N 1TZGH 1EPFA 5E70A 2FHBA 4P2QD 3S88H 1Z9SA 5I8EB 3K7UA 4NCC2 1CDBA 3D18A 3I75B 4OGYH 3T3PE 3RWFA 1MLCB 1KTDB 3B9AA 2WV3A 2VXQH 3VDCA 4AENB 4GFTB 1PG7X 1KCSL 4Z7WE 5ANMB 3EOTH 1OL0A 2ZUYA 1KCKA 3S36L 1IM9A 1A6VH 1F6AB 1U3HC 1KCSH 3PL6A 4M93B 2OZ4L 3UTSA 1IGMH 5EOTA 4L9LA 1QSFB 1WSST 4GRLD 4N8VB 3OPZH 3UJIL 2WBJB 1VPOH 4RWHA 4EN3A 2NY7L 1D6EA 2X89A 2IEPA 4OZIF 1NJ9B 1UENA 2OMNA 1NPUA 2GAZA 1OTUD 1P9MC 1GAFH 1FG9C 2DDQH 5JOFA 5LQBL 5C0CA 4KROB 3GIVA 5DI8A 5I6XB 3JWOH 5IEHB 3QISA 3KAAA 3SGEH 4UT7H 3MYZA 3REVA 3FCTA 4KKBD 4OI9A 1YQVH 3CVIH 4OV6F 5FF6B 5CJ8A 3E3QA 2VXTH 4P99A 4U1SB 4DN4L 2DIBA 5FDWB 3CSPA 5I15L 4EDWL 2DWDA 1MCWW 5T5NG 3G04B 3OF6D 4M9PA 3UBXI 1CK0H 1F00I 4KXZH 3MJ6A 1EHNA 2Y7QB 2WM0A 3HMWH 1AKJA 1JRHL 4OD3L 4R26H 1CGYA 3X3FH 4XCYA 5IK3B 5C0IB 1T5WA 4AM0B 3MZGB 4M8QA 2GJZB 1G7LB 2P5WE 3ARFA 5EWIL 4KVNH 4F37F 2BNUA 1TMCB 3IU4L 2Y72A 1CE1L 3PV6B 3T04D 1X5FA 4L8SB 3C9NA 1MIEH 4OQTA 1A8JH 2OL3L 5DWUL 1F2XK 4CKVX 1FGVL 1KJVA 4R8WL 2BJMH 3V52L 5HBBA 4GAJH 3ARYA 3FFCE 1IBGL 4R97B 2AGJH 3FFDB 2Q6WB 5HHNA 4F2MA 2CGRL 5E8DL 4R4FH 4GG8B 4Y4KC 2H9GA 4ZUWB 2SEBB 3LN4A 4GKSB 6FABH 1LMKA 4YDKL 2VZVA 2ILLA 4P9MH 4Y19D 1TVHA 1F2QA 3O8XC 4R4NC 1L4IA 3OSKA 4JREB 2V5TA 3QQ3B 4J1UB 1OAXH 3QEUB 2VAAB 4MJ6B 4RDQF 3W9EB 3T0EA 5CEZE 5J11B 4K3DL 1RJYB 3OG4B 4X5WB 5C07A 3H9YA 5DK2B 5IP4A 4GRWF 4ZSOB 5BOZG 2DRUA 4LPUA 1QHPA 4G6AD 4J2XA 1AJ7L 4X8JB 3HC3L 5F3BB 1EVTC 1BBDH 4NQVB 4Y2DB 2ATKB 3TT3H 1F6FB 3DJ9A 4G9DA 1JMZA 3NFPA 3H9ZA 3MUHL 2P8PB 2LAGB 4LIQE 2JLLA 3LRGA 1CFSA 2FEDD 1ZA3A 3UJTH 1IGYA 4FMKA 2DQHL 3SPVB 2QHRL 2DLFH 4XBEH 3GSNH 1DBBH 3VCLA 1WIUA 2XQYG 1WF5A 3TC9A 1FVDA 2ATPB 3WE6A 3V6OE 2NXYB 4R0LC 5FGBC 5EG6C 4KRMB 4PJDF 4DGYH 2IANA 4LNRA 1GIGL 5IJKC 4OSUL 1TIUA 1FL6B 3DX6A 3RY5A 5F96L 4ORGA 2VDLH 1A7NH 5KVFH 2I9TA 2R1YB 1PSKL 1NSNH 2H1PH 2ADGB 1YEHL 1J88A 2OM5A 5EA0L 3GBLA 5BZDB 4YXHL 4F7EB 4P59L 4MNGB 2FD6H 4N8VA 3S96A 4XZUB 4Y19E 3AREB 3LD8C 4EOWL 4KY1L 2H32A 3BVNA 3QULA 5JIPA 3WIFA 5I8KH 4CU6A 1G7LA 5F44A 2X1QA 4I1NB 5JXAL 1AFVL 2HFEB 1IZJA 2BOCA 2GAZB 1CF8L 4NDMA 4XWGL 2IAMD 5H94B 3LRHA 3MV8B 1FZJA 2HTLD 3C2AH 2CIKA 2ED7A 1ZEAL 3AMLA 3WFDL 5C0AB 1JUFB 4JFHD 1OP3H 4LVOC 2Q7NA 1X4ZA 1XIWD 3U82B 1CR9L 4QHNA 2HJKA 2VTFA 1N26A 3D69B 3QIWC 1A1MB 1KTLA 2OL3H 1IAIH 2XI9A 2XTJB 5DWUH 1OWRM 5J1TC 5EPMB 2V2XB 2GIYA 5I1LB 5BXFB 5KVGH 2BERA 4QOKD 1KYOJ 3MRLB 3MRMA 2W0FB 4UI2A 3KLHC 5K59E 1YNKH 2QSQA 5FK9B 2ZUSA 4NGHL 4M8QB 1TTGA 1ZGLA 1RUPL 3FB5B 4L4VD 1X5YA 3FB6B 3ZT5A 5BZWA 1ZANL 5GGQH 3FZUC 5FO9B 4N9OB 1AIFA 3U30B 3BSZH 1K8DB 4P9ML 5HHQB 1KT2A 4CAGA 1AGFA 4UILL 3MRQA 5E2WH 3TO2B 5LGJA 1MHEB 5J6GB 4NSKA 1AQDA 3LKPB 2R39A 4XVTH 2R1XA 4D9QD 1FSKC 4GRWH 1CTNA 3QCTL 5HVHC 1FORL 2ICEA 4H1LG 4L8DB 5B8CC 5BVPH 3I6GA 5EDXA 3MV7E 3SDAA 2DLEA 3QUXA 4JN1H 5D93C 4ESKA 3B2VL 3LH2H 1BQHB 2E6PA 4DAGL 1XIWB 2IQAA 4ODUA 1IGTB 1T22A 2QBWA 4L5FL 4U6TA 1YJDL 4JANA 5C0NC 2F54B 2KH2B 2R1YA 1A6AB 2C7UA 2XKUA 5D1XD 3MLPA 2PXYC 1CLOL 3HE7C 4Q9QH 4BZ2L 3RTQD 3IDIB 4OZHA 4GW5A 3UPRA 4Z8FH 5HY9B 3QH3B 1MCNA 5JOEA 1KLGA 3TA3D 1UM5H 4YR6B 1AY1H 3C6LB 4LCWA 2XA3A 2IAMA 3O2DH 3X3GH 5FYJH 3PNWA 1T1YB 4WUUE 4WHYH 5CP7B 3VW3L 1QKZH 4JCLA 4F8TA 3OKLB 4FZ8H 2AJYL 5T5FL 4G7VH 5IFAH 5EO9A 1Z6JT 1CFNB 5A3ID 3LHPH 5CEZL 2E7BA 5D2LE 1WIOA 2VL5A 4X6BA 1E4XL 5CIPH 4WY7L 4M93C 3SDAD 1REIA 1V7NH 1HILB 3IETB 3HG1B 3FQRB 4HMCA 4X6DB 2IFGA 1NLDL 3BE1H 1A1NA 4Q0XL 3QUZA 1M4KA 4I5BA 4G8GE 5E94B 1A7RH 1HHKA 4ODBD 1BLNA 2NYYD 2UUDH 3WL9A 5I66A 4EIZC 4PY8I 1L7TH 1I3UA 2NZ9C 5HDBE 1ORSA 3KS0J 1WZMA 2DF3A 1Q72H 4XPTL 2W38A 1ZT7A 2H2PD 3C5ZB 5D1QB 3TH2T 2EXYD 2ZZUT 3HRPA 4HX1A 4ODXB 5EZIL 3TF7A 3MNVB 1S7VA 5EU4A 5SWZB 5BMFL 5IVZB 2YMXL 2OR9L 4GAJL 5IMMB 3D5OF 2EZ0C 1RZFL 4RGMB 5DVOA 2XXMB 1UCBL 2AKRB 2HJLA 2JF1A 3TO2A 1OGAA 4FS0A 2IGFH 2Q8AH 2Y06L 4WGWB 1MI5B 3VXRA 3PWNA 1NAMA 1FG2A 4ETQB 1OB1B 1DE4A 1WBYB 1YMMA 2ORBH 5EBGA 3W9DA 5E6ZA 3BGFC 2ZOKB 5B8CA 3QJFA 3ZTNH 4OTXL 3QG6B 2BVQB 2VXSL 3E6HA 4UT6L 3WS6C 5FOBA 4YHNB 5F9AC 1PBYA 3BDBA 5FYKD 2VXVL 4NN5C 5C92A 3TGXA 2V2XA 3BUYB 5BMFH 2CGRH 3QO0A 5IV2B 3ZKSD 1T7XA 4CU7A 1UCBH 3EDEA 2XWBB 1J86A 3FB5A 2CR6A 3MRPB 5K9JL 4E0RB 1IKFH 1S5IH 1A6TB 3WIHL 2DBJA 3MREB 4PDCE 5IG7A 1SJHA 3VFTA 5IFJA 2K1MA 2EDJA 4Q9CA 3QZWG 3BWUC 3BGMA 4OZIE 3UTQB 1BVLA 1S5IL 5ID1A 4PB9H 2EIZB 2OSLA 4MXQC 4OGYL 1MEXL 4IRJC 3TZVB 2FO4B 3ULUL 4PJFA 2KQMA 3SJVA 1J0ZA 1XF5B 3AXLB 1T1YA 3OJDB 5TJWK 1F97A 5DFVC 3PWJB 3DX7A 4I18A 3ARXA 1YY8B 4XGZB 4MXWL 4ZO7A 4XVUD 4PB0H 1EVUA 3ARVA 3BN9D 4PV9A 4DOHB 3ZLQC 4BM7A 1KJMA 1QLRA 3HE7A 3X3GL 4I3RH 4U7SA 3VDBA 5DJZB 1F4WH 5GSVB 3VD5A 2JJTA 5F89B 1HHGB 4WDIA 2LABA 1INDL 1DQDL 5E6IB 1DBJH 4ZFZA 2MWCA 1YDPA 4YFLI 4I2XB 1NDMA 4ELKB 3H9SD 3QUXC 1R5IA 3TNMB 4I0PA 4XXCC 4JN2A 4NHCL 3PWLB 1KPRA 4PJGA 3D85B 1AXSB 1AQKL 3FB7B 3S35H 4G8IA 3RWJB 5MHSE 1F3RB 4S0SD 4U7KA 5C0BE 4KROC 1DQTA 4V1DD 2ICCA 2CLZA 4G8EB 3MLVL 4IRJA 1WK0A 1SBSL 1EUUA 1I8IB 4PJEB 4KUCD 3KLHD 1LE9B 2NW2A 3LKSB 3MLUL 3DO7B 4WW2B 3QHZH 3QUKA 4XP1L 5AZEH 4LAQH 2H8PA 4GXVL 2IC2A 1SVZA 1T2JA 2I60H 3BE1L 4GG6F 4I5BB 5TH2B 3CUPB 2CRYA 3ZT6A 3ELAT 4L29A 2VDRL 2A9NH 2RCSH 2JE8A 4PJGF 4FQCL 2BVQA 4K2UH 3B6SA 4KJQC 1CLZH 3IDXL 1RURL 3ERYA 1HSBA 2RFXB 4ONOA 5C9KA 4TSAL 4JDZB 4LCIH 1JZ6A 1H5BB 1AGDB 4N8CH 2F74A 3W5MA 2FECL 3FB8B 5BV7B 2JJSC 3VWJA 1MFCL 1KN2L 2GEEA 3ZKND 5DJ6B 3EYVA 2NY1B 3H3KA 5GGRY 2CUIA 3MLRH 4D9QE 4OCRH 1QBML 3OL2A 4OT1L 3T65B 1GC1H 1IEBB 5F9OH 1A7PL 5KZCD 2BXZA 1BF8A 1I7TB 3FTGA 2QSCH 4D0DA 1W2KT 1IARB 1XCQB 3FO0L 1D7FA 1SBBA 4QRRD 5A16A 1F3JB 5TE6L 2WUCH 3GSWB 3LS5L 2Z92A 2LTQC 3VXPA 3MQIA 4OGXH 4X7SH 5IMKB 4LCUB 3G5XB 5TPWH 5F7KC 3UDWC 4PJ7A 4O51B 4K3HA 4HKXB 3KPQB 5K9QG 4RAVA 4U1MB 4XGZA 1NBZA 1Y18A 1FH5H 5F21B 1KEML 1M7IB 5INCB 2NXYC 4GQ9H 2V7HB 5JLZB 4G9FB 4L3ED 4YAQA 1IC4L 1JCKA 4IMKC 4MAYD 4PJBE 3SO5A 1XF4B 4J3OC 4RRPA 4NP4H 5B4MC 5KW9L 3WO3B 5JORA 2O26U 1VFAB 1ZLSH 1N7ML 5E6IA 4YXHH 1UXWB 2XQBL 3UTQA 4LVHB 4KJPC 1KN4L 1SY6L 2R0LL 1JTPA 3OKYA 4R7DA 5CJOL 1E4JA 5EOCH 4LKXB 1GPOL 2WP3T 1JPTH 2EDXA 5EZLA 4Z8FL 1A7NL 5KVFL 3GGWA 5B39G 4H88L 3GSXB 3F7PC 2W65A 5CD5D 2HRPL 2GJ6D 1BGXH 4I0CC 1LE9A 3TT1H 2HG5B 1W72A 1NCCH 1FNEB 3RP1A 2H8PB 3EBAA 5E8OA 3JTSA 4IEFB 5IB1B 1P9MA 1K2DB 4G7VL 4Y5VC 5IFAL 2UWEB 1YPZE 1FNLA 5FV1L 5CP3H 3DIFA 3A6BH 3DV6B 3P9WB 1T3FA 2O5XL 4HJ0C 4YHOL 2CDGB 4HQQL 3HR5A 3FT4B 3QUML 2O5YH 1A4KA 3WFZA 1VFUA 3SKMB 4XMPL 5D7LD 4YHYB 4OFPA 1XZ0B 2OP4H 1MFEH 4NQTA 2NR6D 5HYSA 1H15A 3GI9L 1S7UB 1Z9OA 4JCMA 3HG1D 1CFQB 2X41A 5DDHA 4JKLA 4WI5A 1VEOA 1J05B 4KUZL 1YMHB 1K6QL 3K1DA 4ZSOE 1JL8A 4ELMF 1YN6A 2DWEB 3A6CH 1RZIB 1WEJH 4KKCC 3LDBB 3IDYB 4H25A 2R4RL 1NMCB 1WWBX 1BM3H 4P3CH 4C56E 1WUNT 4PJGE 4YHOH 3O4OB 1I1CA 3NFPB 1UM6L 3GSWA 3V0WH 1LP9A 5LAXA 3V6FA 4TVSa 3RL2A 5D1QC 3CGTA 3GMPA 5IKCB 1TETL 4POZC 4ZDHB 4Y4KA 4JREC 2AGJL 4ETYA 1NC2A 3MOAL 5DSCB 2MQCA 5I1EH 1X5LA 5I9QB 2RFXA 4O2EB 4LHUA 3O6ML 4KXZI 5EWIH 4E41A 2DM3A 5HGAB 2CRMA 3NCBB 5GJSH 3FO9A 4X6EA 4FQJL 4G8FB 5EIIB 5TF1H 2FEEI 2AW2A 3ULUC 1CVSC 1J9CT 3NMEA 4JFXB 3JUYA 4WFHE 2E7LE 4WNQA 1UKTA 2EH7H 3QI9C 3OXRB 4OFDA 2EEDA 1NAKH 1NC4B 2NQCA 4K7PL 3HTLX 4GRLC 3B5TA 2N1KA 3S96B 3GI8L 4EBQL 1QBLH 4FRWA 3IJSB 3C6LC 2QADC 3GDBA 3WIIH 3OWEA 4FFZL 1D3CA 1I7RA 1MCRA 4RZCB 2JJWA 4ZODA 5D71H 2AQ3A 4QXTA 4OF7A 3TEUA 2BOCB 5DVMA 1CBVH 4U1MA 5JW4Q 2F5BL 3VJ6A 1MHHB 4CVWA 2VN4A 2P42B 2DKSA 2HG5A 1C5CL 3Q1SL 2LAAA 1GGIH 1BQLH 3KLAB 5K9OB 5L8JB 2WIIB 2LE9A 1KUMA 3KYAA 1YPZA 1S7QB 3D0VB 1HHHA 3KDMB 5DA0B 1NMAL 4C4KT 5ICYB 3IFPA 4N5UA 2FSEA 3NZ8A 2B2XH 2ARWA 5D1ZA 1VADA 3BP7B 2R0KL 4YQXH 1BFVL 4PLKD 3UO1H 3MRNB 2VC2H 5EC1A 5IEHA 2FGWH 3W2DH 3BKCH 3EYUH 1MOEA 1WC7A 3N85L 1UA6H 4L3EE 2O93L 4XCCL 4QXUH 1NLBL 3RWIA 1CFQA 2UWEF 5KSBB 4F37K 4TSCH 4JPWH 4I48B 4JHAL 4OLWH 1RK1B 3FT2B 4RAUB 1OM3L 4MVBD 4KI5D 3C5SB 2XRAH 1AC0A 1YEIL 3DRQA 2HLAB 3WNKA 2D7NA 1AKJB 4U6XA 4OLZL 35C8H 4D9LH 4RDQG 2VLRA 3OXSA 1CZ8H 1EUTA 1UCTA 4A2LA 1CE6A 2EE3A 3KJ6L 3NTCH 2UWEA 4IOFC 4JFFB 3OX8B 3FOLA 3QIBD 4LMQE 5ILTH 5KANI 1LQVA 1T7WA 4PYHA 2MQ3A 1G0YR 3BAEH 4E5XA 2X42A 4J8RB 2EDEA 3BP6B 4HXBL 3TBTB 4IHOA 1BQHA 1CGTA 4P2QE 4G6FB 2EXYC 5F1SA 3RZCB 3NPZB 5ENWA 1NCBL 4HBCH 5J6HB 1RUAH 3OBAA 3N06B 1A4JA 2YOCA 2OR8A 3LKQB 1BPVA 4OKVA 1SVCP 1XEDA 3ZHDA 1NC4A 3KPRE 1IAOA 2BDNL 2PW1A 4OJFL 2Y36H 3F8UB 3BD4A 2NNAA 5GS2H 1RD6A 4LRIA 1X5KA 1J0KA 1ONQA 2G5BA 4OLUL 4LPVA 2FBJH 1F8TL 3A6OA 4XP4H 3ZTJG 3MRKB 2NXZB 2HT3C 1L0QA 5EU6D 4JVPA 2EO1A 1TCMA 4XVUC 3O3AA 1KLFA 2AVGA 3S4SB 4MX7B 1PX3A 4XP5L 1NGXA 1TJHL 3MUZ1 4PLNC 1T03H 4OCXL 4WWKD 3RI5F 5C0CE 1TTFA 4WUKH 4AG4H 2OX5A 4QLRA 3TBVA 4NC2B 5D8JL 4MHHG 3TVMD 1YN7B 1RZJL 1A3LL 1TJGH 3VCLB 5I19H 4C59B 4TYUA 2FR4B 4L4VB 5JMOC 5E9DD 2X4QA 4WWKC 3TN0B 1TQCB 4U1KA 5CEXB 1U8NB 2W0LA 5K93A 3BKML 1A21A 1JF5A 3RPKA 3MRJB 1LK3L 3KLSA 3RWCA 1I75A 3HC4L 4I48A 2P8LA 4YXKH 4N0CC 4KPHH 1Q0YL 3EO0A 4MMZC 2PW2B 4JZJA 3FQUB 4X9HA 4FFVC 4MJ5B 1RJLA 4G80B 1S9YB 3TBWB 4FZ8L 5E2TH 1NANI 3B4NA 2VUOA 2H32B 1CDCA 3BVNB 2X9XA 3EJZD 2COQA 1DE4B 1WBYA 3RJDA 3CZFA 5TDOA 1LE5A 3OKNB 1DR9A 4FQQB 1UM5L 3MRDA 4WEMB 2P5EA 4WI4A 2VLJB 5KVDH 4JDVB 3EYOA 4Q6IC 5T1KD 3FT3A 4HPYL 3SE8H 5JZ7D 3ISWA 1RHHA 5HYSG 4POUB 2ZSVA 3AM8A 2ZUTA 3T77B 5L0QB 4F33B 2IBZY 2XQYK 5ENWB 1E4XH 5HYJB 3BKJH 5D2LF 3LB6D 1Z3GH 4HDIB 2VQUA 1QPPA 1EIBA 1UACL 1MCQA 4MD0B 5HYQA 4C4KO 1LO4L 2CUHA 2J1KA 1R3JB 5FM5O 4RNRB 1BVLB 5F3BA 4PJBF 2E9WA 3STZB 2FO4A 4YHIB 2NX5E 1CE6B 4DJMA 1ZT4B 2X70A 4ODTH 1ZT1B 4XMKH 3VFRA 4N1EA 4D94A 4BH8B 4RIRB 3O6FD 4EUPB 1EAPA 1T4KA 5GGUB 1UZ8A 5C0AD 1I1RA 4PJIF 2AEPH 3KJ4B 3WHXB 4Z7WB 4JM4H 3VMOA 1CI5A 3SOBH 3KPPA 4ZNCD 1G7JA 4K23L 3SDYH 4QHLB 5C0DA 4P2RE 5MENB 3B43A 3VRIB 5TE7H 3V6OA 4DZ8B 2HYMA 1WICA 3RX8A 3IDMB 1YEFH 3NZHH 4K3EH 2YWZA 1QA9B 5F88B 1A14H 4F7EA 3UTOA 3GMOB 3ZKMC 5IQ9B 4FHBD 3L3JA 5E4IA 2ARJQ 4PJ5A 1NGYA 1UC6A 4D0CB 2XTLA 3WKMH 1JI1A 2WBJC 2VLKA 1YEGL 4QNPF 4QRTB 5B38A 3NACL 3VFNB 3RGHA 1S78C 5HHVH 2R4SL 1OD9A 1BJ1J 4OSUH 1CLYL 3D39D 2BVOB 4UU9A 3NCFB 4EUPG 1MQKL 1KLGB 1AR2A 2QADD 4WV1A 2MTPA 4M7KH 1P5UA 5EFIA 1RIHL 5DMKA 1HH9B 3ZTJH 4NZTL 5ISZA 1BOGA 2EDQA 3ZHLA 4L8CA 4ZS6C 1LO5B 3NAAL 3VWJD 3BEWB 3P9MA 3PABB 5IMOA 3P2TA 4GBXC 2ADIB 5L6YH 4BQ6A 1MHCA 5DD5H 3SDCD 3GNMH 5EU6A 1FC1A 4JRXE 2QQNH 4WUUA 4D2NA 1N3NA 5CD3A 2ZSVB 1H3VA 4MA7H 3FB8A 1SMAA 4F33A 2DS4A 1BD2E 2M2DA 4BFIA 5TDNA 4HUWB 5EORL 3QIWA 1ORQA 1ZVHA 3F7VB 2YBRB 3WN5C 4RGNE 2L7JA 3D39A 4MNQA 2Y5EA 1H3PH 3WS3B 2HKHH 4S1SL 5LGJB 5CIPB 1J8KA 3RWDA 2NXZD 5JHLH 1V3KA 1MAMH 4KI5F 4Y89A 4LRNL 2OBGA 3F7QA 1Z5LB 1AXTL 3E3QC 2R4RH 2PXYA 4Q74A 4ZOBA 4IIQA 1CCZA 3QNYA 1I8MB 3QEHB 1QYGH 4UNVA 2ZSWA 4YNYB 2BHZA 1PSKH 4YX2L 3MCKB 1J1PH 2V7HA 4LPCA 1HWGB 3WJJC 3JV5A 4QHLA 3TPKA 4EVNA 1U8IA 4B7IA 4N90D 3QIUA 3VFOA 3H3PL 4MAUH 4RAHA 2FZ3B 1W72H 3CFKA 4V3DB 2GK0A 3G6JE 3BSZL 2O5YL 5FOBB 5ADPH 3CH8A 4MGXA 2LTQB 4UILH 1JGLL 5I1DB 3RHWK 3QQ9D 4M6OH 5K9QI 4X4XA 4L4JA 3RWGA 5HHPA 5C8JA 2YD7A 3QFJB 5GJSL 4P4KB 1ADQL 4Z0BL 5CGMA 3L3HA 4QRQB 4FTVB 1BBDL 3NIFE 3HZVB 3TIEB 1QTYT 1P1ZA 1C12A 4YDJA 1MIMH 2V2WB 2VH5L 2ZUWA 1ND0A 1J8HB 1QLFA 3W11C 4Z7WA 2I07B 2VL5B 2VH5H 4X6BB 1KENH 3R4DA 3KPPB 2BNRB 3MGOB 4Y4FA 3VGFA 3SOBL 4BKLB 5BV7C 2JJTC 2ZOLA 4MS8C 4BQBA 1WFOA 3C87A 1K2DA 1KB9K 3H9SA 3VFGH 3KPRA 2A73B 4NGHH 3BEWA 3P9MB 1AGBA 3O3BB 3VFWB 2A6IB 5B22A 1DN2A 4J3VA 4YC2B 4G3YL 3ILPB 1AO7D 5KJRL 4OI8A 2NZIA 2OXGA 1P7KB 4PR5A 4XPBH 4Y4HA 1UVQA 3BHBB 3SDDD 4M00A 5KSAB 3LPFA 3BX7C 4WW1B 2AJ3A 2I9LB 4PTUA 4RGMC 2YS4A 8CGTA 2OMBA 4JFPB 3QEGH 3MC0A 3V95A 5BQ7B 5AG9A 3F7VA 4NFBA 4NZRL 5A2LH 1A9EA 4ACPA 4NNXA 5ICZA 3BT2H 4NQSB 3QDME 3LV3B 4FTVE 3OZ9L 4LSSH 4HIHB 3QSKB 3PWLA 4PJGB 2M1KA 4Y5VA 5IR1B 4YZFE 3UBXB 1NMBH 1MFDH 2Y07L 4ZFOL 4MDJB 5IBTH 2DLFL 3EJJX 5F3HB 4K9EL 3GIZH 3HZMA 4Y1AD 3BDYH 4LHUD 1ZLUK 4KY1H 4N0YL 3J8F7 1FGNL 4OLYH 2I60L 4JM2C 5HDQL 5IJKA 4MJ2A 5IOPA 3HNVL 1ZVYA 3S34L 5CEZD 1LO4H 1A3QA 5TH2A 1IQWL 2YN5A 2ESVE 2WLYA 4MA7L 4QY8B 4YE4H 3QIUB 3V0AC 4FFYL 3X3FL 2F8XC 3IXTB 1XCTB 3PWPA 3DGCR 3ORJA 5DD0H 5C09A 1XR8A 1VFMA 1RURH 3PG2A 2KDGA 3CVHL 1JI2A 1J11A 4JQVA 5JXEA 2BZDA 3MJ7A 1MCLA 3QB7C 1RMFL 2IH1B 5H2BA 4DW2H 3RWGB 1BBJB 2X1WL 3C6SA 4WO4C 5HHMD 5H37H 3CH1A 5J89A 1X5ZA 1U91A 3LSOA 4HULB 5SWQA 1YEKH 1NUGA 5D4QA 2WIMA 1GC1L 1CDHA 2AERT 2APVA 5HHQA 2BHYA 4JGMA 5E8DH 3GSVB 1EFXD 1O7SA 4LF3B 4RFNC 4WU5B 5IF0A 1YY8A 4X4YB 1HN1A 3EKCA 1BIIB 1D9KC 1KIUA 2PTUA 4M6OL 4OLVH 3C60D 3VH8G 3VJ6B 5F7NC 5ID0B 3RAJH 1QHOA 4HJGB 3MGOA 4Y4FB 3QCVL 3QNZA 4PRPE 4ZUTB 1RK0B 2X4NA 4GRWE 5F7EL 5GHWH 3QG7H 1P7QD 1R0AL 3MA9H 3S8WA 3H9SB 3EJZC 1LK2B 4FQHB 1IZKA 1MJUH 4RAVB 4CU8A 4FQ2H 4BH7A 3MRNA 4ZOAA 5EULV 3IAPA 1NDMB 3T0WA 3SCMB 1G9NH 3GB7A 4Z7VA 4UIKL 1LO0L 3QWRD 4B41A 4F7CB 1QOKA 4PS4L 3E2HA 3Q3GA 5HI3D 5DURB 2JJSA 3IXAB 3R0MA 3PV7A 2AJ3B 4PTUB 1C12B 4YDJB 3GFUA 3PQYD 3TN0D 2E7HA 1U8JB 4U1NA 2OLDA 4TRPH 2ITDA 5MI0C 1OCWH 4CMMB 1TZHB 4PJ9C 4XX1G 1VKXB 1JP5A 4KRPD 1YNTB 4AT6B 1NCAH 4GKOA 1N4XH 2IADB 3TO4D 3MZTA 4JFFA 3HI1A 5J8OA 3CDGA 3T4AB 3U4EA 1HE7A 4NQEE 4Q9RL 4QHUA 3QUZD 3WFHB 3E6FB 1CDIA 3V0VB 3V2AR 2DM7A 3G6JA 4XCNB 3IFLH 4LDEB 3EAKA 1DFBH 3RL1A 1TXKA 2AEQL 1GYAA 2KUTA 1TJHH 3T0XA 4PRDB 3PWPD 2ESVA 3GJFH 4G43A 4NHCH 4O2FB 4PRBA 4X4ME 5DK0A 1LEGB 3HC4H 1U8PA 3UYPA 3O4LE 4WEUD 5F7YC 2W60A 2WQ8A 5E95B 3RWEB 1CVRA 5DF0A 3VI3F 3FQWB 4GSDL 3BJ91 3RVXC 3SKOB 1MREL 4O2CB 1G9MH 4MZ3A 3WFBL 4ZTOH 3FKUS 5HYSB 4MNQE 5GS1C 3GK8L 1A6WL 2NNAB 1BEYH 4Y5VB 5IR1A 3CH1B 3W0WD 3IU3A 3S35L 4P2OA 3WYRA 3TFKC 3NVQA 1RZIA 4PJXE 3ZE2F 4JFDD 3I50L 3DWTA 5DMGC 4OZGF 1I8KA 2KBGA 2VDRH 5C0FB 4QEGA 5D93B 1NUNB 5JLZA 4S1RL 4MA1B 1NL0L 1CD8A 4P2YA 1RK0A 3BQUA 4X6FA 4JO4H 4GXVH 3FRPA 2JJVA 2AK4E 4Q2ZB 5F7MC 4JY5H 1QZ1A 2CXGA 4ZUUB 4ELMA 1XF3A 1XF2B 4NO5A 3DBXB 4GXUM 3NTCL 4QHMA 5C6TL 3RNKB 4DUWA 3VXSA 4A2MA 1FSKB 4AEEA 1IC7L 1GVIA 1QSFD 2J8OA 1A5FH 2ZCKL 3QRFM 1MFAH 3I50H 1MCWM 3MA9L 1YEJH 3Q3GB 4DZBA 4E9LA 1MFAL 3H8NA 1IM9B 1F6AA 2IPKB 1EEYA 2X09A 5IVXE 1FQ9C 5HGBB 3G04A 5I1CH 3IDUA 4FFWC 4JKKA 2E6JA 4KDWA 1U6AH 4DCQB 1QSVA 1U8JA 1W72B 5T3ZE 4XNYL 3O6LH 2WUBL 4HZLB 4DK6A 1K85A 5BV7H 3PDGA 2B0SL 3MV9B 3BPOC 2Z31A 3DGGA 3OGOE 3OJDA 4Q7DA 4CN4A 5IJVB 4L3CA 2R2BB 2W07A 1TMCA 5JOFB 2V5MA 3VXOB 5DFWH 3GMNB 5I30H 2FB4H 3CDFA 4KKAD 4F80A 3ARBC 3AVEA 4H8WL 5DRXA 4L3AA 4HHAB 4KJPD 5IHBA 4LSUH 1W0YT 5F7LB 2R1WA 1VEMA 4UTAL 4OF5A 3ULUE 3VRLF 2YR3A 4HS3B 5TF0A 1KXQE 3CLEH 4MA8H 3L3GA 2Y7QA 3JXAA 3L5JA 1JPFB 25C8H 3GHEH 2AQ2A 1B4JH 1FPTL 4K9EH 1K4DB 5EU3A 2G2RB 5J56B 4X83A 2X44D 4HUMB 3GRWL 2AAVA 4JPKL 1OSPL 4X7CC 4Y16D 4YPGB 3CK0L 3DO3A 1C8PA 3WXVH 5AYUL 4KC3B 5KOVC 2O5XH 1CQYA 5ABDE 3E6FA 1IQWH 5M95B 2V17H 1BVKB 2OK0H 3C5SA 1DJSA 1HH6A 3HMXA 1GGBH 5DO2D 3DRQB 4KU1A 3QHFH 3REWA 1MLBA 1KCLA 1WAAA 2RBLA 3N85H 5D2NA 5ETUB 3V6ZA 2HFFA 4F3FB 4JZOA 3ARRA 4LGRB 2B1HH 1CXIA 3GMMA 4NRYA 2GTZB 5D1QD 4JG0H 4OF3A 3NA9H 1CFTB 4KH2A 3BMVA 1V7NL 1IAIL 5BS0A 1AE6L 4U31A 1IGIL 2Y23A 1VCAA 4OAWB 1HSBB 4EI5B 3QJHB 3FAWA 1FVDB 4WHDA 2PTVA 2PYEA 5FYKL 3CPLA 2JB6B 5I1HL 5A43C 2IMNA 1NGYB 4CN6A 1J0JA 1YYMH 4U7MA 3WMSA 3CAFA 5J1AB 5I1HH 1INEL 5FCSH 2YWYA 1HXMB 3VFMB 2X4RB 2P5ED 2UY7A 4Y16A 4YXLH 2IPKA 4WJ5A 3O3EB 5IQ7H 4DW2L 5KN5A 4P57B 3QUMB 5FM5M 4ENEC 1GZPA 5ESAB 1QG3A 4QWWC 1U8QA 5K9OA 1MJ7H 5EC2B 1MWAH 5I71B 1ZS8B 3OQ3B 1KJ2B 1PW3A 1BFTA 4D9RE 1PFCA 3JTCA 5C3TA 2C1OB 2DB8A 3GI9H 3V5DB 4ELMB 4HGWB 5C2BL 5IMOB 3VGGA 1FAIL 1A6ZB 1K8IA 1NBZB 2DI7A 2CPCA 3P0VL 4WGVB 1I3VA 5DRWA 1E27A 1EX0A 2OTUB 3L7EA 4TTGA 3DXAD 4XWOD 1ZLSL 4F7PB 4KMQA 5IB5B 5IIEB 5DEFA 3QUYC 4GG6B 4HF5L 4UQ3B 4ZTPL 1VEPA 4HIIA 5ALBH 1C08A 4L8SC 3GSNL 4Y1AB 4GKNB 3IDJA 1S9WB 4PP1D 3FRPG 4M6MH 4YHPB 3FO1A 1GGIL 3MRLA 4U3HA 4LSUL 1Q9LB 1U3HB 1CXKA 2P48B 4HUVB 2P5WD 1BQSA 4GW4A 3MRJA 2AV7B 2RJMA 3VXRE 3HLAB 4JFHE 1IEAB 5FO9A 2DIAA 2PXYB 4NDMB 4CUCA 2DKMA 4G6AC 4XTRD 1KBGH 3H9HB 1S5HA 1BVKA 3K8MA 3UTZA 1AGFB 4XCFL 4RFEA 5KJRH 1UGNA 2X9YA 3ZKXC 15C8L 1S9YA 1FRGL 2QSTA 4ZUSB 4DGIH 3JTSB 4XBPA 2YA2A 1DQMH 2FLBT 3BIAX 1UZ6E 1FRGH 2VNCA 5FYJD 5IVXB 3IFOA 5TDOB 3QR2A 4KTDH 2WMPA 5DUBA 4LARL 3DROB 2F53D 2NY1C 1MFEL 4NKQB 2ICEB 3SE3A 2DQFB 1YEHH 5EA0H 3HAEH 2AEWA 5C08B 4QGTA 3VFUB 1P53A 3EYOB 1HEZB 1HZHH 4R9HA 4NQXB 1JZ4A 3U7WL 5C8JB 2A0LC 5HJ3B 5GGRB 1BMGA 1ETZA 1ONQB 2G5BB 1S7TA 3ZKNC 5ANMA 3TCLA 2YHGA 5GS0D 3TJHA 1EEZA 2HKFH 1H3TA 3OV6A 3SJVE 5HHMA 5BRZE 4RCAA 1DQJB 2WAHA 1G7IA 5I74B 4HPOL 1ODAA 3IDIA 2J5LB 3BXNA 3H6JA 3EDJA 1O7VA 3O4LA 4JY6A 5CEYA 4WIQA 3QDAA 5FHBH 3S4SA 4L1HA 2GYSA 3F58L 1HKLH 5ADOL 3HNTL 4JRYE 2RR3A 3TYFB 5IKCA 5KSBF 2W9DL 4FMFA 3MNWB 5GGSA 3A6CL 1B2WH 1KPVA 1UXSA 5CP7A 5CSZB 5JW4R 2ID5A 2AJVH 2B39A 3ARGD 1AGBB 1EXUB 4LVOB 4QNPE 4LP5A 3NIGE 2D7TH 3L1OH 4YFEA 4OZGE 4HCRH 3TJHD 3O45A 2CK0L 1FLTX 1FFQA 3DI3B 5AAMA 5C6WH 1ACZA 3F6IA 1F4XH 1T0NA 3IDMA 5IEKA 3OKEB 3QRGL 5FDWA 1IT9H 1Q1JH 5I66B 4WW1A 3DMMB 4GG6A 1MWAB 2GY5A 2HVJA 1F45A 5FCUL 1XGPA 3IB4A 4XMLL 5FA4A 5DC9B 1OGAD 1ZA6B 4H1LB 1A7OL 3EO0B 4UDUA 5ESAA 2EYTA 1UB6B 2G75B 3QO1B 2YPVL 3O9WC 3ZDZF 4Y1AA 1RJLB 4G80A 5DD1H 1YEGH 4LCWB 1IBGH 3EFFA 1TZIB 5T1MB 4CBPA 1Q9LA 2QQKH 5B38B 1HIML 2R15A 3EOYG 3UBXA 3KYKH 5DVNA 2FEDC 3BZDA 4JDTL 2EEBA 4IRZL 3S3PA 5BS0E 2WUCL 4MAYB 1NFDE 1PAMA 3MUGA 4MJIA 4XPFH 5LBSL 5F6HI 2YUVA 4UV4H 1EA9C 1D6VH 4O02H 1UWGL 4P0DA 5FM4A 5EUOE 2BNQA 5IGXH 1B90A 3JZ7A 4L4TE 4U1SA 5HHOE 5CZVL 4PY7A 3QDHA 3TJEL 3DVNB 4K8RH 1OGTA 4J7RA 1XCTA 4KRPB 2SEBA 5IB2B 5AD0A 4NJ9H 3EFDL 5I17A 5C0ND 2DQFA 1RIVH 3WIHA 4UINL 1MCDA 1N59A 3ZE2E 2FJHA 3BD3A 3UJIH 3QEUA 1A6VL 4MJ6A 3V6BR 4WI9A 4M62H 3BEVB 4P48A 3VXQB 5EZJA 3HUJE 2P24B 4PUBH 4IMLA 4OFVA 4XAWH 3RWIB 2FJGB 4PJ8B 5D5ME 3T2QA 1YMMD 1U8OA 3HI6L 3TCLB 1NCWL 3TO4C 1SBSH 4AQ1B 1L7TL 1YJDC 4NNPH 3MRBB 5IESH 2DDQL 5EOCL 3KJ4C 4PJ8C 4L8SA 4PGJA 1JFQH 1HCFX 2JCCB 4HH9A 4O4YL 4X8JA 1RZKH 1E6OL 4UOJA 4HGKC 4Y2DA 3B9EA 4JEGB 2WY3A 3T8XB 4PV8B 2APXA 3TZVA 4UBDD 1U92B 1YMMB 4NQDD 4DN4H 1UJ3C 3D2UB 5ECJE 4AH2A 1CFSB 1OP9A 4RISH 4BSJA 4X6CF 2H9GB 5GGSB 4ISVA 5T33H 2C3VA 1YQVL 3TA3A 3SPVA 5JOPE 3UTTD 5J9PA 2AXFA 3MXWL 5B21A 3BP5B 4TSBL 1S9KC 3F62A 2HT4D 3VMNA 4LLQB 5FOJA 5MEPB 4UT7L 2X7LB 1HNGA 1MF2H 3TVMB 1S9XA 2GSGA 4UV7H 2FECI 3SGKC 4M5YL 5GRJL 5DK2A 1NCTA 4ORGB 3ZHKA 1EK3A 3MREA 2ADGA 3VD4A 5HHMB 1MWAA 1T0MB 3BPNB 1IJ9A 4OQTL 5CLTA 3ULSA 1IM3A 1T2XA 5KG9A 2BVOA 4X9FA 4XXDA 1YEJL 2CSPA 5T1LA 5HYIA 1K4CB 1M05A 3A0OA 1OSZA 4HT1H 4QTHA 4X4XB 4NRXA 1ZHKA 5E6ID 5DMKB 2WK2A 3CLFL 3K8KA 5TE7L 4JFEE 4QRRA 3N1MC 3I84A 4J6RL 5AZ2L 4DFIA 1NCNA 5CSZA 2IWGA 4P5TA 1JYXA 5FIEA 3UTTE 4YHKH 4WRLA 1EV2E 1W0VA 1EXUA 4J4PC 1T66C 5ITFA 3HC0B 3S9DB 3TLRA 1LDPH 4WFFE 2Z93B 3JV6A 3MRGA 4U6YA 5E8PA 3TNNA 3B3IB 4S1RH 1A1OB 4M4RA 4LDLB 4FQLH 4X7FC 4XNUL 1JUFA 5GRUH 2DTSA 2HRLA 3LEVH 3QXAA 1DEEA 3CFDB 1OP5H 3O4LD 5FV2A 3NCJH 1FYTE 1SJEA 3DMMA 4NYLA 2BC4A 3O2VL 1YECL 2HJKB 1E28B 3QEQA 1RFDL 5FYLD 2ADJB 4HIXL 5CBAA 4O2CA 3EOTL 1N59B 3TYGH 3UTSD 5C07D 3C09B 4UT6H 2BK8A 5F97E 1KPRB 1TFHA 4B53A 3EOBB 5AAWA 4F8QA 3GMRA 2BSRB 3WEXA 1H8SA 1ZGLB 1OCWL 2B1AH 1I4FA 5ACZB 5D96C 2AJUH 2DICA 5C9JB 2F19H 5LGKA 2E7MA 1URLA 4TOYH 3QCUH 2NW2B 3LKSA 4JM2A 1FZJB 1FV1B 3CCHA 3VH8A 2P7TB 3U2SA 1C5DB 5MERA 4M48L 1EJOL 5B39A 3DETD 1ZSDB 2VZUA 3IFLL 4LDOB 5D7IA 3UZVB 4P46C 4PTTB 5DYOB 4OCMC 4PGBB 2FL5A 5GS1A 4X80H 1OLZA 2OI9B 4H26A 4ZPVA 1I1FB 3LCYA 4OIIL 2VWEE 1JHTA 5E9DB 5ESQA 4YFLF 2AXFB 1PKQA 2VZTA 1MI5D 1QRNA 1XGYH 5E5RB 5T1KB 2XA8H 3SGKA 3S36X 4KMLB 5E4EC 2CDFB 1Y0LA 2OTWA 1XIWA 6CGTA 5GISH 2X7LA 3P4LA 4FG6D 2CLRA 4LEXL 2P44B 1UM4H 5ACMA 3DTXB 4LASH 3G9AB 5I2IA 1DFBL 4FTVA 2CH8A 3MLXL 1LNUA 4WCYL 3D2UD 5FB8B 4OM0L 4XPTH 4G59A 3KPSB 1KT2B 1NSNL 1XMWA 5ADOH 1N5AB 1U8MA 2EZ0D 5JHDA 2JCCA 1MAKA 4HH9B 4Z7VE 1G0DA 1W72L 1P4IL 3IJHA 1HCVA 2BNRA 4NSKB 1U92A 4JO2L 4L4TA 1QFPA 2EICA 1SEBB 1VGKB 3ROLB 1NUDA 4P5KB 1BVZA 4RIRA 1F02I 4LCUA 4Y8AA 4KKCD 5T1DH 3INUL 1YY9C 5E1AB 4HCRL 5KVEH 4PPTA 1J87A 4ODHL 1DCLA 3D3VE 3SDAB 3GMNA 1BIIA 1HQRA 1FL3B 1V3LA 3MLWH 4LFHG 4FABH 1FFOB 3OJ2C 3EO1A 3QDJB 4LLQA 5MEPA 4JRYD 3C60B 3BAEL 1UM6H 3TBYB 3RVUC 4GMSL 1RU9L 3U46A 1I7UA 4NO0D 5JPNA 3U79A 3KXFE 4KI1A 4HWBH 3SJVD 4HK3N 4LCCB 2CK0H 1WGOA 5D2LA 1IFHL 2H45A 4CN1A 4P2OC 4ZFOB 4NNXB 5ICZB 1JPFA 1MJJA 1AP2B 3L3KA 1DBKH 5HDOA 2D7PA 3B8SA 2Q87A 3TA3C 2OL3A 2QHLA 3MNVA 1JK8B 2FHCA 2GUOB 2ZKHL 4MB5A 4WWKA 1I4FB 1Z9MA 1E4XI 5CD5C 2HLFD 4PRPA 4Z0BH 2A0LD 3H42L 1MCSA 2WINB 2HJLB 5SWSD 3TNNB 4NN7C 3CFJA 3V5KA 2F8OA 3G6JF 5CUSL 3SBWA 5IOPB 1A1NB 1K5NA 1I9IL 4PBWD 4MMXC 2B8OT 1J18A 1HHKB 3H7LA 4KTDL 4ZTPH 1LP9B 1QRND 4JFZL 4XT1C 1R3KA 2CK2A 2YRPA 3VFSA 4M62L 2DJSA 3IXTA 4H26B 3HR5B 3VD7A 4QHUB 2DLIA 3GI8H 3GHBL 5I8EA 3RWHA 5BJTB 4YHNA 2LV4A 3VXRD 2Z9TA 2R2HA 1Y6MR 1I8LC 1AGEB 1QSEE 1J1OH 5CWSB 5HPOA 4ODXA 4X6EB 3VWJC 3PGDB 3QAZC 2AJZB 4QYOB 3QEGL 4L9LC 1KENL 4OLYL 4I2XE 2F5AL 4OGAD 5I2IB 5IMMA 1J05A 2IQ9H 5ALBL 5JQHC 2AK1H 4PJ7F 4UTBL 3VXSE 2FYYA 4TUKH 4ONFH 4Q6IB 4WFEE 5EOTB 1ORQB 1I9JL 2ZUQB 4HPOH 4QXGL 4NWUL 3V6OC 1A3RL 2HWZL 2HRPH 5E5MB 4LBEA 4XMPH 4UTBH 1EO5A 5C0BB 3W39A 1NMAH 5T3XD 3N1PC 3NCEB 1C7TA 2A1WH 3KPLA 3ARGC 1B2WL 2DN7A 2F58L 1DUZA 5CJOH 1IGJB 2GI7A 1E6JH 4XWOC 2NY4D 4M5ZH 4UQ2B 5EU5B 4NHUB 3HUJA 4O2EA 3M17A 4CJ0A 5IB3B 5C0FA 1MAML 4X6DE 3FMGL 4OLEA 1HYRC 1FGNH 3C60A 5GISL 4OBSA 3DUHA 5JHDE 1T7VA 4IM8A 3QDGE 1Y6KR 4Q2ZA 2D31A 3U46B 1TETH 3WLBB 5IG7B 1WVZA 3FONB 2VDQH 1N5AA 1XF3B 1EAJA 1KFAL 3FHQA 1J1PL 4QWWD 4P23A 1KGCD 3HN3A 1FNFA 1T80A 2ICWB 2MSPA 4TUJB 3IDJB 2Y9RT 2AJSH 4DUVA 4GAYB 2AK4A 2NY3B 3L3KB 3O41A 4L4TB 3P30H 2BFVL 2E6QA 3DHMA 5DJ8B 3U6RB 4MD5A 3HZVA 4H0IA 3B9KB 3CXHJ 4PD4J 2YPKB 5E24E 5EO1B 4NBYB 5F7WC 1M71B 4HIEB 5IW1B 1XAUA 3V5KB 3H2WA 3FQXA 3PL6D 4RMUA 4KTEL 1RIUH 1NEUA 2NY4C 1MFCH 2EH8H 4P2RA 4PJAF 1HK6A 3FFDA 2OI9C 1HXYB 1U2CA 1UWEH 5ICYA 5IJVA 4J3SA 5IHZA 5LKNA 1F4AA 3PXJA 4S10A 5ADPL 5CMAB 3NACH 2H26B 4KHTL 1U8KB 4C55A 5CFHA 5EZOH 3S98A 1X6LA 3WXWL 1A9BA 1BIHA 4U1LA 4KZDL 1JNNH 1WTLA 2ZPKH 3BN9C 3EZ8A 1AXSA 2AXJA 1ZKAA 4JFZH 3DNKA 5GSRA 43CAB 2R1WB 3HR6A 5B4MD 1DQQB 1OAXL 3LKOA 2WWMC 1CU4L 3GZKA 4Z7QE 1MEXH 3JUZA 3PHQB 1GXEA 3QUYD 1TJGL 1NAML 4Q6IA 5DQ9A 3DXAA 2P47B 2DQDH 3KYOA 2G2RA 3ARGA 3TO4A 4OFYD 4MJ4A 3DHJA 4ZD3L 1FVEA 5CBEA 4B50A 3VXPB 2JIXB 2DL9A 5DTFA 2Q8BH 3FZUD 3KXFA 3WXVL 3MNWA 3LQAL 2GHWB 1ZLWH 4CJ1A 1OAKL 4ZXBB 1I3GL 4YXKL 1MFNA 2ENSA 3HMWL 4OZFG 3MODH 3N9GL 2LVEA 1JNHB 4OBRA 4JPIB 2MFNA 1A0QH 4JDZA 4OFKA 2IBBA 1JWUA 2YN3A 1JWSB 3HAEG 2VR9A 3K81A 4XNXL 5EN2A 4EQ3A 5HGGS 3CXDH 5T5NF 2R9HC 1CE1H 2EDFA 4LAQL 1GZQB 3I6LD 3VGEA 3HPLA 4TSBH 3SEPA 1VFAA 5AYUH 1OTSC 1IEBA 1KG0A 5CGTA 1F13A 3GBMH 1AXTH 3RBSA 2CUMA 4D0DB 3VWKA 1OW0C 1DEDA 3MJ7B 4PJ9B 4BZYA 1UWXH 4GAYA 5FUZL 1RHFA 2APWA 4J3TA 1QSFE 3R0NA 4EJ1C 1BX2B 5C6TH 4U1KB 5CEXA 1UQSB 1GOHA 5IM7A 3ULVE 2WWKT 5TQ2L 2BVPB 2NX5D 1A5FL 2ZCKH 3GGWB 4G7YH 3SDCB 3MRRA 1PDKA 3O3EA 3EOAB 5CLWA 1FO0A 4UUJA 4LHJB 4OV5B 2DJ4A 2CKBH 4L9LB 1Y18B 4FQ1H 1QBMH 4R0LA 4LCIL 2EYRB 4LLDA 2PO6B 3JWNC 3QNZB 4ZUTA 3SDXE 1KIQB 1QPXA 1MY7A 1MCJA 1JHKH 4MQ7B 1JRHI 2VLKE 1CGUA 2Y5TA 1YN7A 3O9WB 2XG5A 1A14L 1B0RA 3L3DA 4BH7B 4U3CA 5AD0B 3MO1A 1WTGT 4PREB 2ENYA 4PJHB 1ZE3C 2Z0BA 4UAOB 4LCWD 4U1LB 2EIDA 2ARJB 4I9WD 4OTXH 1RHHB 1U8HB 1QR1A 4TNWF 5BV7L 1DQQA 5EO0A 1YMHA 4HUKB 1ZTXL 5JW5A 2LU7A 4Z0XB 4L1DA 4LRIC 4JB9L 1PYWB 5I75B 4HBCL 2YUWA 4HAGA 4RNRA 4LVNC 3QDGB 3RDTA 3RHWF 3REWB 4XRCA 1S78D 3R1GL 3RRQA 1G7MA 3NFSL 4Q58C 3TP4A 1EFQA 1AC6A 4LSPL 2R9HD 3QDMA 2O61A 4EUPA 1J5OH 4U1HA 4I3RL 4LLYA 2YZ1A 5DHVH 3TJEH 3V8CA 5J9PB 1JNHA 3G08A 1ZOXA 2VLJA 1PZUB 3B5GA 3RL1B 5DR5L 4O58L 3LDBC 2OJZH 4JDVA 2APFA 3VXTB 5IW6B 1LEIB 4XCEB 3BGFB 1S9XB 5F93C 5C08E 4M7ZB 2MOVA 4Y4KD 3AS3A 3MOQA 1BFVH 4AEHL 1YEIH 1JNLH 3X14A 1MRCH 5F1KC 4H1LH 3RUGB 5L8KB 3P4MB 3GMOA 2DD8L 1C16B 4OZHB 2AJYH 1GZPB 1WBXB 5IESL 1U41A 5D7JB 2BY3A 4D0CA 1S7SB 1J1XH 1FO0H 1AH1A 1UQSA 5IM7B 4ZXBC 2BVPA 2VLJD 1EHLL 1A7RL 2MKLC 4AZ8A 3EO9L 1MCFA 4YHZH 3N9GH 2XFXA 1PVHA 1LK3H 2ATKA 3EYUL 5D5MF 5GXBB 4GBXB 3FOMB 3P4OB 1HDMA 5HVGB 4KQ4L 1FDLL 2A74B 2W9DH 1YPZB 2P46B 3O3DA 4TNVF 2XZCH 3HPLB 1MF2L 4HKJA 5A2JH 4LEOA 4WNQB 4ZUUA 1PLGL 2CKBL 3THMH 1WEJL 1R3LA 2K7QA 3ULVF 1WITA 1UWXK 3MO1B 5FXCH 1H8OA 1G7QA 3MV9E 3MJ8B 3MROB 4Y88A 1RUPH 4YHPA 3ARTA 2NY5L 5DJYB 1U3HA 3MGAA 1QNZL 3EOBA 3CVHH 4Z7UE 1JYVA 1Y6NR 5KVDL 4NC1C 2YD2A 1KB5A 3VFNA 3WKNA 5DUPL 4FA8A 4QXTB 4UDTB 5DQJB 4KHXH 1FNAA 5EZIH 3CD4A 5TDNB 3BZ4A 5BZDA 2Z4QA 3H9HA 1CT8A 4L8BB 3Q5TA 2MHAA 3MCLH 1PJ9A 1JTTA 2I27N 1FV1A 2ESVD 3QDGA 4OCLC 1MI5A 4N0RA 1ULVA 1KJVB 3VXRB 3ULVH 4X5XB 3U2SB 2YPLB 4XPGH 5L2JA 5J11C 3D0VA 4LCCC 1ZLWK 1HHIA 2BY1A 5DUBB 4LPWA 1G9NC 4XNMA 5KSVB 1VADB 4ZPVB 1QFWL 3VXOA 1UJTA 3MBEC 1MHPH 5J13B 2V9QA 1MRFL 2FATH 4LIQL 4JFQA 1UT9A 2VAAA 5C0AA 4XHQA 5CJ5A 3RKDD 4MLIA 4HKZB 1VFOA 2UVEA 3RGVA 2AABH 3ILQD 2YXMA 4AMKH 5J0BA 1KCRL 4PY7B 4NO3B 3B2UC 3E8UL 4RQQB 1X5JA 4E0RA 4PJFE 4RA0C 2FZ3A 1JGVL 4XC1L 3PGFH 5L9DL 3CVHB 3DUSA 1LGVA 1F90L 4XBGA 2VITB 4X5LA 3P4MA 5HI3C 2NW3A 5ID1B 4GO6B 4FQXD 2XACC 4GXUN 1NGWB 4Q9QL 3OR7B 1CBVL 1DQML 1DLHA 3W2DL 1A0QL 3X11B 5C0JA 4K94L 3PWVA 1BJMA 2GQHA 2VLME 1F3DJ 1S7XB 2VDOH 3DX7B 3PWJA 4KKNA 3ZDYE 4QT5A 2UYLA 2V9RA 4N5EC 5HXMA 4V3EB 3AGVA 1N6QL 1FL3A 4URTB 3DETC 3AMKA 3PGFL 3IAGC 3O45B 3QPXH 3BH8A 1KELL 4IDJH 5GGTL 3QP3A 5JXAH 2ZCLL 3MRHB 1DBAL 3LOWA 3HCVB 2VDQL 3PP3H 3RVWD 4L8DA 4YFDB 2Z31D 3RUGA 3CMOH 1C1EL 9CGTA 4BZ1L 4XB8A 2EYTB 1DVFC 3CPLB 3GO1H 3AREA 2GT9A 2X1OA 2B1HL 1S7SA 3MV11 3GMQA 2NY2C 4LLUB 3T08A 2J88L 3ALPA 4PJDE 3WSQH 1BM3L 4M5ZL 5J12B 3O11B 3RWCB 3LN5A 4GMTL 4YO0B 1WJ3A 4D3CL 1J8HA 2EXWD 3F65A 4H0GA 4ALAL 2A83B 2EDLA 2I07A 4U0QB 3LS4H 4WW2A 4QHKJ 4R4FL 2W92A 3NPSC 3PIQB 3WJLC 1Q94A 2NPLX 4YR6A 4UZGA 2QKIA 3LKRA 1D5IH 2OZ4A 5J57B 3PQYA 3TZVC 1KJ2A 2BNQB 2R0WH 4I13B 5I1EL 3CUPA 1U8LA 4XP1H 4Z77A 2LU3A 4ELME 5HPMB 4H8WC 1MCIA 4LEOB 1HWHB 4JKWA 1MIEL 2NY6B 4XNMB 5JPMB 4PRIB 4QOKB 2X4UA 2X89D 2KKQA 2LFGA 4KK9D 1L7IL 4PGEA 5D7LE 1XGUB 3L7FB 5E2WL 1FNGA 1QQDB 2VDML 2Z93A 4U6YB 4YZFF 3PF2A 5EOQL 5DRWB 3B3IA 5IBUB 3UTTA 2X4PA 3VG0L 2P5WB 4YBQC 1RUQH 1AGDA 1CL7L 4HJJL 3VMPA 3BHBA 4F9LC 3QXAB 1XGQA 2K7PA 1BLNB 2B20A 3V4PL 3VWJB 4UDTA 4ZFFB 1CLCA 2B4CH 4BUGA 2NXZC 1D5IL 2PCPB 1A7QH 5JW3L 1R3JA 4AJ0A 2VJXA 4MJ5A 4GKNA 3MLRL 2XT1B 3MOBH 4K94C 5I8CA 2OYPA 4LSTL 2QHRH 4HX1B 3EYSL 4O5LL 2R23A 3STZA 1NGWA 5ICXB 2F53B 2B7DT 3D9AH 3BPLB 3N0PB 5M94B 2CXKA 1SYSB 1JPTL 4I77L 1ZHLA 2AXGB 4CVZB 1YECH 2H32H 3KS0H 2AKRA 1AXIB 3DURB 1LEKA 4UQ2A 5C0GB 4Z76A 5MI0B 1FNHA 1RIHH 1YYLH 4M3KB 4LARH 3FT3B 5FYLH 4HKZA 2NX5A 3IGAB 2XTJD 3DVFA 2X4NB 2Q6WA 3PHOA 5C09D 2GJ6B 5MP6H 3SE4C 4K71B 4H20L 2DYPA 2YD1A 3ARUA 1M7DA 1I1FA 1B88A 3CSGA 4NM4L 1C5BH 1GGYA 1QRNB 2AV1B 3GJFK 5JTWA 4LRNH 3BUYA 5GPRA 5IQ9A 1EGJA 4Q97A 4Z7VB 2CLRB 3T2NL 5GGRA 3JWOC 5LGHL 1P4LB 4F9PA 3MLXH 4K94H 5IB4B 1UZ8B 5SX4H 4DTGL 5EUOF 4PGCA 5BRZB 4GJTB 4OI7A 3IAQA 4P5TB 5JHDB 4E41D 4Y2DD 2UYLB 4OD1H 3HE6D 5CKAA 3PL6C 1OSPH 3BZEA 5JA9A 1WCBB 5F7DB 3GSOB 3RGVC 3WNOA 1EMTL 1HSAA 4LLVB 4OCYL 4LSDA 4TUKL 4JFOB 4PJ7E 2M8XA 3ET9F 1SEQL 3V4UH 1QLEL 4NYLB 1KULA 3BP4B 1QVOA 1CWVA 4D8PB 1VERA 5E5UB 4RISL 5I6XC 2NY3C 3DYPA 2D0GA 3O2WL 2H6PB 4LK4A 4N8CL 4GKZA 5FO7B 2HKHL 2E9IA 1G1YA 1KXTB 4GH7B 1RY7B 2E7LC 2P5WA 1IL1A 3TBSA 3FO2A 2KQNA 4HJ0D 1YNLL 1RZKL 2PNDA 2HVKA 1RULL 5FUOL 2RCSL 3WJLA 5F9OL 5T1DL 1GGUA 3ZE1E 4FQLL 5CILH 2IF7A 2VXSH 4OUOA 4J6RH 5AZ2H 1Z3GL 4PRAA 4ZFZB 2QEJA 4H1LA 3B9VA 4I2XA 2A83A 5D1ZD 3P4NB 1Q0XH 1RZGA 1D9KD 3C8KA 4U0RB 4JM2B 3QO1A 5CILL 4H25B 1F58L 1MJJB 1TJIL 4LVHC 2IBZX 1NEZA 3GJFA 3PWNB 4KV5E 3TO4B 2Y06H 4M8VA 2R23B 1C5DA 1WZ1L 4TNWK 5MERB 3UZQA 3QUXD 4IIQC 4NT6A 3P40A 5LAXB 3V6FB 1RZJC 2XQBH 1A6PA 4X7DC 4YGAB 1NFDB 5JPMA 4GBXD 2VYRE 4WO4D 2Z91A 3S97C 4ERSH 2FIRT 4X8XA 4ZXBA 3WFHA 4IIQB 4NO2A 5H94A 5I30L 4PJEA 4PGEB 4XNUH 3TCXA 2B1AL 5DSCA 5IGXL 1GCFA 2PUQT 5IBLC 1IC4H 5E8NB 2VN7A 4WHTB 5D7IF 3U9PL 2D3VA 2YC1B 4CGTA 4UTAH 1FH5L 2XWBA 1U8PB 3EIFA 3U9PH 5LBSH 2FX9L 1QR4A 3FAXA 3VGDA 3D69A 5D6CB 4OQ1A 4NNYA 3WKML 2H3NA 2XNAA 1P7QA 2VLKD 1RZ8B 4OCWH 2C1PA 5I1DA 2DI9A 3RNKA 2J5LC 2EDHA 1JNLL 2CRZA 4M43H 2FH6A 3RVTD 1G7HA 4RWYH 3UTPE 3ZYJA 1BX2A 1CGWA 3L3HB 4JPVL 2HT2D 1DQDH 2YZ8A 3L95A 1JTOA 3QUZC 1C5BL 1EEYB 3HNSL 5DEGA 4YWGH 3UC0H 4YDLB 1NFIB 1LD9A 2I26N 1QLFB 1XCQA 2YD9A 3HB3C 1JIBA 2ICWI 2DD8H 5C0CD 1WISA 1LVEA 4Z7VF 2FO1A 3ALWA 5DUML 4Y4FD 4P9HC 3HMXL 2MCPH 4TRPL 5C86A 3CFCH 3L5IA 1M7DB 1NEZG 1FFNB 1OARL 3NZ8B 3WFEH 2G60L 4D8PA 3O6FC 1FAKT 3L9RA 4J4PA 1DBJL 4QHMB 1NFDF 1PG7L 2PTTB 4M5YH 1Z0MA 2E7LA 4LHQB 3QIUD 5HHPB 1IGTA 3G6DL 4JANB 2F54E 4JO4L 3ZYIA 3HI6H 4N0FA 3D0LA 2IGFL 5C0EB 1JVKA 1TITA 2C3WA 1NMCC 3TIEA 4JE4B 2E9BA 4DN3L 3MLVH 1I8LA 3BDYL 4HWUA 3ARFD 4HPYH 3SE8L 1EDQA 4PJAB 4R97C 2J6EH 2YD5A 1N6UA 2J8UA 2EIBA 3CFJB 4DEPC 5DJ0A 1RZFH 4YE4L 1WBZB 1ZEAH 1CFVH 3FOLB 5SX5K 2NZ9D 1QLEH 5D7KE 2DQJL 2C4FU 4AK1A 1N2RA 4X6CA 5TDPA 4GRWB 3SN6N 2UZYB 2R2HB 4JN1L 4QF1A 2JCCF 1V7MH 5SWZE 1H5BA 3HG1A 5E8OB 3VXTA 5IW6A 5DMIL 4LKCA 2VLLA 3KGRA 1WWCA 3ZE0E 2DTMH 5C3LD 1OQXA 4QY8A 3GUTA 2I9LA 5I16B 3FN9A 1CR9H 1E28A 5D6CA 3WD5L 3FT4A 3HI5H 5GGVH 3BPCA 3WXWH