1YN6A

Crystal structure of a mouse mhc class i protein, h2-db, in complex with a peptide from the influenza a acid polymerase
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
273
structure length
273
Chain Sequence
PHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Lack of prominent peptide-major histocompatibility complex features limits repertoire diversity in virus-specific CD8+ T cell populations
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 71
structure length 273
sequence length 273
ec nomenclature
pdb deposition date 2005-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yn6A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1yn6A01
3V9FA 1RIUH 3DV4A 4PLOB 4DZBB 4YDIH 5IBUG 3RQ3A 4X7CC 2I9TB 3VI4E 3WHE1 4PJFA 5FUZH 2ZPKH 4LBEB 2DLEA 3U0TB 1MOEA 5FEBA 1J05A 1S78D 1SJVA 2VABB 5KS9F 5JO5B 4YAQB 5C07A 3D9AL 4OJFL 2RQ8A 1ZT4B 1AXIB 2IH1B 4JDZA 3EDEA 3STLA 5MERA 3HI6H 1JPST 1RJZB 3IFLH 4FFZL 4CUCA 1CF8H 2MOVA 3FMGL 4G8GB 1CK0L 4YHIA 2P42B 3MLSH 1V7MH 4DZBA 2I9TA 1NANH 1W72L 4R4FH 2MTPA 5GRJL 1BOYA 4LSTH 1N7ML 2RB8A 2Q86B 1GHFH 3U0TA 1KCLA 3RVWD 1I9JH 1JHLH 2VABA 2VSCA 4YAQA 5ITFB 5JO5A 2YBRB 1KIQB 4DKEL 1ZT4A 5SWZD 3SGEI 4DUXA 2K9UA 5J13B 1RJZA 4K2UL 4G8GA 3UTTB 4WY7L 3U6RB 2UZYB 3ZTNH 3OAUL 4KH2A 1DANT 3CH1A 1J1OL 1QZ1A 1OAKH 4LP5A 2DI7A 1MFCL 5GRUH 3BE1H 5FHBL 2F8OA 2Q86A 3VXUD 4XB7A 5DJ0B 5CJXC 1D5MB 1BVZA 5ITFA 4O51B 2YBRA 1XGPA 5TE6H 3C5JB 3GSVB 3VFVB 1IQWL 5CZXD 3IRPX 1U3ZA 1GGTA 4Y4KC 4WTXA 2APXA 4PJXE 2UWEB 1S9XB 5IMMB 3UTTA 3U6RA 3BOVA 1X5AA 4PRIB 2WBJD 3L7EB 3U1SH 1P5UA 1BFTA 4I0PD 5I1IH 4J8RB 5TF1L 4PJFE 3WUWB 1IRAY 5IMOB 4JGJA 5EZJB 1TQCB 4K3JH 4NM8L 4C57C 4RNRB 4ZOAA 3EYUH 5DJ0A 1GGBL 5I18L 5EZLB 1D5MA 4O51A 3QQNA 3EKCA 3D2UB 3VFVA 1NCWH 1EHAA 4NQDB 5BW7C 2UWEA 1S9XA 5IMMA 3PDDA 3PWUB 4H20L 1XGYL 3ME0A 4PRIA 3CK0L 3L7EA 4KK9C 3QHZL 3P0YH 4FG6D 3VW3L 4KI5E 1KTLB 2R0ZH 2XN9B 1QRNB 3LSOB 4PJ9D 4J8RA 1BD2D 1SJXA 3WUWA 1EO7A 4RNRA 3PIQB 3PGFL 2DDQL 1SVZA 3DWTA 1BBDH 5EZLA 4PJCE 2EKSB 1G7MB 1HILB 4GSDL 3D2UA 1Z9SA 4P5MB 3T4YB 5JQ6H 4NQDA 2V7HB 4Q9QH 3PWUA 1FIGH 4ONFH 1S8DB 2AS5M 5J0BA 5ADOL 1KTLA 3LSOA 1PAMA 1QRNA 2XN9A 5D96C 3FHQA 1ZANH 3BVNB 1EA9C 4RBPH 2BVPA 2EE6A 5D7JB 4ISVB 1D5XA 4KJYB 2ZJSL 3DGCR 2HRPL 4ONGL 1FLTX 3DJ9A 3HI5H 4OGZA 1QVOB 4XNZC 2EKSA 1I1AC 4N0UB 1G7MA 4P9HH 2CRIA 1HILA 2E27L 1YJDL 4BZ1L 4HWBL 1P6AB 1RIVH 1F4YL 2E9WA 5I19L 4P5MA 2DTMH 1F8TL 4R0LC 3MV7D 4X8XA 1V05A 3VD5A 2V7HA 3UTTE 4PGCB 4XC3H 1S8DA 4RSVA 4F9LC 1RZIB 4S10A 1WT5A 1NGQL 3UZQA 4QY8A 2P8MB 3BVNA 3KJ6H 4ZS6C 4JRWA 4M62L 1DR9A 4HCRL 4ISVA 5I6XC 1FFRA 4KJYA 1ZLWH 1KACB 3MRHB 3IXTA 4QLRA 4R90H 1BEYH 4N0UA 4UINH 2SEBB 5F1SA 4HJJH 3VGDA 1UXSB 4NT6B 4J6RH 3V0WL 4APQC 4L4VB 4K94H 1X4YA 4PGCA 3WS6C 3FQUB 4JDTL 3G08A 4WTWA 3F6LA 1RZIA 3ZKND 1JE6A 4TPRH 3WFEL 2P8MA 4KXZI 4R7DB 4N5EA 3E6FB 2E7LC 1VESA 1A02N 3LB6D 3QNZB 3HTLX 3JWOC 3MRHA 2FH8A 1FL6B 4KKLD 4UTAL 2EDWA 2FLBT 5DD3H 2SEBA 1AIFB 4GLRH 4DFIA 2NY3D 1UXSA 3S35H 4NT6A 3VGAB 3MRRB 3BZDA 4O9HL 5GRVL 4IOFD 2JIXD 1UM4L 2C3XA 4R6UA 4Y7MA 4F37K 3FQUA 2R2HB 2XN9E 4KTDL 3JUZA 5KSBB 4Z7VF 2F9BT 2VL5B 1UZ6F 3B9KB 5D9SB 2EYRB 4U6TA 4HDIB 4XPAH 4PP1D 5CHNB 4R7DA 1ORQB 5F9OH 3Q5YA 3QNZA 3KXFB 3RDTB 4OLWH 1HKFA 4AIXA 1FL6A 3MV9D 5C0FB 4UT9L 4K7PL 5HI5C 5DD1H 3W82A 3BXNB 3S96B 3SDAC 3CFDB 4JM2B 3MRRA 4M43H 3DO7B 5F7FA 4OF8A 4X9FA 1AHWB 2R2HA 5TJWK 4MNQB 2DJ4A 5KSBA 3ULVL 4JKPH 2VL5A 5IBLD 5HYEA 3R4DA 2QHLA 5K9QI 3TJEL 4U33A 3IXAB 2MMXA 5D9SA 2EYRA 1NQBA 4HDIA 2N7BA 4FNLH 5I9QB 5CHNA 1ORQA 5E5RB 4RMUA 1QACA 3JBG7 5H94B 1NAML 3KXFA 3RDTA 5C0FA 4N0UE 4K23H 4R7NB 3CXDH 4MXVF 4EUPG 3BXNA 3S96A 1N5AB 1Z3GH 4JY4B 4M7LT 3CFDA 1KGCD 4JM2A 4XCCH 4B50A 4N0CC 3DO7A 3P0VH 3V6BR 3V4UH 1CCZA 1KJVB 2X05A 1AHWA 3TFKC 1ZLSL 4MNQA 4UNUA 4XMPH 2YK1H 3IXAA 1A6UH 1U3HD 4LAQH 5FUOH 3AY4C 3IAQA 1KPUB 5H94A 4F33B 1I7RB 3PDOB 3QB7C 3SGJA 1S3KH 1NCNA 1K4CB 4GKZB 4R7NA 3AROA 3IETB 4ZAKD 1E27B 3MROB 3UAJC 1FNFA 1N5AA 4YQXH 4PV9B 4NC1E 5I1AB 4JY4A 3FRPG 4L4VE 4EJ1C 4K07A 3RWFB 2AJYH 4IMKA 1KJVA 3VFRB 5FGBC 4K7FB 1KIRB 3QI9C 2CDFB 3V0AC 1UYWH 3P9WB 3A6OA 3MGTB 3GIZL 3H42H 1KPUA 5IVXF 4YBQD 4YFLF 2ZUXA 4F33A 3VGHA 1I7RA 3PDOA 4MQXC 1K4CA 5E95B 1QTYT 3IETA 1E27A 5DVLA 3MROA 5FCUL 4P5TD 4YNYB 4PV9A 5I1AA 1UKQA 3LQAH 4F15C 5DD5L 4ZTPH 4ORZC 1K3ZA 3QQ9D 3V7AG 3RWFA 1FJ1B 3VFRA 4XNUH 1TFHA 1RUAH 1WBZB 3ZYOA 2CQVA 2Z31C 4K7FA 1KIRA 2AK4D 1N5YL 5C1MB 3I3DA 2CDFA 2XTJE 1QKZL 1OQXA 5JXAL 3KXFE 1ES0B 4Z95H 4GQ9H 4YHZH 3I50L 1MCKA 2Z91B 4GAGL 4YNYA 1AJ7L 2ENYA 2Y06L 5E7FA 3MNVB 2VDPH 5FIEA 2W0KA 3QH3A 5I30H 4XP1H 2D0FA 1FJ1A 1L6XA 3MA9H 1WBZA 4KVNH 5AYQA 1RIHL 3WFHA 4X99B 2HFGL 3GSNL 2VDQL 4YUEL 4JFDD 5JORB 3TBSB 1KC5L 4HG4J 1CS6A 2Y6SC 5IVOA 1SJEB 2Q8AL 3DSFL 1ES0A 2PXYC 5GS3A 2GT9B 1X5LA 3BP5B 1T20B 2P5EA 1D3CA 1AXTL 3RWGB 3AS1A 1EZVY 4OCLC 1YYML 1AP2B 3MNVA 4YXKL 2C9AA 4P46B 1JGUL 1OTTC 3HE6C 2DQHH 4XBEL 2AJ3B 1MWAH 4X99A 1WV7T 1YEKL 4QHNA 1ODAA 2NY7H 1GOHA 1DQQB 2YPKB 3UX9B 3T0AA 5JORA 3TBSA 4Q7DA 5DMIH 4NBZB 1SJEA 2K3TA 2GT9A 3CCHA 3R0MA 4G9DB 1RJLA 3BP5A 1T20A 3RWGA 1G1CA 3RA7L 3ZSSA 1FFQA 3ISWA 3BEWB 2QQLH 4XAWL 1RZ8B 4XBPB 1PEWA 1AP2A 2QADD 2NZ9D 3BGAA 5F96L 3MUY1 4LQFH 3JTCA 2JJSA 4P46A 3HG1B 5HHQA 3B43A 2H3NB 3T1FB 2AJ3A 1I4FB 4NCC2 4DQOH 1HH6B 2YPKA 1DQQA 1ZVSA 5FYKE 5DJ6B 3NA9L 3NCEB 2XZCL 35C8L 3N1PC 2F5BH 3PDGA 1JWUB 3PXHA 1OARH 3BWAB 1T89A 5CD3B 4G9DA 1W0WB 4L3ED 3SY0B 2D7NA 2AJZB 1A0QL 1VKXB 4GO6B 3BEWA 3LHPH 4HZLB 1RZ8A 4XBPA 4NJAH 4CMMB 2OP4H 4JJHA 1FVDB 3D69B 5IG7B 4DOHB 5KOMC 4WFGE 3HG1A 2FBJH 2H3NA 3T1FA 3WXWH 3D3VD 1I4FA 2B0SL 1HH6A 5CJ8A 2VWEE 4XVTL 3EDJA 3NFSH 4JVPA 3WD5H 5DJ6A 2DMCA 3MODH 1JWUA 5HHXH 4ORGA 3BWAA 5CD3A 3L5IA 3CUPB 4XNMB 3H9ZA 5T3ZH 2WWMC 3SY0A 3HC3L 2OXHA 4F3FB 1VACB 2AJZA 5KSAC 1VKXA 5E1HB 5F7EL 3T0WA 2DQJL 4HZLA 2APFA 5C3TA 4CMMA 4ZG1A 2WBKA 3DMMD 2GCYB 4JRXD 1FVDA 3D69A 3F58L 2BNRD 3QDJB 1K6QL 3CDGA 3PABB 3CFJA 4F9PC 4MA8L 2VR5A 1JRHH 4R4ND 1OAZH 1NANI 2Z0BA 3HNVL 4ZS7H 4GFTB 1MREL 4C4KO 1CXKA 4C56B 3CLFL 2AW2A 3ZT7A 3CUPA 4Y4KB 1F3JB 4N8PA 3QYCA 1VACA 2X41A 4H26B 2WQRA 5I15H 3W11C 4ODTH 3BPNC 2GCYA 5KVFL 4LRIC 3QDJA 1NFDE 4UT6H 3PABA 2XQBH 1C5DA 5A2JH 4EIZC 5CJXA 2VKWA 5KG9B 1KJ2L 5E08H 3OHXB 5FYJH 3V2AR 2BY0A 1PG7W 5ACMA 2FNBA 5GIRB 4Y4KA 2OMNA 1F3JA 1P84J 4QYOB 4ZSOE 1U8QA 2PO6D 1YZZA 3MLUL 3B2VL 4H26A 2AJSL 5FDYA 1AXSB 3QEGH 1I85A 3WN5C 1XEDA 1FIEA 4QTHB 4I2XB 3V79C 2ZCKL 1WAAF 3UTSB 2V5MA 2A9ML 5D7KD 5ALCH 5JPMB 4PJ7F 5BRZD 2P43B 5KG9A 4MJID 1T5XB 5HHOB 1NAKH 2P47B 4KV5F 2FATH 1H3TA 5DJAB 3TN0D 4CVXB 5GIRA 5BW7A 1N4XL 4LSUL 4BH8A 1JTOA 2UZIL 4QYOA 4WIQA 2C3VB 5IUSA 4Z7OE 3ARFD 5HDLA 1J9CT 5ITBL 1G0YR 1UB6B 1CGVA 2HTLD 1DFBL 5GRXG 5D96B 3QSKB 4QTHA 3OTTA 4RA3A 4AIZB 3UTSA 5CLTA 2NY4D 5JPMA 4LPWA 4XNZB 3RWCB 1I1AB 1FPTL 1T5XA 4IRSC 3BHBB 4XP4L 1ZHKB 5F7YC 3O2VL 3O6MH 2AJVH 5DJAA 3PHSA 1J1XL 4R0LB 5DEZA 3TA3C 4CVXA 4JO2L 4R97C 2F19L 3RX5A 5IQ7H 3OJ2C 5J9PB 3O6FD 1ZAGA 2C3VA 2CKBB 4JREC 4X6CB 2X09A 1UB6A 3MCLH 2AEPL 2VLKD 1QHPA 2BY3A 3PUCA 3QDJE 5F93C 1YECH 5DD0H 1TTFA 4AIZA 2R8SL 5I6XB 3CDFA 1EGJL 3DTXB 1FAIH 5ALBH 5CEXB 3QUMH 4QRTB 1MLCB 1CGWA 1I1AA 3RWCA 4GW1B 4LEXL 2VXQH 1ZHKA 4I18C 3F8UB 4C56E 3PQYE 4G5ZL 4R0LA 4YHMH 4APQB 2Q6WB 3X3GL 5CEYB 5J9PA 4ZO9A 4MAYA 4U4BA 2CKBA 2YN3A 4DEPC 1R3HB 1JF1B 4X6CA 2AK1H 1M71A 8CGTA 2YRPA 5D7LB 4F9LA 3F7PC 1AE6L 3ZDZE 4QHUB 2VLJB 2DQCL 4MA1B 5J6GB 4FQXD 3HC4L 4PRHB 5B22A 1NCTA 1QNZL 3MCKB 1EO5A 5CZKA 3SQBA 5CEXA 1EEYB 1YY9D 3D9AH 3LN4B 2H32H 2R1XB 1MLCA 4MJ5B 4QRTA 4OJFH 3WIHL 4GW1A 3T0EC 3O81A 4HV8B 2N1KA 5T1LB 4FFZH 5GISL 3FFCB 4LSDA 3FMGH 4APQA 1CK0H 1I3UA 4I9WE 1QRKA 3MYJB 1C16B 4NYLB 5CEYA 1IJ9A 4JE4B 4LQ1A 1KUMA 3WS6A 1JF1A 1W72H 3RIFK 5D7LA 4QHUA 4D3CL 3BQUD 4I2XE 4BK5A 2VLJA 1X5HA 5J6GA 3VGFA 4PRHA 4LSVH 1QSED 2R4RH 2OMBA 3MCKA 2AEIT 4Q6IC 5HD8C 2VIRB 1EEYA 5EU6E 3LN4A 4MJ5A 4DKEH 2R1XA 3AGVA 5HHOE 3G6JE 4PGJA 4HV8A 5T1LA 3SDAB 1PYWB 1INQB 3SHSA 4K2UH 5J1AB 3FFCA 5T1DL 4NYLA 3MYJA 4WY7H 4S0UC 3RVTD 2BSRB 2HVJA 1YA5A 3S5LG 4QXGL 2QBWA 4GLRI 2OI9A 5DMYA 5FHBH 4OQ1A 2ADFL 2K7QA 2ZUWA 2JF1A 3TPUB 4DKAA 1RUML 1YY8B 3MRGB 3S37L 1NLBL 1SYVA 4L3EE 2VIRA 4X4ME 3C5ZC 5D5MB 1IQWH 5T5FL 3D39D 1T7VA 1PYWA 5J1AA 4XCFL 4PJIE 4F7EA 5ADPL 4HUMB 5GGRB 5L88H 4Y4FD 4Y16C 4Z7NE 2BSRA 4X6CE 3VMPA 1VB9A 2WWKO 1JGVL 3BSZH 5E94B 5ENWB 5ISZD 1X9QA 3QDGB 2QJDA 2QSCL 4NM8H 2VXTH 1YY8A 4JFXB 1DBBL 1GGBH 5I18H 3MRGA 5GGRY 3DUSB 1TCMA 1KJ3L 4NO0B 8FABB 2BVUA 5D5MA 4F8QA 1UXWB 4FP8L 1RZKL 3JV6B 2I25N 4XNQA 4OI8A 2VLRB 5GGRA 3K8LA 1XGYH 3B9AA 5HGHB 4ZO7A 3CK0H 4UOW0 1ZGLM 3VW3H 3TFKA 5E94A 4ZOEA 5ENWA 3QI9B 3QDGA 3HE7D 3CSYB 1TENA 4I3SL 3CFKA 3PGFH 2AVGA 3N1GC 2DDQH 3I9GL 4JFXA 3H7BB 2VAJA 2E7LE 5IROC 3QDMB 3DUSA 4KY1L 3K7UA 1J8KA 4NO0A 1RUQL 8FABA 4GSDH 2MFNA 5LKNA 4Q9CA 1F2XK 5DXWA 1UXWA 1I8KA 4UNTA 1P7QB 3JV6A 4KUCF 4OD3L 4F15B 2VLRA 5HGHA 5DQJB 1QUNA 5E70A 1MI5B 5LGKA 3K1KC 4PJGF 1UB5B 3UBXI 5ADOH 2BHZA 3IVKB 1YEGL 1LDSA 5FGBA 4P3WA 2FSEB 3QI9A 4OFIA 4HXBL 3CSYA 3H7BA 2HRPH 1QR1B 4UDTB 1KXTB 2X42A 4CJ0A 4G43B 3V6ZA 2E27H 4BZ1H 4HWBH 5LWYL 4NHUB 4I1NB 2YC1B 5I19H 4KQ4L 1QLRB 4NFCA 4PLKD 1P7QA 4XCNB 2LU4A 4BM7A 2V6HA 2EDEA 3SE8L 5DQJA 5AG8A 1MI5A 1B4RA 1UB5A 3A6CL 1NGQH 2FHBA 3IVKA 5F7WC 5C07D 2FSEA 5BRZE 3ARQA 2R39A 2CPCA 1EBPA 5HYQB 4AL8L 3TPUE 1QR1A 4UDTA 1IBGL 1L7IL 2VJXA 2PXYB 4G43A 4NHUA 2YC1A 1OAXL 3WIFB 1QLRA 2YXMA 4TSAL 1DTUA 4EI5A 3DVFA 4G7YL 3V0WH 4XCNA 5I1HL 4FZEL 2YKLL 4MQTB 2E7HA 3TIEB 2EDHA 3GJFK 3HE6B 3C5SA 1JWSB 2P7TB 4OCNC 4GRMB 3WFEH 3GHBL 4LVNC 4TULL 4Q6YA 5J12C 5HYQA 3ZHKA 1RZJC 4P3CL 1PBYA 2PNDA 4MJ2A 3ZYJA 2MQ3A 3VI3F 4AMKL 3QNYB 2PXYA 5DDHB 1KELL 3CAFA 4BFIB 1CDJA 2ARJQ 2YS4A 1K8IB 3WIFA 5FHAL 4OZGE 4O9HH 4HEME 1LNUB 3MZTA 3N85L 4OCYL 1LMKA 1P53A 3TIEA 3MLRH 3HE6A 3ALWA 4OI9A 4KTDH 4QHLB 1MCDA 1JWSA 4YHPB 5H8DA 4GRMA 3FO9B 5E24E 2O61B 4DGVL 5FV2A 5LBSL 3QDME 3QNYA 2EZ0D 4UT9H 4K7PH 1LGVA 5DDHA 2ERJC 4BFIA 1LD9B 4ZO6A 4X5LA 1K8IA 3GJEB 2IAMC 3S3PA 4QOKA 1MCNA 4Y4HC 4JFEB 3ZT6A 1EEUA 1FDLH 1LNUA 3FB7B 4JPKL 2R69L 1EBAA 4KHTH 3BZ4B 4WU5B 1MJ7L 3ULVH 2FGWL 5DFWH 4QHLA 4YHPA 3TJEH 3NBNA 3FO9A 1FNHA 2FJFB 1HKLH 2J3SA 2O61A 2XZZA 2FR4B 5EBMA 2IMMA 1NAMH 1F13A 3AMKA 4POZC 1KIUA 4ZPTB 1LD9A 4N68A 3GJEA 3L5XL 2EXWD 5AZ2H 1LP9F 5KSAB 1EO8L 1IGFL 5J06A 1MCEA 3HAEG 5D1XC 5LCVH 5FO7B 3Q6GL 4MB3A 1UEYA 3FB7A 1NC4D 5HHNB 3BZ4A 3QEQB 4QRPA 1NDMB 4WU5A 1ZLSH 1QSEE 4LRNL 4PJHE 4GG6B 4GKNB 2YD5A 3ESUF 1OCWL 2FJFA 4OLYL 4S1SH 3O2WL 2FR4A 4OGXL 1K2DB 4JPIB 4M5YL 4NKDB 3TO4C 4NUJA 2UY6A 4ZPTA 3KYKH 1H5BC 1ZK9A 5KSAA 2P8LB 3KPQB 1QRND 3IDYC 2AQ2A 2D7TL 2R1WB 3GMRB 3BPNB 4M8QB 5FO7A 1PLGH 3CZJA 5DRWB 1IAIM 5DRXB 4N9GB 5HHNA 2Y36L 3QEQA 1NDMA 3E8UL 3NCMA 4JPWL 4GG6A 4GKNA 4F9PA 3VI4F 1UADC 5KAQG 3GIZH 1DBML 3CXHK 1K2DA 4NKDA 1MHPL 2D7MA 3O8XD 5FCUH 2X89D 2J7LA 3LV3B 2P8LA 3KPQA 5T5NG 4TNWF 5DD5H 3WN5B 5ISZE 2ZUTA 1OTUD 3GMRA 2R1WA 3ARVA 4KROC 1L8JA 1XIWA 4Z8FH 1LO4L 5DRWA 2EYSB 4LRIA 5C08B 5DRXA 1YEIL 2X70B 4N9GA 3E6HA 4I3RL 2F5AL 3ILQD 2NY6D 3GO1L 4N5UA 1QKZH 4LPUA 5M7QA 2PR4L 5JXAH 4NBXB 5GPRA 7CGTA 3I50H 2BCKB 1MFBL 4NKIL 3B4NA 4GAGH 1AJ7H 3ZE2E 2EDDA 2Y06H 4N8CL 5IHBA 3EDFA 4JFEE 5A40E 1S9WB 4QCIB 3MRJB 2EYSA 5E9DB 4HPOL 5C08A 2X70A 5CCKL 1RIHH 2AGJL 5C71A 2HFGH 3GSNH 2P49B 3HKFA 4YUEH 3T77B 2IPTH 2RFXB 1WIUA 4IRSB 2ZWLT 2Q8AH 1YUHB 5L9DH 3TA3B 5DRNB 5ESAB 4R97B 1AXTH 2BCKA 2FCBA 2VDML 3BFOA 4JREB 4LCYB 4HQQL 3RJDA 4YXKH 2FX8L 4WI8A 1G6RB 3KPPB 1S9WA 1A3LL 4QCIA 2WP3O 3D0VB 4PJXF 3MRJA 5JHDE 1OPGL 2Q20A 4KKBC 3QEQE 4XBEH 1VEOA 5SWSB 1I3RB 1YEKH 1ZEAL 1Z0NA 4C83B 4CAGA 3T77A 3VA2C 1FHGA 3PWPB 2RFXA 1KLUB 2P46B 3HPJB 4IRSA 3WLWD 2DD8L 3QUYC 2YRZA 4I18B 4H0IA 1IEAB 1YUHA 4JQIL 4NRZB 2W0LA 3TA3A 5DRNA 5ESAA 1ROWA 5DVNA 3RA7H 4L8SC 4LCYA 4XAWH 1DUZB 4DEPB 5F96H 1G6RA 3KPPA 4LLWB 3D0VA 1IZJA 1KCKA 5CILL 3RDTD 5T33L 1I3RA 5E99L 4M3JA 3MOQA 4XCYB 3TH2T 4AEHL 3KR3L 3KPRB 4G6JL 4C83A 4KI5F 5T3XD 3G6AB 2FO1A 3PWPA 35C8H 3NA9H 3E3QE 1KXVC 1KLUA 3KJ4B 1ZLVK 1P4IL 3T0EB 1UH4A 4I18A 1IEAA 4R8WL 3IF1B 1MIEL 2O93L 1A0QH 4I3GA 1U8IB 1LDPL 4NUGL 4PJCF 4LLMB 4JM4L 3KDMB 4D0DB 4YC2C 1DUZA 4MNQD 3QXVA 5F1IB 4CN4A 1J0HA 3I3BA 1JK8B 4LLWA 2A9NH 4PFEA 4S1DD 5HYSA 3MXVH 3OV6A 5CGTA 3MFFB 2HG5B 3PP4H 4XCYA 3KPRA 1A7RL 4Q6IB 1AGDB 2EIDA 5DZOA 4KPHL 4Z5RB 4ZPVB 3T0EA 3EYOB 3KGRA 2NXZC 3LH2L 4MAUH 3IF1A 3NH7H 5DR5L 4Y1AB 4LLMA 3RVVD 3KDMA 1PQZB 2DQJH 4JHAL 2FEDC 3WHXB 2H8PB 5HGBA 3F58H 5F1IA 2XG5A 3P30L 1JK8A 5E9DE 4CN6A 1K6QH 2C1OA 2VITB 3B8YA 4HXAL 4JAMB 1E6OH 3MFFA 2HG5A 2HFTA 1KB5B 4MA8H 3BKCL 3RTQD 4NZJA 5E7BA 3HNVH 1AGDA 4L8CB 3WS3B 1MREH 3C5ZB 1WC7B 4HC1A 4UBDC 5CJOH 3EYOA 4ZPVA 3CLFH 2W9LA 4KJWD 3MUGB 2R2EB 2WMPA 4ZD3L 1RZ7L 4YX2L 4KMLB 4Y1AA 3CVHB 1DSFL 4Y16B 4Z78B 1WIPA 1PQZA 1U9KA 3WHXA 3O9WC 5KVFH 4OV6F 5B4MC 4Y88A 5HYJB 3ULUD 4CW1B 5I1EL 5A2IH 1ZS8B 1MSPA 2VITA 1QFWL 5T5NF 4KWUA 2GKIA 2H26B 3NTCL 4JAMA 5SWSE 3MLYL 1KB5A 3DI3B 2GEEA 4K3EL 4L8CA 5DEGA 2DRUA 3EZJB 3C5ZA 1WC7A 2HMIC 5CBEA 5MEND 3OF6A 3MUGA 4F57H 3CVHA 3MLUH 2J8UB 3B2VH 2AJSH 4Z78A 4YJZL 4U3XA 2J88L 4MDIA 1KENL 5HYJA 2LTQC 2ILLA 1PSKL 2VE6B 2BP3A 1ZS8A 3K4DA 3I02B 2YMXL 4NHCL 2A9MH 2ICWI 2P5ED 4QXUL 2OL3H 3SBWC 1K9TA 4X7SH 1M7IB 1FC1A 1N4XH 4LSUH 4NZRH 2UZIH 1I8LC 1JBJA 2J8UA 2UVFA 2MSPA 5ITBH 2C1PB 3IDXL 1MY5A 4EQ3A 4OKDA 3VXNB 5ID0B 2VE6A 2F53B 3I02A 5E00B 4NQEB 5EG6C 3FT2A 3CSGA 3DETC 4DW2L 4YFLI 4X4YB 1FPTH 5KVGL 3L3GB 2FRGP 1XAUA 4K3GA 4XP4H 1G6VK 3QUXC 1FL5B 1M7IA 1J1XH 2DOCA 3ILPB 4KKCD 4JO2H 3JUYA 2NX5E 1WWWX 1PVHA 4RCAA 1OP5H 3UTOA 1MRDL 1C5BL 1INDL 2KL6A 5DURB 2LQRA 2NY5C 2C1PA 1IKNC 4G6AC 3VH8B 2AEPH 2FZ3A 5CGMA 3VXNA 5ID0A 4NKQB 3C08L 2F53A 5E00A 2HFEB 2R8SH 3DYPA 4NQEA 3PGDB 2YWYA 1EGJH 1EH9A 4LPCA 3EJYD 3F62A 2D03L 4X4YA 1YMMB 3L3GA 2OS7A 12E8L 5DJDB 3PNWB 4LEXH 2NNAB 4LGPB 4G5ZH 3ILPA 1OD7A 2YD6A 3HG1D 1BPVA 1HHIA 3UBXB 3HB3D 3OKLB 2WSKA 4WRLA 1QPPA 4PLJC 3VH8A 1W8OA 1RV6X 3MRDB 3UJTL 3TYFB 4R26L 4H88L 2DQCH 4LVNB 4Y8AA 5J12B 5GS0D 2QKIB 1CYGA 3HC4H 2HFEA 1QNZH 3PGDA 3RVUD 5JOFB 4BYHA 5DTFB 1YMMA 5HXMA 5DJDA 3PNWA 1JUFB 5GISH 1IC7L 1NEZB 1CE1L 2X1OA 5E8NB 3B9VA 5E6ZA 3TBVB 3UBXA 5DMGD 1F4WL 2UV3A 3OKLA 5GGVL 2NTSP 1CICD 2Z92B 5FFLA 3MRDA 3TYFA 4D3CH 1Z6JT 3ARYA 3ZE0E 1DEEB 2QKIA 1IM9B 3L9RB 1R0AL 2BSSA 2XKSA 3MJGX 5JOFA 5EIVA 3S6CA 2JTDA 4M5ZL 5DTFA 3FN9A 4TVPL 5IB2B 2ERJB 4NZTL 1U8KB 1JNHB 1I7ZB 1IGTB 1V7NL 2CR6A 3CX5K 4GRLD 4C55A 1JUFA 2IAMB 3VD9A 3PWJB 1PD6A 1NEZA 1JF5A 4U7SA 2GSGB 5E8NA 2EXYD 3ZYZA 5T1DH 1IGIL 2VO5A 3KNBB 4Y4HB 5DFVC 1IMHC 3H9SB 1BQHB 3L3OB 4ZNEA 4CADB 1I8IB 3TBVA 1CGUA 4WI9A 2CO7B 1PKOA 1NKOA 3INUL 2H2SC 5EU3B 1URLA 4LVOC 2Z92A 3GM8A 2HN7B 2Y25A 4X7DC 2ADFH 5T3XE 1DQLL 1DEEA 5EPMB 5C0EB 3O4LB 1IM9A 3LDBB 3L9RA 4QF1B 3UYPA 5DLML 5IMKB 3VMNA 3S37H 4BZ2L 1NLBH 3X12B 3I2CL 5IB2A 4FQPA 1WWCA 4E9LA 1U8KA 1JNHA 1I7ZA 2YN5A 1IGTA 3NFNB 2VXUL 4CRPA 3ARBD 2IAMA 3PWJA 4L3AA 2GSGA 5ADPH 3KNBA 4Y4HA 4PJDB 4H5SB 3H9SA 5D1XB 1BQHA 3L3OA 4CADA 4U05A 5BS0D 1RI8A 2BVQB 4P4KC 1JGVH 3GKZA 4LOUD 1RPQA 5JLZB 2O5YH 2HN7A 2QSCH 5EPMA 5C0EA 1PG7L 3EAKA 3O4LA 4QF1A 1DBBH 5IMKA 1BBJB 3X12A 4YO0B 3TO4B 1KJ3H 1J8HA 3PP3H 1YMME 1H5BB 3NFNA 2GI7A 1KV3A 1BREA 3IDIB 4LLVB 3UJIL 4URTB 4FQJL 3WE6B 3IDYB 3JWDH 1K3IA 4BH7B 4PJDA 4H5SA 5D1XA 1OAUH 3O41B 2X9YA 2R0WL 4OD1L 1B2WL 3K8KA 5CJQL 2BVQA 1N6QL 5CZVL 5KS9B 5JLZA 2A1WL 3UROR 2GW5A 4LHUB 4I3SH 3I9GH 3IU3B 4X6EB 4ONOA 4KHXL 2A0LC 1BBJA 5EZIL 4UQ2A 2YXFA 4KY1H 1RFDL 5IMLB 3TO4A 1RUQH 1KYOK 5GS2H 2DLGA 1MEXL 1KEML 1H5BA 5K9OB 3WE6A 4LLVA 5IM7B 3IYLW 1CU4L 4OD3H 4PS4L 4BH7A 2RR3A 3ULUE 3O41A 4S11A 2VZ3A 5EU4B 2NY0C 4P59H 5EH1A 3IAGC 3OAZK 5LJYH 1YEGH 4OAWB 5KS9A 3S3JA 4HXBH 4L9LC 2Z35B 4LHUA 1WK0A 5A43C 3IU3A 4X6EA 4X7TA 1QO3A 4OZFH 2NW2B 2Z8VC 1OSPH 3DX6B 3LEXB 5IMLA 1ZMYA 5LWYH 1E6JL 4MAYD 2IAND 2ATKA 4KQ4H 4YHYC 5K9OA 1WFNA 4HPYL 5D8JL 4XWOD 1FN4B 3KS0J 4MD4B 4P0DA 4XPFL 3BAEH 5ECJE 3H9SE 3QA3A 5C70A 3BIKB 3CFBB 4LP4A 3H9HA 1I9RL 4LKXB 5EU4A 1BVKB 4TYUA 4Y5YA 3A6CH 3QQ3B 3ALPA 4OAWA 1FO0B 4JRYB 4WCYH 1T22B 2Z35A 1IAMA 5HHMB 4AL8H 5EUKB 2NW2A 3DX6A 3K4AA 3NMEA 1IBGH 1L7IH 3LEXA 3MTRA 1MCWM 4FRWA 4GOSA 3P4MA 4D9LL 1I1FB 2F54B 2CKBL 4G7YH 3LEVL 4KK8D 5I1HH 1FN4A 2YKLH 5IHZB 4MQ7B 4L8BA 1X5XA 2VLJD 5IR1B 3CFBA 4LKXA 3UMTA 4FQ2L 4WFFD 4PRHD 1BVKA 2L7UA 2XZAL 3FKUS 3QQ3A 3T65B 1FO0A 3GHBH 4JRYA 3RZCD 1JF6A 1T22A 3IDNB 5HHMA 4PG2C 1UWEL 5T1LD 1WSST 4AMKH 2W65B 1NFDF 4HKZB 1KELH 4Z0BL 3FO1B 3OX8B 4HUUB 3IGAB 3VXMB 5T1MB 1X4XA 5IBTL 3UZEA 4EXPX 1I1FA 2F54A 1LEIB 2FJHB 4L8SB 2AQ1A 2X9XA 5FHAH 4HAGA 1HI6B 4UB0L 5IHZA 4MQ7A 1QBML 2J1KA 2NCMA 4BZYA 4MGXA 5IR1A 3N85H 4OCYH 1BFOB 4WO4B 5B38G 3VDBA 1MFNA 1OB1B 1MCOL 2CIKB 5DS8B 3T65A 3TLRA 4RIRB 5F6HI 1P4BL 3JWOL 2IQ9L 3IDNA 3SE4C 4OF0A 1EIBA 5C86A 4DGVH 4XTRD 1QLFA 5LBSH 2E5EA 1MVFA 2W65A 1M7XA 4HKZA 1JZ7A 3FO1A 3OX8A 2AJXH 3IB4A 4HUUA 3IGAA 2VERN 4OM0H 3VXMA 2FJHA 5C0ND 4L8SA 1GYAA 5A2FA 4V1DD 4YC2B 1HI6A 1A9EB 4F7MB 2O26U 4JPKH 2R69H 5DUML 1BFOA 5EWIL 4JFPB 1FYTB 4WO4A 5I66B 1D5IH 3WNMA 1MJ7H 3VWJC 2NYYC 5BMFL 2FGWH 1OB1A 2CIKA 5DS8A 1C8PA 4Z7OF 4NDMB 4RIRA 3TC9A 1HINL 2JJTC 3SDYL 2VQ1B 2DI8A 1KN2L 4CKVX 2NXZB 3HPLB 5HJ3A 2ZKHL 2RCSH 4PYGA 3IKCA 3T3PE 1EO8H 1IGFH 2Q87A 1A9EA 3QDGD 2ID5A 4F7MA 3Q6GH 1PDKA 1LE9B 1QSFB 4EIGB 3OKKB 5IBUB 5KW9L 5I66A 5GZND 1FYTA 4WI7A 2HRLA 4LRNH 5JIKA 4MDJB 1ONQA 2EDXA 4NN5C 4U1KB 5L2KE 2R0LH 5HHME 4OGXH 1RURL 3H3PL 4M5YH 1HNGA 4HMDA 1EEZA 2LFGA 5GGSB 2XG4A 3HPLA 4U1HB 1DANU 1MLBB 3TM6A 2YUZA 4KU1A 2F54E 1FQ9C 3BYTA 5DMJB 1NDGB 2D7TH 5CEZD 3RNQB 1GH7A 3O9WB 2G5BB 1QSFA 3GMNB 1LE9A 4PBVC 3EO1B 2Y36H 5CKGA 5GGSY 1B6DA 1G7IB 4U1KA 4Z7UE 4J2XA 4P2QB 4JPVL 1EEQA 3ZDZF 5MEPB 3HZYA 1DBMH 3O11B 5EBLB 2J8HA 1MHPH 5IJKC 4NKMB 5GGSA 3TZVD 3WXVL 4U1HA 4KK6D 3VXME 3QWQB 1MI5D 4Q2ZB 5BS0E 5TE7L 3ARPA 4K9EC 2VZUA 4YHKH 1AGCB 4QRRD 1NDGA 2JCCE 4Z7VB 5IF0B 3RNQA 4OLZL 1T1WB 2HJKB 1NC2B 3O9WA 4FXGA 4JO3L 2G5BA 3GMNA 4LIQL 1YEIH 2LTQB 3EO1A 4I3RH 4D9QD 2F5AH 2R4SL 3LPFA 3T0VA 2V9TA 3GO1H 1G7IA 3FZUC 2IFFL 5J3HD 1FNEB 1D6EB 2PR4H 2E7CA 4P2QA 2N56A 5MEPA 4KMQA 1LO2L 4EI5D 2R23B 3O11A 4PBXA 4RX4D 3K74B 5EBLA 4NKMA 3L7FB 1ZHNB 4NKIH 4Q2ZA 1VPOL 3SGDI 3T3ME 1AGCA 2R29L 3RL2B 1AR1C 4N8CH 3WNOA 3G6JF 3I84A 4Z7VA 3QHFL 1AH1A 5IF0A 3FL7A 1T1WA 2HJKA 1NC2A 1O7SA 3WIIL 4HPOH 5CCKH 1FYTE 2WAHA 1ZWIB 2AGJH 3M07A 2Y6SD 3U4AA 2PXYD 4HKJB 1BP3B 1D6EA 3ARED 1CDUA 3N06B 2R23A 3EZ8A 3SBWA 1GC1H 3REVB 5SWQB 1T2QL 4F8TA 4MCZB 3U0WH 2EDYA 3BKJL 3K81A 3L7FA 1ZHNA 3MC0A 4F7TB 4JG0L 1I8LA 5DJZB 4G8EB 3ZKXC 3BISA 1OLLA 2FX8H 1NKRA 1ZTXL 3QP3A 1QSFE 4K3HA 1OPGH 4LARH 4PJIF 5JOPD 5LVEA 4K71C 1ZWIA 2MNUA 4Z7NF 1ED3B 2JJWA 2N4IA 4NQCB 4X6CF 5C8JB 3EBAA 4HKJA 4LVHC 3UTQB 2ITCB 4U49A 4BFGA 1F4AA 2ZUUA 3X3FL 3SKNB 1N0XL 2IC2A 3EYQC 4QOKD 1PY9A 4JQIH 3REVA 5SWQA 1CD1B 2H9GA 4MCZA 4NO5B 3QUZD 2WIMA 4XI5C 4F7TA 5BZDB 2FD6L 5DJZA 4G8EA 1YEHL 3HMXA 3MA7B 4IBLT 3AVEA 1G9ML 3KPSB 1IKNA 5IESL 5I74C 2PYEB 1BQUA 1WLHA 5CILH 4D9RE 4LFHD 1NUFA 2YA1A 1H3WM 5T33H 5IVXB 5E99H 1ED3A 1EDQA 3SDCB 4G8IB 5C8JA 4G6JH 1XF3B 4NQCA 5J57B 5KVDH 3UTQA 2ITCA 2EE2A 1S7XB 5C0RH 4JVWA 1P4IH 3HMWL 4H1LG 2D9CA 3BPCB 4R8WH 4NO5A 1MIEH 3JV5A 5BZDA 4RGMC 1P2CB 5CJBA 1DUYB 4NUGH 4WI5A 1NFIB 2JJVA 4WFFE 3MA7A 4QRPD 1NBVH 4JM4H 1FAKT 1S9VB 1OTSC 1A6TB 2PYEA 3FOLB 4YDVB 1HK6A 3BUYB 1U6AH 3EYVB 5IVXA 4IRJD 1S7QA 3THMH 4X5XB 3SDCA 3DYOA 4G8IA 1XF3A 2NY1C 1A7RH 5ESQB 1S7XA 2YUXA 4KPHH 3JSSA 1CQYA 1S7VB 3MGOB 1U2HA 3LH2H 2MCPL 5DR5H 1KB9J 3MRPB 1P2CA 1DUYA 3AFLA 1NFIA 1H3PL 2BFVL 4JHAH 4CU8A 4CVZB 2MQCA 1S9VA 4QHKI 4LVOB 3BPLC 4XNYL 5DWUL 5FOBB 3TF7A 1A6TA 3FOLA 3Q6FB 4YDVA 1JIBA 3BUYA 3EYVA 4HXAH 2QSQA 5FYLE 4FTVB 4X5XA 3BKCH 1RUKL 3EUUA 5FUCC 3PWNA 3B2UD 1JP5A 1S7VA 2JLLA 3MGOA 4GBXC 4M6AA 1XIWD 1BIHA 3QIBC 4XPHL 4ZD3H 1RZ7H 4UV4H 2CDGB 1DSFH 3A6BL 4XZUB 3ALXA 4ZUVB 2JB5L 4CVZA 3OB0K 4P4KB 4EN3D 4L9DA 5FOBA 4MNGE 1V3KA 5I1EH 1QFWH 3NTCH 4DK6A 4FTVA 3UPCA 1GXEA 4ZNCD 1OGAE 4LNVA 2BNQD 3UDWC 3IFOB 4WW2C 4RRPG 2W92A 1ZXQA 5D71L 4WGWB 2AAVA 5MP6H 4LSPH 5E8OB 4PD4J 1Q9WA 5C08D 2DMKA 4DTGL 2X4TB 2CDGA 5J7CC 1I3GL 3IKKA 4ZUVA 1EK3A 3NIDE 2J88H 3KPSE 4P4KA 1KENH 3LS4L 4HUWB 3DVIA 1TNMA 1ZGLP 4OZGF 3EHBD 2WNGA 4KRNA 5H37H 2YD8A 2ADGB 1T0MB 4NHCH 5I1CL 4WV1B 4WWKD 4QXUH 4OFYA 1GPOL 1KXQE 1K85A 1GCFA 3B9DA 5CEZE 3LQAC 1ZA3B 3T2NL 5L6YL 5E8OA 4EUPB 1CF8L 2GY5A 1CLOL 3RFZC 2NY0B 3KPOA 3B9EA 1V7ML 3W39B 1FZKB 1MCPL 1MCRA 3GBML 4HUWA 4L9LB 2QQNH 4R4FL 1RD6A 2HYMA 2ADGA 2YD2A 4WV1A 3TA3D 2GJ6B 4DW2H 1I9JL 4J1UB 5KVGH 3SDDD 3ZKMD 4QRRE 3GMOB 4YHYB 1RK0B 1P6FA 4LMQE 3QJFB 1N2RA 1UA6L 4EUPA 3VFNA 1INDH 1TETH 2UUDK 2I26N 1YEJH 4P23C 3W39A 1OAKL 1UQSB 1FZKA 3G5XB 1P7KB 3SEPA 3PWPD 1JNJA 4L9LA 1MJUH 3C08H 4AEFA 4FTVE 5IFHL 1K8DB 3SKOB 5JXEA 2ZZUT 2GJ6A 2D03H 4PJHF 4J1UA 4GRWE 4P5KB 2OX5A 2IG2L 3GMOA 1RK0A 4XC1L 4P2OC 3NGBC 3RX8A 3QJFA 2YD9A 5JW4Q 1NGYB 1FCCA 3FRPA 3KLAB 3DUUB 3OJMB 4FQHB 2P4AB 2C26A 2VMFA 1MFAL 4OSUL 1NMAL 3UJTH 1UQSA 3G5XA 1P7KA 1CE6B 4R26H 4H88H 4BFBD 4M6NL 5FDWB 3JZ7A 1KLGB 1JYXA 2WQ8A 2VLMD 1K8DA 3SKOA 4PGEB 4JEGB 3QFJB 1F3RB 4OD2B 4P5KA 3TT3H 1KF9B 2NQCA 4RGNE 4WHTB 3U82B 1IC7H 1CE1H 1GZQB 1YYLL 5DJ8B 1BQLH 5FCSH 4R4BB 1NGYA 3UP1A 3RGVA 2LAAA 3KLAA 3DUUA 5DJYB 5GGVH 3E0GA 2ZNXA 3QG6B 4FQHA 5HYFA 4J4PD 3GKWL 5I73C 3PL6C 4PJ7B 3CXHJ 4HIJB 1CE6A 5BJTB 5E2VL 1A6ZA 1KLGA 1R0AH 4FMKA 4PG2A 4GXUM 4KKAD 5IW3A 1U3YA 1JNNH 3T08A 1T66C 4PGEA 4M5ZH 2V5TA 4TVPH 5C09D 3QFJA 4NZTH 4NGHL 2OK0L 4OD2A 1CWVA 1JYWA 3GSOB 3AM8C 4WHTA 1GZQA 1OAYL 3X14B 1IGIH 5DJ8A 4R4BA 2AV1B 5GRWA 4Q9QL 5BVJB 1WAAA 3QPQD 5DJYA 3INUH 3QG6A 4YBLC 4MVBC 3VWJB 1HWGB 3NIGE 1S9YB 3ZE2F 4POYA 4PJ7A 5GRYA 4HIJA 3BJ91 1DQLH 1TMCB 5BJTA 1ZANL 3ARGC 3SE4A 5DLMH 4BZ2H 4HC1L 2DKSA 1QSZA 4ZXBC 3KWWB 3MBXL 4QEGA 4OI7A 3EW3B 1QYGL 2VXUH 4TOYL 4TN9A 4EOWL 3GSOA 3C09C 3HS0B 2DB8A 3PV6B 2DTML 3X14A 4AQ1B 4YK4C 4WUKL 1WUNT 3LIZH 5BVJA 3JVGC 3ELAT 4LSQH 3VWJA 1UWXK 2P24B 3EOBB 1S9YA 4G9FB 5BZWB 5I76B 1AO7D 4DFHA 1TMCA 1PG7H 2JJTA 3TEUA 4PRPD 2VZOA 5C0AD 3TH4T 4H8WC 4DWHA 4I77H 3KWWA 4O2FB 1YEFL 1WGOA 1BEYL 2J6EA 4B0MM 3CVHL 3UJIH 4UINL 1ZVYA 3HS0A 5BO1H 3PV6A 4HJJL 4XHJC 2W0PA 1EXUB 4PY7B 5FYKU 1B3JA 4OD1H 1B2WH 5CJQH 1KIPB 4BUHA 2A1WH 2P24A 3EOBA 4KI5C 5BZWA 3SGEH 4IRZH 1JFMA 3H3KA 2AQ3A 5FM5O 3NCYP 4KHXH 1MELA 5EZIH 4NM4L 1U8HB 3F7VB 1RFDH 3HA0A 1KEMH 1ZGLB 5IW6B 1R3JB 2FB4H 3ZTJG 5FV1L 2NR6C 3F7YB 3LKNB 4PS4H 4M00A 3C2SA 4QTIH 1EXUA 4PY7A 4KJPC 4NQED 5IVNA 3B3IB 1KIPA 3QULB 3NIFE 4P2CG 4PJ7E 4E42B 3C2AL 2EIEA 1DBAH 4YE4L 3MREB 2NY2C 1U8HA 1EHNA 3F7VA 5F9OL 5IJKA 2J4WL 1E6JH 3VXQB 1R5WB 5MHSE 1ZGLA 1MUJB 1AQKH 5IW6A 1R3JA 3LKRB 4HPYH 4U6XB 1YEEL 5DD1L 2EH7L 3F7YA 3L5WB 3LKNA 4XPFH 3WYRA 4XVUC 1I9RH 5JR1H 4M43L 4Y19B 3B3IA 3QULA 1T4KB 1P5VA 4Q9BA 4E42A 5C0CA 4R2GD 3GEWB 5CAYB 1II4E 4QXWA 3MREA 4KVCH 3M8OH 4WUUD 4D9LH 3OZ9H 3VXQA 1R5WA 4NC2B 4C59B 1MUJA 3O6LL 5HTSA 3LKRA 5KANG 2CKBH 4U6XA 3CXDL 4MCYB 1WEJL 3ZKXB 1V3MA 4U1GC 3L5WA 2P1YA 1Q1JL 2EC9T 4XCCL 4XWGL 4FQ2H 1BJ1H 1E4JA 2OSLB 4GAFB 4KAQL 4GMTL 4K71B 1T4KA 4JHWL 4G9FE 4M4RA 4JZOA 2VB5A 1A4KB 1VEMA 3CMOL 5A3IC 4LVHB 3RY6C 4FABH 1UJ3B 4XMPL 1DQDL 1UWEH 2YK1L 5IB1B 4OIIL 4YDKH 3D48R 3ZE1E 2PTVA 4Z0BH 1SMOA 1G7JB 3MV8D 5IBTH 3P9MB 4RAUB 1G7QB 4LSSL 3HCVB 4MCYA 1G9NC 4UB0H 1Z5LB 1QBMH 3DX7B 4CVUA 4NKOB 4OLUL 5I74B 2OSLA 1RZJL 4W6WB 2HJFB 1A4KA 3JWOH 5JW4M 5GSVB 5IV2B 1UJ3A 2ZSVB 5IB1A 5EO1B 4ENEC 4MXQC 3WJJC 3ABZA 1G7JA 5I1DB 5C92A 2EKJA 2R56L 1MF2L 3VXRB 3P9MA 4L4TB 3O0RL 4RAUA 4PJGB 3L3DB 1G7QA 3HCVA 5TQ2L 1Z5LA 2BMKA 3DX7A 5JMRA 4NKOA 1HN1A 1EUUA 5DUMH 4HLZG 3QO1A 1XCTB 3ARXA 5BMFH 1A7QL 2IJ0C 3NPSC 1J8HD 1HINH 3VD7A 2HJFA 1IM3B 1MFDL 2NY1B 5GSVA 5IV2A 2ZSVA 5EO1A 5HSFA 1IAOA 3GSUB 5I1DA 5EA0L 2ZKHH 3VXRA 4GQ9L 4YIQB 4PJGA 3L3DA 4Y5XC 4W6YB 3MUHL 3QXAB 4NFBA 4KXZH 2XWJB 1YMHB 3BPLB 5KW9H 4JHZA 4Y19E 1XCTA 4P2RB 3ARUA 5CKAA 2EIBA 5EZOL 3RVWC 2G2RA 1UH2A 4KVNL 5HGGS 1IM3A 5CIPB 2DM7A 4MZ2A 1RURH 3RJQB 2Y1VA 3TJHD 4GBXB 3GSUA 1WFUA 1TTGA 1U95B 4TSCL 3QIBB 5DZNA 3S36X 1MCLA 3TNMB 2HT3D 4YIQA 5E1AB 3ARDD 1BQHG 4RFOH 4U2YA 4ODUB 4BQ9A 1VGKB 1YMHA 1KCSL 5H2BA 3SN6N 1MY7A 5SX5K 5I16B 3G04B 4P2RA 1TTUA 4A6YB 1AKJB 5DHXB 5CIPA 5KSUB 4JPVH 2NY7L 3DXAE 3WNKA 4EVNB 2V9RA 3MO1B 1Q94B 1CXIA 5CZXC 3KLHD 5DMIL 3WXVH 4GBXA 2A6JB 3H9YA 1U95A 3QIBA 4E41B 5TE7H 3TNMA 5E1AA 3EGSB 2WBJC 3S97C 5CSZB 4I0PC 4OLZH 4ODUA 1AO7E 1VGKA 2W07A 4JO3H 1H0DB 3MBED 5I16A 3G04A 5K33A 3MLWH 2HP4A 3L3HB 4A6YA 4NN7C 5C0AE 2IFFH 3J8F7 3ULSB 5I1LB 5KSUA 1TVBA 5FM4A 3UDWA 1LO2H 2QV2A 1CGTA 3MO1A 4N1HB 1Q94A 3ZE0F 4EVNA 3WUZA 2WLZA 2A6JA 1PX3A 4J3XA 4L4TE 4G6FB 3BP6B 2LU3A 1VPOH 4HHAA 3EGSA 3V0VB 2R29H 1DE4B 5EORL 4FG6C 1PJ9A 5CSZA 3QIWB 4PJ9C 3LHPL 3FQNA 3WIIH 1H0DA 5FKPB 2CUMA 2BERA 3L3HA 3OG6B 4LCWB 2D0GA 3WXWL 3CSBA 4JFYB 1YJDC 3CFCL 3ULSA 1YQ2A 5I1LA 2BDNL 3L6FA 1G9EA 2CKNA 2P48B 4PRAB 1LP9B 2XT1B 3ZHDA 2P8PA 3MODL 4X9BA 5HHXL 3BKJH 1NL0L 4DCQB 5E2UL 4B41A 2EDBA 2Y5TB 3BP6A 1F58L 5F7LB 3V0VA 1DE4A 1PG7X 2LV4A 3HI1B 3QIWA 4P23B 4KRLB 4ONHB 1ZTXH 1FO0L 1QOKA 3O3DB 5D1ZD 5FKPA 1Q8MA 1VEPA 3QT2A 1H3GA 4GJTB 1J12A 1DBJL 3B8SA 2VR4A 5D1QB 1EVUA 2VDLH 4JFYA 1VA9A 2Y07L 2DL9A 2DIAA 3X3FH 5FUCE 4Z7WF 3RWIB 1FZJB 1OY3B 5FYJD 1T1XB 4PRAA 1LP9A 1OAZL 4ZS7L 4P2OB 5E8EB 4DCQA 3NGBB 1FG2B 1P1ZB 2C7UB 1YEHH 2Y5TA 4WO4D 1JPGB 4M9PA 3GUTB 3AAZB 1IGYB 1ERNA 3HI1A 5IESH 4P23A 4I4WB 1S7SB 3O3DA 1A5FL 4RGOL 1ND0B 4XBGB 3VI3E 3OGCB 5D1QA 4WUUE 2BOCB 4UT6L 3QRGL 3BT2H 1HSAB 2V2TB 3RWIA 1FZJA 3WFCL 3DNKA 2MKWA 4P2YA 5E08L 3QBTB 1CXEA 1A2YB 1RY7B 2DJUA 4XP5L 1D9KC 5E8EA 2OCFD 1I3VA 4PJ5D 4E41E 1FG2A 1P1ZA 1JPGA 1KSRA 5DUBB 3GUTA 4JKLA 3TCLB 3AAZA 1IGYA 1KTKE 43CAB 3ZKNC 5I73B 3PL6B 4I4WA 4WEBL 1S7SA 3BMWA 4MJ4A 2ZG3A 3UC0L 1M05B 1P9MC 3S88L 1ND0A 1K5NB 4XBGA 3ULUF 1CD9B 3OGCA 3LB6C 3MRQB 4WU7A 5FA4B 2XY2A 4KKLC 4YHLL 1G84A 3MV8E 1HSAA 2V2TA 2YRLA 2AXFB 3HUJE 4LDOB 2Z8RA 1A6VH 1NGZB 1A2YA 3QXDB 5KJRL 2FEDD 2O5ZL 2MCPH 2FATL 4M4PA 3SCMD 2ARJB 3UEZA 5J11C 2APBA 3O45B 4IOFC 1H3PH 2XIDA 2BFVH 1MPAL 5DUBA 4KGLA 4LPYA 3TCLA 4LLQB 4YBLB 5DWUH 3WKMH 4WW1B 1M05A 1NGWB 3ARGB 4PP1C 1MIMH 1E4XI 1EFXB 1K5NA 2EDNA 2KBGA 4YZFE 4LCWE 3MRQA 1AQDB 2KKQA 5FA4A 4ZXBB 5HYIA 1T21B 2AXFA 1T6VN 3MSPA 4JFFB 3QXDA 3AM8A 3C09B 4DN4L 1GGYA 1H3VA 2ARJA 1XF5B 4DK3A 4YK4B 4I5BB 4PJXB 1ORSB 1B0WA 3HFML 2JB5H 1S9KC 4CMHC 3BX7C 5CGYD 4LLQA 4MVBA 3MCLL 2R2BA 4WW1A 4P2QD 4MMXC 1NGWA 4TNWK 1EFXA 3KLDA 3VFUB 4X98B 1S7RA 1AQDA 2FDBP 1T21A 1FAIL 3ARWA 4D8PB 2DLHA 4X6BB 1LILA 5D71H 4JFFA 1JNLH 2HFFB 3EYSL 4G6MH 2VXQL 1ETZA 1NC2D 1XF5A 3P11L 4DTGH 4I5BA 4PJXA 4TUKH 1I3GH 5J89A 1TPXC 2I07B 3H8NA 3JVGA 1KG0B 5AAMA 1U8NB 1J88A 3GRWH 3LS4H 3VFPB 2AK1L 1FSKB 3LN9A 4JFHD 5C7XL 1U3HC 5I1CH 1FLRH 3VFUA 4X98A 5EO0B 1NGPH 3ZDXE 1RHFA 5IGXL 1NSNL 2CGRL 2GAZB 4PJCB 1GPOH 1MRFH 4ZAKC 4D8PA 4X6BA 1UT9A 5INCB 1KPVB 1HXMB 4HMCA 2I24N 2HFFA 4MB4A 5DT1L 1ZSDB 3T2NH 5L6YH 2YPLD 2Z8WC 2BX5A 1CLOH 5ABDE 1NFKA 3FO0L 1R3LB 2I07A 1AFVL 3HAEB 1CDBA 1KG0A 4I0CC 1MCPH 3GBMH 3VFPA 2J2ZA 4TTDD 1IL1B 4LBEA 2X5PA 5EO0A 2G5RA 4YBQC 4LSVL 2R4RL 4XXCC 2GAZA 4HGWB 4PJCA 3NABL 2OJZL 4P5TC 5INCA 1KPVA 3CNKA 1HXMA 1Y6NR 2IH1A 1ZLVH 1ZSDA 1QG3A 1UA6H 4O4YL 3QQ9C 4C4KT 1SQ2N 1R3LA 3J7HA 3HAEA 5I2IB 3T3PF 5DF0A 3G5VB 3KPLB 4RAVB 3QDHA 2MCG1 4E5XB 4JFOB 1IL1A 3C8HA 5IFHH 2EDKA 4HBQA 2X1QA 1T83C 5T3ZE 3LKSB 2WUCL 4HGWA 2IG2H 1KIQA 1P7HL 4JFFE 3FQXB 3OG4B 4XC1H 4C54A 2B7DT 4N90E 4U1GB 5EOQL 1G6RH 1BF8A 2PYED 3W81A 4OF3A 1ULVA 4OF6A 5L88L 4WHYH 3BD3A 2W38A 2WBWB 1A21A 3SDCD 4OSUH 1MFAH 1NMAH 5C0DB 4X9GA 5I2IA 3G5VA 3KPLA 3RI5K 4HWEH 5F7MC 2DWEB 4CN1A 4M6NH 3QUMB 3BSZL 5GJSL 4E5XA 3U48A 2IH3B 4JFOA 3EO0B 5B3NA 2VXTL 3CU7A 2CD0A 3IDMB 2ESVB 3HNSH 3MNZB 1OAQL 3FT3B 1BGXL 3LKSA 4Z7UF 3FQXA 1HWHB 1YYLH 3C5JA 3GSVA 3QXUA 1M6OB 3QJHB 1BOGB 3MJ9A 3GKWH 3PGCB 5C0DA 2DWEA 1E28B 2JCCF 3ZSTA 5E2VH 1I1RA 2IH3A 3EO0A 2FIRT 5IMOA 5EZJA 3T04D 1QFUL 3IDMA 2ESVA 4FOMA 3MNZA 4RZCB 3AB0C 4NGHH 2OK0H 3FT3A 5D7SL 4FQCL 3TBTB 2FHCA 2OTPA 1OAYH 1F4XL 4TNVK 3RY5A 1M6OA 2QADC 2NZ9C 4HF5H 3QJHA 1BOGA 1T7WA 4DZ8B 3ZO0A 1HHHB 5BOZG 4MNHB 4PY8I 1A7NH 2MPAL 4ZDHB 4BQCA 3PGCA 5TF0A 3T3MF 3U9PL 3NPSB 4FS0A 3LD8C 3H6JA 1HE7A 1CZ8L 2P5WD 3WDHA 4HC1H 3PIQA 4J3UA 3GHEH 4OV5B 3MBXH 1A14H 1QLEL 4RZCA 4PJ5E 1QYGH 4MXQA 4TOYH 5D70H 4OUOA 3TBTA 4EOWH 2YD4A 4LEOB 4Y5XB 5F3HB 5HDQH 2IBGA 3LPGA 3T4YA 4NBYB 5F6IC 2NZIA 4WUKH 1T1ZB 5E5UB 2VZTA 4DZ8A 1HHHA 4MNHA 5K9JL 2H2PD 4ZDHA 1NGXB 2G60L 3WV0A 1U58B 4M8VA 2B8OT 3RU8L 1KB5H 5F9WC 4OFYD 1NBQA 3QZWB 4JKWA 4RMTA 1OL0A 4R3SB 4PUBL 5D7JA 4OV5A 3KG5A 4KRPD 1T7YA 2VOTA 1YEFH 1QVOA 2IALB 5AZEL 3CVHH 4LEOA 3L5HA 4Y5XA 3BN9D 3FO2B 3DMMC 5D2NC 4DUWA 3VXOB 2A0LD 4PJEE 2W0FB 3VXUB 1NGXA 3Q0HA 1U58A 3DI2B 2H1PL 1J10A 1LK2B 5F70A 3QZWA 4R4NC 4M1CD 4UAOC 4R3SA 4CL7A 3C6SB 4NM4H 2ESVE 3MXWL 3VFOB 2VDRL 5BQ7B 1LO0H 2IALA 3FJTA 4XPGL 4JY6B 2NY0D 2O5XL 2WBJB 3HLAB 1F6FB 1ZKAA 5EULV 4I0PB 3FO2A 4L4VA 1M1SA 2VRAA 2OQJB 2D9QB 4ODBD 3VXOA 2XY1A 2W0FA 1VHPA 3VXUA 5JXED 3MLRL 4KRMB 3ULVD 3C2AH 3QRFM 5E6YA 1A6WL 1GOFA 4YE4H 2YHGA 3OR6B 5EU7E 1LK2A 3P77B 3BPOC 2XTJB 3A67H 3C6SA 3E6FA 3W0WE 1JVKA 2KZ1B 4QHMB 2J4WH 1OP3K 2ZCHL 5J6HB 4PR5B 1YEEH 4JY6A 1AIFA 3UO1L 1JWMB 2EH7H 3PV7A 2WBJA 6FABH 3HLAA 4LL9A 1F02I 4U1JB 4I0PA 4KKNA 1WISA 1C7TA 1UJTA 3RPIB 2OQJA 5BV7B 2Z4QB 1C7SA 1FDLL 4X7FC 4F7CB 4KHTL 3OR6A 2WWKT 4J3OC 1EHXA 3P77A 3B9KA 5D93C 1HKLL 2K7PA 2ICWJ 3O6KH 3TN0C 4QHMA 5B3JE 1ZOXA 3QCVL 4IEFB 3RGVD 3BDYH 5F9DC 5LGHL 3O6LH 5J6HA 4PR5A 3VFGH 1WEJH 2XOTA 1JWMA 4FZ8L 4DKDC 3ARFC 5JDSB 4K8RD 1Q1JH 5AZ2L 5E6IC 4U1JA 2HTLC 1CTOA 4LFHG 3JWNC 4XWGH 3CD4A 5LCVL 3GBNH 4KAQH 3RPIA 2OJEB 2Z4QA 4GMTH 2CK0L 4F7CA 4JHWH 1EAJA 3QFJD 3CMOH 2NY4C 1CD0A 1DQDH 3UYOD 2DQGL 5IT2L 4OIIH 5DO2D 4F58H 4NP4L 5SWZE 2DQUL 4S1SL 4PDCE 3LRSB 4NWUL 5E4IA 4G42B 1WICA 1X5KA 3KYKL 4LSSH 2VDKL 3O6FC 1IVLA 3SGKC 5JDSA 4HLZH 4OM1H 4K8RL 5EOCL 4OLUH 5DVMA 4FQIL 2X2YA 3PG2A 1RZJH 1PLGL 1Q0XL 2OJEA 4HCRA 3IRZA 3VXUE 1TQBC 1L7TL 4MS8A 1MCWW 3NIDF 3CSPA 2X1PA 2B20A 5EUOE 3SJVD 2JB6B 4AIOA 1UFUA 1HZHH 1D9KB 3LRSA 2VQUA 2R56H 1MF2H 4G42A 4R96B 3O0RH 3QAZB 4GKZA 3EDKA 5HGDB 5TQ2H 4M93C 2IPUG 2NYYD 2FECI 1W0VB 2ED9A 4TRPL 2OR8A 5CJ5A 4M03A 4Z8FL 4FQXC 1A7QH 1MFDH 2V7NB 4ZMAT 4JY5H 1DQMH 1Z9LA 1YY9C 3TCXA 4CDGC 2JB6A 3MGTA 2YUWA 3UTPD 1D9KA 4LCIL 3RVXD 3X11B 5EA0H 4R96A 5J11B 2JIXB 4LPTA 5HGDA 3OJDB 3NCCB 4LLAA 1PW3A 1BHGA 2BY2A 1W0VA 1BD2E 2AV7B 3BQUC 1J11A 4XHQA 1P9MA 3L1OL 1X6NA 5L0QC 5EZOH 1DP0A 3U7WL 2V7NA 3OAZH 5DJCB 4HG4K 5IQ9B 2X4SB 2J6EL 2IPTL 4ZUSB 1KNOB 4PJ8D 3LCYA 3LRHA 2X1XR 1I1YB 3X11A 4TSCH 1D6VL 5L9DL 1EHLH 1CFBA 4Z6AT 4NRYB 4ELMB 3SOBH 2XZQL 4DN3H 2JIXA 2CRZA 3RVTC 4GRWF 3OJDA 4P48A 2Z91A 1UG9A 4CMHB 1KCSH 2YUVA 4DUVA 2XQYG 2AV7A 2P5WE 1OM3L 4JFQB 3VJ6B 1JI2A 1NFDB 3VXSD 2DQEL 1JZ3A 5GRVK 4OFDA 3EJJX 2ZUQC 5DJCA 5IQ9A 1RK1B 2X4SA 1RZKC 5ELIA 2BHYA 4ZUSA 4ALAL 1KNOA 2EEDA 3WO3B 1DQJB 3MV7E 1I1YA 5JW4R 4Y4FC 4NRYA 1TPXB 4ZSOB 4CGTA 1NLDL 2HKHL 3MACL 5EC1B 5C0CD 4OKVB 4OFKA 3V6OC 3LN5B 5ANMB 4JFQA 1U3HB 1NFDA 2BJML 3AXLB 4X9IA 2Q7NA 1LQVA 1RK1A 2P44B 4ZAKB 4K9EL 4ZFGL 1AR1D 1NCCL 1DQJA 1CL7I 3V52L 3LZFL 4HT1L 3AMLA 3E1F1 5A2KH 2JJUA 1DVFD 4ZSOA 5EORH 5E03A 5EC1A 4LLYB 4OKVA 3C87A 2K1MA 3GMQB 3HE7C 3LN5A 5TQ0L 5ANMA 3QCTL 1VCAA 2A9NL 1U3HA 4KTYA 2XNAB 4XAKD 3GZKA 3MXVL 2DLIA 3AXLA 1GSMA 3CFCH 1PZ5B 2BDNH 4YEEA 3PP4L 3NIGF 5HY9B 4M48L 4ZAKA 4P5TB 2I60L 3FONB 2BVOB 4PIRF 4LCCC 1NL0H 1GVIA 2ICCA 1H3UA 5E2UH 1W0WA 1UM6L 4MAUL 1F58H 3NH7L 5LGJB 2HA1A 4LLYA 1FO0H 2PYFB 1JJUA 3GMQA 4DJMA 2AK4B 2OBGA 2CSPA 1DBJH 5IG7A 4YGAB 2GSIB 1PKQE 5HVFB 1KPRB 1MRCL 1NUDA 4ODWB 2Y07H 5HI3D 1E6OL 1PZ5A 2ZCLL 3MV9E 5HY9A 4XXCA 4P5TA 4PLKC 1FG9C 3FONA 1ITCA 4X4ZA 1CIDA 5CJOL 4PPTA 4DVBB 1JYVA 3GI8L 4MB5A 3PQYB 3VGBA 4XNMA 4ELME 4DGIL 4F3FA 1XH3B 5LGJA 5F1NB 4ZOCA 3K1DA 1JGLL 5GXBB 5JZ7D 2PYFA 2IGFL 1A5FH 2AK4A 5TE4L 1XGQB 4RGOH 1U42A 3BD4A 5HHVL 2V5SA 5IK3B 2GK0B 1KPRA 3QRGH 4ODWA 25C8L 3OR7B 4Q74A 3WFCH 1F5WA 3S35X 1U8JB 3GI9L 3E3QC 1T3FB 4XP5H 3FN3A 3STBA 1KGCE 1P84K 1BFVL 3SKJL 4C56A 4DVBA 3PQYA 3BP4B 3QXWA 1BAFL 4F57L 1XH3A 3FHAA 5F1NA 2XI9A 4GQPH 2QTEA 3WSQL 4WEBH 1JZ6A 1H9VA 2NY1D 3UC0H 5ANME 1XGQA 3S88H 4IOSD 3MR9B 4KK5D 5IK3A 2GK0A 4YHLH 4PBWD 3WBDA 3NIFF 3OR7A 3AB0B 4LHJB 1U8JA 2EH8H 5EU6B 3OHXA 4YH6A 5C2UB 1XR9B 5KJRH 2OL3L 4LKCB 2O5ZH 3G6JB 4X7SL 3ET9F 4JKMA 2HT2D 1XF2B 2QADB 4NZRL 3BP4A 5CMAB 1MPAH 1RHHB 4MLIA 4LGSB 1AXSA 2Y4SA 3TVMD 4QRSB 1HQRB 4HKBB 4I2XA 3MR9A 2WP3T 3WJLC 2QQKL 1Y18B 5IJVB 2EZ0C 3QIBD 3WNLA 1EJ6A 5KOVC 4L3EB 5I8KL 5EU6A 5M95B 1XR9A 5HHOA 1F2QA 4LKCA 3G6JA 4DN4H 2CR3A 5F6IB 2MQ0A 4PJIB 5CMAA 3S9DB 3HFMH 4NOBA 1RHHA 4JZJC 4H0HB 5C6TL 4U6HB 3G5ZB 3OKOB 1I9IL 4W6XB 2AK4E 5B38B 4QRSA 4AH2B 3NACH 1HQRA 1LEGB 5F9WB 1KCUL 3VWKD 4HKBA 3V5KB 1NCUA 3UTPE 1Y18A 1REIA 5IJVA 1RUPH 3WO4C 1XZ0B 4PLNC 5GS1C 4L3EA 4X4MA 4BKLB 1ACYH 3WFZA 3BHBA 3EYSH 3WL9B 2B4CL 4OQTA 4PGBB 3P11H 3ZE1F 4HIXH 4PJIA 3DMMB 4JRXB 5KZCD 2R9HD 1TDQA 2DM3A 3Q5OA 2BNRB 1WBYB 5D2NB 2Q8BL 5D7IB 4A6YL 3G5ZA 3OKOA 2QL1A 4LDLB 1KJ2B 5B38A 3S7GA 4AH2A 1YPZB 1LEGA 3K2MC 4JFDE 5C7XH 3V5KA 4UAOB 5IGXH 5L8LB 1NSNH 2CGRH 2LAGB 4L3CB 1IAIL 3DTXA 3AC0A 4G6FD 1XZ0A 4YDJB 3SQOL 5JUEL 4BKLA 1HHKB 4MD0B 2YSSB 5DT1H 1RJYB 4PJAE 3QIWD 3R06B 3WL9A 5J1TC 4PGBA 1KOAA 4XRCB 4NNPL 1WIOA 2Q6WA 3FO0H 1AFVH 2BNRA 1WBYA 1NCDL 3KPMB 5D2NA 5D7IA 1R3HA 1RZGB 3LKOB 4LAJH 3ESVF 1EMTL 1MCHA 2VZSA 1KJ2A 4PREB 5EIIB 1N0LA 3BPOB 2E7LA 4L3CA 1U8LB 2D0HA 1B4JH 1FFPB 4UTBL 3O8XC 3P0GB 3NABH 4YDJA 2OJZH 2PF6A 2AJUL 5C0BD 1R3KB 4MD0A 2X4RB 5INDB 1RJYA 3R06A 1WT5C 4O4YH 4XRCA 1SJHB 1C16A 1A64A 4OIBA 3PF2A 5HGAB 5D1QD 4YFDB 5FYLH 3KPMA 3ILQC 2NY6C 1RZGA 3LKOA 3LRGA 4PREA 5BRZB 2BZDA 4QGTA 4HJ0D 3HN3A 3FT4B 5D93B 1DLFL 5CP7B 5I17B 3TN0B 1U8LA 2FJGB 2WUCH 1FFPA 4IJ3C 3HMXH 1R3KA 1A6PA 5CD5D 2X4RA 5INDA 1UC6A 2XWTB 1EFQA 1JPSL 2NY5H 3ARFB 5EOQH 3SDAA 5ICXB 1INQA 1SY6A 5E6IB 1R6VA 4LLDB 1N6VA 1SJHA 4OGAD 5DMKB 4JCMA 5KANI 3IDGB 5I1JL 4P9MH 3D3VE 5GJSH 1I1CA 4D0CB 2O5YL 1NPUA 5BRZA 2BRQA 2LVEA 3RUGB 3PJSB 3F6IA 1MVUB 3TPUA 1W0YT 3FT4A 2QSVA 1OAQH 1NCBH 5CP7A 5I17A 1BGXH 3TN0A 5GS2D 4FA8A 2BC4B 2X1WL 3VMOA 5DUPL 5MEOB 3O6FB 2NXYD 4MYWB 5ICXA 5E6IA 4OZGB 4LLDA 2VLKB 4JRXE 3JWDL 5DMKA 4N0CA 1B0RB 1OAUL 2BNRE 3CPLB 3IDGA 3GSXB 3CC5B 4WJ5B 5D2NE 2FX7L 2NLJB 2PCPB 5D7IE 1T66D 1TQBB 2VH5H 1QFPA 5DQDH 4PJBE 1YPZE 4D0CA 3BW9B 3RUGA 3PJSA 5DD6B 5JDJA 1QFUH 1MVUA 3WLWC 3AY4A 3GJFB 3CMGA 4CBPA 5D7SH 3T0XA 4FQCH 2BC4A 1CFSB 5MEOA 3O6FA 3W2DL 4MVBD 1F4XH 1EERB 4M93B 4NQXB 4ESKA 1BZ7B 4HS6B 4OZGA 1F45A 2VLKA 5GSRB 2MPAH 2X4UB 4YPJA 4JKKA 1B0RA 3CPLA 4WJ5A 3CC5A 2NLJA 2W60B 3RDTC 4FQXB 3U9PH 4P59L 2WZPD 2Z31B 1CZ8H 2FEEI 3L3KB 2XKNB 1KCVL 1QLEH 3GJFA 1OSPL 4LLUB 4MX7B 4ODHL 1VENA 4P4RB 3QDMA 1FNSL 1CFSA 3FQTB 4NQXA 1MCJA 1BZ7A 4HS6A 1R24B 3O2DA 2XTLA 5GSRA 3BAEL 4U6VL 5K9JH 1QFHA 2X4UA 3BQUB 1RU9L 4M7JH 1RJCA 2G60H 3O3UN 2W60A 4FQXA 3RU8H 1VFUA 5L0QB 5D7KE 1QSEB 3SGJC 4PJHB 2Z31A 4WCYL 1HHJB 4A2MA 4PUBH 4MJIE 2XKNA 4LLUA 4MX7A 3U83A 4P4RA 5AZEH 4J12A 4H1LB 5M94B 5FECB 4IMKC 3FQTA 3RVVC 3RWDB 3KYOB 2VQTA 4HW6A 1R24A 1IEHA 2AI0L 1C5CL 4HJGB 3LEYL 4N8VB 3BQUA 4AG4L 3TBYB 4QHKJ 2X9WA 2H1PH 4J7RA 1QSEA 1T03L 4PJHA 4I8DA 1WFOA 4H8WL 5JA8B 3RTQC 1JGDB 3RUGE 5GZOD 1HHJA 2ZUQB 4WI2A 2YA0A 3MXWH 2F15A 4HFWB 2VDRH 4KJWC 3R1GL 4G8GD 4H1LA 4UIKL 4XPGH 1X4ZA 4Y4FB 2O5XH 5SX4I 3RWDA 4WW2F 4JO4L 1X5FA 1I7UB 2H45A 2VLKE 5ISZB 3NCBB 3ULUC 1GGCH 4HJGA 2F8VA 4HS3B 3TBYA 3O3EB 1T6WA 1F3DH 4DKFL 5ID1B 1A6WH 3ROLB 1FVCB 2P7TA 1J87A 2HLFD 1OVZA 4HFWA 1DN0B 2ZCHH 1QPXA 4EUPH 3UTTD 3N1QC 2AJXL 4Y4FA 3UO1H 4OM0L 3HUJF 5D72L 4X6DE 1A7OH 1CDGA 2PTUA 5D2LE 2BVTA 1I7UA 1NMBH 1YQVL 4UT7L 5ISZA 4ZFFB 1UACL 3HE7B 5JA9A 1A47A 2D2OA 2XPGB 4HS3A 4UIMB 3O3EA 3X13B 4ODSL 4ERSL 4M1DL 1D5IL 3ROLA 1NUNB 4KJQD 4JGMA 1FVCA 4Y8DC 1VGEL 2C3WA 1Q9OB 1NH6A 3NPZB 2LU7A 3SE9L 5ACLA 2GTWB 1DN0A 1T1YB 3QCVH 4HX1B 4U1SB 4YZFF 4LCCB 3NZ8B 3OXSB 3DVNB 1JGEB 4HFUL 5LGHH 3TV3L 4PRID 3D25B 4FZ8H 2HH0L 2RCSL 2G75B 2FIKB 2I5YL 3SKUD 4O2EB 5A3ID 1BWMA 3N1MC 4ZFFA 4JFEA 5JW5B 1KLFA 1A4JB 3I6LD 3HE7A 1JZ8A 5JHDB 2CK0H 4UIMA 1AY1L 3X13A 5DGRA 4RMWA 3MOAH 4EXKA 4Z0XB 3B5TA 4UMGA 3V6FB 1Q9OA 2DQGH 4IDLA 5IT2H 3F7QA 2R0LL 4NP4H 4OCWL 3D2UD 2DQUH 4NZDA 4K3DL 2GTWA 2FWOB 4NQDD 4KKCC 4NWUH 3RY4A 4OB5L 4S1QL 1T1YA 4U1SA 3PXJA 4HX1A 4LCCA 4RRPA 3NZ8A 3OXSA 3DVNA 1JGEA 3QWRA 3MJ9L 2VDKH 3D25A 4YXLL 1A1MB 2G75A 2FIKA 2XN9D 4K8RH 5EOCH 3BJLA 1PX4A 4O2EA 4FQIH 3T2PA 5JW5A 1A4JA 1Q0XH 5DEFB 3WEXB 5JHDA 2CH8A 3IU4L 1L7TH 4W4OC 1L0XA 2R0KH 4Z0XA 3EJYC 1UWXH 3V6FA 4PGDB 5E0QA 3KAAA 5K59E 3D39E 2FWOA 4JPIA 1G9NL 4Q9RL 3ZDXF 2WIIB 3HB3C 1A1MA 1CDHA 2EDQA 4M7LL 4YHKL 1MAML 4TRPH 3V6OE 1LHZA 4M8QA 3D5OF 5DEFA 4JB9L 5D7JD 3WEXA 4I48B 5GS0C 3RVUC 1MQKL 3GMLB 3H2WA 3GRWA 1UEMA 4PGDA 3CH1B 3MLPA 3E3QA 3M17B 1X5YA 4LCIH 4TUJB 3RKDD 2WIIA 3TT1L 3T8XB 5DMGC 3MCG1 4J3TA 3MJ6A 3LV3A 1CICC 4PRBB 4X9HA 4XVJL 3WN5A 4JJ5B 2AP2A 4MZ3A 4XCEB 1XGPB 3RHWF 3L1OH 4I48A 4N5ED 2OR9L 3U7WH 2WINB 3GMLA 3MYZA 4OTXH 2J6EH 2Q3AA 4MD5B 4GW5B 1PZUB 4GRLC 5TPWL 5GHWH 3M17A 5HI4D 3DX8B 3P4NB 1D6VH 2EXYC 3LVEA 1GC1L 4TUJA 3FCTB 4L4VD 2XZQH 2ZG1A 3I85A 3U0WL 3T8XA 5FXCH 5IHUL 2D7PA 4GXVL 1BM3H 3Q1SL 4JZJB 1KBGL 4PRBA 4GMSL 4J23A 4JJ5A 4BQBA 1OM3H 5F7NC 4GAJH 4XCEA 3FB5B 5E9DA 2R1YB 4LARL 3UCRA 2DQEH 4P49A 3O4OC 1FL3B 3EFDH 2WINA 3WJLA 1HYSD 3WO4B 2UZXB 5GS1B 4MD5A 4GW5A 3ARBC 4ALAH 4BQ6A 1I85C 4JFZL 4ODXB 3DX8A 3P3YA 3P4NA 1HOCB 3EYFB 3FCTA 1LEKB 2OZ4A 1NLDH 4O5LL 3UPRB 2HKHH 3MACH 1NC4B 2RBLA 4JZJA 5AG9A 4LOUC 3L5JA 3BGFC 5C07E 3B9KD 1TZGL 3V4PH 1LK3L 2XTJD 3FB5A 2R1YA 4OFVA 2BJMH 3QZWG 2DICA 1FL3A 3KXFD 1PGRB 5SWSA 5KVDL 3QR2A 4Q0XL 1NEUA 5GS1A 4LCUB 1G7LB 5C0RL 1Z2KA 4K9EH 4ZFGH 3HPJA 1NCCH 4ODXA 3V52H 4JM2D 1HOCA 3GMMB 3LZFH 4HWUA 4NRZA 4HT1H 3EYFA 2FO4B 4I13B 1LEKA 4ETQB 3OKNB 2IPKB 5CP3A 3RI5F 2BVPB 3UPRA 1D5XB 3UZVB 4UZGA 1NBVL 1NC4A 2HTKD 5KBNC 1F6AB 1LO5B 1DL7L 1UCBL 3VFSB 5TQ0H 3QCTH 1X6LA 2DM2A 1U6AL 3THML 3BUTA 4G8GE 2QLVB 2AEQL 3G6AA 4M48H 3O8XB 1FORH 1Q38A 3DBXB 4LCUA 1G7LA 5HBBA 1RVFL 2I60H 1WZMA 3Q3GB 2A74B 3GMMA 2FO4A 2HKFL 3EIFA 4QY8B 3S8WA 1UM6H 2NX5B 4ETQA 3OKNA 2IPKA 2APTA 1U8IA 5BV7L 1B90A 4JG1H 3QO0B 4MS8D 5ERWB 5KVEL 4D0DA 1F6AA 1LO5A 3C8DA 3IXTB 3VFSA 2NY6B 5CLWA 4FFVC 3S3SA 3C9NB 4O58L 1MRCH 2ZCLH 3BKMH 5JIHA 4WEUD 5TGBB 2A2QT 2I27N 4IJ3B 4MAYC 4Q6IA 4TNVF 3O8XA 3DBXA 4XWOC 3G08B 2X89A 4N0YL 4Z5RA 3G6DL 3Q3GA 3LPWA 2A74A 3GI8H 2XYCA 2NX5A 1B88A 4DGIH 1G1YA 3TP4A 5KAQF 4UV4L 4ZODA 1JGLH 1JCKA 3QO0A 5ERWA 2IGFH 2YD1A 2V17L 3PE9A 2EE3A 2H8PA 5TE4H 5LG1A 2IBZX 3PHQB 5FYKD 5HHVH 3C9NA 3VDAA 3WNPA 3HR6A 1D9KD 2EDRA 1CXFA 25C8H 4PJEF 2UWEE 5J56B 3SGDH 5TGBA 1IGCL 3GI9H 4D94A 4PRIE 5F7DB 1CVRA 4KK8C 1KFAH 2EC9U 3WS3A 1BFVH 3SKJH 4OZHB 2HLAB 3BI9X 5KSVB 3EOYG 5MP6L 1BAFH 2R2EA 4LSPL 4HUVB 4MA1C 3I6LE 3IJSB 4WFGD 4U2ZA 4Y16A 3U2SB 3OAYK 3WSQH 3LQZB 1S7TB 3RZCC 3W9EB 4GKOA 3C6LC 1BVLB 3PHQA 4BUGA 1JZ4A 4CW1A 5F7HA 5DVKA 5SX5H 4K7PX 1QBBA 5FYKL 3EO9L 2H26A 4NQDE 2DBLL 4FFYL 1VADB 5IEHB 5F7DA 2CMRL 1D5ZB 1TJGL 2OI9C 1JI1A 4IOIB 1QRNE 4OZHA 5E2TL 2HLAA 5KSVA 3GSQB 4HUVA 3IJSA 5IVZB 4BELD 1EV2E 3S4SG 3U2SA 3LQZA 3P4OB 1S7TA 4YHOL 3V8OA 3W9EA 3RZWA 1SBSH 1BVLA 2OTWB 2QQNL 3MRNB 2Q1EA 4XTRC 2QQKH 4AENB 1UZ8B 1AGEB 1VADA 5IROA 2NTFB 3N9GL 5I8KH 3LY6A 5IEHA 2FHFA 1D5ZA 1SHMA 3P2TA 5C0NC 1XT5A 4IOIA 1HDMB 1QBLL 4YWGL 3GSQA 4P46D 5B3JF 5IVZA 3ZKQD 5DSCB 1TETL 5C6TH 3ARTA 1I9IH 3M1BB 1YEJL 3P4OA 2QEJA 5F21B 5CIPH 2FGZA 4EZMA 1V3JA 4Z7WB 1KCUH 1VFAB 3IAPA 2HWZL 1MJUL 1VSCA 2OTWA 3MRNA 4AENA 4PG9B 1UZ8A 1AGEA 1YC8A 3BRFA 3P73B 4LU5L 2NTFA 4J3SA 4Y89A 3SDXB 1J0KA 4LSRH 2EECA 2B4CH 5KTEL 5FGSA 1FL5A 4I0KA 1HDMA 1L6ZA 4Z77B 4J3WA 3K8MA 4LMQI 5DSCA 5GZNC 2Q8BH 4A6YH 1DBKH 5TDNB 3M1BA 4Z7WA 1VFAA 1A1NB 5F1KC 4ZTOL 1HQ4B 3RTQB 4RISL 4WNQB 1QA9B 2ICES 3DROB 4PG9A 1IAIH 4TVPD 2GUOB 3P73A 5GGTH 3SQOH 4PGZA 3VRIB 5JUEH 3AS0A 2ZOLB 3TT3L 3SDXA 5EUOF 4UQ3B 3MLZL 2NNAA 4OZHE 4L1HA 4Z77A 3L95B 4NNPH 1NBZB 1ITBB 1BQLL 1E4XL 2EDJA 1NCDH 1CD8A 5TDNA 3OKDB 1EMTH 3IJHB 4Y5VC 3G9AB 2GITB 4NN6C 1A1NA 5F7UA 1HQ4A 3RTQA 3SO3C 4WNQA 1FGNL 1HYRC 1QA9A 3TZVC 1JNNL 3DROA 3KVQA 5DHVB 5EFIB 5MENB 2GUOA 4UTBH 3QH3B 4BFEA 4KK6C 4EDWL 3VRIA 2AJUH 2ZOLA 5L2JB 5E2JA 2DAVA 4UQ3A 4ZO8A 3WFHB 2B2XL 5KSBE 3FN0L 4FN0A 5CUSL 4JVUA 3U9UB 3L95A 1KTRL 1NBZA 5L7XH 2YEZB 5K9KB 1WTGT 4GKSB 3VRLE 4L5FL 2AABH 3QDJD 4XX1E 4A2LA 4N1EA 3OKDA 2M26A 3IJHA 2DIJA 5J3HC 1IE5A 3RPKA 1CDYA 2GITA 2P5EB 1YN7B 2F58L 5FA3B 4EI5C 1MNUH 1DLFH 4XGZB 4C56D 3PQYD 5DHVA 5MENA 4Y4KD 5EFIA 3ZL4H 3ARZA 2B39A <