1YN6A

Crystal structure of a mouse mhc class i protein, h2-db, in complex with a peptide from the influenza a acid polymerase
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
273
structure length
273
Chain Sequence
b'PHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Lack of prominent peptide-major histocompatibility complex features limits repertoire diversity in virus-specific CD8+ T cell populations
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 71
structure length 273
sequence length 273
ec nomenclature
pdb deposition date 2005-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yn6A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1yn6A01
1AQKH 3V0WH 4MDIA 3SPVA 3TFKA 4KU1A 5E5MA 3HTLX 3CU1A 3X13B 5HI5C 1HQ4B 3BKCH 4K7PH 4MXVE 1N7ML 2IWGA 4X4XB 1HYRC 1GOGA 3U82B 3ULVC 4HS6B 3V6OA 4NC0B 1UH3A 5A40E 4FFYL 4AMKH 3EGSA 3V7MA 2XN9D 3S35X 3S5LB 1QLEH 5ERWB 4N8VG 4PJAF 2CH8A 3GHEH 4EDWL 3VXME 3HI6H 4LGSB 3U7WL 4OZIF 3OL2A 4KVCL 5EZJA 4UTAH 1CI5A 3CZFA 1S9XA 1T1ZA 3T2NH 1RIUL 3KPNA 2JCCF 1P7QA 3MLXL 1K4DA 2EZ0D 2CRMA 5CHNB 1UWXK 1DDHA 2AJVH 4I48A 4OCSL 4XPGH 3I84A 5JIPA 4BQBA 4HK0A 4YZFE 5T3ZD 1FPTL 4TNVF 4UQ3A 4C56B 3WJJA 4CGTA 2ZUTA 4ZSOE 1Z0NA 2DQJL 4FQCH 1UVQA 4AL8H 3B2UD 4Q6IA 3MLTA 1EV2E 4DTGL 5EOCL 2VLJE 4Z95L 3WIIH 2UV3A 4NKMA 3ZKXC 5GIRA 5DT1L 1E4KC 3RL1A 2WNGA 1Y6MR 4MJIE 1UA6L 5TH2A 1JPSH 1N0XH 5IT2H 5AD0B 2YMXH 2D7NA 3T0EC 1YEKH 2X70B 2BRQA 4C83A 5IMOB 4TN9A 2N4IA 2BRRL 4X6CF 2CXKA 4LSRL 2OTUB 2X7LB 1ZAGA 3SGEH 5I1HH 3F7RA 4HX1A 2HN7A 4NQEA 3TJEL 2O5XL 4MWFA 1JGEA 3ZE1F 5C0EA 4FABL 5C0FA 5F3HA 1MNUL 2E7LE 2DQCH 4Z7UA 1D5MB 1HYSD 3ZKSD 3LH2H 1JF1A 3AREB 2VN4A 1DEDA 4LPTA 3L9RA 4FXKB 3GSOB 5HYJE 2J12B 1KJMB 4OLUL 2XICA 2OK0L 3IFOB 3MZTA 2A83A 4RFOL 1Y6KR 3HG1D 4X7SH 1VERA 2D4DA 4QGYA 5C8JA 5MEOA 3B6SB 5CGTA 5E8OB 2JJTC 4Q74A 3VFNA 5E8DL 4MCYB 1CFTA 5JDSB 3VXSB 1U93A 4LPCA 2FSEA 1HWGB 1EGJL 4HWUA 3F58H 3MGTB 4HH9B 4K7PY 4L4JA 2VN7A 2APTA 5E9DD 3CMOL 4XP4H 3D18A 4X4MA 1JWSB 1F3DJ 2HH0L 3GSQB 3UTTD 3GMOB 3PP3H 1E4KA 3I85A 5FUCE 3I2CL 4HWEH 1IGML 3KPOB 5DRWB 3W39A 1G9NC 1F4WL 3U4BL 4X6FA 1RHHA 2J6EA 4AM0A 3T0EA 1WZ1L 5DSCA 1TENA 5FHAH 2V2TB 3VFPA 2BY2A 5C0DB 3LD8B 2DLFH 2W0PA 1EUTA 4LASL 3WNKA 3OZ9L 3KXFD 3RI5K 3PIQA 1MLBB 4HXAL 4G7YL 4KGJA 1J1XH 1FN4A 4MQTB 3HUJA 4YHMH 3OGCB 3QT2A 4DGIL 5IR1A 2VDRL 1TNNA 3LQZA 2W0KA 3G9AB 5DGQA 4PRIB 4QRQB 4JHWH 4HPYH 4EUPA 4TNWF 4LPWA 1WFTA 1FL6B 2F74A 4G6FB 2G5BA 5B22A 1VACA 4ZAKD 5CCKL 2AK4E 4LLDB 1S78C 3WUWB 1HQ4A 1IC7H 4N0CD 3LEVH 1J8KA 2DIBA 4X4XA 3QIWC 4HS6A 5FYLD 1T20A 1FQ9C 2BCKB 1EHNA 4G8GD 4V1DE 1JGVH 1S7XB 3S5LA 4EUPG 4I2XE 5ERWA 3CZJA 1OAZH 2FDBP 4MS8C 5GGVL 1HIML 3CUPB 5FGBA 4NQUA 3SKNB 4FG6C 4K9EH 5KSBF 4KROD 3T2PA 4W81A 3MODH 1FNAA 1YNLH 3L6FA 1BOYA 1RULH 2NLJB 5IWLC 3O6ML 2J1KA 4BJLA 2K7QA 3QDME 5CHNA 4YQXL 3FB7B 4H0GA 4XI5C 5HGHB 4C56A 4PLKD 5DD3L 4UB0L 4UBDC 1CD0A 4B50A 1MCSA 3O41A 1WZMA 1XAUA 1AP2B 2R1WB 3MCKB 1OT2A 3P2TA 1X5GA 1XCTB 1BX2B 3IU4H 2QQKL 2JELH 4OIIL 4Q0XH 1TFHA 2BVEA 2VXVL 4NJAL 3VI3E 5A16B 3X14B 3A6BH 3ZTJH 1Z5LB 1DQTA 3ES6B 3QHFL 4YFEA 5AD0A 5CP3H 2X70A 5IMOA 3QIWA 4XRCA 4Z7VE 3BZFB 2KQMA 4OFDA 5BXFB 2X4OB 4IIQC 5JOPD 2OTUA 2X7LA 2FNBA 2IAND 4TVPH 3K7UA 1GC1H 1VGKB 1YEDB 2NY1C 3FQUB 1YEIL 4PJBE 5GS3A 1U8HB 4TQEL 1D5MA 2P49B 3AREA 5FYKL 4FXKA 3GSOA 1EJOH 1KJMA 2W38A 5IESL 4NNXA 4PS4H 3IFOA 3L3OB 2R2BA 5M7QA 5CKAA 5LGKA 4LKXB 2MQ3A 2DJSA 3K3QA 4UT7H 3B6SA 2C3GA 5E8OA 3ZYZA 5EOTA 4MCYA 4CDGC 5JDSA 3VXSA 4XP6L 3EOYG 4E41B 2MCPH 3OG4B 3GI9L 3MGTA 5D7KE 4HH9A 3HNSL 3BAEL 3CVIL 4HC1L 3WFEL 1UYWH 4QRRB 5BCAA 3FN0L 1JWSA 5IFJB 3GSQA 2DIAA 3GMOA 3RIFF 1H3XA 2F54B 3GK8H 1AGDB 4M6ML 3KPOA 5DRWA 1K85A 5IROA 2QJDA 3GFUA 1CFNB 5LGHL 3WKML 4WFGE 1BVZA 5ALBL 3AXLA 5JMRA 2V2TA 1AGCB 1IILE 2YA2A 5I15L 4HJGB 2FX7L 1XEDA 3BKJH 1TNMA 1EHLL 4XNUL 3RBGA 1G6RB 4J23A 4KV5E 2OTWA 1MLBA 4N1HB 3RTQC 4KUZL 4RISH 5JW5B 1K3ZA 4L8SC 3OGCA 5J56B 1RVFH 3QO1A 3EZJB 3EDFA 4PRIA 4QRQA 5ETUB 1BWMA 1MRFL 3BHBB 3GGWB 4HBQA 1FL6A 1IBGH 2VDMH 1RIVH 4GAYB 25C8L 2P7TB 4Y19B 5FOBB 5ITBH 4Y2OA 4LLDA 4JQIH 5JXED 3ZL4L 4TUKL 5EBLB 3WUWA 3NIDF 1RY7B 2Q86B 4JHAH 2X9WA 2VZUA 1AFVH 3EJZC 1RFDL 3VXPB 2YOCA 2BCKA 4JZJB 1S7XA 4KDVA 3T3MF 2A0LD 2QKIB 3D3VD 1DQLL 4FP8H 4M43L 5DWUL 5SX5K 5EO0B 3L3KB 3CUPA 3GIZL 5IFHL 2CKBH 2EDBA 3NVQA 4PGZA 3SKNA 3WUWG 3KYOB 3KLHC 3BN9C 2EH8H 2NLJA 3NFNA 2EC9U 3MJ8B 4BH8B 4I1NB 2F53D 3V0VA 4Z7WB 2HFGL 2ZOLB 2EDTA 2FEDC 3DROB 4ODUB 4XP1L 4R7DB 4HJJH 5IB4A 4N5UA 3HKFA 4JEGB 5HGHA 2GHWB 4HS3B 2BDNL 3RFZC 3RJQB 1E4WL 4JO1H 4RGND 3TV3L 4GJTB 1QBML 1AP2A 3MCKA 4IMKC 3DWTA 3HC4H 1XCTA 1CD1B 2MQ0A 4Q9RH 3STLB 2Y72A 4KAQH 4I0KA 4PJCE 3HRPA 5MENB 1FDLL 4JKPL 5A16A 3OTTA 3X14A 3DUSA 4M4RA 1E6JH 1Z5LA 3ES6A 1V7MH 4XTRC 1TJIH 4ZUWB 4ZDHA 2BFVH 1MCWW 3I50H 5L88L 4M93C 3MXWL 3BZFA 3K81A 3TIDB 3SO3C 5BXFA 2XG5A 2X4OA 4M61B 3G9VA 3K1KC 4M5YL 4NZUH 5F96L 1GCFA 3W2DH 3V6BR 4FTVD 5I73B 3H6JA 1VGKA 1MCPL 1YEDA 3FQUA 4OLVL 1U8HA 2NY2D 3NFPB 2FIKB 4ZO9A 1CCZA 1FFQA 4KRPC 4PD4J 2OBGA 3GI8H 3VCLB 5JPNB 4ZUTB 1WZLA 3L3OA 5K9QG 2E8ZA 3LHPH 4LKXA 2ESVB 4P3DB 1DUZB 4PJ9B 3H8NA 4U6YB 2D03L 2ZG3A 3QFDB 3S37H 3MLZL 1SMAA 1DFBH 4E41A 1UH2A 2Y06H 4QHKI 4Y7MA 1Q0XH 5SWZD 2PW1B 2VQ1B 1UM5L 2ADJB 4QRRA 4JCLA 5F6HI 1IAIL 3SE9H 4U6XB 3MOBH 4ZFOA 5IFJA 3DXAB 1H8OA 4OD1L 4YHZH 2XNAB 3L5JA 2F54A 1AGDA 4LCCB 5L7XL 3ULUF 5CILH 1MSPA 1YEFL 5HGDB 1CFNA 5CIPH 2R0WH 1CT8B 2VWEC 2FJGB 3PQYB 4F80A 5JXAL 2YK1L 1KCRL 2VKWA 5HHOE 4N0UB 1AGCA 4HJGA 4ORGB 1AY1H 1OAYH 2GYSA 1CXFA 1G6RA 2WP3T 5KSAD 4PJ7F 5JW5A 4X9BA 1MI5D 5GHWH 5GQBA 1KEMH 1DN0B 5ETUA 5CZVL 1WC7B 3U4AA 2O93L 4TTGA 3BHBA 3GGWA 4X9IA 4GAYA 2VMFA 2P7TA 3MLYH 5FOBA 1DQDH 4NHUE 5CZKA 2EH7H 5EBLA 3V4VL 3VXUD 4WI8A 3VXRB 4JJ5B 5EH1A 2QR0B 3TFKD 2Q86A 2EO9A 4X8JB 3WXVL 2R15A 3S37X 1FRGH 1VHPA 3O3UN 3QUYD 3H3PL 2P5ED 3E6FB 2QKIA 1SBBA 5EO0A 3L3KA 4Z7NE 3HE6C 4NM4L 5ISZD 3KYOA 4PRHE 4V3DB 4D8PB 2PO6B 4C56E 2HWZL 3SDXF 3ZMRA 4JFOB 3MJ8A 4JFPB 4YBLB 4BH8A 3IKCB 3O8XD 4Z7WA 3NA9L 3RI5F 2ZOLA 5LQBH 3DROA 5MERB 3GSNH 3OKLB 3K8KA 5DHYB 4J4PD 2VH5H 1GJIA 5DJDB 4EBQL 4KKBD 5ACZB 2J6EL 4HS3A 2DJ4A 1J86A 1II4E 1Z9SA 3MRIA 3C9NB 3SDDB 4WFFD 1JYVA 3MGOB 3NMEA 1SJEB 4M3JA 4OFYA 3STLA 5DJAA 4XVUD 3TGXA 5MENA 3WHE1 4JQXA 2QHLA 3VFMB 5F9AC 5A2JH 3AGVA 1IGCL 4AIOA 4HIXH 2DQDL 2OL3B 4ZUWA 1MHPH 3SQBA 3R8BB 2HKFL 1R3KB 4XVSH 4ZFGL 3TIDA 4LDOB 5HI5D 5EO9B 3AFLA 3ULVD 4JKKA 1I3GH 3TEUA 3TN0B 1V3LA 1L0YA 3CXHK 4YAQB 2AK1H 4X5XB 3N85H 1UZ8B 3T4AB 2FIKA 5L9DL 3VCLA 5IMMB 1KXQE 5JPNA 3ESVF 4ZUTA 4O58H 4FFVD 3A6OA 2ESVA 4P3DA 5J11B 4PJ9A 3H42H 4G6AC 4U6YA 4WW1B 2ICES 3QFDA 2J5LC 4NCC2 5KVFL 1KFAL 4JDTH 1UJ3B 1JZ3A 2XZZA 5DC4B 2I9TB 1YYLL 2G60H 2V7HB 3T77B 9CGTA 1G7MA 2PW1A 4IMLB 1ZE3C 2ADJA 4XPTH 5CD5D 1YNTB 2R2HB 2AW2A 4JANB 1RSFA 4U6XA 4X83A 3DXAA 4MJ5B 2XNAA 2K3TA 2PO6C 2YPVH 5HGDA 4OI7A 2WSKA 4YBLC 1EXUA 4OCYH 4MCZB 2V9TA 1CT8A 5F9OL 2FJGA 3JV6A 2X9XA 3PQYA 5H2BB 5F7YC 1F00I 2IADB 3C2AH 3K1DA 4NN6B 2X4NB 5D8JH 4ORGA 4KHTL 5DD5L 5T3XH 3ZDZE 2AJXH 2B8OT 4X6DB 3SJVD 3UJJL 4DKEL 3D0LB 4ZUSB 1PW3A 4IRJD 4JY5L 4Z7OF 4UINH 4LCIL 3SDDC 4TSCH 2XTJC 2EDLA 1DN0A 4ZG1A 1WC7A 1OD9A 3ARRA 2GJ6A 5DMIH 1DVFB 1S8DB 1JGUL 3C09B 3MV9D 2E6QA 4JPWL 5I8OL 3ZHKA 3N06B 4E9LA 3BD3A 5C0ND 3FAXA 3AMKA 3VXRA 1A0QL 5C0JB 2IPUK 2QR0A 1DL7H 1QVOB 3UYOD 2OZ4A 4X8JA 2KZWA 3TT3L 1P4LB 5CJQL 1RUQL 3E6FA 3WFDL 1R5IB 1YECH 1W0WA 4ODHL 4RGMC 3V5HB 1NL0L 1G9EA 1MFAH 3TLRA 1LMKA 4D8PA 5CGMA 2PO6A 4ONHB 5B21A 5JO5B 4K9EC 1OAXL 4JY6B 4JFOA 3BWUC 4JFPA 2E27H 3E8UL 2W9EH 5ID1B 3QWQB 3TCLA 4R2GB 1J5OL 1R3JB 4S1RH 1T7YA 5MERA 3OKLA 5DHYA 4NQSB 3FT3B 3MRJB 3ZTNL 5DJDA 3G5ZA 5ACZA 1ZGLP 1UJ3C 5DRNB 2NXZB 4MJ4A 4C57C 3C9NA 1GRWA 1L9NA 3UROR 3MZGB 3SDDA 4G9FD 4UILH 5E6ID 5EU5B 1XGQB 1JBJA 2CK2A 3MGOA 3WS3B 2ITCA 3RUGB 1SJEA 3EDKA 3WNOA 3TPUE 1A1OB 5C0BB 2FYYB 4RFEB 3VFMA 4MA1C 3AB0C 2ZCLH 4HCRA 4NO0A 3BVNA 4OZHA 3UJTL 4LEOB 1JUFB 1D5ZB 3IDMB 1S78D 2C4FT 1R3KA 4JM2C 1ZLSL 2DAVA 4NN6C 5D9SB 3B9EA 3G6DL 5EO9A 3VXTB 4S11A 3QIWD 4M1GL 4U1GB 3ZYJA 4CMHB 2GY7B 3DBXB 4YAQA 3RZCD 4X5XA 2FD6L 1UZ8A 4TUOB 3T4AA 1F6AB 4YDKH 3TJHC 5E2TL 4MS8D 3PG2A 5CINL 1GC1C 1F6FB 3GJEB 4YGAB 1ZLUK 5I18H 1HHKA 3LZFL 1REIA 1KB5H 4FG6D 4JPIB 2EDRA 4PLNC 4LCUB 3C09C 1TLKA 3R1GH 1VGEL 1WK0A 4Q9BA 2FX9L 4U6HB 2CO6B 4P4KB 3BZEB 4M62H 5DRZB 3SBWA 1UJ3A 2I9TA 4J3OC 4ZTOH 5C07E 3JWOH 4XI5D 2V7HA 1T5XB 1CL7L 4UDTB 2ZKHL 4IMLA 1YNTA 2R2HA 4OCWH 4JANA 4YHOL 4KQ3H 4MJ5A 3CFIC 4YPGB 4NM8L 1JHLH 2YZ1A 3PWPE 2WQRA 1Q0YL 1I8LC 3VWKB 3NCJH 1KJ2H 4R90H 1IVLA 3QJHB 4ETQB 4MCZA 4EN3B 4PJGF 4UV7H 1QYGL 5H2BA 1I8IB 1FV1B 2A1WH 2IADA 1T4KB 5I1IL 3U1SH 2W0FB 4CJ0A 1DP0A 1SMOA 4X6DA 2D31B 1CXEA 3D0LA 4D9RD 4ZUSA 4P2RE 4OUUB 2NXZC 5KW9L 4FFWD 4AENB 4Y19E 4K2UL 2R2EB 1FORH 1U41A 3NTCH 4HK3J 2VIRB 3KR3L 3PV6B 1JPST 3ISWA 1RZJC 1DVFA 4PJAB 1MFCH 1WICA 2NY1D 1S8DA 3WDJA 1R3HB 2HJKB 2VQUA 1W72H 4D94A 5I71B 2VDQH 1P1ZB 2IBZX 1SYVB 5C0JA 1MRCH 5F88B 1QVOA 2Q7NA 2JCCB 4XPAL 5HDLA 4WGVB 3SDAB 4KKCC 1RUKL 2YRPA 3BFOA 3NIGF 3HNTH 2GJZB 3HPLA 1A21A 3IDJB 3PXHA 1R5IA 3DURB 4U1GC 4PB0L 1IFHL 3V5HA 4WO4C 4MVBD 4YHKL 2NY5C 4HKBB 3BPNC 3ZKND 4ONHA 1I8LA 4QTIH 5JO5A 4MQXC 4JY6A 3WXWH 2LQRA 3QO0B 2P5WA 3PHQB 4E0RB 1KELH 5CIPB 1R3JA 4BQ8A 1YEEL 4NQSA 3FT3A 1M6OA 5F71A 2GFBB 3MQIA 2XRAL 4JFED 2O5ZL 3MRJA 3UTSD 4P4KC 1NMAH 2BVUA 5DRNA 1BD2B 3TVMC 3RGHA 4MA3B 4IDJL 4YFLI 1S7WB 2HFTA 5F7EL 3BDYL 1MHEB 1F2XK 4JFXB 4X6CB 5EU5A 4Y16C 3U7AA 3WS3A 3RUGA 3RTQD 3RU8H 1G6RL 1QHPA 1EHXA 1A1OA 5LBSH 5T3ZE 5EC1B 2H32H 2FYYA 4RFEA 5C0BA 1EBAA 4PRPB 3BP4B 1K9TA 1OWWA 2IMNA 1MFNA 4DW2L 3X3GL 1O7VA 1GHFL 5GRUL 3TBSA 3L3HB 2CGRL 5GJSL 4OCXH 3MNVB 5DURD 3BX7C 1JUFA 3TYGH 4EN3C 1D5ZA 1HZHL 4EZMA 1FYTB 4WU5B 4HXBL 5D9SA 5TF1H 2QSVA 3O4LD 1Z9OA 2OTPA 5D5ME 4K94H 3I3EA 3DBXA 4TUOA 2ESVE 1F6AA 3D2UD 5E4IA 3JSSA 2P8PA 1M7XA 4JM4L 4U6VL 3ROLA 2J4WL 3GJEA 2BVOB 5FYJU 4XBEH 4JPIA 4NYLB 2JE8A 4LCUA 1BFVH 3LEYL 2YHGA 4LPYA 4M3KB 4GXVL 3LQMA 1IAII 1KLGB 1NCBL 4U6HA 3KS0H 1YMMB 2ZCKL 4P4KA 3BZEA 5DRZA 4G6ML 3U30B 2BVPB 1HILA 2OI9B 4POYA 5C9KA 2B5IB 3DXAE 4YK4B 1UWEL 3FKUS 5GISH 3SDAC 2XA8H 4NFDA 1AI1L 2AABH 4QOKB 2EDFA 4Y16A 3CGTA 1HHIB 4RZCB 1XIWD 1KV3A 4S1DC 3OF6D 2QL1A 1NBZB 3DX9B 4GKNB 4JRXB 3NA4A 4YPGA 4N0UE 2VZTA 4YJZL 2V5MA 2PYFB 3VWKA 3QIBB 1IGIL 2MTPA 1L7IL 4GXUM 4MNHB 3QJHA 4WI9A 4ETQA 4EN3A 1UG9A 2A2QT 3C5JA 1I8IA 1FV1A 3MC0A 4XPBL 1T4KA 1X5KA 2W0FA 3UTTE 4BH7B 2Q1EA 3V52H 2Z0BA 1H8NA 4M7JL 4OUUA 4AENA 1Z3GH 5DXWA 2R2EA 4K7PL 2VIRA 3PV6A 2GK0A 4PJAA 3VXRE 4GAGL 4ODTH 3BZDA 1R3HA 2HJKA 3MACL 4KRPD 1CFVL 5KSBB 1SYVA 1A7QH 1B9ZA 2NY3C 3P0GB 3MV7D 5F88A 2UY6A 1PKQB 2JCCA 1EERB 1QFUL 3WIHH 2UZXB 4MQ7A 2MWCA 3SDAA 4XCYB 4KZEL 5HHPB 2GJZA 3JWDH 4XCNB 1CQKA 3IDJA 3DURA 2C1PA 4RMSA 5HI4C 2EEAA 5TDNB 3GSRB 5KN5B 5FYLE 3ZE2F 2X4QB 4HKBA 4GKOA 4G8GE 4XX1E 4PJXB 1IEAB 4HBCH 3QO0A 4LAQL 3PHQA 4DZBA 5TE4H 4E0RA 3QPXL 2NYYC 4R3SB 5CIPA 1RZGB 4P23B 1JYNA 2GFBA 4X6EB 3MRRB 5GRVL 4HMEA 3U30C 1BD2A 4MA3A 1S7WA 2ICWI 1MHEA 2H2PD 4X6CA 2DQTH 3U2SB 2F8XC 2QV2A 4HS8H 1NMCB 4NJ9H 2BHYA 5EC1A 4PRPA 3P4OB 3BP4A 4S10A 7FABH 3O3EB 1X6NA 2XV6B 2IG2H 5IGXH 1P4IH 3L3HA 5A43C 4URTB 4KDWA 3F7YB 3MNVA 1BEYL 1FLTX 4XNZC 2DQCL 1YN7B 1W0VB 4JFDD 1FYTA 3OKDB 4WU5A 1KGCE 2J88L 3FQXB 4WENB 1JE6A 3V79C 4QHMB 1CLOL 4M7KL 3QB7C 2DWEB 4B53A 4ODSH 2OZ4L 1RIHH 1C16B 4NC2B 3QNXB 5I6XB 2OCFD 2BP3A 2XACC 5JOPE 2BVOA 3HE6D 3D39B 5EDXA 4QXUH 4M7LH 5LKNA 4KJPC 1A3QA 4NYLA 3W9EB 2DIJA 2H2SC 3C6LB 1ZLVH 1AGFB 4W6XB 4AEHL 2AGJH 3L3IB 5FCUL 1JNLL 1ZTXL 3IRPX 1YMMA 5DJ2B 5DVNA 5C0RL 5I16B 1Z9LA 2BVPA 2P43B 1NFKA 4QOKA 4CJ1A 3Q0HA 2P46B 3RY6C 1WLHA 1HHIA 1WWCA 4I77L 3RVVC 2DLFL 5F7DB 1NBZA 3DX9A 4GKNA 4JRXA 3VD5A 3SKMB 2AXGB 2Y5EA 4ZFZB 2PYFA 3QIBA 3UX9B 4X6DE 5E2WH 5C0AB 1EFXD 4MNHA 4WEMB 3NCYP 4WEBH 4YUEH 1RMFL 4LKCB 1T03H 3IFNH 3H0TB 4A6YH 4P23C 4BH7A 1FC2D 4F7MB 1NC4B 2OL3L 5MI0B 3ILQC 4HCRL 5I8KL 3IFPB 1MH5B 3TNNB 5D96C 5ALCH 2NY7H 3FHAA 3MROB 5CEZH 1YQVL 3LKSB 3RNKB 4R4NC 2BNRD 1QOKA 1ZVYA 2KDGA 1CK0H 4NN5B 2QTEA 4KI5F 3MJ9H 1NMCC 3GRWH 5DFVC 1OARL 3IXAB 4G42B 5LGJA 1PSKH 3SDCC 2R9HD 2F58H 3RGVB 2XQBH 1H8SA 5KSBA 2RIKA 2R4SH 5CSZB 5ABDE 5E2VH 1PKQA 4ONGH 4NP4H 1YNLL 1XR8A 3RPKA 4TYUA 1QFOA 5HHPA 4ELMF 1T2QH 3UPRB 4XCNA 3RY6A 3OJDB 4XPFL 2R56H 2IALB 5DA0B 2J8OA 4LSSH 5D2LF 3U48A 1IGYB 1SEQL 5TDNA 3GSRA 3PHSA 1YPZF 5KN5A 1R5WB 1XH3B 2X4QA 4UU9B 5I6XC 1CGSL 1RPQA 1F58H 4PJXA 1IEAA 4LSPH 3PGDB 4KPHH 5C09D 3D3VE 3GBMH 4X98B 5B3JE 3D85B 4LRIA 4N8CL 3IDYC 2AAVA 2FIRT 1RZGA 1LDPH 2F5AH 4L4VD 4H26B 3U0PB 2RHEA 4P23A 2ERJB 4X6EA 3EUUA 1U3JA 3MRDB 4FQPA 3MRRA 4H0IA 3OJMB 5L0QB 4WTWA 4MD0B 2FH8A 3LIZH 2F53E 4ONFL 2A9MH 3U2SA 2D7MA 2IBBA 1RK1B 4FMFA 3OSKA 1J1OL 1HDMA 5I75B 2XTJD 4LRNH 3P4OA 2NCMA 3SDCA 3O3EA 4RA0C 1LP9F 3WSQH 4RGNE 1MFDL 5FDWB 5C7XH 1LO2L 3F7YA 5FGRA 4C55A 3PWLB 5HYEA 1YN7A 1IL1B 1RI8A 5GS0L 3OKDA 4MAYC 3FQXA 5JIHA 3P0YL 4NO0D 4OF6A 3CFEA 4ODWB 4PS4L 2RB8A 3KG5A 3NCBB 5MI0C 5E24E 2PF6A 4N1CA 4QHMA 3H9YA 4BFIB 3RWCA 2CDGB 4EOWH 2DWEA 3W11D 3EOTH 1I9IL 1BOGB 1C16A 4MXQD 5TFSL 3QNXA 4PLJC 4W70A 2BNQA 4NN5C 4P57B 1TZGH 1FNEB 2DBJA 32C2B 3W9EA 4FTVE 3TH2T 4L1HA 1CL7I 1AGFA 1G7JB 3L3IA 3K2UL 5CS7A 2IAMD 4OAWB 3ABZA 5DJ2A 2NZ9C 4LHJB 1A7NL 3G5VB 2R29H 2VZ1A 5I16A 4FFEX 3ZT5A 35C8H 5F7NC 3RIAK 3QCTL 4PV9B 2P8MB 4YHNB 1BQHB 3ARXA 4GW4B 3KYKL 1TQBC 4XCCL 1JMXA 3D2UB 3JWOC 4U3HA 5EG6C 1GGBH 1JNHB 4NT6B 4OCRH 3MV8B 3WV0A 2IFGA 4FNLH 3SGJC 3B9KB 2Z91A 2J8UB 4KVNH 3KPSD 3SCMC 3SKMA 2AXGA 4ZFZA 4JRWA 5SWZE 4U1MB 1RZJL 4M8QB 1RVFL 6CGTA 3QISA 5F7HA 5K9QI 2PR4L 4LKCA 1OLLA 3H0TA 4MAYA 3W0WB 4H20L 5JQ6H 3O6FB 1YNKH 1IBGL 3RKDC 4F7MA 1NC4A 1IEHA 3B8YA 4JM2D 4CL7A 2VO5A 5J0BA 2Y07H 3IFPA 1MH5A 5F8QC 3TNNA 1EUUA 4O9HH 3MROA 3H9SB 3IETA 1T0NB 3LKSA 5GSVB 3RNKA 1BFOB 1F3JB 5KSVB 1OSPL 1MWAH 3EO9H 1M71B 1KPUB 4TVPD 4CN6A 5I75C 3IXAA 2X6MA 4G42A 3TJHD 2GY5A 3IFLH 3RGVA 5EUOF 2H45A 1OGTB 1PGRB 2NY5L 3MLRL 1MVUB 3FZUC 1VFOA 3QEQB 2DI8A 4JO4H 5F7LB 2WMPA 4MXVF 3RL2A 3I6GB 4FFZH 1SQ2N 3OJDA 5GGUB 3DVNB 3VXUE 2EXWC 5MHSE 4OLYL 3O2WH 2HT3C 3GB7B 4EXPX 2O61A 3LVEA 3D9AL 1R5WA 1XH3A 4UU9A 1NCWL 3RVWC 2B1AH 3ARYA 2P5EE 2MNUA 3PGDA 3EFDH 4X98A 4YNYB 1DJSA 4DUXA 3RVTD 5FA4B 1ITBB 3D85A 5TQ2L 3B5GA 2FHFA 4H26A 5ISZE 1OVZA 3SE3C 1YQ2A 4JFZL 3MRDA 2P5WD 3HA0A 2FLBT 4YZFF 2VABA 4L8BB 3X3FL 4XCFL 4ZD3L 4MD0A 3THMH 2YN3A 3C2SA 4PRPE 2Y7QB 1DBAL 3BRGC 1C5CL 1ZHBB 2BFVL 1U9KA 5D7JB 4AG4H 1PY4A 1C5DB 4HZAA 3FFCA 1KTLB 3NCYS 1YY9C 1FYTE 3MUY1 1ACZA 1NBVL 5FDWA 4NGHL 43C9B 1AHWB 3V4UH 5HYSA 1SJVA 1IL1A 4AEIL 4TSBH 5L8LB 5HHXL 4DZ8B 3GI8L 1X4YA 3O6FC 1L0QA 4NQCB 4ODWA 1BQLL 3DTXB 4JO2L 4DN3L 2Q76B 5BVPH 1UC6A 4BFIA 5IJVB 1AE6L 3NPSB 4H8WH 1BOGA 4QHUA 1QBBA 1YC7A 4YH6A 5TQ0L 1BZ9B 5AYUL 4P57A 1GAFH 4WO4D 1KG0B 1FNEA 2I07B 2Q3AA 1V5JA 32C2A 1G84A 3X12B 3CIQA 5JORB 3EO0B 2W65B 1OM3L 1DBJL 1G7JA 2AEPH 3I9GH 1UKSA 4MQXD 3SE9L 3SE3A 3MOBL 3NH7H 4G6KH 3EOBB 2XKNB 4X4YA 1IT9L 3G5VA 4YXKH 5EZIL 4PV9A 2P8MA 4YHNA 5JPMA 1VESA 3QCVH 1BQHA 5T5FH 4GW4A 1PG7H 1FO0H 4O00A 3TF7C 1JNHA 2HT4C 4NT6A 3TVMD 3MV8A 1B6DA 5ESVB 4PP2B 1NCNA 3B9KA 2AJUL 2ZSVB 4Y16D 2VLKD 1VPOL 2DQEL 5E56A 3JBG7 1AO7B 1JNJA 4MA8H 4U1MA 4M8QA 1KN2L 4PUBL 4OTXH 3N9GL 1BHGA 1DEEB 2YKLH 1SJXA 3WFBL 3O6FA 1GVIA 4PB9H 3ARTA 3ZSTA 4BK4A 3H9SA 5GSVA 1T0NA 5LG1A 1BFOA 1F3JA 5KSVA 4NFCA 1G7PB 4FQHB 1IZJA 1I4FB 4I3SH 2APXA 1M71A 1QRKA 1PLGH 1KPUA 5DLML 5HHMA 2YUVA 1IQWH 2VL5B 1PKQE 3UZQA 2WBJB 3TM6A 1HI6B 4OT1L 4ZXBB 4X5LA 1A1MB 1OGTA 1UACH 5C08A 1MVUA 3QDGD 5DVOA 3QEQA 4RAVB 5EOQH 4K7FB 1SY6H 3SDXA 1A02N 1QNZH 5HVHB 2DYPD 1OT1A 3I6GA 3JTSA 4NN7B 1R0AH 1XF3B 3OAZK 3NZ8B 4OZ4B 5GGUA 3DVNA 4RX4A 4PJXE 1X4XA 4ENEC 1WITA 3GB7A 3CFBB 3NPSC 4HFWB 3L5XH 2OJZL 4P2QD 2ED9A 1PG7X 4G5ZL 3ZYIA 4S1DD 4Z77B 3MCLH 5DUPH 5SX4I 1Y18B 2E3VA 5D72L 1NUDA 5FA4A 3NAAL 5EORH 3VFSA 1Q9KB 3BSZH 5E2UL 1RU9H 3JV4B 2DL2A 4LGPB 4L8BA 1WTGT 1OLZA 1J18A 2Y7QA 4U0QB 4LFHD 4KRNA 5AAMA 1ZHBA 4HLZH 5DD1L 4XHQA 5D7JA 4WUUB 1C5DA 4LSQH 1KTLA 5FDYA 4OBRA 5DF0A 4C4KO 3VI3F 1I9JH 5EWIH 2C1OA 5LCVH 4G9FE 43C9A 5ICZB 1CLYL 2AK1L 1AR1D 4MGXA 1ZANH 1GGIH 4XXCC 4JRYD 4Z7VF 5E95B 4DZ8A 5ADOL 1VEMA 4MA7H 4Q9CA 2NY3D 3V4PL 2JB5L 4NQCA 3DTXA 1BJ8A 3WL9B 5FV2A 1SYSA 2Q76A 3D39E 1FFPB 4NBZB 5HGAB 5IJVA 3H42L 4I18C 2A77L 1F97A 4KMQA 2NX5D 1A6UH 1BZ9A 4S0SD 1KG0A 2I07A 5BMFH 1Q72H 3X12A 2Z93B 5JORA 2W65A 2WBJC 1EMTL 1R3LB 4NHCL 4BZ1H 3U36B 3EOBA 2XKNA 4FQLL 1S5IL 3LPGA 5HVHC 4PJGB 2ARWA 3O9WD 2AXHA 4S0TD 2X1QA 4FMKA 1WBYB 3BKYL 3JWNC 2FCBA 4NSKB 5ESVA 5C0AE 3KPRD 4PP2A 3RDTB 5KANG 1FL3B 5IBTH 2ZSVA 2XKUA 2RBLA 1A3RH 1HK6A 1LGVA 4QCIB 1CD8A 1AO7A 3W81A 4KY1H 1ODAA 1LEIB 2D0GA 2EDXA 1QP1A 2VDNL 1HCVA 3KJ6L 1DEEA 1KCVL 2WW8A 4IJ3B 5DMIL 3QXAB 4OF0A 4YFLF 3PF2A 2XWTB 4XVJL 1QBLL 2DM4A 2R1YB 4KV5F 2GTWB 2VZSA 4XH2A 4MNGB 6FABL 4I18A 3EKCA 1INQB 1X7QB 1G7PA 1N7MH 1WVZA 5J3HD 4R97B 1I4FA 1JGLL 4Z8FL 4FFYH 3R0MA 2VL5A 4D9RE 4ZPTB 2WBJA 1HI6A 4ZXBA 1JPFB 2CD0A 1L8JA 1A1MA 3P4NB 4NKIH 2VLRB 4EDWH 1J0ZA 4ODVL 4RAVA 2EIZB 4F7TB 3U7WH 2H2SD 4K7FA 3X17A 3OKEB 4DFHA 4L3ED 4YXHL 1WEJL 1RZ8B 2DICA 2RGSA 1QR4A 1XF3A 1RIUH 1ZT7B 3NZ8A 3MLXH 1BIIB 4NC1C 1U0QA 3CFBA 4OCSH 4HFWA 1FPTH 4R96B 1QPXA 4QRTA 1URLA 5JNYB 3QUZC 1FSKB 3VFTB 1Y18A 2DQJH 2YPLD 3Q6FA 5AWNL 2VOTA 3EDJA 1Q9KA 4HV8B 4L4TD 4DTGH 3JV4A 3T0XA 5EOCH 4Z95H 4HDIB 3K0WA 3BJLA 1UA6H 1Q9WB 2RAMA 4U1NB 3ILQD 5DJ0A 1RHFA 5T3XD 4WUUA 4JFEE 1Y6NR 3GM0A 2BRRH 3RDTC 3UTSE 4LCWD 3DI2B 4LVHC 4BM7A 4Y4KC 3LN5B 3MNWB 1CDBA 5GS1B 4PJCF 4DGYL 3TJEH 1NMBL 2O5XH 4MNQB 1ZVSB 4FABH 2ZJSL 1CE1L 5ICZA 3SDCD 3MXVL 1MNUH 3NBNA 3PL6B 1U8MB 5D1XD 4OLUH 1QRNB 2OK0H 3WL9A 4AEFA 4RFOH 4PTTB 1FFPA 1OP9A 5HGAA 1PQZA 2B39A 5E8DH 2MCG1 4R97C 1EGJH 4PTUB 5JZ7C 3GUTB 3QUZA 1A7RL 1LNUB 2BNQD 5TE6L 3CMOH 1R3LA 5T1KD 2CR3A 1MFEL 2HH0H 3U36A 1C5BL 3MUGB 3MV8E 5FM8A 3I2CH 1JHLL 5H37H 4PJGA 3LN4B 4P2OC 4AJ0A 1F4WH 2J8UE 3U4BH 3BISA 4Z7QE 1WBYA 2WANA 2BHUA 2E9IA 1WZ1H 2DM2A 5JMOC 3TA3B 4RRPA 3T4YB 5HDOA 2K1MA 3RDTA 3FQNB 2XZCL 1FL3A 3PJSB 4LASH 4TOYL 1QFWL 1C8PA 1GZQB 3H7BB 3OZ9H 3W0WE 4QCIA 4P5TB 3MUJA 4HXAH 4G7YH 1FSKC 4A2LA 1OCWL 5DUBB 4WIQA 3VD3A 4DGIH 2VDRH 5JW3L 1JTOA 3H9SE 3JUYA 4U49A 3QXAA 4L3CB 1NC2D 4HUKB 4RRPG 1T66C 1J87A 2Y6SD 2XWTA 2A9NL 2R1YA 1NAKL 5CCKH 2GTWA 4MNGA 5ACMA 1INQA 1X7QA 2JK5B 3N0PB 3EYOB 1UCBL 4I13B 5FYJL 3QWRA 3I6KB 5I1JL 3EYSL 4ZPTA 3X11B 4PLJD 4WI6A 4Q7DA 1JPFA 2P42B 3P4NA 1X5LA 1ZHKB 5GGVH 1HIMH 3EOAA 3REVB 2WINB 2EIZA 4F7TA 1AXTL 4MLSA 4OB5L 3ALPA 3OKEA 2IFFL 5EFIB 4JREB 2ZUSA 2Q8BL 3WNLA 2FWOB 3O6MH 2NZ9D 2HTLD 1ZT7A 5J8OA 3ULUL 3MO1B 4GS7C 3ZDXE 1BIIA 2P44B 4M7LT 1KELL 4YQXH 3FO0L 4Y1AD 3MV7E 2ICEB 1FO0B 4Z7NF 1ED3B 4R96A 5DD3H 4UB0H 4F8QA 1NMAL 3O11B 1QZ1A 1GGTA 5JNYA 3VFTA 1ITCA 3SCMD 2EDYA 3WFCL 2PTUA 4OM0L 2YR3A 3OAUL 4NRXB 3GJFK 5EU3B 4HV8A 1NFDE 4GRWB 2ORBL 3CLEL 3RVXC 1WFNA 2QQKH 3I75B 4HDIA 4OIIH 4M9PA 3K4DA 2VXVH 4NJAH 4GAJL 2QQLL 1NSNH 4EVNB 2DB8A 2GKIA 4H0HB 5TF0A 3RKDD 1Q9WA 1WSST 3QHFH 5FV1L 5D71L 4UIKL 3VW3L 1JL8A 2VWEE 1T5WB 4Y4HB 3Q6GL 1JRHL 3LN5A 3AUVA 3KLDA 3MNWA 3QFJA 5GS1A 4GOSA 5IKCB 4MNQA 2E9WA 1ZVSA 3ESUF 5BRZB 2DM7A 1DANT 2E5EA 3ARDD 2VTFA 2XWBA 1RZKL 1J0HA 4TQEH 3PL6A 1G1CA 4PP1C 1N59B 1U8MA 3FZUD 3VG0H 2NQCA 2ADGB 5FYKH 1QRNA 5IESH 3LB6C 3UTPD 2PXYB 5D1ZD 4PTTA 5KG9B 1ZA6B 2C3XA 2V17L 4MDJB 3QJFB 4K8RL 2IJ0C 4JFDE 4XP6H 4U1JB 4H8WC 4PTUA 2HT3D 2WWKO 3GI9H 4RA3A 4Y4FB 5F97E 3HNSH 3BAEH 3CVIH 4DVBB 4PJIE 4HC1H 4KMLB 3RVWD 1EEUA 1LNUA 4MJ6B 3TWCL 3ZT7A 4F8TA 4P49A 4OZFH 3WFEH 3FN0H 5M95B 3PV7A 3L5IA 4L5FL 3MUGA 1A7PL 4M6MH 1RJCA 5H94B 3LN4A 3MLVL 5GGVY 4DOHB 4AZ8A 5LGHH 3HR5B 3WKMH 4U0RC 4KUCD 1FG2B 4JQVC 5C86A 2NX5B 2F15A 2R69L 3BD4A 3TA3A 2AVGA 3T4YA 5IK3A 1RZ7L 2YPKB 1IC4L 1PFCA 2JKXA 3FQNA 5I15H 5D7LB 2FX7H 3PJSA 1EHLH 4XNUH 2EDQA 1GZQA 3H7BA 2ATKA 4P5TA 4KMTL 2F8VA 5J1SC 4KUZH 5FF6B 5DUBA 3SDYL 1YY9D 4PJHB 5J12C 1LEKB 3AROA 4HGMA 1MRFH 3K4AA 4L3CA 2BVQB 2EEDA 4X7FC 5KSUB 1FZKB 1OTTD 4ALAL 3RWDB 25C8H 3ZDZF 3RVUD 1AR2A 2WWMC 4PJ8D 3SY0B 3HB3C 4TUKH 3ZL4H 1B4RA 2HRLA 3W5NA 5HJ3B 4OQTA 2JK5A 1PX3A 4ELMB 1ZT4A 3EYOA 3NIFE 5HYQA 3V0AC 3I6KA 5JHDD 1RFDH 5D2LB 3X11A 3HC3L 1U3HD 1K8IB 1YPZB 1E4XL 5JW4Q 1DQML 1DQLH 1ZHKA 4M43H 5DWUH 4Z0BL 5F3BB 2QQQA 3REVA 2WINA 3GIZH 1SBSL 1WFUA 5IFHH 1CIDA 4HIEB 3VGGA 4CUCA 2F5BL 5C08D 3GZKA 2FRGP 3U83A 2FWOA 4XVTL 3OPZL 4UIMB 1E6OL 4JQVA 3MO1A 2HFGH 2PTVA 2YC1B 2V5SA 4XP1H 1I7UB 2R2CA 2E7MA 1JI1A 2ICEA 1FO0A 3LEXB 5BOPA 3BN3B 1ED3A 2CUMA 4P3CL 3O11A 2BDNH 1EO5A 1H0DB 4JR9H 1EEQA 4Y4FC 1E4WH 1DQQB 5CJ5A 2NXYB 3TV3H 1KENL 1QBMH 4N0RA 4NRXA 3BGFB 1OOAA 3FN9A 4EI5B 5EU3A 2EICA 3FB8B 3S6CA 4WWKB 1LP9B 3L7EB 3I75A 2ZUQC 4FQ1L 1R3IL 1FDLH 4GW5A 4JKPH 4WUUE 4EVNA 2BX5A 4ZS7L 1NFIB 2XZQL 1MLCB 1S9YB 5C09E 3TP4A 5FGSA 5C92A 4HSQA 4IRSB 1Z0MA 4QT5B 3BIAX 5L88H 2CQVA 4OV5B 1A2YB 3MXWH 4JGUA 4PYHA 3BYTA 2IPUG 1T5WA 4Y4HA 3NGBC 4M5YH 4PJEE 4LPXA 5F96H 1MCNA 4AT6B 1FL5A 4ZFFB 3J8F7 5BRZA 1MCPH 1T83C 4FQQB 1TTUA 4KI5C 4OLVH 2VSCA 3O4OB 2D7TL 3G04B 4RFNC 1N59A 5DFTA 1FGNL 1I85C 1SY6A 5HDQL 1IKNC 2CJUL 4UV4L 4LF3B 3FB5B 2PXYA 5F6HJ 3T2OA 4D0DB 3QQ4A 5KG9A 1ZA6A 1EJ6A 4QYOB 2D03H 1F02I 4MDJA 3QJFA 4CADB 3MLZH 5KZCB 1P7HL 5D2NB 1WISA 4OI8A 4U1JA 3MLWL 4ENED 3R06B 2BVYA 5IUSA 4Y4FA 3DPBA 2O5YH 4XB8A 4MJ6A 4OCLC 1UM5H 4XGZB 4CRPA 1IAIH 3P77B 5L7XH 5H94A 5B4MC 1JPGB 1YEFH 3HR5A 1TJGL 2DQFB 5DQ9B 5TE7H 4NOBA 4WEBL 5JXAH 1T03L 2YK1H 2YPKA 2Q20A 4FS0A 2EE3A 5IW6B 1J0KA 3BGMB 1ULVA 2NW3B 4X4ZA 4ZTPL 1C08B 2ZPKL 4HZLB 5ALCL 1CE6B 1I7ZB 3QQ3B 5FF6A 1T83A 2GAZB 4PJHA 2QADC 1DLFL 4JN2B 1LEKA 4CN1A 3BGFC 2AEIT 3FQTB 4MNGE 5CZVH 1T22B 2Y25A 4WTZA 4EI5C 5KSUA 1FZKA 3RWDA 4I8DA 4LSUL 4F2MB 4I0PB 3H7LA 4N68A 3SY0A 1TPXC 3V4VH 1FAIL 1UZ6E 1YJDL 2R4SL 5HJ3A 4IRSC 4ELMA 2VLRE 4KHXL 1KEGL 3WXVH 4TSAL 3ZO0A 4WTZG 5D2LA 3H3PH 4JGJA 3DOSA 5FM4A 1K8IA 3VXMB 1YPZA 1JZ6A 1J11A 3IDGB 2WBWB 5F3BA 4LSSL 4G6JL 5EOCJ 4NM4H 3SE8L 4HIEA 4QTHB 4FZEL 4TVPE 4Z5RB 1FH5L 3TT1H 2K7PA 1ORSB 2HWZH 2HAZA 5HI3C 2BSRB 4UIMA 3NA9H 4Y2DB 2YC1A 4XAKD 1I7UA 4O51B 5E1AB 4ZSOB 3LEXA 1CDYA 4EBQH 3WFHA 4AH2B 2J6EH 5KOVC 1H0DA 4P46B 3I02B 1DQQA 5DK0B 4ZNCD 1KT2B 2IF7A 4LHUD 2DLTA 2FB4L 2JJUA 5CEXB 2VLJB 2ZG1A 4QHNB 4EI5A 4J1UB 3FB8A 4WWKA 1LP9A 1OB1A 3WJLC 1RURL 3CMGA 3OAYK 4MJIB 1H3PL 3AAZB 4UT6L 2PTTB 2KL6A 2WIMA 1IGCH 4P5MB 1NFIA 1MLCA 2XXMB 1CG9B 4WNQB 3CDGA 4EUPH 3HNVL 4IRSA 4QT5A 2VXUL 3N1GC 1A2YA 1S7VA 2HKFH 2EIEA 4H25B 4ZFGH 1UM6L 4NRZA 2M2DA 3N1FC 3S36L 2IBGA 2EIDA 5DHVB 5CEZD 5L2JB 2PYEA 4Y89A 2ADIB 4HUUB 4F37K 4ZFFA 1DSFL 2HA1A 4FQQA 4HIIB 1T04B 2VXQL 3UXFA 1MREL 5HYJB 5ANMA 2JJVA 3G04A 5L9DH 4HMDA 1TIUA 5SWQB 4UTBL 2A38A 1CICC 3FB5A 4I0PC 1XGTB 4L1DA 3MRKB 2FX8L 3CSYB 4QYOA 3HMXA 2Z31C 4CADA 4CU8A 1FP5A 5T1LD 5D2NA 5SWSB 1UFUA 1A6VL 3E0GA 5KVFH 2R29L 1KFAH 1EO7A 1NJ9B 1QFPA 1DBKL 3R06A 2X89D 4L9LB 1YYLH 1VFMA 1HINL 1WTLA 5DK3A 5K9OB 3P11L 4XGZA 3WJLA 3JVGC 1TJHL 1BZQK 3P77A 1QFWI 4NQXA 4P9ML 4A2MA 1JPGA 1CFBA 3DX7B 2DQFA 4IHOB 5DQ9A 5F9OH 3MMEB 4Y2DC 1KXVC 1JTPA 4FHBD 4KHTH 5HXMA 3BGMA 3C8DA 5DD5H 2NW3A 2NY6D 3MRLB 3UJJH 4DKEH 1P7KB 4JY5H 4HZLA 1CE6A 1I7ZA 3QQ3A 2GAZA 4LCIH 4Y4KD 4BA8A 4JN2A 3FQTA 4WDIB 4CDHA 5J9PB 1T22A 1P69B 3EO9L 5ID0B 4OFPA 2H41A 2VLKE 2AK4B 4KKLD 5DO2C 1JGUH 4F2MA 4I0PA 4S1SL 3QXUA 4L8DB 3E1F1 4JPWH 5I8OH 3AVEA 1HH9B 3UC0L 3KJ4B 1JYXA 4UOJA 1A0QH 1HSAA 3F5WA 3MRHB 1MPAH 4V1DB 4F7EB 1I1AB 1ZK9A 4I2XB 3TT3H 2Z92B 5CJQH 1RUQH 4FFZL 2H3NB 3VXMA 3IDGA 3WFDH 2IH1B 5JZ7D 3O2WL 2E7LC 3AS2A 1NL0H 5IMLB 3KDMB 3VGAB 3LRHA 1NLDL 5M94B 3PWJB 4QTHA 5FM5M 4Z5RA 4M00A 2B1HL 2DKUA 5EPMB 1ORSA 3LMJL 5CKGA 4ACPA 3E8UH 2BSRA 4Y2DA 4P2OD 4X6BB 3QDGE 1J5OH 4O51A 5E1AA 3I6LD 4ZSOA 4OZIE 3MOAH 3ZTNH 3U7YL 5DI8B 4GRWE 1EDQA 2ENYA 4XMKL 4P46A 4L9LC 1ADQA 5DK0A 1K6QL 1KT2A 2XOTA 1D5IL 5CEXA 2VLJA 4QHNA 4J1UA 4AG4L 3ZZ1A 3W5MA 4P2QE 5FUCC 5AYQA 4APQB 1DLHB 4MJIA 3NPZB 2R4RL 3RX8A 3AAZA 3DSFL 1JRHI 2PTTA 4L8CB 2IGFL 3ARGB 4GRLB 1J0JA 3AY4C 4P5MA 4F9LC 1CG9A 4GQ9L 4QRPB 4Z7VB 4WNQA 5C3LD 4Z76B 4GBXB 3UJTH 1ZLSH 5IM7A 4H25A 1BJ1H 4JB9L 3E3QE 3DETC 4YDJB 3G6DH 1L0XA 4M1GH 5L2JA 4PJBB 1TQCB 4HUUA 4OQTL 1D9KC 2E7LA 5C0CB 2IMMA 4HIIA 2JIXD 3BMVA 3QFJD 2V7NB 2FD6H 5HYJA 5E2TH 1GL4B 4MMZC 5SWQA 2CLRA 3BH8B 4PGDB 5L2KD 4EI6B 3LZFH 3T0BA 1L4IA 1XGTA 4HKXB 3DHMA 5HYIA 3MRKA 5FB8B 2P8LB 1ZT1B 4X80L 2PKDA 1VGEH 4U1KB 5CZXC 3CSYA 2AJYL 4O5LL 4QWWD 3KJ4C 2FX9H 4HT1L 4JRYE 2NPLX 1NJ9A 1I1AC 4GMSL 4GFTB 3TO4B 4L9LA 3QRFM 1AD0B 1KJVA 1QSFD 4DK3A 5K9OA 3QUKB 3HFMH 2ZKHH 3SKUD 3IYLW 1MJ8L 4Q58C 4YHOH 5DMGC 1S7TB 3VGAC 2NX5E 3V8CA 2WM0A 4NM8H 1JHTB 3AY4A 5D7LE 4F9LA 1Q0YH 2WIIA 3DX7A 3P4MB 4IHOA 4OIBA 3MMEA 1BLNA 3PGFL 4OTXL 1QYGH 2ADFL 2H26B 1J10A 2VITB 1JFQL 1N26A 3Q1SL 4YHYC 4PJHE 1OP5H 4KXZI 5I1IH 4LLYB 2OR9L 4N8VB 4PB9L 2OXGA 1P7KA 1S7QB 4UAOC 2DMKA 5KW9H 3GM8A 4X6DF 5LXGL 4K2UH 5FUOL 4FQXB 4WDIA 3KPRE 5J9PA 3KR3H 5ID0A 2VDKL 4APQC 2AK4A 5GRZA 4MHHG 5JW4M 4BQ6A 4O2EB 5EU4A 3ARGC 1E4XI 2DTML 1HH9A 3EJJX 2VR4A 3FQRB 4GBXC 1C12B 3MRHA 4YDIL 3L1OL 4V1DA 1I1AA 1OP3K 4F7EA 4I2XA 4XPAH 2Z92A 3OJVC 1AQDB 4QNPE 2GCYB 1LQVA 1RUKH 5KANI 2H3NA 2ZOKB 1VEOA 1JZ8A 1OGAB 4PB0H 1IFHH 5IMLA 4R0LB 1CXIA 4YHKH 3IRZA 3PWJA 2QSTA 5EPMA 3QDMA 4RDQF 3BMWA 1X9QA 3IDXL 4X6BA 1OTUD 1U92B 1YEEH 1ZS8B 2XRAH 1AXSA 3Q5TA 4XNXL 5DI8A 3DO3A 4L3EE 3EDDA 4YWGH 4N5EA 1IM9D 1JHKH 1ZWIB 2VISB 1NDMB 5F7EH 1J8HD 2HLFC 3KGRA 2NNAB 1CTNA 4G59A 4PJCB 5B3JF 1G6RH 3TESA 2CSPA 4RMVA 2BSTB 4APQA 1DLHA 4LSQL 2BOCA 3GKZA 4KTDL 1LWRA 3RUGF 3TCXA 4L8CA 4YBQC 3DLQR 3ARGA 4GRLA 2EE9A 3X3GH 4DW2H 1NH6A 4JKWA 1GHFH 3CU7A 5GRUH 4PREB 4QRPA 2YPLE 2YD1A 3FMGL 2CGRH 4I5BA 4RAHA 5GJSH 4Z7VA 4Z76A 4GBXA 3OKKB 1I9RL 4L4TE 1HZHH 1IM3A 4G9DB 3ARPA 4P5KB 4R8WL 4YDJA 5GGQL 4CVZB 4PJBA 1G7LB 5C0CA 3F62A 4G3YL 2V7NA 1BZ7B 5T3XE 5EU7E 1CDJA 4CVUA 4FQXC 1JWMB 1KOAA 1A6UL 4K3GA 4LCWE 4U6VH 1UEMA 1WCBB 3BH8A 4JM4H 2J4WH 4PGDA 4WY7L 2IH3B 4D3CL 2CDFB 4EI6A 2A73B 4PJ5D 1QHOA 2VXSL 3D48R 3LEYH 5FB8A 2P8LA 3IJSB 1ZT1A 3MA7B 4R4BB 1TCMA 4U1KA 3IU3B 1RJYB 1ZA3B 5FKPB 1JZ2A 1NCBH 5D6DC 5DK2B 3GMPB 4ZPVB 2ZCKH 5CGYC 4G6MH 1GOHA 1WFOA 3VDCA 1XGYL 1AD0A 1UWEH 4LMQI 1QA9B 1AI1H 5JUEL 4P2CG 4LP4A 3QUKA 1UH4A 1S7TA 1VKXB 3FRUA 3GMLB 3WLBB 3VWJD 3QEHB 5FOJA 1IGIH 1L7IH 3SKOB 2FATL 5GRJL 5HHOB 2QLVB 4JFFD 2H26A 3FCTB 4F37F 2VITA 4OF7A 4Q6IC 4XPBH 3OJ2C 4MQSB 1IQDA 4LLYA 4JFHE 2QHRL 1F90L 1QSED 4N8VA 1NUFA 1I7RA 5ADPL 2RJMA 3BI9X 4M7JH 5T3ZH 4AK1A 4OFIA 2BY3A 1IEBB 3QUMB 5DQJB 4M48L 4FQXA 1NGXB 2OR7A 4G8FB 1IC5L 2X5PA 3UZEA 4GAGH 4NHUB 5B3NA 4KI5D 3MACH 3QXTA 4MSWB 4O2EA 2ID5A 3W82A 3MBXL 1CFVH 4NKIL 5C6WH 5D6DA 3FQRA 2AV1B 3OB0H 1QFUH 3FHQA 2GCYA 3MJ6A 1MJ7L 4KZEH 4YX2L 3HAEB 2ZOKA 3HMXL 5D6CB 5D1QD 4S2SB 1OGAA 2MHAB 4PRHB 3B4NA 3GBNL 2OR8A 1OTSD 4OCMC 2AI0L 4LIQL 5IQ9B 3DMMC 3C5ZB 1AKJD 4LAQH 5H35A 5B4MD 4U3CA 3QPXH 3PNWB 1U92A 1HHGB 1ZS8A 5AAWA 1F8TL 1XZ0B 3BQUB 3WYRA 3WBDA 3MV11 1ZWIA 3MX0A 5SX4H 1NDMA 1WV7T 3O45A 2X1WL 5J1TC 4ZQKB 3LRGA 2WUBL 3VGDA 2P1YA 2NNAA 4PJCA 4Y1AE 2ICCA 4IOFC 3HR6A 2BSTA 5HY9B 2QADD 1NAMB 4K7PX 2DI9A 5HD8C 3ARFB 3CX5K 3TO2B 5E94B 2HRPL 2EKJA 5HVWA 4PREA 1OL0A 4XAWL 1BEYH 3OKKA 4HF5L 4TPRL 1T7ZA 5H8DA 5DZNA 5HGGS 4G9DA 4IM8A 3O6KL 4NQDD 4P5KA 2J88H 3ARBB 4P3WA 1A6WL 4NZJA 1YEHL 2EC8A 5IV2B 1G7LA 4HMCA 1CLOH 4M7KH 1PX4A 3IJHB 2BZDA 1ZGLM 3HE7D 1BZ7A 2OZ4H 4N0YL 4PJDE 1JWMA 3TIEB 2PYED 1VCAA 3DMMA 2IH3A 3OG6B 2CDFA 2YXMA 2A73A 5SWSE 2EKSB 1XCQA 2AJSL 4M6NL 4LHUG 3MA7A 1T21B 1I3RA 4R4BA 4AEHH 3IU3A 1RJYA 1FNHA 1EBPA 5FCUH 1ZA3A 1JNLH 4OCNC 5FKPA 5DK2A 1ZTXH 4GG8B 5FGBC 4ZPVA 5C0RH 3VRJA 2PNDA 3FRPA 4WUKL 1QA9A 3UTPE 5I1GL 3V6FB 4I77H 2GTZB 4IS6B 2E8YA 2FO4A 3MYZA 1VKXA 2OJEB 1ADQL 3GMLA 1AIFB 3MRQB 2Z8VC 3QEHA 1TZIB 1NGYB 3SKOA 2F19L 3QI9B 4GQPH 1CLZL 3CVHB 1FBIL 5HHOA 3FRPG 2DOCA 2QSCL 2ICWA 3SHSA 1RMFH 4GG6E 4Q97A 1B88A 2HT2C 5IBUG 3MREA 3P30L 1G9ML 5GZNC 1A64A 1NGWB 3L95B 3BQUC 1A6PA 5BJTB 2OL3H 3LKQB 3C60B 4DAGL 1OPGH 4HCRH 3WIFB 1JF6A 5I8KH 5IW3A 3S88L 1IEBA 3QUMA 3X13A 1YQVH 5DQJA 1NGXA 1KIRB 4WW2F 2VZ3A 4G8FA 4JHBA 2ILLA 3RWIB 4HUVB 3QUXD 1INDL 4N9OB 4NHUA 1OARH 1UQSB 1BBDL 4MSWA 3WS6A 2W60B 4PJ7E 3HC0B 4WFEE 2X09A 4BZYA 1CICD 5EU6D 4GRMB 5HVFB 2AV1A 3QAZB 4LBEB 4J3WA 3AREC 3PE9A 2Z31D 3ARBC 2DMCA 2RCSL 1ZLWK 3HAEA 3Q5YA 4HLJA 1JVKA 4KJQD 2MHAA 4KI1A 4S2SA 4XPFH 4PRHA 3DYPA 1SEQH 3QNYB 1MAKA 4XPHL 3CH1B 4PD4K 4HAFA 4NKOB 3QDHA 5JHDE 1CGSH 3C5ZA 4UNVA 3BUYB 2X1XR 5DC0A 1FC1A 5MEQB 2NY4B 4KJWC 3TBWB 1AH1A 5J89A 3DECA 2QSQA 3PNWA 1BJ1J 4N8CH 3HAEG 4B7IA 4PJXF 4X9GA 2OX5A 5E6ZA 1XZ0A 3BQUA 4XBPB 3BZ4B 4KK6D 4F57L 4BYHA 4QEGA 1NSNL 4J6RL 2KQNA 5IROC 4WI2A 4ONFH 4ZQKA 3G6JE 2HKHL 3TPUB 2DKMA 4PG2C 3QDJD 4QRPE 3P9MB 3HMWL 5HY9A 1J1OH 3LD8C 1NAMA 1NDGB 4JKLA 5HHQB 3BUTA 3TO2A 5E94A 3EBAA 1CYGA 2X4TB 5A3ID 1MFDH 3RY4A 5DO2D 5IOPB 1LO2H 3QI9C 3GO1L 2B2XL 1LHZA 5C0CE 5BVJB 5GS0H 5GSRB 4KKAD 1MUJB 2YD9A 3WUZA 3VG0L 3ARBA 3P0YH 4JDVB 4IOIB 5BV7B 3CFDB 2CRYA 5IV2A 4D9QE 2GIYA 3IJHA 1C1EL 5IB1B 1F4XL 3EYVB 1I9IH 2DRUA 5KVGL 3G5XB 3TIEA 1I3UA 5TFSH 4JFQB 5F1KC 2BY0A 1M7DB 3TZVB 1JMZA 5FO8B 1HSBB 4JN1L 3L3GB 2NTSP 1HH6B 1T21A 3DRQB 1JYWA 3K2UH 3ORJA 3U0TB 3BESR 3PWUB 4GT7A 4X99B 1J0IA 4GG8A 3KLAB 5C07B 1IAKB 3QAZC 1A7NH 1UEYA 4CKVX 1HQRB 4PYGA 3CX5J 3QCTH 1A47A 3KYKH 4RBPH 4V2CB 4XCCH 4PG2A 2GTZA 4IS6A 5C0DA 4O02L 1CD9B 3BO8B 3PWPB 2IC2A 2OJEA 3QIUD 2NR6C 3FB6B 1MY5A 1AIFA 1FYHB 5EZOL 3U0WL 3MRQA 2DN7A 4NZTL 1TZIA 1W8OA 3QI9A 1UKQA 1RZJH 3GMRB 5E0QA 2PR4H 2VC2L 4H20H 4P2RB 1NGWA 3L95A 2Z8SA 5DJ6B 1JZ4A 5BJTA 3O0RL 3LKQA 4J3XA 4OGXL 3WIFA 2YD4A 3C08L 3DETD 1OAKL 3UAJD 3MBED 1KIRA 1OSPH 1D9KD 4LLQB 2C3WA 3RWIA 4HUVA 3KHQA 3ETBF 12E8L 4K3EL 4XHJC 4NWTL 1GPOL 2W60A 1EZVX 3HC0A 2NY5H 3MLRH 4DQOL 4LBEA 2VERN 1OGAE 5FYKD 2ZWLT 5T5NG 1B90A 4RSVA 3QNZB 4I3GA 1D5XB 1IGFL 1D7FA 4UNUA 4HFUL 4OLYH 1P84K 3FB7A 1CDCA 3PP3K 3BWAB 4PGEB 3QNYA 3D9AH 1MCOL 3CH1A 2UWEB 2XN9B 5BS0D 4NKOA 1NCWH 2W9DL 5EC2B 5C0IB 1IARB 5C6PB 3TZVC 4JR9L 1PZUB 3BUYA 1BP3B 2W59A 1S9KC 3QQ9D 1L9MA 5MEQA 5INDB 3TBWA 4JE4B 2KH2B 3GBLA 3B43A 4MLIA 2R1WA 5TQ2H 4WWID 1H5BB 1EZVY 1ORQB 1BX2A 1ZSDB 3QDMD 4YR6B 1TVHB 5DD0L 1IAIM 4JFZH 3DVFA 4XBPA 5IBLC 1UB6B 3X3FH 1HHJB 3ET9F 4XCFH 1DE4B 4ZD3H 1DBAH 4GMTL 4FOMA 1C5CH 3TPUA 4QRSB 4XAKE 4Z9KB 3P9MA 5FKAB 3G08B 1ACYH 3KLSA 1NDGA 5HHQA 1N6VA 3MPCA 1NBVH 1BBJB 4BUHA 4NGHH 2OXHA 2VDLH 1KULA 3MUHL 5CSBA 3CCHB 2V9QA 4AEIH 5BVJA 4RMUA 4X9FA 1WWAX 1MUJA 5HHXH 5D5MB 4JDVA 3U9PL 5L8JB 4IOIA 1BQLH 2DD8L 4HG4J 2XIDA 4JO2H 2FBOJ 4DN3H 3GJFB 5IG7B 1WAAE 3M8OL 1AE6H 3EYVA 4F7PB 3G5XA 5TQ0H 4JFQA 3VFRB 1M7DA 2W07A 3TZVA 3QXWA 1HSBA 5AYUH 2O5YL 4WFHD 4JZJC 3L3GA 1WJ3A 3O2DL 4FA8A 1OM3H 1HH6A 2LFGA 1DBJH 3DRQA 3U0TA 3PWUA 4X99A 4KK8C 5ICYB 3KLAA 5C07A 1MCFA 1IAKA 1MF2L 2CUIA 5GGRY 3OXSB 1IT9H 4BZ2L 4C54A 4ISVB 1HQRA 3HG1B 5EZIH 4PBWD 4M1CC 3FO2B 2G75B 4UI2A 2Q87A 4J2XA 2NY0D 2BY1A 4FQ2L 5TE7L 3SN6N 2HLFD 2AJUH 3BO8A 3PWPA 4KK5D 4NC1E 1VPOH 3FB6A 4BK5A 4GO6B 2DQEH 5E9DB 2V2WB 2MFNA 4Z7QF 4D9LL 2J8UF 5DMKB 4XMLL 1KN2H 4PUBH 3GMRA 4OFVA 3UTTB 3P0VL 3N9GH 4WFGD 1H5BC 1LK3L 3WFBH 1O0VA 4QXGL 4V3EB 4P2RA 2VLLB 5DJ6A 1OD7A 4GSDL 5HSFA 5AG9A 4JQXC 4Y19A 4HWNA 4ZO6A 1CLCA 4G8EB 5IB2B 1LO4L 5T1DL 1FFOB 1ERNA 3V8OA 2DLGA 4LLQA 3KXFB 1I1YB 5DLMH 3S4SB 3VXPA 2PETA 4JZJA 2X1PA 3H2WA 4OT1H 4AIXA 2BERA 3LV3B 1U36A 5I73C 1T1YB 1CGVA 2XQYK 1KCSL 3FOLB 5BO1L 4ZAKB 5I9QB 2VNCA 1ZKAA 4EQ3A 3TT1L 4Z6AT 5CGYD 1D5XA 5C70A 2UUDH 2ZUUA 3MLUL 4ODUA 3A67L 4R7DA 2D2OA 4PJ9C 3BWAA 4PGEA 4XMPL 1B2WL 2OJZH 4G8GB 2AQ2A 1P7QD 4UDUB 4G5ZH 5EC2A 2D4FA 3EJYC 1B6UA 5K33A 3HI5L 5INDA 2SEBB 3GSXB 5C3TA 2XFXB 5D72H 1MJUL 2EXYD 3NAAH 3MRNB 4KROB 3ZDXF 3QA3B 1H5BA 2RFXB 1CD1A 1QKZL 2V5YA 1ORQA 5E2UH 3LKOB 4UT9L 5F6IB 1UB6A 2LTQB 4FN0A 4LCCC 1DE4A 1HEZB 2DDQL 2YXFA 4YXLL 1X5HA 4QRSA 5DD1H 3AMLA 4ZOBA 3V9FA 3I6LE 1NCTA 5FKAA 3G08A 4OLWL 4U1SB 3DRTB 1NFDF 4M61A 5B39B 4Y0GA 2X2YA 3QUML 2DL9A 2ZNXA 1BBJA 2FH6A 3PWNB 4WVRA 5DEGB 1CLYH 5A2IH 1P84J 1DUYB 3CCHA 3NFPA 4JO3H 1U3ZA 4NQED 1MIEL 3IAGC 5ADOH 3DO7B 2XKSA 3DJ9A 5D5MA 3V4PH 2JB5H 3O3AB 3NN8B 4EDXB 5J13B 3GJFA 5IG7A 1J7VR 1DUZA 2BOBB 4OIAA 2JJSC 2XI9A 4F7PA 2A77H 4LEXL 3VGFA 2IANB 5KTEL 3VFRA 1U8IB 2VDPL 3B5TA 3NCCB 5IHLB 3ERYA 2VQ1A 3TYFB 3DMMD 3P4LA 3BP5B 1EMTH 4NIKB 2L7UA 5KS9E 5ICYA 4NHCH 1MCKA 4DEPB 4DFIA 3WKNA 4FQLH 1S5IH 5ELIA 4ZAKC 4LCCA 5L2KE 4ISVA 3HG1A 1J1PL 3WNNA 2VUYA 4OF8A 3FO2A 2G75A 3O6LL 4N0CC 5C0GB 1YEJL 2UZYB 3BKYH 4S1QL 4PJIF 5IHUL 3HHRB 1TITA 4N0UA 1MCJA 5IP4A 3GNMH 5DC9B 3T0ED 2CDEB 1QSFE 2YD5A 2V2WA 1M7IB 2B20A 5DMKA 1H9VA 2VDNH 5GGTA 5IHBA 2OYPA 3UTTA 4U1LB 3UTOA 1NAML 3KJ6H 3QHTC 1KCVH 1QLRB 4Q9QH 4ZNEA 1MEXH 1N6QL 2VLLA 2HVKB 4XVJH 1QBLH 1Q8MA 5EN2B 5FHBL 4G8EA 4NUGL 2JJSA 6FABH 1KIQB 4U05A 1P4BL 4JJ5A 1RUAL 3KXFA 1MPAL 1R5VB 3JZ7A 4HPOL 4EIZC 5IIEB 1JGLH 1I1YA 4U7SA 1KCUH 4LU5L 3S4SA 4NWUL 4Z8FH 1FVDB 3QHZL 5DYOB 3WMSA 5J7CC 1BGXH 3LV3A 3TN0C 4ODVH 1AD9B 4ZODA 1T1YA 2XA3A 3FOLA 4ESKA 3LS5L 4ZAKA 2D7PA 3NIFF 2KKQA 3WD5L 4YXHH 1WEJH 4N0CA 1F3DH 1VDGA 4N9GB 5TPWL 3MJGX 3IKCA 3S4SG 4CW1B 2UVEA 1B0WA 5J11C 3QG7L 4Y88A 2LE9A 3RKPA 4G8GA 3MOAL 3IKKA 4UDUA 4JZOB 3SBWC 1NGPL 3D3VB 1L7TL 3ZKMC 1T1XB 1UKTA 3G6AB 5CLWA 4YDLB 5HDBE 4C56D 1G1YA 4MHHI 4KTEL 2XFXA 5AWNH 4PFEA 2I5YL 3NCFB 2RFXA 4UUJB 3GSWB 3LKOA 5F7FA 5DJYB 3ZE2E 1CGYA 2F53B 4HW6A 1KUMA 5LJYH 3CVHL 2HT2D 1HEZA 4XX1G 2VE6B 2OL3A 4PBXA 4ERSL 4M6OL 2Y23A 3V5KB 1I3VA 3DRTA 4N0FB 5CFHA 4Y5XB 1MIMH 4RGNB 3T09A 4DGYH 2HLAB 3JV5A 3F12B 1NMBH 2VYRE 5GGRB 3TN0A 3PWNA 5T33L 2ZJSH 1CE1H 2D7QA 5DEGA 5IVXE 1GSMA 4N90E 3MXVH 1DTUA 4WEUD 4HIJB 4JVUA 4XZUB 1RUML 5JIKA 1DVFC 1DBBL 5IMMA 3DO7A 4JZNB 2YD2A 5BQ7B 1NEZB 2YEZB 5GS0C 3NN8A 2ZUVA 5B39G 4EDXA 3UBXB 3Q2CA 3ARED 4XC1H 5E7FA 2Q8AL 2BOBA 2BXYA 4WW1A 1Q1JL 1GH7A 1U8IA 3GDBA 4FTVB 1A7RH 5LWYH 1IMHC 3VXSD 3T77A 5D7IE 1A6ZB 3D1MC 3TYFA 3HFML 2E7CA 2NY2B 5TE6H 4UBDD 2YD7A 3BP5A 4J12A 4QGTA 4NO5B 4XP5H 4KJWD 1MFEH 1C5BH 3CPLB 4X5WB 2J2ZA 4WU7B 5AEAA 3I3BA 4POZC 4YLQT 5JXEC 4PJ5E 5C0GA 2ZCHL 2VR5A 4R2GC 3S97C 1IGTB 1HKFA 5CUSL 3BXNB 2X4NA 2XZCH 4TOYH 1LO0L 4N8PA 5SWZB 1K3IA 5I76B 1QFWH 1IZKA 3D6GA 2CDEA 2GK2A 1M7IA 3J7HA 3DYOA 1OQXA 3AC0A 1OCWH 4L9DA 2Y4SA 3QEGL 5AZ2L 5JW3H 4PRDB 4U1LA 2BMKB 1QLRA 3MYJB 3ECBB 4WTXA 3CK0L 2HVKA 5CJOL 1UWXH 2A9NH 4PRID 3VD9A 1NAKH 5F9JB 1KIQA 4G6FD 4JFFE 5L6YL 4U1IB 3PWVB 5KSAB 1R5VA 5IIEA 1UCBH 5FYJH 1T1WB 2FHBA 1CU4L 1QSEE 5BV7L 4Y5XC 1P6FA 1P4LA 3H9HB 1FVDA 1MI5B 2HFFB 3EYSH 3PDOB 4RGNC 5I1JH 5DYOA 3IVKB 4CMHC 4DJMA 1AXTH 1AD9A 1UZ6F 3TBYB 3RA7H 4OB5H 4FXGB 3UYRL 2IFFH 1NCDL 5JXEA 5J1AB 2UWEE 2XN9E 4JGMA 3DGGB 2Q8BH 3VXUB 5ID1A 4N9GA 3ULUH 4CW1A 2XWJB 1RZIB 3OKMB 2OMNA 1EPFA 3FO0H 4WI5A 1MCWM 3QRGL 3QUYB 2P5EB 4JZOA 4YWGL 2WLYA 3CDCA 3D3VA 1JHKL 4RDQG 1A9EB 3BT2L 1XGRB 1T1XA 3P40A 3G6AA 1NEUA 5TDOB 3WFCH 3DV6B 4OM0H 5ISZB 1XGQA 3OAUH 3Q48A 4IBLT 4UUJA 3GSWA 2ORBH 3CLEH 5DJYA 2F53A 3O8XB 4GAJH 2QQLH 1J0YA 1FNFA 5EZJB 1T6VN 2VE6A 4CVWA 3GHBL 3VWKC 1S9XB 3MRMB 2GITB 1O5DT 3FJTA 4LEOA 5D71H 4LOUC 3V5KA 2WY3A 3IDMA 4EJ1C 4UIKH 3WEXB 3VW3H 4N0FA 4Y5XA 3Q6GH 1JRHH 4G7VL 3VXTA 2E9BA 2HLAA 3F12A 4OZGE 2CXGA 3EJZD 5GGRA 3WCYA 4XHJD 1TXKA 4F58L 1RZKH 4HIJA 4XZUA 2DQIL 4DGVL 1EHAA 4JZNA 2ZG2A 5BQ7A 1CN4A 2YEZA 3KLHD 3BN9D 3UBXA 3RL1B 4PRAB 3D5OF 2P24B 4HKJB 5I71C 1V7NL 4ZMAT 5TH2B 1I1CA 2V17H 3FT4B 2AEQL 2LVEA 4K8RH 4OM1L 4M6AA 4P0DA 2FEDD 5KSAC 4NQDE 4FTVA 4WHYG 5DGRA 1UWGL 1T5XA 1A6ZA 4UDTA 4R26L 3TWCH 3HG1E 4E41D 4R4FL 1NEZG 3ARSA 4NO5A 3UBXG 1NBYB 1SM3L 2KZ1B 3VMOA 3CPLA 4X5WA 4L5FH 4LHQB 4Q2ZB 4CU7A 4QRRD 1A7PH 1EFQA 1NUNB 4WU7A 1A3LL 2I27N 3MLVH 1BPVA 2VXTL 3JXAA 5E5RB 5ILTL 5E9DE 4OKVB 2GW5A 2F54D 1YUHB 3STBA 2WZPD 1IGTA 2R69H 1RZ7H 5DMYA 1IC4H 4OUOA 4XTRD 5F21B 3S3SA 1CFTB 5SWZA 5I76A 3QUYC 2D31A 3O3BB 5E08L 1SHMA 4KMTH 5T3ZL 4ZNEE 4WW2B 4MAUH 2AS5M 3SDYH 3RWFB 1CZ8H 1MY7A 2BMKA 3G5YB 4KXZH 5D4QA 3MYJA 3ECBA 4NCDA 5C2UB 2N7AA 4ALAH 3KXFE 2R0KL 4ZOAA 3O8XC 1XFPA 2CRIA 1J88A 4X6FB 5F9JA 1P1ZA 2OP4L 4J4PC 4U1IA 4Y19D 3PWVA 3SJVB 4KKBC 5KSAA 4H5SB 1T1WA 4IRJB 4TRPL 5I1CH 3H9HA 5BOZG 2HFFA 1MI5A 3PDOA 3CSPA 4KQ4L 1TDQA 3HC3H 3IVKA 1E4XH 4BQ9A 1DQMH 2Y36L 4Z0BH 1DCLA 1X44A 3IAPA 1SBSH 1JFMA 3TBYA 4XVUC 2HVJB 2F5BH 3MV9B 3PDGA 5J1AA 2AV7B 3DGGA 3VXUA 4XVTH 1S7RB 2FBJL 3OPZH 2EC9T 1E6OH 2DBLL 2XWJA 1RZIA 3OKMA 4ODBD 4BFEA 5EU6E 4M1CD 3LSOB 1RJLB 1IKFL 4W6YB 3QUYA 5IFAL 2P5EA 2I24N 4P3CH 1A9EA 1T20B 2OI9C 4FQJH 1XGRA 2B5IC 4HWBL 4YK4C 5TDOA 3DV6A 1BREA 1KENH 4JFXA 5ISZA 4NQVB 1CFQB 2Z35B 1W2KT 3GMNB 1KIUA 4FQ1H 1R3IH 3O8XA 4FFVC 4GRWF 5JA8B 3L6FB 5GGTL 4ZS7H 5I19L 3CFCL 2XZQH 4OFYD 3QIBC 2WAHA 3MRMA 2GITA 4OKDA 5MEND 4J4PA 3RWHB 3WEXA 2B7DT 4G9FB 5E6IB 4PG9B 5IQ7L 2XXCB 5CD5C 4WW2C 5CMAB 3O41B 3SGDH 3QDJE 4E5XB 3IXTB 3IGAB 4NO3B 2D7TH 1I8KB 1FGNH 5HDQH 2CJUH 2IANE 4UV4H 1QSVA 4PRAA 2P24A 4HKJA 3ZE0E 3QCUL 4B0MM 3FT4A 1KLGA 1NCCH 2C4FU 1KCGC 3QIWB 2ESVD 4XRCB 1KTDB 3MLWH 3NACL 4LPVA 4PJ9D 4IRJC 1RV6X 2OI9A 1U42A 4MB4A 4HULB 5FYLL 3RZCB 5CLTA 3EJYD 4WCYL 4C4KT 3DUUB 2UZIL 4RZCA 4YGVB 1NBYA 1S3KL 2CMRH 2W92A 1A6TB 1FE8L 4Q2ZA 1KJ3L 2HP4A 3S34H 3RBSA 5KVDL 3VD4A 1UXSB 2PN5A 3LS4L 3T8XB 4TTDC 5C0NC 3DXAD 4NNXB 2E9JA 4OKVA 2R2BB 1TJGH 1YUHA 1F4AA 1U6AL 2GSIB 2H1PL 4LRIC 3BP7B 2W1NA 1D6VL 5EOTB 3HPJB 1VFBB 3QR2A 3O3BA 5SX5H 1U95B 3PQYD 1QR1B 1OPGL 4H1LB 4ZTPH 4WW2A 2ZPKH 3TC9A 4RWHA 5HHVL 2JB6B 3RWFA 1DLFH 1MELA 2FECL 2OSLB 3JTCA 3G5YA 4PJHF 5FAAA 1XMWA 4OLXL 4LSUH 1F4HA 2GJ6D 1IC1A 4XNYL 1PY9A 1FAIH 1YJDH 1U8OB 4HQQL 3EO1B 2Z4QB 3SJVA 4KHXH 3AXLB 3DARA 4H5SA 5I0ZA 2Y5TB 1KEGH 4IRJA 4G6AD 4OF5A 4TSAH 4YE4L 2MKLC 4IIQB 5DZLA 3VXRD 4Q6YA 4XCYA 5E6IC 5C9JB 2OTWB 1OAQL 2C7UB 1L6ZA 4RWYL 4S0UC 3ARVA 3FQWB 2AJZB 4G6JH 5I1KL 2NY1B 3QO1B 2HVJA 4XCEB 3SE8H 3MV9A 4LNVA 4FZEH 1FH5H 3LKNB 1ES0B 2AV7A 4P9HC 1S7RA 4QNPF 3C6LC 4RMWA 3EYUL 2PO6D 1HXMB 4R3SA 2YUWA 3H3BC 3MFGB 2JJTA 4BKLB 4PBVC 3LSOA 3QWOB 1RJLA 4RAUB 5FYKE 3QYCA 2MPAL 2WBKA 4OGAC 1LE5B 5EA0L 1GIGL 3RZCC 2FB4H 5IVNA 4NQVA 3MCG1 1CFQA 2Z35A 3NFSL 4PV8B 5BS0E 3SDDD 1RURH 3GMNA 1JF5A 1H3PH 4UT6H 3NFNB 4JFEB 3HNVH 3RWHA 3UTSB 3V0VB 2VXUH 5B8CB 3S5LG 1W0VA 1MCCA 1UM6H 2G2RB 5IB4B 3S36H 2AERT 4XP9L 4G9FA 5E6IA 4PG9A 4P59L 3DVIA 3RTQB 1DSFH 4L8SB 2APWA 1BQSA 5CMAA 2VXQH 4AY0A 4E5XA 3IXTA 1MREH 3IGAA 4NO3A 3FT2B 1I8KA 3TN0D 3RWEB 4UTBH 3LQAC 3ELAT 3D39A 1JNNL 1KGCD 5DURB 1A4KB 3C6LA 4OJFL 3RGVC 3DUSB 2FX8H 4WI7A 1UCTA 5IF0B 4H88L 2CLVB 4ZDHB 5F72S 3O4LB 4IRZL 1A6VH 1ZXQA 1KTDA 1DBKH 4QF1B 1ONQB 1HINH 3MLPA 4FFWC 2IPTL 3RZCA 3DUUA 4MS8A 3ZKMD 3P11H 5T1MB 4YGVA 5F7DA 1TJHH 1A6TA 1EX0A 4JG0H 4Z0XB 5CAYB 4RQQB 4WFHE 1UXSA 1CGXA 1C7TA 3MOQA 4P9MH 5IWLA 2BJML 3BE1L 3T8XA 5C0AA 3SKJL 3UPCA 2GSIA 4MD4B 3QP3A 3BP7A 5DR5L 1QPPA 2ERJC 3HPJA 1VFBA 5EB9A 2YS4A 1U95A 1QR1A 4H1LA 5L0QC 4AYFA 1XIWB 1LD9B 5FUZL 3S36X 2JB6A 3CNKA 2WUCL 1KTRL 3SO5A 5GGSB 3D69B 2OSLA 4MVBC 5DDHB 3ZKNC 3F6IA 4ZFOB 2ZZUT 4KZDL 4S1SH 2C4XA 2X40A 3UPAA 1DVFD 1MI5E 1XT5A 2VRAA 4H1LG 3KNBB 1U8OA 5CSZA 3UC0H 3EO1A 5GS0D 1A5FL 1WIUA 1YEGL 2Z4QA 4M93B 5B8CC 1BECA 2NW2B 2Y5TA 1AGBB 3SO3B 1ZLVK 1HKLH 3B9DA 3T3PE 4IIQA 2A6KB 4O2FB 3T0VA 1RJZB 1YMHB 3UPRA 5C9JA 4LSVL 5FEBA 4JG1L 2C7UA 2IALA 3O2VL 1NANI 3FQWA 2AJZA 4EKXA 1IGYA 4XB7A 5DQDL 4XCEA 1NLDH 3MR9B 3KAAA 4KRPB 3LKNA 1ES0A 2B1HH 2COQA 2BSSB 3LMJH 4LQ1A 3V6OE 2H9GB 3MV7B 1HXMA 4POZD 4LLVB 4BKLA 3VGEA 3U0PA 2N56A 3ULUC 2H6PB 3QWOA 4RAUA 4JHZA 4LVOB 4R2GD 3U7YH 3DV4B 4XMKH 3GEWB 1LE5A 4YPJA 1K6QH 1NFDB 1D5IH 4MVBA 3F7QA 1RK1A 4DCQB 2E7HA 2NXZD 4DKDC 4PV8A 1ACYL 3CLFL 1FHGA 3B9KC 2R4RH 2X4SB 3DSFH 1EEZB 2IGFH 2D7OA 4GQ9H 5C0BD 4WFFE 3KS0J 2VDLL 3D87B 4JFEA 5E70A 5B38B 5JTWA 1BF2A 3UTSA 1HE7A 2C26A 3PWLA 1YC8A 5B8CA 1MAML 1QUNA 4E42B 2VDOL 4GUPB 4JB9H 2G2RA 3RNQB 1KC5L 3IDIB 4NNPH 5AZEL 3A0OA 2R0LL 3VMNA 3TNMB 4GKSB 3DGCR 3RTQA 4OQTH 3MRIB 1FJ1B 4GW1B 1XIWC 4FQIL 4L8SA 2CDGA 4KKCD 1WWWX 3FT2A 4X8XA 2D9CA 3RWEA 1RZKC 2MQCA 5DJAB 4JPKL 2W9LA 3O81A 3ULVE 2WV3A 3PXJA 1A4KA 4C58B 3OKOB 4X80H 4JFDB 3WFZA 5IF0A 2AJYH 4IOSD 4O5LH 2CLVA 8FABB 5K59E 4OAWA 3O4LA 4HT1H 4NQEE 4PJDF 3TH4T 1U2CA 3VA6A 4PJFB 1AC0A 4GMSH 4PJIB 4QF1A 4AEEA 1ONQA 4K8RC 3AS3A 4XC3L 4Z7UE 4PR5B 4P4KD 3R4DA 4EXKA 3D2UA 3CSBA 3OMZA 4P99A 3QPQC 2DQHL 2P47B 5T1MA 3HE6B 1MJ8H 2AKRB 2J8UA 3ZDYE 4PGBB 4Z0XA 5JLZB 4Z18A 4RQQA 1X5IA 3BPLB 1Q94B 5F93C 5JHLL 2XZAL 3R0NA 4GRWH 4MD4A 3PGFH 4F15B 2ADFH 1N5YL 4LLMB 1KCKA 1JFQH 3Q1SH 3VWKD 4JPVL 2LVCA 3GKWL 3W0WA 1RUPL 2OR9H 4LVOC 5DVLA 4NKDB 5J6HB 4EN3D 4LOUD 4X4ME 1S5HB 1XIWA 1LD9A 2WWKT 3U6RB 3OF6A 2AEWA 5GGSA 1JP5A 1G7MB 1T80A 3D69A 4IMKA 5LXGH 5FUOH 5DUML 3ARUA 5D7JC