1YNKH

Identification of key residues of the nc6.8 fab antibody fragment binding to synthetic sweeteners: crystal structure of nc6.8 co-crystalized with high potency sweetener compound sc45647
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
219
structure length
219
Chain Sequence
RVQLLESGAELMKPGASVQISCKATGYTFSEYWIEWVKERPGHGLEWIGEILPGSGRTNYREKFKGKATFTADTSSNTAYMQLSSLTSEDSAVYYCTRGYSSMDYWGQGTSVTVSAAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPSGPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords immunoglobulin kappa light chain
publication title Cocrystal Structures of NC6.8 Fab Identify Key Interactions for High Potency Sweetener Recognition: Implications for the Design of Synthetic Sweeteners
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 40
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2005-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ynkH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ynkH02
1CDUA 4DGVH 3ARDD 1JPGB 4EN3B 2IQAB 5J13B 4BA8A 2VLRB 4QRTB 4G80A 3MRMA 3SO3C 4XWGL 3BP6A 2NXZB 5HDOA 1F58H 1FGNH 1XF4B 3N1QC 3OAYK 4NIKB 5TJWK 3SPVA 3B2UD 3L3OA 4L3AA 2QTEA 4TYUA 1T2QH 1FZOA 2A1WL 2DWEA 4UDUA 4NQDE 3UAJC 1RMFL 3I02A 3SKUD 2FATL 4YQXH 5FGCE 4UQ2A 3ARUA 3GSNH 2HKFH 4Y4HD 1IVLA 2AJVH 4YHKH 3S36L 3ZYOA 1ZEAH 4MXWH 3DRQA 4QT5B 5EU6A 1LO2L 4M3JA 2BVTA 4M93B 1MI5A 4ONHA 4F57L 2BP3A 2RHEA 3L7FB 4KPHH 2FO4A 2OL3A 3QFDB 4HBCL 1F6FB 4ZTOH 4E41A 4HK3N 1KPUA 1BZ7A 1JBJA 3SDAC 3QXAA 1QHOA 3PABB 1ZT4B 5D1ZC 5GS2D 1UH3A 4PJFA 5IGXL 1UB5B 1S9XA 4NO3A 3SGEI 3HRPA 3DGGB 3GSVA 4Y2DD 1HWGB 1R6VA 5HDQH 1JWMB 3JBG7 2IBBA 5I1IH 3RU8H 5HHXH 4UNUA 3DV4A 4C59B 4D9RD 4D9LL 5SX4H 2OL3L 5I1EL 5ABDE 2DLIA 3FT3B 4P5TD 4YLQT 3OMZA 1EIBA 2ERJC 5J6GB 1IC7H 5GGRY 1FFRA 1CGYA 1JTPA 4UB0H 1DBAL 1Q0YH 3RIFF 3IDIA 4IDJL 3SBWA 1YPZE 4IRJB 1ZK9A 1DQLL 1UH2A 3LN4A 4LSRH 1BQHB 1T66D 3GSNB 1NCNA 3GZKA 5I6XB 2A77L 5KVEH 4XNXH 1F4AA 1HHIA 3VFNA 1X5ZA 3X11B 4LNVA 5GRJH 4Q9BA 1EEZB 4O9HL 5LCVH 4JFHD 1IMHC 2FIKA 2XTJB 2UY6A 1RIUH 4MMXC 5F7KC 1NFIA 5F70A 4WU7B 1S78C 5SWQB 3E3QE 2FH6A 2ZUYA 2AJUH 2B20A 4OT1L 5D7KD 3EDEA 4ZFZB 3DURA 1JMXA 4Y4HA 5HBBA 4PY7A 3L5WA 1NGZA 4MA1B 1KEMH 4E0RB 4PJIE 4X6CF 3LKQB 5DWUH 4ELME 3LKNB 3WN5A 2FSEB 4UTBH 2YPVL 3VMOA 2ZUUA 1R3KB 3C5JA 3IFLL 1ZVYA 3IDYC 3GMNA 5EA0L 1U8OA 1SMOA 4E42A 2C26A 4LGRB 1CI5A 1CFNB 4XC1L 3UTOA 3PHSA 4N1EA 1OW0A 3AAZA 1R0AL 2XNAA 4G6JH 2NY7L 4G6FB 4EI6A 1DANU 4GOSA 4QWWC 4L3EB 2A1WH 3MRBA 5DC4B 3DETD 4ODHL 1CGWA 2VXVH 2QEJA 2VJXA 2P8LB 1PG7H 5I8CB 1MRDL 3MUGA 4YHIB 4Z7WE 1ZGLB 1FORL 1FNLA 3NZHL 2P44B 3ES6B 1WBYA 4UOW1 2J4WH 4WV1B 1CLYL 4M1CD 1TZGH 2NW2B 4MGXA 1LO2H 5IROA 1TZHB 5HY9B 2CJUL 4K3JL 3SDXE 4EI5C 3FQRB 4MD0B 4UAOB 4F57H 3FMGL 5JA8B 3AB0B 3M17B 5MI0C 4Y4KB 1MFEL 4P5TA 3I75B 4R3SB 3VRJA 4DKDC 4HBCH 3MXVL 4PYHA 2R23B 3EFDL 4DEPB 2VABB 3UXFA 1LEGA 3ZDXE 1A6VL 5DGRA 3BQUD 4PRPD 1KV3A 2UYLB 4JDZA 4G8GD 4JANB 3IU3A 2Z93B 3DV6A 4XGZB 1DQJA 4EVNA 2WBWB 5E5UB 5IGXH 4NN6C 3MRJA 1PYWA 2EDHA 2D4FA 4ZQKB 2G5RA 4NWUL 3QRGL 4E5XA 3WIHH 2ICEB 3GSOB 5B3JF 2KL6A 3T1FA 3O45A 4LLQA 4KDVA 1FN4A 3E6FA 3TVMD 2D7OA 1LO3L 3T77B 2E7HA 3O3EA 1AQKL 1HZHH 1N5YL 3HA0A 1D5IL 1AGFB 1A3RH 2CDGB 2OL3H 5I1EH 5BZDB 2WINA 3V4VH 3QXUA 2HTLD 3D69A 4I4WB 5JZ7D 2JJVA 4OKVA 5HI3D 3HUJA 4PJGB 1J1XL 2V9QA 3DX9B 4PG9A 3BXNB 3O81A 1ZWIB 3NCJH 4IDJH 3V8OA 1DQLH 1A0QL 1UZ8A 1NMAH 4K7FA 3HZYB 5HSFA 3OKOB 1KXQE 3QR2A 4LHJB 1IGYB 4WI8A 4F3FA 1YEJL 2A77H 4FN0A 2AK4E 3OKMA 5IMLB 4O9HH 1OP3K 4K7PY 4ZTPL 3RVTC 4GG6A 4UINL 2Z91B 2EECA 1JGVL 4LCIL 5EB9A 2ESVA 3J7HA 1T03L 1JK8A 5I8EB 1LD9A 2VUOA 5ESQA 4G80B 3T2OA 3MRMB 4OT1H 3BP6B 4H88L 1T89C 1YA5A 3RVVD 4CADA 3SPVB 4XBEL 3L3OB 5DMIL 1FZOB 2DWEB 4OZHF 4UDUB 4YFEA 3O3AA 3EJZC 3C87A 5HHMB 2YPVH 1AKJD 1LNUA 4NNXB 4UQ2B 1RU9L 1BVLA 4OI7A 1KCVL 5EA0H 3VGGA 4KKLC 5D2LE 3DRQB 5EU6B 1BMGA 2OTWA 3BQUA 4F9LA 4PRPA 4YHNA 3HPJB 2W91A 4G8GA 1MI5B 4M7JL 4ONHB 1FC1A 8FABA 4UUJA 1UEYA 2DL2A 4ZNEE 2FO4B 2OL3B 1AHWA 2NY7H 4E41B 2DI7A 3RBGA 4MQXD 3RA7L 3VD5A 5BQ7A 2UVEA 4O58H 1KPUB 4RX4D 3RX8A 4ODHH 1LP9F 1BZ7B 2AVGA 3QULA 1XCTA 1WZMA 3NAAL 2D7MA 2Y1VA 3QXAB 3WFEH 1FORH 3OWEA 1PDKA 4MNQD 2E6PA 1IGCH 5H37H 4DZBA 4PJFB 3T3PE 1CLYH 4U2YA 1S9XB 4LFHD 4NO3B 4DJMA 1G7MA 5D1QC 2E8YA 2M26A 4KROC 2HTKC 1NAMA 3FMGH 1OT1A 1RUQL 4X0KA 5C0DA 1MFEH 3DV4B 1CD9B 3MXVH 1WFTA 2DMBA 3EFDH 4L8SA 4NYLA 2Q1EA 4BZ2H 4HWBA 2P43B 2PKDA 2YPKA 5DMKA 5GS2H 3K1DA 1LEIA 1LDPL 3S98A 4PBWD 2X9YA 2ARWA 3GBMH 4RFNC 5JW3L 3C60D 1TDQA 3UTSE 4NWUH 3X17A 1YMHA 4U6TA 2H6PA 1OSZA 3LN4B 2O5XL 3ARDB 2EEBA 3VFMB 5IMMA 1QFWM 2EE6A 1B0WA 4XPBL 4B50A 1LO3H 5HPOA 1A6UL 1HHIB 3VFNB 4UZGA 1NAML 2HWZL 4QXWA 1N5YH 1WT5A 1D5IH 3MUY1 4FQIL 2FIKB 3RBSA 1HQRA 2OR7A 5I2IA 3MRPA 5DD0H 1NFIB 3QIUC 3AVEA 4S1DC 4PD4J 4HWBL 1NKOA 4DUXA 1ZLWK 1AKJA 1JE6A 1J1XH 3LQZA 3DURB 4KDTC 4Y4HB 1RZJH 4YFDB 2JK5A 4UMGA 3UTZA 1A0QH 3TV3L 4PY7B 3L5WB 1NGZB 3FO0L 3UTTD 1NL0H 1GYAA 1YEJH 4GKOA 3P9MA 2IANE 4X7TA 3WN5B 2Y6SD 1I1CA 4C58B 1IM9A 2JKXA 4NO5A 1N3NA 1XR9A 3BPCA 1DVFD 4EOWL 3C2AH 3KPRA 1IM3A 2Z8VC 2CRYA 3BVNA 3C5JB 4UINH 4WFED 5H8DA 4OF5A 1JGVH 3GMNB 4E42B 1U8OB 2R0LL 5C7XH 3NTCL 4DUWA 1OLZA 4LU5L 1T03H 4GXUM 1EVUA 3L3DA 4Z7NF 4Y4FA 4OF6A 3AAZB 2J8UF 3V5DA 2XNAB 4H88H 4YDKL 5SWZD 4XBEH 3SKNA 5DMIH 2EDOA 5TE6L 3MRBB 4M03A 2NY2D 4QNPF 4JHZA 1RURL 5DEGA 1BQUA 1A1MA 3RQ3A 3ZDYF 1C5CL 4NNPL 4OLZL 1RU9H 1NFDE 1WBYB 5HVFB 5L0QB 1U91A 4TVSa 3MX0A 1A3QA 1WUNT 1K9TA 1FVDA 2YEZB 1UYWL 4XVJH 2AS5M 3S36X 4M7JH 1WFUA 3RWDA 2MQ3A 3C60A 4P5TB 2XY1A 1UWXH 3HC3H 1WBXA 3VRJB 2K7QA 1OTUC 4PY8J 3K2MC 1LEGB 1A3LL 4M5ZL 4RA0C 4RSVA 4JDZB 3DI3B 4EI5A 4ZS6C 2PYFA 3NGBB 3G08A 5DJ2A 3DV6B 3WS6A 1DQJB 4C56E 4EVNB 1F2XK 2X42A 3MRJB 1MJJA 5HGBA 1PYWB 2EDTA 4JHAH 3ROLA 3ZKXC 4LPTA 4GAFB 3L95A 2P1YA 5EBWA 3H9SE 2OZ4A 1RUQH 3WNNA 3KLHD 2P47B 3T1FB 3O45B 5D7JD 3O9WC 1FN4B 3E6FB 1JHTA 3TBWA 3QCUL 4LVEA 3HE7C 4LPXA 1LDPH 3QPQD 2IPUK 2WINB 3UTTA 4AT6B 5JW3H 1PKQA 4P48A 4YDVA 5JUEL 2MJWA 3D69B 5INDA 3KYNA 4OSUH 4OKVB 4WI7A 1O7SA 3HUJB 2AXFA 1YDPA 4PG9B 5IMKA 1QSFD 4LIQL 3JVGC 2X89A 1P2CA 1UZ8B 3KPNA 4K7FB 1MAML 1YPZA 5E2UL 4F7PA 4QCIB 5LGKA 4F3FB 5FO8A 5BRZD 2C7UA 1J0JA 5JW4R 1X5KA 2OJEB 1A6UH 1KELL 1HH9B 5D1XC 1NAMH 2OZ4L 4NZTL 1JTTA 3K8LA 2FEEI 4FQIH 4GG6B 2MHAA 5LAXB 2YSSA 3VI4E 1RV6X 2AW2A 3QZWG 4OFKA 2G9HB 4HBQA 4PJEE 5BS0E 4LCCA 4HWBH 3DYPA 3PWVA 1LE5A 1JK8B 2P42B 4CGTA 3L1OL 5ESQB 4FMFA 4H20L 3ET9F 1QOKA 5CJOL 3TV3H 4WEBL 5T3XE 3OKLA 3MBED 1DJSA 3FO0H 4CBPA 2LU4A 3RWEA 3TN0C 1P9MA 2UZIL 4PJIA 2ORBL 3O3AB 1RY7B 4XNYL 1LNUB 1NCWL 4KHTL 3FO2A 4EOWH 3HZVA 3DPBA 4ISVA 4ZUUA 1BVLB 4M4RA 2V2WA 2F15A 4MXVF 4YBLC 2R0LH 3BZDA 3NTCH 3P0GB 2OTWB 3BQUB 4LU5H 4PRPB 1N6VA 3CFEA 3GJFA 5C0JA 4YHNB 4G8GB 8FABB 4UUJB 1L7IL 3EYUL 1F3JA 5IHZA 2QSCL 3GM0A 1AHWB 2YZ8A 2YD2A 4YDKH 1NGPL 5BQ7B 5TE6H 5BV7C 3CFCL 3DLQR 1H3UA 3LRHA 5IOPB 4XCNA 3QULB 2J1KA 1XCTB 1BF2A 5IR1A 3O2DA 5I1GL 1HI6A 1FG9C 4K3GA 1HE7A 4Z7WA 5D2NE 5D7JA 1C5CH 4DZBB 4KTDL 4HKJA 4NNPH 3TVMB 1QFOA 3MLXL 5HYJE 4LCUA 2ZNXA 5DXWA 3K8MA 1NDGA 2CRZA 1G1CA 3U79A 2IQ9L 1UYWH 1EO8L 3V4PL 5HHNA 3QUMA 1NAMB 4X0KB 4UBDD 1KTRL 4KUZL 3JXAA 1OQOA 2NY4C 2G75A 4L8SB 4NYLB 2H2PC 4KXZH 1FLTX 2QQLH 1IFHL 1A3LH 4K2UL 3BRGC 1P4LA 2YPKB 4M5ZH 5TDOA 5DMKB 3EOAA 5I71C 1E4WH 5D1QA 1LEIB 4Y8DC 4MJIE 4OM1L 3V7AG 4GKZB 4OFIA 2CH8A 1EHXA 1IGML 2A83A 5JW4N 1HHGA 2W60A 2HT3D 3O2DL 4RWYL 3UO1L 1YMHB 4WY7L 1OSZB 5KSAC 2AQ3A 2XQYG 1AXSA 5IMMB 1GC1C 4KUCD 4LCWD 4LHUG 2E9BA 2VL5A 5F1NA 3QCUH 5JORA 2ZWLT 2WNGA 3QUML 5MEND 3IB4A 3PGDA 3MBEA 1HQRB 5I2IB 5T5NF 3MRPB 4KHXL 1NPUA 3SKJL 5JUEH 2K7PA 5SX4I 3U4BL 4NP4L 5BMFL 5DJZA 1B2WL 3MYZA 1AKJB 3LQZB 5KN5B 4LIQH 4IIQA 5MHSD 2PTTA 2JK5B 5LG1A 5B4MC 2ZPKL 5E2UH 4P2RE 1T2XA 1QA9A 1H3WM 3OJMB 1KELH 1IM9B 4NO5B 4K8RC 1A6TA 2OZ4H 1XR9B 3BPCB 5EC1A 5I66A 5J06A 1IM3B 3KPMA 3OAZH 4KDTA 3BVNB 4N0UA 3EW3B 3BP4A 4PJ5E 2CIKA 4JN2A 2M1KA 1BIIB 3L1OH 3MROA 3L3DB 4Y4FB 3D5OF 4H20H 4M6AA 4CMHC 3V5DB 1Z3GL 4R2GC 2PTVA 4WEBH 5JHDD 1T0MA 3MODL 4NRZA 3PDOA 4GS7B 3SKNB 1QKZL 5C0CD 5A2LH 2DD8L 1S5HB 2ORBH 1OGAE 2IWGA 1A1MB 1P4IL 1SJVA 4XNYH 1NCWH 4KHTH 4JFEA 1U8PA 5KSUA 2GJZA 1U91B 4LSUL 1GAFL 3RNQB 1FVDB 4HQQL 2UWEF 3STZA 4X6BA 4URTB 1L7IH 3RWDB 3EYUH 1U2CA 3C60B 5D2NC 5CLTA 2QSCH 1WZLA 4LQFL 1NGPH 4HUUA 9CGTA 1PD6A 5GIRA 5KSBA 2XA3A 3G04A 3CFCH 4ENED 2MWCA 1MCDA 1AGEA 3FQWA 3IDMA 5I1GH 4EI5B 5CZVL 2A2QT 2PYFB 4LCWA 3ZKQD 3HZMA 3G08B 5DJ2B 3BKJL 1U9KA 3IU4H 3MLXH 4GMTH 1MJJB 5HGBB 4JPKL 2B5IC 3ROLB 4C4KT 3S9DB 3RFZC 2E7LC 4N8VB 4RRPG 4ZUTA 3SEPA 2IQ9H 1A64A 3L95B 3KPTA 1EO8H 4PB0L 3TIEA 1C5BL 3V4PH 5EBWB 4QHNB 2J88L 4KUZH 1OF2A 2W0FA 1JHTB 5C86A 5DF0A 3TBWB 1LK2A 3GJFH 3TFKC 1IFHH 2IFGA 2XN9E 4K2UH 5L88L 3MV9D 2P5EA 1H15A 5E8PA 2IH3B 3EDFA 1XF1A 3UTTB 4OM1H 4KKCC 5C2UB 1DUYA 4JKLA 1PKQB 1IGMH 2GW5A 4YDVB 5INDB 1KCUL 3KYNB 1KT2A 1IAOA 4DN3L 1DVFB 1EHNA 2AXFB 1YDPB 3O2DH 3SE3A 5IMKB 5JPNA 3T3PF 2V5TA 3CCHB 3WNMA 4WY7H 5J8OA 5B8CC 1A9BB 1P2CB 1N4XL 4F7PB 3QQ3A 1CGTA 4KI1A 2WWMD 5FO8B 4P2OC 1E4KC 3ZLQC 2C7UB 3KYKL 4LEOA 4LSTL 1RZKC 5CP7A 4KI5D 4HWUA 1KPVA 3QUMH 4L8BA 3BMWA 1TJHL 4I2XA 5JHDA 1N59A 4ZO7A 2MHAB 2ZCKL 3FTGA 1JFQH 1QLFA 4LCCB 4TSAL 3PWVB 3U4BH 4NP4H 5BMFH 1LE5B 1KC5L 4KZDL 4J3XA 5DO2D 4OGAC 4V1DD 3OKLB 2ZPKH 4F37F 1TXKA 2CMRL 2FJGA 2Q8BL 3KG5A 3RWEB 2IFFH 5C1MB 3HNTL 5GRZA 2B2XL 2QQNL 3UDWC 3MGTA 4HIEA 5F7LB 1GGYA 3FO2B 1CVSC 3HZVB 3I6GA 2BDNL 4ISVB 4IOIA 4ZUUB 2V2WB 3S88L 4PTUA 5F7HA 3VD7A 2YWYA 3NVQA 3DX8A 3U82B 4FQCH 1DEEA 3CSBA 3CFEB 3GJFB 4GRWE 3TN0A 5C0JB 4JM2A 1F3JB 5IHZB 1Z3GH 3M8OL 5CHNA 3MODH 1F42A 1QKZH 2Y5TA 3RVXD 3QG6A 4XCNB 1H3TA 5HYEA 2Q86A 4YXHL 5IR1B 1P4IH 1HI6B 5D7JB 3SJVD 4OLYH 4V2BA 3T08A 4LCUB 1R5VA 2YR3A 4LSUH 1EXUA 1NDGB 1GAFH 1V7ML 5HHNB 1U8IA 3QUMB 4Y2DC 2ED8A 4HKXA 3LB6D 3DVNA 4LQFH 2G75B 1HIML 3ARPA 4PP1D 3IS0X 1P4LB 1QSFB 5JW4Q 5TDOB 3EOAB 4QRPE 4U1GC 4N0FA 5MP6L 5CZVH 4KROB 5DD1L 3EDJA 3RRQA 1IGIH 1I7TA 3QISA 3QXDA 3RGVD 2A83B 3OL2A 1HHGB 2YOCA 2W60B 2Z31D 1T1ZA 3OXSA 4JY6A 4PB0H 1C5BH 3RVUC 5INCA 1AXSB 5F7NC 5B22A 4S1SH 2J88H 5FIEA 5DEZA 3TESA 1NQBA 5GGVL 3A6OA 1GGBL 2VL5B 5F1NB 5IB1A 5BV7L 1A7QH 5JORB 1UZ6F 5JIIA 4H1LG 5L88H 3L7EA 4V1DA 1CWVA 4OM0L 3PGDB 3MBEB 1J18A 3QEQE 4LDOB 5DVLA 2YXFA 1TITA 2DWDA 4NC0B 1LWRA 4Z6AT 3OBAA 5DJZB 1KCUH 4LK4A 1S7QA 4XMPH 4HIHA 3KLSA 4NKDA 3I84A 1G0YR 4IIQB 4F7TA 1LO0L 2PTTB 3JZ7A 5BZWA 1JF1A 1QBMH 4NQVA 4XX1G 4XVUD 3C9NA 5HJ3A 5CEZE 2IPKA 4R97C 1QA9B 4LSTH 4Y16C 1BOYA 1A6TB 1V8HA 1CQYA 4JQIL 4XXDA 5EC1B 1TJHH 5I66B 1LGVA 4HAGA 4L4JA 5EU5B 1FGVL 3KPMB 4W4OA 2DJ4A 3MJ6A 5FV2A 4N0UB 2FB4H 1CDGA 4GG8A 3ULUC 1V3KA 2CIKB 1KC5H 1FFPA 1KJ3L 1PY4A 3MROB 5F1OB 2FL5B 1I7UA 4KZDH 1KGCD 1CT8A 4NN5C 3SJVA 3GK8L 5E7FA 1N6UA 3UC0L 4NRZB 3PDOB 4HT1H 2O61A 2Q8BH 3DETC 3HNTH 3WV0A 1XGPA 2B2XH 2F5AL 2QQNH 4KJPD 4K3DL 4U4BA 5IHBA 4DZ8A 3KPSD 1BFSA 3HN3A 4OZGE 4JFEB 1T4KA 1U8PB 1UFUA 3LAFA 2D9QB 2X6MA 1T7VA 1H0DA 1Y18A 1LEKA 4EUPG 4M61A 3PV6A 5KSUB 1AGBB 2GJZB 3S88H 3BPNC 3I2CL 1Y6NR 4PJ7A 1P69B 3STZB 4PJEF 4X6BB 2BXZA 2N7BA 2X4UA 4MQSB 1C08A 5F6HJ 1OAZL 4MNQE 3RGVA 1MRFL 3M8OH 2C1PA 4HUUB 3UPCA 2MQ0A 5GIRB 3STLA 5KSBB 3G04B 4PJGF 2ENYA 3L5JA 1W0VA 4M8VA 3CSYA 3FQWB 3IDMB 4OV5A 3ARGC 3QHFL 5GRYA 4LCWB 2QLVB 3HZMB 5GRUL 3HC0A 2WMPA 2EKSA 4JR9L 3QUYC 3HAEA 4Q6IB 4I0CC 3TIEB 5C6PB 1V7MH 1AH1A 1ZV5A 2NY0C 3CLFL 1EK3A 2ZCHL 5FA3A 4MNGA 1MHPL 3MLRL 1OF2B 2XWJA 3FFCE 5IW6A 3V7MA 2W0FB 4JPIA 2R1YA 1VA9A 1K85A 5FCUL 2E6QA 3ZT5A 1OP3H 1H15B 5E8PB 1SBBA 1VB9A 2GEEA 5MP6H 1NBYA 3KJ4B 5F9WC 3IT8D 1A7RL 1DUYB 2D03L 2Z8WC 5DD1H 4MJIA 3TNMA 4CRPA 4MQTB 1J0HA 2VAJA 1KT2B 1IAOB 2AJYH 2XY2A 4YHPA 5JPNB 4NM4H 1VGEL 5C0ND 4AMKL 2WAHA 3VFUA 1BJMA 5KVGL 1RHFA 2YPLD 3QQ3B 4XP4L 5DQJA 3K4AA 1GGBH 5BV7H 4LEOB 1G0DA 4WUUD 5FXCH 1KPVB 4L8BB 3MLTA 3DSFL 4M43H 2R2BA 4I2XB 4OM0H 5JHDB 2NY5C 4TUKL 3WFDH 1UT9A 5AZEL 2DS4A 4HFWA 1QSVA 4FQQA 4JQVC 4P4KC 3FTGB 1QLFB 5JW4M 4PJCE 4AQOA 3PGFH 3WIFA 1RQ5A 3FQTA 4FXLA 4N9GA 1KJ2A 1LO0H 2DTSA 1SBSH 1QSED 3JWDC 1JMZA 3UEZA 2MOVA 3O4OB 4NC2B 4Z0XA 2FJGB 3ESUF 4JREC 1UM4H 3MGTB 1QEWB 4HIEB 2MCPL 3NCEB 1FSKB 1G7HA 3I6GB 1FGVH 5CJ5A 4IOIB 4NKMA 5SWZE 3BGFC 4WFFE 4PTUB 5I17A 3X13A 3DX8B 5SWSD 1X5XA 1DEEB 4PJ5A 4NHCH 3TN0B 1KJ3H 1T0PB 2HLFD 4KJQD 4JM2B 3UZVB 3GK8H 3UDWA 1KYOK 2EDWA 3UC0H 5CHNB 4LL9A 4LSQH 2AEQL 4ACPA 1GC1H 2CKBL 2Y5TB 2FR4A 1GJIA 3QG6B 3TM6A 4CNIA 1HNFA 2RGSA 2Q86B 2ITCB 4FQHA 1Q0XL 2W9DH 4D2NA 2LV4A 4TQEL 3EYSL 4ZNCD 4LVNB 5F7EL 3PGCA 4Q6YA 4X83A 4K55A 1ZGLM 2VZ3A 1S7UA 3BPOB 2AK1H 1R5VB 1YY9D 4FXGA 4PBVC 3I2CH 5C0BE 4XPFH 1EXUB 1VESA 3DWTA 3O8XC 1EA9C 4OF3A 5BV7B 1FCCA 2QHRL 1U8IB 2V2XA 3CZJA 1FDLL 4HKXB 2VLJE 5JDJA 4JKMA 3DVNB 3HKFA 4CU6A 3CAFA 4DKAA 5IVXB 3ZSSA 1AXTL 1CDBA 2DKUA 5F9OL 3RWFA 1LO5A 3HC4L 4X7EC 1ZVSA 4JQXC 1KN4L 2I9TA 5IT2H 4YGAB 1I1AC 2DQDL 2VZTA 2WWKO 4K8RH 4HH9B 1NUGA 4N0FB 2B8OT 3QHFH 3ARZA 5DQDL 3KR3L 1U3HC 2NPLX 1I7TB 3FB8A 2EXWD 4JR9H 2ICCA 1IKFH 5E99L 2NY4B 3O6LL 4NO0D 1ZLWH 1T1ZB 3OXSB 4JY6B 3KXFA 1CDHA 4PR5B 1OY3B 1XF2A 5INCB 3CLFH 1V05A 3JSSA 4KGLA 4M1GL 1MHPH 1TTGA 5IB1B 5ERWA 3B9KD 3ULVD 3I3BA 5FCUH 3L7EB 4OFPA 2XN9A 2XT1B 3GHEH 4V1DB 2HKHL 1FFQA 1QSFE 5FOJA 3HHRB 3NCBB 4BQBA 1A7RH 2D03H 2P5WD 2DWDB 4XCFL 5H37G 4JDTL 5BRZE 1S7QB 4JFDD 3U30C 4U49A 1WZKA 4JO2H 4NKDB 3CSGA 4G5ZH 4F7TB 1DEDA 1VGEH 5BZWB 4AMKH 1JF1B 4NQVB 5DFVC 5EUOE 2Q20A 4XP4H 3C9NB 3FQNA 5HJ3B 1JI2A 1JJUA 1L0YA 4IOFC 3UYOD 4XXDB 4HGMA 4Z8FL 4TUKH 4KDWA 1NEZG 2HMIC 1YNLL 5AZEH 2F74A 2UUDK 4MSWA 4GG8B 4KKBC 3OSKA 2JJSC 5EO9A 4YK4C 1I7UB 5E5RB 1CT8B 3P11H 3SJVB 1VACA 3BN9C 1LVEA 3BPLB 2O61B 1EBAA 1Z9OA 2C4FT 4L5FH 2NY2C 3NFPA 1XGPB 4XCYA 4JO4L 2MCPH 4MA7H 4DZ8B 5DSCB 1IAMA 1T4KB 4MYWB 1H0DB 1LEKB 2DJUA 4M61B 2W0LA 4R4BB 5ESAA 1Z0NA 3NACH 2Q6WA 4HUVA 4UTAL 4L4TD 4OCSL 4KZEL 1DL7H 2DBLL 3EUUA 5IWLC 2X4UB 5FYLE 1C08B 3RGVB 2VOTA 2C1PB 3L3GA 3STLB 2AEQH 3HUJF 2XRAH 3U4EA 3V6FA 3CSYB 4OV5B 5E2VL 1Q0XH 4TNWK 1KJ2H 4TQEH 3EYSH 4PPTA 4JZNA 4S0SD 4HJGA 5EU3A 5F7EH 3HC0B 4J8RA 2EKSB 4WEMB 3ULUL 3GUTA 3QG7L 3HAEB 1YECL 4G6AC 1OP5K 1OVZA 5CMAA 3INUH 3WNPA 3VXME 4GG6F 2QHRH 4I0PC 2P5WA 1FDLH 5FA3B 3S97C 4MNGB 4YBHA 2XWJB 5IW6B 1X4XA 3E2HB 4JFDA 4JPIB 2R1YB 1AXTH 4YXLL 2XG5A 3W5MA 4LSVH 4P46A 1KN4H 2Z35A 1NBYB 1FNAA 5DQDH 4IMLA 5F96H 1Z5LA 3TNMB 5K9QG 3RZCD 2VO5A 5E99H 2OXHA 1DQTA 4YHPB 1D6VL 5MENE 4YPGA 1XGTA 3N9GL 2VZVA 3TYGH 3VFUB 4Q9RH 2GI7A 4M1GH 3CLEH 5DQJB 3QUZD 4EEEA 4LGSB 3ULVL 4UT6H 3TJEL 3H3PL 3OF6A 3I50L 1DFBL 3MLTB 2HKHH 2R2BB 4QLRA 1TVDA 1RZIA 4FQQB 2DQUL 1BEYH 1UCBL 4XCFH 4JDTH 3QDJD 2CKBB 3WHE0 3KPSB 3WSQL 3WIFB 4KVCL 3FQTB 2FO1A 3T0ED 5K9KA 3AY4C 4N9GB 1KJ2B 3T0WA 1JL8A 2VDOL 5J4MA 3P0YL 4P4KA 4JQVA 4L4TA 2J8HA 3AXLA 4KJWC 5GGTA 2H32H 1CZ8L 5E4EC 1P6AB 3IGAB 2OR9L 4WFGD 1IQWH 5ADOH 2OQJA 3ZE2F 4B53A 1R24B 1G7HB 1I9EA 4Z8FH 4NKMB 1L6ZA 2DLTA 5C0CE 5I17B 3S3JA 3X13B 2QR0A 4RMWA 4G42A 3QI9C 1QRND 2APTA 1HHKA 4U0QB 1BX2A 1HHJB 2JCCA 1FBIL 4W4NA 3SCMD 4Y5XA 5DA0B 1I8KA 4F7EB 4PJHE 1TTFA 3BMVA 2FR4B 3RIAF 4CNIB 5EIIA 5L2JA 4X9BA 4OF0A 3LRSA 4JO4H 5E8NA 2R2CA 3RUGA 5F3BA 1ZT1A 2D31A 2NY5L 3PGCB 1S7UB 3D2UD 3LKPA 5DR5L 4FXGB 2BOCA 5GGTL 5CJXC 1AD9A 2OI9C 1QYGH 5B38A 5CKGA 4UTAH 1X9QA 4KZEH 2V2XB 1DBKL 2P8MB 2DBLH 1A1OA 3RZCA 4FFYH 5KVFH 2A9NH 3C6LD 5FYJD 3D39E 4NUJA 3RKDD 4LOUC 3RWFB 3U83A 1LO5B 2PR4L 1MELA 1ZVSB 3RZWA 2I9TB 1AIFA 2AJ3A 3O8XA 2X2YA 1PAMA 3QUZA 3M07A 4XMKL 4YNYA 4U2ZA 3FB8B 3ULUH 3QG7H 2XKSA 2X70A 1YECH 1A5FL 3KXFB 2D7TH 1GGTA 5KANG 3MV9E 4JQXA 3RTQC 4OD1L 4XI5D 4NHUA 2NX5E 3MREA 3QDJA 4GMSH 3VCLA 5J56B 4YXLH 3DECA 5CCKL 3T0EA 3VFRA 2Q3ZA 4R90L 1INEL 5CSBA 1QSEB 1QPXA 2BOBA 2WW8A 4YGVA 2DMCA 3BIAX 2OP4L 3QYCA 1E6JH 3O4LE 1WIOA 1G6RA 4KI5E 3N06B 5IEHA 1AGDA 2QSVA 2X4TA 1YEGL 1OSPL 2DLGA 2OMNA 1SY6A 3TJEH 1QRNA 4BQ6A 3H3PH 5AUMA 4ODVL 3I50H 3W11D 3SCMA 2O5YL 1DFBH 5ID0A 3RP1A 4H8WC 4LKCA 5LJYH 4JM4L 5IVNA 1EGJH 1GZPA 2F74B 5K59F 4Z7UE 2DQUH 4MSWB 1UCBH 3TZVC 3LRGA 5EO9B 4PJCA 1DBJL 4GO6B 3I6KA 3NPSC 3WSQH 5IKCA 4KVCH 3JTTA 1VACB 3D2UA 3ESVF 1CICD 1INQA 3ZHDA 1FE8L 4NGHL 3QHTC 2XFXA 2AV7A 3P0YH 2WLZA 1G6RL 3NFPB 2XQYK 4IMKC 1CZ8H 4XCYB 1BREA 2OR9H 3DMMC 5J11B 2NYYC 1S7TA 2QHLA 5IIEA 2H9GA 5DS8A 4YEFA 1SY6L 1M7IA 4U1SB 3C6LA 4ODTH 2YD1A 2WBJC 3IFOA 5ESAB 2I5YH 2Q6WB 4HUVB 3RL2A 1XIWD 2VXQL 1SYSA 3L5XL 1MJ7L 2OR8A 3UYPA 2X4NB 3D85D 4EBQL 4HSQA 3NA9L 4N8PA 2K9UA 3SGJA 3FRPA 1JZ4A 1ITCA 1P84K 4X6DA 3PG2A 1BAFH 5GS1A 5HHOD 3V6FB 3WKNA 4JZNB 4NQED 3DJ9A 4WO4D 4HJGB 5EU3B 2NY5H 3RVWC 2PO6D 3B6SA 4J8RB 1YEHL 2YRPA 4M6NH 3IDGA 3P9LA 4WU5A 1KYOJ 5DR5H 3BO8A 5GGTH 1TVHA 5CMAB 2IBZX 4R8WL 1PG7W 2FHFA 1GOGA 4WCYL 2P5WB 5C0EA 5GJTL 2ENSA 3BZEA 4JFDB 3MRIA 1A7BA 1CLOL 4KY1L 4PRID 2WV3A 1MIEH 4LDEB 1KCLA 1O7VA 4LVOC 5CJQL 2PR4H 4DFIA 4P46B 1IAIH 3L3KA 5DJDA 4KWUA 1IJ9A 4P4RA 2Z35B 4RQQA 2HRLA 2EZ0D 4M00A 4I0PA 4IMLB 3VRLF 1NCBL 1HH6A 5A2JH 1BQLH 2AEWA 3BRDA 4DKEL 1KG0B 1I75A 1A5FH 4YPGB 1XGTB 4KTEL 5E95B 5GS0C 4OD1H 3C5ZA 3SKMA 3AGVA 4KFZC 5D72L 3MR9A 5CCKH 3UYRH 3I85A 4KI5C 1T0NA 1CICA 4XRCA 1RZIB 2V9RA 4PLKC 4WUKH 2VISA 1H9VA 3CSPA 2OP4H 3T0AA 2AJSL 4LSPH 4L8CA 4Z7VA 4N8CH 3GMRA 1GXEA 1MF2L 2V17H 3TJHD 4FG6C 1QHPA 3B2VL 4M02A 1E28A 4PJ9D 1OSPH 2C9AA 4H25B 1G7QA 5EUOA 1NGYA 3LPFA 4P4KB 4L4TB 3AXLB 1XIWA 2EYRA 4ODVH 5I30H 4F8QA 2O5YH 1X5FA 2OQJB 3HZKA 2PF6A 1K3IA 1VADA 3H0TB 4JM4H 1OARH 1QO3A 1DQDL 2FYYA 5FGSA 5IESH 2MQCA 2DKSA 3BD4A 5HHOA 1R5IA 3QWQB 2QR0B 5C08D 1DBJH 2QJDA 4G42B 4EQ3A 1HHKB 1BX2B 2JCCB 5DUML 4NQEA 1WVZA 4WO4A 4Y5XB 1L6XA 2PO6A 5EBGA 5GZNC 1I8KB 5LXGL 3K8KA 5KW9H 2HP4A 2PYED 3Q5TA 3P40A 4NGHH 4QHKJ 1TJGL 2E3VA 4RFEA 4WW2F 4LPVA 3RVXC 3NCMA 1G6RH 2BNRD 3PUCA 3CFIC 3FHQA 3LRSB 5E8NB 3RUGB 1YJDL 5F3BB 1AP2A 2D31B 5DK2A 1NMCC 1SY6H 2R2HA 3LKPB 5JO5B 1KLFA 4PRIA 5I1HL 1KTLA 2BOCB 3SO5A 1AD9B 3VH8G 5B38B 4DFHA 4OCRL 2VXQH 4R26H 1XMWA 3D25A 1MJ7H 1A1OB 4QRUA 1LHZA 3RZCB 3TPKA 3NA9H 3U1SL 3WJLA 1RHHB 5TFSL 4GJTB 3ZL4H 3W0WD 1ZHNB 4NUJB 3RL1A 2HT4C 1AIFB 1DN0A 2ED9A 2IBZY 5IBUB 2AJ3B 4ODUA 2OXGA 2XA8L 1NCCL 3QUZB 5E00A 3WJJC 4YNYB 4JRWA 4PB9L 5FDWA 2NTFA 4IRSD 5HD8D 1CGUA 2X70B 5DC0A 2Z31C 1I8LC 2H3NA 5TDNA 3NABL 4R8WH 3FB5B 4WCYH 1PKOA 1NGXA 4NHUB 5FUZL 5K9JL 3MREB 4PJBB 3QDJB 3VCLB 4PJDA 4UIKL 3MYJA 3AROA 1CLOH 4KY1H 4OCWL 3T0EB 3VFRB 2ZSVA 2DQTL 1R3HA 4Y19A 2HFTA 4PJ9A 2H2SD 3RWHA 1X5IA 3B9EA 1QACA 3RTQA 4KK9D 2YPLE 2BOBB 3EDKA 4UI2A 4YGVB 1NCBH 5I1KL 4FZ8L 2EDJA 3F7PC 4D9QD 4DKEH 4WUUE 1G6RB 1MFCL 3UJTL 2EXYC 1YEDA 5IEHB 1K2DA 4WI4A 2DQFA 1AGDB 2X4TB 3GJEA 3U7AA 5CD5D 3DUHA 4OLUL 5T1DL 1G9MC 2HYMA 4ODWA 5C08A 1YZZA 1QRNB 5D72H 5AUMB 1UJ3C 3CZFA 3VXRA 3SCMB 4MXQD 4NKOA 5IHLB 5ID0B 4POZD 4LKCB 3OJDA 5KSBF 1GZPB 3BI9X 1J10A 2BNRA 4TSCH 2DQIL 1H3VA 2AJSH 2YHGA 3MV8E 4K07A 5TQ2H 5IKCB 1K4DA 3IETA 2WUBH 4KUCF 3JTTB 5A2KH 2W9EL 3QSKB 1HINL 3D2UB 2HLAA 1INQB 2QKIA 4WI5A 2BC4A 2IAMA 5J3HC 3B2VH 2F53E 2XFXB 4MX7A 2AV7B 3IRZA 1GGCL 2EH7L 2VXSL 4NUGL 5SWSE 4KRLB 4Z7QE 1PEWA 1HWHB 2MPAL 3VWKC 1A1NA 2CIIA 5I73C 1S7TB 3IDXL 4NZDA 5IIEB 5DS8B 1DE4A 1DQDH 1M7IB 3W0WA 4XPHH 3C6LB 1MLCA 5BCAA 1NCAL 1RJZA 3IFOB 3BW9A 2AEIT 5D7LA 1PFCA 3RL2B 4QOKE 1SYSB 5DUMH 4IMKA 2CR6A 3UBXG 3MRQA 5HGGS 4APQD 4IRSA 3DVIA 1TJGH 4X6DB 2BVYA 3LIZL 1MY5A 5GS1B 3BHBA 3P0VL 1F6AA 2W9LA 1YJDH 2NY1D 3MV11 4OFYD 5EH1A 3B6SB 3IDGB 3P9LB 4WU5B 5DT1L 1RIHH 4NN7C 3G6AA 4MLIA 1KCRL 1W72A 1TVHB 5CBAA 3EGSA 4TVPE 3JWOC 3QO1A 4OCRH 4FFWC 3QA3A 5EORH 3HI5H 3X3GL 5IJKA 1T7XA 3NIGF 3ABZA 5C0EB 4LKXA 3U1SH 3VXSD 3BZEB 5B21A 5TFSH 3MRIB 5JOPE 2ARJQ 3BWAB 4JFFD 5DJDB 1UQSB 3B5TA 4PJHF 4X99A 4P4RB 4FTVD 1U92A 4RQQB 1NCCH 5HI5C 3TO2A 4DN4L 1L7TH 4M7KL 4PB9H 1HH6B 4HXAL 2QBWA 5DTFA 2NZIA 3QP3A 3WHXB 4HV8A 1F4YL 4N90D 3OX8B 1JV5A 1HOCA 3MACL 5EZIH 1MCOH 5K9JH 3C5ZB 5C8JB 3SKMB 3LPGA 3FQUA 4UIKH 1W72L 3MR9B 5DD5H 3NH7L 2DQTH 3VFWB 1CICB 1OCWL 4XRCB 4F8TA 2Y5EA 4MVBD 1KCSL 4NBZB 2VISB 1MCNA 3TLRA 4HIJA 2AABL 4L8CB 5I1KH 4LARL 4XBPB 4JFZH 4Z7VB 1HKLL 1XZ0A 3PL6D 1MCWM 3TBVA 4W6YB 4F80A 3QQ9D 1E28B 4LNRA 2RJMA 1BF8A 4OLUH 3VFTA 4G8IA 4WHTB 1G7QB 1NGYB 4PRBA 3WE6A 1XIWB 2EYRB 1H5BC 4OLWL 3D85B 1BFVL 5FA4A 3W39A 3HZKB 4APQA 1VADB 1CXEA 5IVXF 1QO3B 2YN5A 2FYYB 1TNMA 5F6HI 4I18A 4ZSOA 2XYCA 2JIXA 4HDIA 2DQIH 5HHOB 1R5IB 5CS7A 4MHHI 5E08L 5IFAH 4NQEB 4KJQC 4WO4B 4JGJA 2W9EH 2PO6B 1ZT7A 1HINH 5GS0L 4KI5F 3CDYA 4RFEB 3W9DA 4NC1E 1GGCH 2EH7H 3B5GA 2VXSH 2BRQA 4NUGH 3ZMRA 2VE6A 4XNZC 5H35A 3CK0L 2MPAH 1AP2B 2AJZA 3G5YB 1WISA 5DK2B 3VXSA 4XT1C 2XQBL 2NR6C 2RR3A 2EDDA 2HVJA 32C2A 1ROWA 4BK4A 2R2HB 4A6YA 4PRIB 4JKPL 1KTLB 5ALCL 4O2CA 2GYSA 4AK1A 3IDNA 1X7QA 1SVCP 3BP5A 3D25B 3LS5L 4OZ4A 4QRUB 3GMQA 3TPUA 3SE4A 3NFNA 1GIGH 4JDVB 5IG7B 5AD0A 3WFHA 4DTGL 3FN9A 3ALWA 4HJ0C 1ZLUK 2VXTL 2DIAA 3A6BH 3RL1B 3OXRA 5DEFA 1DN0B 3BGMA 3T3MF 3C09C 2WK2A 4ODUB 1MCJA 4H8WH 3MFFB 3CC5A 3QAZC 1KACB 3WLWC 5FDWB 2JE8A 2C5DC 3V6OA 2NTFB 3DUSA 1KCRH 1P84J 1SQ2N 3D18A 2H3NB 5TDNB 4LHQB 2DYPA 1NGXB 3X3GH 4A6YL 3ARXA 3MA7A 4PJDB 3MYJB 4MJ5A 2X1QA 1KULA 5GQBA 3ARBD 2BRRL 4WWKC 2ZSVB 1M7DA 3S4SA 5ISZA 3QZWA 2BZDA 4Y19B 5GS3A 4PJ9B 3RWHB 4X9GA 1MIMH 2QQQA 4D0BA 1I8IA 3OTTA 3RTQB 4M7KH 4DN4H 4NCDA 2UUDH 2BVQA 1QRKA 1IRAY 4HXAH 5J89A 5F7DA 3VG0L 5J9PA 1D3CA 2X7LA 5GGUA 2AQ1A 3OPZL 1YEDB 1F4YH 3MACH 3VI3F 3X14A 1JNLL 2H8PA 5DC9B 3GJEB 1H8SA 1RI8A 4P9ML 4AQ1B 4FFVC 1CQKA 4BZ1H 4PRNA 2NXYD 3AS2A 2AGJL 4ODWB 5D96C 5C08B 1W72H 4LAQL 4TTDD 3CZFB 2OM5A 3NH7H 4NKOB 1JNHA 4YHOL 2VKWA 1OCWH 3DNKA 1RZ7L 4ALAL 4N0CD 4HUXB 3V0VA 1D9KD 1WFNA 1KCSH 3CX5K 3WMSA 3THML 4ORGA 2BNRB 3P77A 2KKQA 3Q6FA 3VA6A 4JHWL 2FGWL 1K4DB 3IETB 1HKLH 4WFGE 2HLAB 2QKIB 1AFVL 1DSFH 1V5JA 2IAMB 5HI4D 3KJ6L 4MS8C 4MX7B 2NY6C 3BN3B 5ACZA 5ICZA 4N68A 5KS9E 4PRHE 4Y8AA 1S7WA 3V52L 1BFVH 2X1OA 4Y1AD 1U58A 2R4RL 1A1NB 2CIIB 2DDQL 4B5EA 1UKTA 1NC2A 1QVOA 2KZ1B 1DE4B 1YNKL 4YE4L 3W0WB 1MLCB 5MERA 1BM3L 3FN3A 1RJZB 4OLVH 4AEIH 2JF1A 3BW9B 4NC1C 4QRRE 1O0VA 3QIBD 2AAVA 5E08H 3MRQB 3VWKA 5ICYA 4FQ1L 1HCVA 5FO7A 1JTOA 3ARFD 5GS0H 2ZUSA 4IRSB 1W8OA 4Y5VA 4Y7MA 2A0LD 3B8SA 3BHBB 2HJLA 3B8YA 2R1XA 1F6AB 3CK0H 2GTZA 1HYSC 1MNUL 2XQBH 1PSKL 3BKYL 3VG9B 5EZOL 4U7SA 1AI1L 1RFDL 3MNWA 1OPGL 1B0GA 4GUPB 4JKPH 4L4VE 4ODXA 3G6AB 1MCPL 1WTLA 1NANH 1W72B 5FYJE 5ALCH 1QQDB 5CBAB 3EGSB 1AO7A 1BHGA 2ZP0T 4U0RB 1R3JA 2VDQL 3QO1B 3QA3B 4Y0GA 2CDFA 3Q1SL 4LHUA 5C0AE 4LKXB 4K71C 4JN1L 1A7OH 4LPWA 4DTGH 1JZ7A 1JZ8A 4WI9A 4UV4H 5E0QA 4MZ3A 3U9PL 1FNEA 1U92B 3TO2B 1L0QA 3QDGD 3EDDA 4NFDA 3VXOB 2JB6B 3OKKA 4F9PA 1Q9LA 1OP9A 1SJEA 4NQCD 2V7HB 2OTUA 2B1AL 5DTFB 5DVNA 4KC3B 3NIDE 4HV8B 5FGRA 1CXHA 1JV5B 1FJ1A 1HOCB 3H42L 1FPTL 3EJYD 4XZUA 3DARA 5L7XL 3VGAC 4A6YH 5I74C 4PLJC 1JRHL 3FQUB 4OCNC 3QHZH 2VERN 4JFQA 4XTRC 5DFWH 3VWJD 2B4CC 3H9ZA 3HCVA 4OFVA 3S37X 2ATPA 2GAZA 3MRGA 1S7SA 3H9HA 4IHOA 4HIJB 3VG0H 3OB8A 2FGZA 3WL9A 3T2NL 4Y1AA 3BKMH 4I77L 3F8UB 3OPZH 2BVEA 4JG1H 3TBVB 5CZXC 1JNLH 1JF5A 4ZFOL 4LNRB 4P9MH 4N5EC 4YUEL 4IRZL 3VFTB 4G8IB 5JMRA 3HMXA 1CF8L 4Y5YC 4RAVA 4PG2A 4PRBB 4RMUA 3WE6B 4HG4K 2YKLH 5FA4B 1TVBA 4YHOH 4M6MH 3W39B 1S9YA 2VLKE 3ARFA 1RZ7H 4APQB 4CW1A 1OTSD 5GJSH 2E8ZA 4XPAH 4NBYB 1HHHA 3HS0B 4QXGL 2HJFA 4I18B 4OUUA 4AEEA 4ZSOB 3THMH 4I9WD 4HDIB 3ZKMC 3DX7A 2E9WA 4JHWH 2R2EA 2FGWH 4QXUL 3PWLA 2NY1B 4OLEA 3ALXA 4IJ3C 3GKWL 1ZT7B 2DTML 2FLRT 3PQYA 4AM0A 4WDIA 2ZZUT 2EC9T 3W9DB 3CVHA 2B7DT 4C83A 5HYIA 1YMME 4ZYKA 1YYLL 2O93L 4TPRH 5F1SA 4X6CE 2VE6B 5H35B 3V52H 5HYQA 4JVPA 2R4RH 2AJZB 3ARTA 3VXSB 2DDQH 2HVJB 1OAYL 32C2B 1YNKH 4YE4H 3HMXL 2LAAA 4A6YB 4RRPA 1S9WB 4JFFB 4XNQB 2VDLL 5K9OA 1I8MA 1NCTA 1ZTXL 2YK1H 4O2CB 3MJGX 1EDQA 3IDNB 4M7ZB 3VFSA 3BP5B 4FA8A 3B83A 4OZ4B 3QDGA 3GMQB 3TPUB 1JCKA 4PJ8C 3NFNB 4FQ1H 4NQCA 3T65A 1KTDA 4LVHC 5AD0B 3WFHB 1F00I 1VHPA 3BP7A 1WCQA 1DLFH 3OXRB 1JIBA 4UV7L 5DEFB 3UZQA 2EYSA 43C9A 4NM8L 1N8ZA 4ZDHA 4U7MA 3CC5B 1MNUH 2MKWA 4WTWA 5EZOH 3CVHL 1I9JL 1AI1H 3F7QA 1NGQH 3SQOL 1MCPH 2EKJA 2DL9A 3BZ4A 3G9AB 3DUSB 4I48A 1MCWW 5ALBL 3V0WL 1FC2D 3D18B 1IBGH 1EFXD 2VDQH 2DF3A 2PXYA 1XEDA 3PWPE 3Q1SH 3E6HA 3MA7B 4PJXA 4JN1H 3MC0A 5DLML 3PL6B 5E6ID 5DMGC 1DQML 4OTXH 2KPNA 3S4SB 5ISZB 3U9PH 3QZWB 3P30L 3PHQA 3P4LA 4D0BB 1NBQA 1I8IB 1TCMA 2F54A 2BVQB 5E8EA 3TT3L 3K80A 5F7DB 5J9PB 4PRAB 2DICA 5EU4A 2B1AH 2X7LB 5GGUB 4YXKL 5J6HA 1I9RL 1TQBC 1Y6MR 3X14B 2E7CA 4FQXC 5L7XH 5CJ8A 4OGZA 5B3JE 1EPFA 4PRNB 1JRHH 4BFGA 2WLYA 4ZS7L 2DQJH 5HHVL 2VXUL 2P49B 4JZJC 1IC4L 1JNHB 5DI8A 3QEHA 1QLEL 4QF1A 3V0VB 2GITA 5T5FL 4J6RL 3P77B 3SKOA 3Q6FB 2N7AA 3T2NH 5T33L 1I9IL 4G43A 4I77H 4PV9A 4FHBD 3JWOH 5ILTL 1CFQA 5ICXB 5L8KB 1MH5A 2XIDA 1KEGL 4G6FD 4QRSA 4OIIL 3K0WA 3ULVF 3H3BC 4J4PD 3MTRA 4GQ9L 3W9EA 1NUNB 5B3NA 3Q3GA 2A6DA 5ACZB 5ICZB 1KJVA 3LDBB 4K9EC 5HDBF 4ZAKC 3S35X 1S7WB 2V2TA 3MCLL 4HMEA 1U58B 1BJ8A 3WNLA 1P6FA 3SN6N 5MERB 2PYEE 4QXGH 4RGOL 2XOTA 3A67L 4G9DB 4KRPD 2YBRA 1IC5L 3F58H 3A0OA 3EYQC 3OZ9L 4QXUH 2FCBA 5ICYB 5FO7B 1J05A 4TTGA 1F02I 4ZMAT 5EDXA 4FFZH 4Y5VB 3KPOA 1CFTA 5FM4A 1CXFA 1EFXA 1YYLH 5MEQA 1VFMA 1WC7A 1X4YA 2R1XB 4OZHE 3K2UL 2GTZB 3DHMA 2CR3A 3VXUE 5D5MB 4PJAE 2X4QB 3HMXH 3MNWB 3EIFA 5EUKA 1B0GB 2Y7QA 3MLVL 3G5XA 4ODXB 5J7CC 1I1YA 5E6IA 2VDLH 1RUKL 2HJKA 1I7ZA 1HEZB 1ZTXH 4XC3H 4MAYD 1AO7B 2IBGA 4XAKD 3UTPE 1QPPA 2HH0L 3GB7A 3OKEA 5ITFA 1D5ZA 1B9ZA 4ODBD 3VW3L 1R5WA 4JJ5A 2CDFB 4LHUB 4DGVL 4XCEA 5DHYA 3F12A 1R3IL 4H1LA 3SDCC 4N0YH 3D3VD 2FECL 5DRXB 4UV7H 1F58L 4NT6A 1LP9E 1FNEB 4NM8H 4NZRL 2VC2L 3PV7A 1T2QL 2X4SA 3IXTB 2NXYB 4XB8A 3OKKB 4KRMB 3CVHH 4ZFOB 1FYTD 1I9JH 1Q9LB 1SJEB 3HI1A 2OTUB 1CE1L 3SQOH 3ORJA 1YY8B 4MAUH 3UROR 4YQXL 3NMEA 1HSAA 5ALBH 3V0WH 1FJ1B 2HKFL 4GBXC 5F21B 2R8SL 2AJVL 5CEYA 4XZUB 3S6CA 4MXWL 3R06A 4FP8L 1QZ1A 5F72S 5BW7C 3QH3A 4X7CC 2Z92A 2JCCF 3S34L 4NSKA 3C8DA 4JFQB 1DQMH 3QDMD 1S9VA 3HCVB 4S11A 3ZYIA 3P30H 4ZTOL 2ATPB 4JFYA 3SDDA 1TPXC 3STBA 2GAZB 2CXKA 3MRGB 4K94C 1VCAA 3H9HB 4IHOB 2DB8A 3PWUA 3TT3H 4OCYL 4P23D 5MEPA 2X40A 3KYAA 3WL9B 3OKDA 1BGXL 4Y1AB 3RUGF 3I6LE 1NEUA 5EPMA 1T7YA 4P3DA 1FHGA 1I9RH 5DUBA 2P8PA 3WDIA 5AAWA 5HYFA 3HG1A 4YHYC 2CRIA 3DIFB 3MQIA 2D3VA 1ONQA 3W5NA 2HN7A 3GIZH 5DD6A 4ZS7H 5HHVH 3PHOB 3ZZ1A 4WFHD 4F15C 5C9JA 1IC4H 1TVBB 4TVPH 3MCG1 1IAKA 4EUPA 1S9YB 2ADIB 3ARFB 4CW1B 2GSIA 4Y2OA 2C3GA 3GIVB 1FNSH 1HHHB 5E56A 5T5FH 2HJFB 4J6RH 4OUUB 5FGBA 3Q2CA 2Z8SA 3O3BA 1ULVA 1MY7A 2NZ9D 3DX7B 1SJXA 1QSZA 1EEQA 1WCBA 2R2EB 5T33H 1I9IH 3PWLB 2SEBA 2YD6A 5ILTH 3CD4A 3PQYB 4AM0B 4WDIB 4R7NA 1KEGH 5A3ID 1IC7L 3KYMB 3QUXC 5CILH 4E41D 4GQ9H 5AG8A 3CVHB 4MAYA 3L3JB 4C83B 4R6UA 1ZAGA 1Q0YL 3CX5J 4LP4A 4ZYKB 1QLRB 3F6LA 4RIRA 5FYKH 2OYPA 3G5VA 3MCLH 5HYQB 5KS9A 4LSRL 2B4CL 5B38G 4XHJD 4PJBF 3FB7A 3QJHA 5KVEL 4OZIA 5FV1L 4RGNE 3RHWK 3LSOA 4XAWL 1GOHA 2Y06L 3D3VA 4DOHE 1EHLH 1CFVL 5K9OB 1I8MB 3RY6C 5LKNA 4MQ7A 1IC5H 3OZ9H 3ARQA 2VB5A 3OGCA 4TUJA 2FIRT 3QDGB 2Y4SA 5FHAL 1FYTA 1MCIA 3L6FA 4NQCB 3T65B 1KTDB 4D0DA 3EFFA 1N2RA 3U36A 1SJHB 2I26N 3LD8C 1CR9L 2R9HC 3BP7B 2QV2A 2VN7A 1XAUA 5JQHC 2EYSB 4QNPE 1Z2KA 3K2UH 3CMOL 43C9B 1N8ZB 4ZDHB 2LTQC 2CD0A 3LS4L 5DWUL 1MQ8A 4HX1A 4PJ8A 3KAAA 3MLVH 3IJSA 3BZ4B 4I48B 1JZ5A 1RUKH 4HXBL 1Q9KA 4KK5C 4JKWA 2HH0H 4JRYE 5D6DA 2PXYB 1GGIH 3VW3H 3RX5A 4FTVE 3C09B 3E6HB 4P23A 2YUXA 2VMFA 4PJXB 3LQAL 1R3IH 4LSDA 3QXTA 1MFNA 4YC2C 3QIWC 4G6JL 5H94B 3PHQB 4NZRH 2VC2H 2F54B 4GW5A 2VXVL 5E9DA 5IMOA 7FABL 1PG7L 5EU4B 1NBVH 1CE1H 5CLWA 5GGQL 3WIHA 4JY4A 1J0KA 5JXEC 2R8SH 1HN1A 2J4WL 4JY5L 5I9QC 5GGSA 1TZGL 4KKAD 4ZXBD 4FP8H 3GDBA 1TJIH 1HKFA 2YRLA 3S34H 4XWOC 4MB4A 5DI8B 3IFNH 1ERNA 3QEHB 4OCXL 4QF1B 2GITB 2VH5H 4X6DF 4H1LH 4FQXA 3SKOB 4OCYH 1BGXH 4G43B 4PV9B 3RWCA 4G3YH 1RUPH 3K74B 1CFQB 1MH5B 3NIDF 3IXAB 4QRSB 1BBJA 1EUTA 3Q3GB 2A6DB 3R8QA 1KJVB 1M4KA 3WIHL 3F62A 3SGKA 4WI6A 2V2TB 2H1PL 5D7IA 3O6FD 2KH2B 4MD5A 3VD3A 4N1HB 5D93B 3FRPG 5HVHB 1HZHL 2YBRB 1ED3B 4EKXA 2RFXA 5JXAH 1A3RL 5IF0A 4BQCA 4ZAKA 4CVUA 2BHZA 4HG4J 3V4VL 4WGWB 1J8HE 1IAIM 5C09E 4RGNC 1BZ9A 4JRXE 2XXCB 2APFA 3KPOB 1CFTB 2CK2A 1E0OB 4U1JA 1EFXB 3NCJL 5MEQB 1OTTC 4GRLD 2CK0H 1WC7B 2J6EA 1YMMA 4Z18A 1NMAL 2B4CH 1KUMA 4NQSA 3VD9A 4CVXA 1N0LA 5FKPA 2AKRA 4HWZA 3QCTL 5DJYA 5EUKB 5J1SC 2Y7QB 3G5XB 4XAWH 2Y06H 3AS1A 1I1YB 5E6IB 2HJKB 1CFVH 1I7ZB 3UX9B 1E6OH 4MXVE 5ITFB 3OKEB 3GB7B 1D5ZB 1TCRA 4EUPH 5DJAA 4FS0A 4G6ML 1R5WB 4JJ5B 5CGYC 2IMMA 4XCEB 5FHAH 5DHYB 2G60H 2ITDA 4Q74A 3F12B 4H1LB 1FIGL 3HB3C 4Z7VF 3RDTD 5C07D 2HAZA 1CR9H 1NUFA 5HGHA 1KB9K 4K7PX 3TIDA 3CMOH 1CG9A 3LS4H 2OJZL 4IEFB 4ZXBA 3NN8A 1QUNA 1CE6A 4PP2A 3HI1B 3CX2A 3GMPA 2J6EL 4HXBH 3A6CL 1HSAB 4L1DA 5ANME 4RA3A 5D8JL 1BD2D 1ETZA 5KOVC 5CEYB 5F9AC 4NFCA 3QFJD 4G9FE 3R06B 3MRRA 3LQAH 4HS6A 2OMBA 3QH3B 4NSKB 3WFZA 4M8QA 3DBXA 1NEZA 1S9VB 3TH3T 2R29L 4J3UA 3SDDB 4JFYB 5CAYB 2V9TA 4GBXA 4OLXH 1T7ZA 1KIQA 4O58L 3AREC 3PWUB 1S7VA 3GMMA 2ESVD 4RDQG 5MEPB 1MCHA 1T22B 1JHLL 5I74B 7FABH 2AI0H 4OI9A 3OKDB 1KCKA 3WFEL 3O6FA 5GGQH 5EPMB 4P3DB 5CSGA 1IGCL 3FO9A 2P8PB 3VU2A 4MB5A 3HG1B 1OD7A 4JY5H 1VEMA 4P9HC 4KRPB 4W70A 2HN7B 5DD6B 2OS7A 2W65B 5FHBL 3ZTJG 5C9JB 1WSST 1KENH 5EBMA 1IAKB 4EUPB 5JNYA 1W0WB 2GSIB 4OCXH 1BLNA 5TF1H 3V95A 2QADC 4BZ2L 1I85A 3O3BB 4GRLA 4P2QD 1AGCA 4YFLI 1WCBB 2FZ3A 3UAJD 1GRWA 3DGCR 1F3DJ 3GBML 2VZ1A 1ZA6A 3IVKA 5J1AA 5C0FA 1A2YA 3MLUH 4MAYB 1ZLUH 4RIRB 3G5VB 3QDHA 1A14L 1V3LA 2H1PH 4X4ME 4R96A 3CNKA 4PJDF 5GXBB 3QJHB 3RDTA 2GJ6D 4OZIB 3F6IA 5C07A 5C92A 2IGFL 3LSOB 4IBLT 3D3VB 4JG0H 1EX0A 1D6EA 4MQ7B 5E94A 3OGCB 4TUJB 5DD0L 3SDAD 3NA4A 5ID1A 4Y89A 1T6VN 5FOBA 4R4FL 1FYTB 3L6FB 1M6OA 4D0DB 3EFFB 1N2RB 3U36B 3FHAA 3MLWL 5D1ZD 4LRIA 4PREA 2YD4A 2FHCA 5I1DA 3CPLA 1RZJL 4EDWH 4XCCL 1BD2A 3DXAE 4OZHA 3QFJA 1NL0L 3QCTH 5T3ZD 2Y36L 3E3QC 3MNZA 2ILLA 3MRFA 4HX1B 4PJ8B 3IJSB 5E6YA 3QDMB 4OAWA 1Q9KB 3QEUA 3C2AL 3TBYA 2ADJA 4JO1L 1N6QL 4G6MH 4HK0A 2UWEE 5DZLA 1OAKL 3ZKNC 3V79C 5C7XL 4NJ9L 1JPTL 4P23B 1Z9MA 3HE6A 1FIGH 2X1PA 3O2WL 1GCFA 3ARBC 1OHQA 4K9EH 4ZG1A 2O5ZL 5DK0A 5CEXA 4YDLB 3TO4C 2L0DA 4UT7H 1B4JH 2BNQE 2OJZH 1BQSA 4GW5B 1YQ2A 5E9DB 5IMOB 3TC9A 3I02B 1DCLA 5CGMA 4PJAF 2J6EH 4UU9A 3A6CH 2JLLA 5F97E 2AXHA 5D8JH 1ND0A 4L9LC 4AY0A 1EVTC 4RGMB 2Y25A 1U93A 1BZQK 4NOFA 4P2QA 5C70A 4KV5F 4M4PA 5I16A 4XVJL 4RFOL 3MV7D 1S78D 2VLRE 1IM9D 4ZUSA 5FKAA 3U4AA 4PGEA 3G6JA 3HC3L 2R29H 3WUZA 3KPRD 5JXEA 5BXFA 2PUQT 5ETUA 1LO4L 3HR5A 1TFHA 1JHLH 4CMMA 1EAPA 1G1YA 4LSSL 1HXMA 4Y4FD 5KZCD 3RWCB 2GJ6A 2VDKL 3BDXA 1FAIH 2HT2C 4JHAL 3GBNL 1BBJB 1XGUA 3GSVB 5FHBH 2DKMA 3SDAA 4NQDD 5D7IB 4FMKA 1QP1A 1JRHI 4MD5B 5I75B 5D1ZA 4YX2L 2B0SL 1RD6A 1OLLA 1YUHA 4QWWD 1MQKL 3U6RA 2RFXB 2L7UA 3OKYA 5IF0B 3QIBC 1MCLA 3QXWA 4U33A 3FCTA 2G2RA 1BZ9B 1HCFX 4OSUL 1QG3A 5JIHA 1WAAA 2A0LC 4OB5H 3IDIB 1TLKA 1A14H 4EI5D 2D4DA 4NQSB 4CVXB 2AKRB 4HWZB 4M9PA 5DJYB 1BBDL 2EO1A 4K94H 4HS8L 2IGFH 5EO0A 2OCFD 2N56A 1TCRB 4NKQB 3QXVA 5DJAB 5CGTA 2E9IA 5F8QC 3MLPA 1S5IH 3VE0A 4R4FH 2ITDB 3UP1A 3BZFA 1LK3H 3D6GA 3MLWH 2LVEA 2J8UA 5L2KA 1WV7T 4ZPTA 5HGHB 1LE9A 4YHZL 1T6WA 3OV6A 5TGBA 2J5LB 3GSXA 4XCCH 3TIDB 2PW2A 5T3ZL 2EH8L 3EBAA 2DRUA 1CG9B 1WWCA 1OWRM 1YC8A 4ZXBB 3NN8B 1WQVT 4XNMA 2Y36H 3N0PB 5IFHL 1CE6B 1M7XA 2HFEA 4PP2B 3MV7A 3GMPB 5T1KA 2WWKT 3BT2L 3REVA 1G9NC 3V5HA 1UGNA 1Y6KR 4JO1H 1KN2H 1N6QH 1ETZB 2X89D 2XTJE 1OAKH 4NJ9H 1JPTH 3MRRB 2CQVA 4HS6B 2MCG1 1HDMA 4KK8C 3O2WH 2N1KA 2X9XA 4M8QB 3DBXB 1NEZB 2O5ZH 3VWJC 4OUOA 3TA3C 4EI6B 4GBXB 4JHBA 1KIQB 1S7VB 4EN3C 4NQDA 3MUGB 3CIQA 3O6FB 3IDJA 1PG7X 3FO9B 2NXZC 1JGUL 3RVTD 3P4NA 2NY3C 4RFOH 4ETYA 3MUZ1 4YFLF 5EBMB 5I15L 2CPCA 1UZ6E 4U1KA 6CGTA 1BLNB 4GFTB 1UWEL 2QQLL 2VWEE 4L3EE 4S1RH 1LO4H 1OAUL 2D7PA 4GRLB 5CJBA 1AGCB 1TQCB 3KGRA 1E4WL 4LSSH 5BOPA 2FZ3B 4M93C 3JV6A 4N0RA 3EJZD 1AR1C 3IU3B 3BFOA 5GZOC 3CH8A 3IVKB 2VDKH 5J1AB 5C0FB 4XXCC 1A2YB 2O26U 4LAJH 3GBNH 1V7NH 3WHE1 5EOQL 3GFUA 4KKLD 1MHHA 4E5XB 4JPVL 4M6OH 4XP9L 3DVGA 4R96B 2XWBA 4LLQB 3ILQC 3RDTB 3ZE1F 5C07B 2VR5A 2B0SH 4YX2H 1UM6H 3O3EB 4YBQD 3K4ZA 5GRVK 1MQKH 1D6EB 4RMSA 4QRQA 1F2QA 4WW1A 2OX5A 2P48B 5E94B 1F4XL 3AU1A 4KVNL 5ID1B 1CFSA 1M6OB 5F1KC 4DQOH 3QWRD 2OSLA 1JHKH 2GUOA 2VQTA 4JRXA 4PREB 3Q5OA 3C8KA 3CPLB 4QHLA 1BD2B 4NPYA 1CCZA 5D1QD 3QFJB 3FL7A 4KROD 2HTKD 3VFOA 3DOSA 4ZO8A 3MMEA 3H7LA 1BBDH 3BH9A 3MNZB 1F45A 3MRFB 4MJ4A 2YMXL 4HS8H 2GIYA 3OKMB 2BK8A 5JIKA 1GPOL 4OAWB 2BY0A 4HF5H 3QEUB 2M2DA 3TBYB 5HGAA 1F3RB 4HK0B 5EBLA 4IRJC 3S4SG 4O2EA 2ESVB 3IRPX 3UJJH 1KXTB 3V6BR 5I6XC 3HE6B 4MNHA 4WI2A 1U95A 3GRWA 1LD9B 1F3DH 4YHZH 5DK0B 3LZFL 4PJGE 5CEXB 3QCVH 2MFNA 5DZOA 5T3ZH 4CADB 2EH8H 2XTJC 1Z6JT 3LN5A 4WRLA 3CJJA 4O51A 3W81A 5IFHH 4G7YL 4ELMA 4HGWA 3BT2H 4UU9B 5EULV 5FYKU 1T83C 4X9HA 3QDME 3SO3B 1ND0B 3VJ6A 1U93B 1T89A 1WIPA 4P2QB 4OZFA 4MA1C 3QIUD 5I16B 1K6QL 1UWGL 4S1DD 3EJJX 4ZUSB 2AK4D 5FKAB 4PGEB 4PGJA 3G6JB 4OIAA 3BIKA 1EUUA 1U2HA 5A43C 2BJML 5ETUB 2FECI 1UG9A 3GRWL 1JUFA 3IJHA 3HR5B 4WTZA 4CMMB 1EAPB 4Q2ZA 3MA9L 2X4OA 1HXMB 4JFXA 5HHME 4BFIA 5D5MF 2OK0H 1P7HL 2GJ6B 5DHVA 3IU4L 5TE4L 1FZJA 4FABL 4GMTL 2VWEC 1NC4D 1PZ5A 1JGUH 1G7MB 1U3YA 5DJ6A 1XGRA 3PF2A 4RISL 1XGUB 3T0VA 5EU6E 4CU8A 3FN0L 4OCLC 3SDXA 4HHAA 3SDAB 4J1UA 1MI5E 5C0DB 3MJ8A 2VQUA 5I15H 1PGRB 1CDJA 3QWRA 4JFED 1UWEH 4CN6A 2EEAA 4DW2H 5D1ZB 1RJYA 4R7DA 3VH8A 1YUHB 5DFTA 4WV1C 4E41E 3K7UA 5F93C 5L6YL 1CIDA 1OAUH 3T09A 3U6RB 4ZD3L 2EYTA 2VITA 3AB0C 2APWA 2P24A 4Y4KC 2C3VA 3TH2T 3FCTB 2G2RB 4JEGB 1RUAL 4PJFE 4DEPC 1QBLH 5GGSY 5GRWA 4Y88A 5EOQH 1CFBA 1Q9OA 3ARYA 2ICES 1U8JA 2H6PB 4JPVH 3EOBA 1A6ZA 1B6DA 4XP9H 4W81A 2GHWB 1G0XA 4DK6A 1NKRA 2XZCH 4M1DL 2ERJB 5EO0B 3QUKA 2WUCL 1BOGA 3V6ZA 4LASH 4PGCA 1F4XH 1WGOA 1A7NL 2FEDC 4KVNH 2W07A 1EERB 1JFQL 1A7PH 3VE0B 4HPYH 1L0XA 4ZS6D 3BZFB 4P9HH 1VFBA 4QHMA 2J8UB 5L2KB 4ZPTB 3LEVL 1LE9B 4CVZA 5TGBB 1NCDL 4NQXA 3GSXB 2GT9A 3LKSA 2P5ED 2PW2B 2YD8A 3UTZB 1C1EL 3VMPA 5DK3A 1MFAL 2IFFL 1CLCA 3QIUA 2NTSP 3P9MB 4XNMB 4X7TB 2YMXH 3MV7B 1UWXK 2X4RA 3O9WD 2AK4A 1GPOH 1OAXL 1N3NB 3V5HB 4M7LH 3KPRB 3UTSD 3HE7D 4NO2A 4F33A 1U8NA 3LKRA 2AJXL 2H45A 1R3LA 4FQCL 2L7JA 4OFDA 3K81A 1HDMB 5KZCB 2FWOA 3LZFH 4HS3A 2JJTC 4BELD 1NC4A 2VZSA 3BH8A 4DKFL 1FP5A 1K8IA 1E4JA 5DJ0A 3IDYB 4J23A 4R4NC 5E24E 4G7YH 3F7YA 4CAGA 4FQLL 1OAQL 4NQDB 5DEGB 3ZE0E 2F9BT 3IDJB 4OLYL 5FGCB 2K1MA 4NQUA 4Z77A 4R9HA 2IPTL 2ZOLA 1U36A 4U3CA 5D2LA 1K6QH 1YC7A 1UWGH 4U6VL 3SE8H 1ORQA 4U6HA 3QT2A 2AV1A 1CK0H 2ADFL 4BSVA 4C57C 1WBXB 2AXGA 3FZUC 4HKZA 4U1KB 4ZNEA 4H0GA 2BJMH 4HPOL 3VFVA 3GRWH 4GAJH 4YAQA 4BKLA 5BO1L 1AR2A 3MA9H 3UBXA 3TN0D 35C8L 4HH8A 4BYHA 3NBNA 3JV6B 3JV5A 4JM2D 5MI0B 5TE4H 1IGIL 2GY5A 5C0RH 4FABH 5I1LA 4H5SA 3E8UL 2EC8A 4QTIL 1IEAA 4RISH 4LEXH 4D9RE 5C6TL 3FN0H 1MHHB 4OCMC 4QT5A 5IW3A 5CBEA 2DIJA 3DVGB 3MPCA 4S1SL 4XHJC 1VKXA 2XWBB 1N0XL 4K3EL 4OZFH 2XI9A 1A7QL 4NN6B 2VNCA 4LF3A 5L6YH 2KQNA 4ZD3H 2B1HL 4WW1B 4MA8L 4XMLH 3N85L 3AU1B 3RIAK 1D5XA 5L9DL 2C1OA 1CFSB 3O0RL 2C3WA 2NCMA 3BUTA 3O9WA 2OSLB 1RUAH 2GUOB 1ZT4A 4XMPL 2D0HA 3BYYA 1UB5A 1CDIA 3C8KB 2WQ8A 3HE7A 4JFHE 4QHLB 3KS0J 4NPYB 3UTSA 3L3HA 3OAYH 3KPNB 3MNVA 5DHVH 1QBML 1YPZB 3VFOB 1VFAA 4QTHA 4MCYA 3MMEB 5IQ9A 1ZS8A 4M1DH 4FNLL 1II4E 4C56D 1EZVY 2NY4D 5D7KE 2H2PD 2WUCH 4PYGA 1JGLL 2ARJA 4HKBA 1XGQA 1A7NH 5HGAB 3RI5F 3SBWC 3JVGA 2YSSB 3WXWL 2FB4L 3ARDC 2E7MA 3H9SD 4O2EB 1U95B 2VDML 3NCFB 5F7YC 2FRGP 5AWNL 3LEVH 2XZQH 1NCDH 3HUJE 5J6GA 5D1XA 4P2YA 1C1EH 4JZOA 2A73A 4HT1L 3B2UC 4HWEL 3LN5B 4JGUA 1MFAH 4O51B 4XH2A 1T1YA 5KSAD 4G6KL 3V4UL 5LQBH 4PJIB 4ELMB 4HGWB 2IANA 4TNVF 1OAXH 2WZPD 3OGOE 2AP2A 4Y4HC 2FD6L 1EEZA 4GG6E 4W68A 2EDRA 2AJXH 5CINH 3HNSH 2ESVE 1HQ4A 4NRXA 3WN5C 1N26A 3BIKB 3VMNA 1I4FA 4DKFH 1JUFB 2KDGA 1J9CT 1MFBL 3IJHB 5B4MD 1B0RA 1UC6A 1MEXL 2RB8A 1QR4A 3C6SA 4Q2ZB 5BS0D 4FQLH 1OAQH 2X4OB 3LKQA 3EKCA 4JFXB 4BFIB 5KAQG 4Z7WB 1OW0C 4HKJB 4K8RD 5DHVB 2R15A 5IBTL 2HRPL 2R0ZL 4B7LA 1NFDA 2IPTH 2XKUA 1PZ5B 5I1CL 3BRFA 5DJ6B 5T3XD 1XGRB 1CU4H 4U6VH 4PRPE 4FZEL 4GLRH 3SDXB 4HHAB 4J1UB 4G8GE 5E2TL 2VL4A 2ADFH 3MJ8B 5DJXA 3CXDH 1RK0A 2EIZA 4HPOH 1RJYB 2E7BA 1BECA 3CXHK 3VH8B 4BM7A 5L0QC 4R2GD 1JZ2A 4ZOAA 2KQMA 5H2BA 5BO1H 5IROC 2EYTB 5D1QB 1J1PL 35C8H 2VITB 3EZJB 5C71A 2C3VB 4P5TC 4C56A 3MGAA 1NBZA 3E8UH 1AY1L 4QTIH 2AJYL 5C6TH 5IB2A 4NM4L 1U8JB 2IG2L 2ZUQC 6FABH 1A6ZB 5HY9A 3H9SA 1T66C 2JJUA 1N0XH 3NGBC 4K3EH 4RFNB 3ZE2E 1FYHB 2DIBA 3KYOA 3OKNA 5HYJD 1X5JA 1BOGB 2B1HH 1PQZA 4M43L 3V6ZB 1H8NA 4MA8H 4PGCB 3WFDL 3N85H 1J88A 3U0WH 5KSAA 5L9DH 3T2QA 2D9CA 3DUUA 3O0RH 3LEXA 3PGFL 1ZANH 4BQ9A 1VFBB 4QHMB 4P0DA 5DHXB 1FL6A 1KIRA 2R0KL 3F7RA 4CVZB 4NQXB 4TSBH 3LKSB 1SBSL 5M7QA 3QIUB 4MJID 4QGYA 1UM4L 2X4RB 4FNLH 4MDIA 4RBPK 2AK4B 1JGLH 5IM7A 1IGFL 3TFKD 1U42A 4WENB 3NIFF 5IW1A 4RMQA 4NO2B 3WXWH 4F33B 1MWAA 1U8NB 1AGFA 3BP4B 4ZPVA 3LKRB 1UKSA 1R3LB 4JN2B 4KKCD 4PJEA 5BS0A 4NHCL 2UZYB 2AQ2A 2VDMH 5AWNH 3WO4C 2IADA 2VSDA 1EHAA 4M48L 3X3FH 4HS3B 4OI8A 4I3RL 1T0MB 5J12C 1NC4B 4LSQL 4NCC1 2EDXA 4HWEH 1GC1L 3SY0A 3BH8B 1K8IB 4G6KH 5DJ0B 3V4UH 2CKNA 3HZYA 3OKOA 3F7YB 4QKXB 3W82A 2DQEL 3WFBL 4P2OD 3KWWA 2W9DL 5AYUL 1A02N 4M5YL 15C8L 2A74A 3GJFK 3GI9H 4OZIF 5KSVA 2AK1L 2FD6H 3KPRE 1RULL 2ZOLB 4M1CC 4XPFL 5EIQA 4XNUL 3IS1X 3VA2C 5D2LB 2Z91A 4P2RD 3BEWA 3MRCA 1ORQB 3B43A 4NOBA 4U6HB 5LBSL 3HI6L 2AV1B 2VQ1A 5I8EA 2BY2A 4BSVB 3QNXA 1MWAL 2AXGB 2I9LA 2ZUXA 4HKZB 1RJLA 4CJ0A 1VENA 3PWNA 4K3HA 4OGAD 3VFVB 1UM5L 3UTQA 1QR1A 4YAQB 1MFBH 3TCLA 1BIHA 3C2SA 2BHYA 4BKLB 4X5LA 5IT2L 1AGEB 1MEXH 3BQUC 4D0CA 4F9LC 3UBXB 3EHBD 4K8RL 4PJ5D 1N64L 5HTSA 2NY3B 3E1F1 4GSDH 1URLA 5T3XL 5D2NA 5IBTH 3VGHA 1AHWC 2HRPH 2R0ZH 4NNXA 5I1LB 1IKFL 5HYJA 4H5SB 5I1CH 1IEAB 5BOZG 4ZUTB 5K9QI 4X7SL 3I9GL 4X4ZA 3VXQA 4FZEH 4RMRA 4LMQI 5CBEB 1HNGA 5E2TH 4QY8A 1OGAD 3HPJA 1VKXB 3QRFM 3U48A 2V5MA 3KLAA 2BSTA 4KMTL 3TVMC 1FNHA 5A16A 2VDRL 1LK2B 2R0WL 4LF3B 5K59E 3GHEL 4JCMA 4ZUWA 2P5EB 5DVKA 3ZKXB 2E7LA 3QPXL 1J1PH 1X5GA 4C55A 1EO5A 2UZXB 1D5XB 5EO1A 2ZKHH 1IC1A 2C1OB 4LIQE 1F8TH 2BVPA 2HTLC 5JZ7C 5DD3L 3O9WB 5L8LB 4L8SC 1AY1H 5HI3C 4XVSL 4JO2L 2I27N 4G5ZL 3UTSB 3HE7B 2IG2H 3L3HB 3MNVB 4XPGL 2XACC 3LH2L 1JZ6A 1MCFA 1S7XA 1VFAB 4QTHB 4MCYB 1O5DT 4JKKA 5FCSH 3RWJA 5IQ9B 2VSCA 1ZS8B 5CP7B 3VFPA 2ARJB 4HKBB 3KXFD 1XGQB 1N59B 1MCSA 5B8CA 1IT9L 1MJUL 3UTTE 1PKQE 4P2OA 1E4KA 3CFJA 5SX5K 3FO1A 1PY9A 3P11L 2R0KH 5D1XB 5EOCJ 2XN9D 3B4NA 4JFPA 4PJFF 1WT5C 2Z4QA 4JZOB 3RVVC 1DANT 2A73B 4WFEE 3RVUD 1YEEH 1T1YB 4XH2B 5ADPH 4L5FL 1I3GH 4P2RA 3ARDA 3VFMA 2IANB 4MA7L 4OJFL 1BP3B 4JVUA 5D7IF 4LPYA 1IGFH 1FG2A 4Q58C 4X98A 1RZFL 2DAVA 3NACL 3BDYL 2Q76A 3TNNA 1HQ4B 1DL7L 4NRXB 3DO3A 1TMCB 4M48H 1Q38A 4I3RH 2EDFA 4XHQA 4NNYA 1I4FB 4MQXC 2NQCA 2XRAL 4WHDA 5GRVL 4YBLB 1B0RB 5I1JH 3KS0H 3KPLA 2DQEH 1RZKL 3C6SB 3VRLE 3WFBH 5AYUH 1KJ2L 1OGAA 4Y4FC 4M5YH 15C8H 4Y16D 4X5XA 2DMKA 1OM3H 1RULH 1NFDB 4XNUH 4GS7C 4HIXL 1NCUA 3MO1A 3INUL 3MXWL 4ODSL 3ULUD 5LBSH 4LCYA 3HI6H 1INDL 5KANI 5DJXB 1MWAH 3MUHL 1H3PL 1RK0B 2EIZB 1JN6A 4XWGH 1F4WL 3K4DA 2EDEA 1UM5H 3RNKA 4D8PA 4LSVL 1I1RA 5H2BB 1N64H 4BH7A 4Y2DA 1RMFH 3KHOA 5F96L 5T3XH 2FATH 3C60C 1IL1A 3QXDB 3ZE0F 4C56B 1NBZB 4XPTL 1CVRA 2A6KA 2H32A 4X7SH 5SV3A 3S36H 5IB2B 3I9GH 2IMNA 1TIUA 3TYGL 1MREL 3OG6B 5I71B 3H9SB 2YEZA 4Q9RL 3CLEL 3BE1L 4KMQA 4UT6L 4KMTH 4YR6A 3WS6C 2VDRH 2VRAA 1QFPA 3KYOB 3MRHA 3OKNB 2R0WH 1CBVL 2Q8AL 1WWAX 4F7MA 1PQZB 4U1NA 3FT4A 2DLFL 3QPXH 4KXZI 5KSAB 3RX7A 4OBRA 1BEYL 2VLMD 3ARGD 3DUUB 3TEUA 1MCKA 3LEXB 5DD3H 1XH3A 1VFOA 2E5EA 3DI2B 3HTLX 1FL6B 1KIRB 2C4XA 4HIHB 4XVTL 4XVSH 3QUYD 4P46D 4MJ6A 1K4CA 3H8NA 4Z78A 2FJHA 4XPGH 2RCSL 3LH2H 4MB3A 4QRPD 1EH9A 2ICWJ 2NY0D 2IPKB 5T1MA 5FK9A 4KQ3L 3IDUA 2Y6SC 4MDIB 3AFLA 1IQWL 5ADOL 5IM7B 1DVFC 2WBKA 5IW1B 1DBBL 1A6AA 4D9LH 1MWAB 1IT9H 1MJUH 4ZPVB 3N1GC 1VEPA 4PJEB 5BS0B 4AT6A 4QO1A 1MOEA 1FFPB 3OF6D 2IADB 4L9DA 4Y16A 3U9UA 4BUHA 5K33A 1W2KT 4NZUL 5AYQA 4UNVA 4I3SL 1DBAH 4GAGL 1WBZA 2PN5A 3QEQD 3SY0B 1P5VA 1JYVA 4LCCC 4NCC2 4QCIA 3EOYG 2RIKA 3KWWB 4OJFH 3UJIL 4S0TD 3HNVL 2A74B 1CLZL 2OJEA 1HH9A 4CMHB 1Y18B 5KSVB 1OT2A 3PV6B 4R2GB 2YS4A 3K46A 1RZFH 3ROOA 1MCCA 1Q94A 4N0UE 4PJ7B 2FBOJ 3BDYH 1ZE3C 1QYGL 1UEMA 4P4KD 5LAXA 3BEWB 1P9MC 2G9HA 2Y07L 3MRCB 5JQ6L 5CEZD 2VQ1B 1Q9WA 4FQPA 3QNXB 2I9LB 4FFYL 4AG4L 1RJLB 5KVFL 3PWNB 2A9NL 3UTQB 4LLMA 1QR1B 5EOCL 3TCLB 1W0VB 1WZ1L 5J0BA 1RZKH 4D0CB 3AUVA 2A6IA 4Q0XL 1JNNL 5D9SA 4X4XA 5D2NB 4P5MA 4JFEE 1SEBA 4Z7OF 5HYJB 3PWJA 2Q3AA 1KBGL 4HIXH 2D7TL 3IFLH 3MXWH 4ODSH 3UPRA 3VXQB 4QY8B 1INDH 3ARGA 4XC1H 3KLHC 1EGJA 4GMSL 5D7JC 1H3PH 1FO0A 5A16B 3KLAB 2BSTB 1R0AH 1G7PA 1F4WH 4POUB 5KSBE 4YBQC 5JPMA 2DQHL 3QUYA 2B5IB 4ZUWB 5KJRL 2C4FU 3QPQC 1FZKA 5IOPA 4QRPA 4RZCA 5EO1B 1MRDH 4MJIB 1OL0A 4LCWE 2RAMA 3RJQB 2BVPB 3NZ8A 1E6JL 3NZHH 4XPTH 3TVMA 3UCRA 3CXHJ 4ONGL 3CGTA 3QWOA 4HAFA 5M94B 3O8XD 1MREH 2CJUH 4K3JH 1S7XB 3BE1H 3RWJB 1SEQL 5DRZA 4WTXA 1YN7A 3BWUC 1CBVH 2Q8AH 5IB3A 3VFPB 3G6JF 3PP3K 4WW2C 5IHUL 5MHSE 3Q48A 2DLFH 3GGWA 2E27L 4KAQL 4WHYG 5SV4A 2P5EE 1EGJL 4OIBA 1FO0L 3QEQA 4HFWB 1A6VH 1I1AD 5B8CB 3I3DA 3EOTL 4CVWA 3WO3B 4UDTA 3FJTA 4P2OB 1JPSL 4S2SA 3CFJB 1U3HD 3G9VA 2IEPA 4GKZA 3VRIA 3FO1B 3IAPA 3FFCD 5DJCA 4YH6A 4XVTH 1YEIL