1YNKH

Identification of key residues of the nc6.8 fab antibody fragment binding to synthetic sweeteners: crystal structure of nc6.8 co-crystalized with high potency sweetener compound sc45647
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
219
structure length
219
Chain Sequence
RVQLLESGAELMKPGASVQISCKATGYTFSEYWIEWVKERPGHGLEWIGEILPGSGRTNYREKFKGKATFTADTSSNTAYMQLSSLTSEDSAVYYCTRGYSSMDYWGQGTSVTVSAAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPSGPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords immunoglobulin kappa light chain
publication title Cocrystal Structures of NC6.8 Fab Identify Key Interactions for High Potency Sweetener Recognition: Implications for the Design of Synthetic Sweeteners
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 40
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2005-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ynkH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ynkH02
2GFBA 1QLRA 2VXSH 4O00A 2ORBL 1ZGLB 2EH8L 2XICA 2NR6C 2XKSA 5EU6B 4A6YB 2Q86B 4U1GC 2ICCA 3QCTH 4X7CC 5ITFB 3SGEH 3GGWA 1P2CB 5I15L 2NX5D 4ODVL 2J8UF 4PJ5A 2P5WE 4MNGA 5DJZA 1RHHB 1INDL 3FRPG 1A4KB 3JZ7A 1EEQA 4U1MA 4KKAC 3JTSA 4YFEA 1PQZB 4U1KA 5GS1C 1UCBL 5T5NF 3ZHDA 4GRMA 2CKBH 5A3ID 1AXTH 4N8CH 2NXZD 3HR5A 3PJSA 2ZG3A 4MNHA 1RIUL 4X7SL 3CX5J 1LDPH 3ULSA 3QAZB 5D2LE 4G43B 2CLZA 1YQ2A 3NTCH 2RJMA 5DJ8A 1OY3B 3QFJB 1YDPB 2QEJA 3CX5K 1KCKA 3BWAA 3C5ZC 5I1LA 4TRPL 4XXCC 5T5FL 4WTZA 1YPZA 1AI1L 4HUVA 4FFWD 1ZTXH 2PXYC 4XP1H 4KHTL 4MCYB 2VXUL 1W72H 3KR3L 4WDIB 5MI0C 2CGRL 1W2KT 4UTBL 1LP9F 2ZUUA 2V2WA 5KN5B 4UQ2B 3VFVB 4ZO7A 2EDBA 3CLEL 3WEXA 4K94L 4L8BA 1M7IA 5SX5H 5I9QB 1R0AH 1R6VA 4PRIA 1F13A 2FEEI 4WHDA 5BV7B 1KPRB 3GJFA 5DWUH 2W9DH 4X8XA 3WIHH 1U3HC 2VISA 5C0CB 4OBSA 3QI9B 3ZYJA 4ALAL 3OKNB 4R4BB 1U36A 3FB6A 5F1IA 1JWMB 1KG0A 1ZS8A 3UAJD 4OTXH 3VMPA 3O3AB 2BVYA 4OF6A 4E5XB 1RZJH 3AU1A 3VD3A 3SCMB 1CXLA 2H41A 3VFRB 2FB4L 2ED8A 1NAMA 2H26A 3BGMB 1ONQA 4ZSOE 1XH3B 3EFFB 1Z9SA 1YJDC 1CLYL 4JANA 1G7QB 2CIIA 4UI2A 4QY8B 4WNQA 3PDDA 4DGIL 3WFCL 3D39B 4X80L 5DJ0B 4KMTH 3SKJL 1LK2A 3PWNB 3WD5L 3T0DA 1YUHB 4UDTA 5HI5C 2YWYA 2B1HL 1RI8A 3HAEG 4XPGL 1JMZA 2YWZA 3N1MC 4GRWF 4ELMA 3ARBD 5I75B 3ARUA 3BZFB 1RUQH 4NN6C 3LDBC 2X4UA 5TH2B 1AIFA 1SMOA 3UCRA 2WP3T 3NN8B 3MFFB 1FL3A 3HNVH 5GZOC 3U4BH 4O4YL 1DANT 4JQVC 2VQUA 3S88L 3OZ9H 4X99A 2NY5H 5SWZE 3T0AA 2JIXD 1UADC 2B0SH 3RWCA 3I2CH 4Z5RB 3G5VB 3DYMA 3Q1SH 1OGAD 3QWRD 2ZUYA 1OT1A 1FGNL 5DEFA 5DUBA 3ZL4H 4MB5A 1QOKA 4PR5A 2XZCL 3TBWB 4OFIA 2V7HB 1BQLH 1LP9E 1KPVB 2ESVA 2I27N 3B8SA 2FEEL 2R1XA 3C08H 2I5YH 5I19H 1JMXA 1RZIB 4ZTOH 1FIGL 4QOKE 2W92A 3IDXH 1BBJB 2F53E 3HNTH 2EDRA 3GSNL 3QXTA 3C09C 5GSVB 4RDQG 2VLJD 1T0PB 5DRNA 1LGVA 3FOLB 2AEQH 1JIBA 3LMJH 4TUJA 5FCSH 5I1JH 3GRWA 3FFCE 4XVJH 5IESL 2VR5A 5CUSL 2CR3A 3X17A 4HMCA 1MSPA 1T89C 1TCRA 3PDOB 4OZHE 3D6GA 1RZFH 1NLDL 4WHYG 3RVVD 4OCYL 1P53A 2X4RB 5DA0B 3STZA 2QQNL 4XWOD 5BMFH 4XVUC 3MOAH 3RPKA 4O2FA 4PJAA 1I3GH 1XGPB 2XPGA 3MV9D 2GTWA 5D93C 1UACH 4KDTA 5JOEA 1Z5LB 3ARDC 2XN9B 5GJTL 1NBZB 2YRLA 5F96L 3DIFA 3NACL 4OI9A 4CVXB 2VLRE 4DZBA 4WHTB 4ODTH 3ILQD 4EN3A 1NUGA 4QRPA 5C0AD 3ZE0E 4UILH 5GZNC 3IXAA 3UX9B 2NLJB 1HZHH 4FG6C 1FVDA 4GRWE 5BRZB 4NKOB 1DBML 1RZ8B 2CO6B 3BVNB 2ZKHL 4P2CG 5LGHH 3BD3A 3UJTH 3QXDB 4HAFA 2WUBH 4KK8D 1KFAH 3BKMH 1E4XI 5KAQG 1FNGB 3QO0A 4ODUB 4QGTA 1UVQA 1OGTB 2AJSH 2X4TA 3MLWL 2DLFL 4D9LL 3IJSB 4N0FA 4WI7A 1KTRL 4R0LB 1J1XH 4IOFD 4HPYL 1I3UA 2B4CC 3QRGH 5DXWA 2HTLC 4ORGA 4LMQI 5F1SA 4WUUB 1NCAH 2BVTA 3HZVB 5IEHB 2BOBA 4N68A 3OG4B 3IJYA 4L3EA 3V6BR 2WUCH 4P46D 1X5YA 2PNDA 3KS0J 4OGYH 9CGTA 3P9LB 5FHBL 2QQLL 2Y5TA 3BAEH 4X98A 1HQRA 3TLRA 3O6FB 2LTQC 1DQDH 4ZUVB 1K4CA 3R8BB 2PO6B 1NH6A 3TO4D 3MNVB 4KY1L 4WW2F 4Y5XB 4LKXB 3TEUA 3H9HB 1I8IB 4JFQA 2BSRB 4I0PC 1Z6JT 3T09A 4DGVH 5TQ0L 4ZUWA 1UB5B 3CX2A 3F12B 2ZOKB 4FFYH 5GS3A 1ZE3C 3HNSL 4Q2ZB 1HHHA 2OQJA 5T5NG 2FLRT 5LCVH 4G42A 2X09A 1ULVA 4Q9CA 4RISH 1LD9B 5I17B 4KROD 3RI5K 2QTEA 4WU5A 5ADPL 3EYSH 4QHMA 4KHXL 1SHMA 2VLME 3OKEA 5IR1A 3MV8A 2KDGA 1QSEA 5CBEB 1ADQL 2GY5A 2WLYA 4QXUH 5KW9H 2ZCHH 2VAAA 1E4XL 3EOBB 3MO1A 1U8MA 1AY1H 3O3EA 3O4LE 3FQWB 4OZFG 3UPCA 3VFTB 4XGZA 1JFQL 3TBYA 2BXZA 5F7HA 1A6TA 1UM6H 3MRCB 4XNQB 1R3JA 5J1AA 3RFZC 4LNRB 1JV5B 4IOIB 5E95B 2WK2A 5GXBB 4NSKA 4ZAKA 3UTSA 3CXHK 1J1OL 1YEJH 1IGMH 3DETC 1SM3H 3QUYD 3MC0A 5C0ND 3IFOB 5J3HC 4OBRA 4F33A 1YC7A 4N0YL 2YHGA 4R26H 3VI3E 3BH9B 4Y5VB 3I3EA 2EIZB 2DBLL 5D2NE 5HYJE 2CLVB 5EZIL 2ZG2A 1VFBB 4MD0B 5FO7A 5TE4H 5IG7B 1R3IH 3FT2B 2UVEA 3WUWG 1C12A 3IB4A 1NJ9A 3BDYL 5IB5A 5EOTB 1IGCH 2DWDB 1IAII 3QEUA 1QVOB 4NO0A 5IMLB 4S0SD 1XIWB 3PWVB 43CAB 1LEGA 3CFDA 4L4TE 5DFWH 1LHZA 1EHXA 3SE3A 5C07A 4PRHE 3PV6B 3BZEB 3PWJB 3RTQD 4AMKH 3HLAA 1MQKL 1EAPB 4ZD3L 1MFAL 5C0EA 4JHAL 4BKLB 1WEJH 3S36H 3QT2A 1PLGL 4QHUA 4MXWH 5JA9A 3T3ME 1CFVL 4KMQA 4NQDE 2XKNB 3KPOB 1A5FL 2HN7B 5DQJA 1LDSA 3T4AB 1MFCH 2YPLA 2V2TA 1U8HA 3LKQA 3WJJA 5F3HB 3SDXB 3U9PL 5IMOA 4M6NL 4S1SL 4RBPH 3EZ8A 3QR2A 4EN3C 4LCWB 5I2IA 2DKSA 3JWDH 3QEHB 1QLFB 4P2QE 3ELAT 2OTPA 3CK0H 2HLAA 1ACYH 1UYWH 1NSNH 3RGVC 1PFCA 1A7OL 1FCGA 5FYJD 2HWZH 2NXYD 3PHQA 4XBPA 5CHNB 3RWJA 1T21A 2WBJD 2DYPA 3SKNA 1KUMA 3I6KA 4YHPA 3OB0K 3BMVA 2MKWA 3KGRA 3KPNA 2GTZA 2P5ED 4M5YL 3JWNC 1NC4A 3MYJB 1VEMA 2YOCA 3C5SA 4R7NB 5C08E 1I7TA 5B8CC 3S96B 1S7RB 1BFSA 4HS6A 1T7ZA 4P5KB 4K8RD 1AD0A 3WNLA 3QRFM 2FWOB 4EI5D 2CKNA 1IAIL 4JFDE 1XF3A 5JMOC 4ZS6C 3IDIB 2MHAB 5BV7H 4JGJA 4IMKC 4PJDF 3ARQA 3ILPA 3OWEA 3RWDB 2DTSA 1EMTH 5D7IA 4XP9H 4RFOH 3SO3C 3SDDD 1JNLH 4I3SL 4HKBA 1RPQA 2NY6D 3MRPB 1BHGA 1EZVY 4YZFF 3MGTB 1XGYL 4PJ7E 5DS8A 4AEIL 4UB0H 2FO4A 3PL6C 3PUCA 4M5ZH 3RHWF 1UB6B 2GI7A 3FCTA 4XMLH 2HFFB 4JM4L 4N9GB 5DTFB 3CMOH 1OF2B 4FS0A 4LMQE 1H0DB 3DUHA 2VDQH 1RURL 2BX5A 4NCDA 2V5TA 3ULVL 2OZ4A 4P5TC 5I66B 3DV6B 2VITB 1FFPB 3ARXA 4TSCH 2WANA 2Z93A 4H5SA 1RULL 2GJZB 4KJYB 5F1NB 4CMMA 1QFUH 4RGMB 5DJ2A 4FQ1H 1QBLL 32C2A 2E9WA 1MCWW 3KG5A 1QPXA 3WXWL 4RFEA 5C0GA 1MWAA 5FYLL 3GUTA 3VD5A 1LE5A 3K8LA 5JIHA 3CDGB 2A83B 1OGAB 1BVLA 2GK0B 2IQ9H 2VC2H 4W6WB 4HUXA 3T0ED 4AH2A 4I2XE 2L0DA 3VW3L 3JUYA 4XTRC 4M8VA 5EBLB 4WI8A 4PD4J 1RZKC 1YECH 3AROA 4OCLC 1AGDB 1RY7B 4XCYA 4GG6B 3LD8C 4Y4KB 2ZJSL 4JY4B 3QJHA 4PD4K 2ICES 1N64H 1N0XH 3MRRA 4JHBA 1FG2A 3MJ7B 3S5LB 2VXVL 5MP6L 3WLBA 5IFAL 5JXEA 4XWGH 2HFGL 4PJDE 1C5BL 1Y0LB 2NMSA 3TBVB 2EZ0D 5MEQA 4C56B 1IKNA 4AEHH 5E9DD 3SKOA 3QQ4A 1VGKA 3BKJH 4JFFB 4QHKJ 1HILA 5C0BE 3TV3H 5GHWL 2HLFD 4NC2B 1CGTA 1C5DA 3GSXA 5D7LE 5IMMB 2HP4A 2VO5A 3O3UN 4PJGA 4OGZA 2DMCA 3CPLA 3C6LD 1AH1A 2BRRL 4YHZL 1PDKA 5DRWB 4RQQA 4UMGA 4XNUH 2HKHL 1L6XA 1NANI 5JUEH 3BW9B 4KVNL 3P40A 1N5YH 3MLYH 4HJGA 4PJHA 2I9LB 3B2UD 3RA7L 1FLTX 1ZLUK 4Z7QF 5B3NA 3CFJA 1CL7H 4LBEA 3VFWB 2BCKA 2PYEE 5HYSB 3BKYL 4ZPVA 1CDBA 3WJJC 4PLJD 1KENH 5KJRL 3ARWA 1I9JH 1VHPA 4YE4L 5HPOA 3QIWA 3T0XA 5HDOA 3GBNL 1SBSH 2I25N 3SJVD 1HHKB 2VZ3A 4Q74A 3TVMA 3AREC 2AK1L 4ZUTA 4M00A 2R15A 1RZKL 3ALWA 4OIIL 1BGXL 2BSTA 4MVBD 1BF8A 4P48A 4FP8L 1B88A 1MHCA 4JDTL 3WO3B 1UJ3B 3OGOE 35C8L 3I75A 4GBXB 5C6PB 2DM4A 3TFKC 4V2BA 3FO2A 2GJJA 2PTVA 2R2CA 3DHMA 1NGXB 3G6DL 4EIGB 1E4WL 4Y2DD 1AR2A 3AXLA 4DKFL 4OT1L 3ULVE 2JTDA 4BFIB 1MVFA 1A22B 4PJ8D 5A1AA 3VWJD 1U95B 2JKXA 2V17L 3DUUB 4LLVB 3NZ8A 1Q72H 3O6KL 1A7PH 1A2YB 4WTZG 1CLZH 2NY2C 3GMMA 3LV3B 5ESVB 5FYLE 3ZKXC 1EJ6A 4UIKL 4E42B 5JDJA 1D5XB 1J11A 1T0NB 5AG9A 3QDMA 4K07A 4GO6B 3OJ2C 4ELKA 3N1GC 1NFIB 3BHBB 4G8GD 4CW1A 1RZGB 3T2QA 5C71A 4HMEA 2R1WB 4GUPA 3WCYA 1A3RH 5C9KA 4OD1L 5CJQL 2WQRA 4Y16C 4XNMB 3BJ91 4I18A 1BP3B 3VXPB 1YY9D 2AJVH 2W38A 5MEOA 2G60H 1CGUA 1FDLH 2LV4A 2JK5B 3EOAA 3CMGA 3U7WL 3QDJA 3EZJB 1FNSL 3VFSB 4Y8AA 1CDGA 3HG1E 2UY7A 4PTUB 4MXQD 4UUJA 1FBIH 3QFDA 3OAYH 5HHVL 2HFEB 5F9WC 4ZYKA 2OJZH 3QUYB 4AT6B 1HKFA 1R5IB 1V5JA 1PG7X 1BVKB 1ORQB 3LRGA 1JGEB 3DSFL 1QR4A 5KS9F 1AQKH 4RGOL 1ES0A 2P5WD 5CWSA 3MLRH 4BQCA 2Z8SA 2GJ6D 4S1QH 4PGCB 3X3FH 4NNPL 2K3TA 4HXBH 4KK9D 1K6QH 4KWUA 4OV5B 1FYTA 1DLFH 2AXFB 1PG7L 3KXFE 3P9MA 1CXKA 4YO0A 5J13C 4HZAA 5F1KC 3HKFA 4PREA 2BRQA 4KTEH 2DQTL 1YY8B 1RSFA 4B50A 2VLKB 3STLA 5HHQA 4Y4HC 5ETUA 5I74B 5H94B 2DJSA 4JB9L 2UVFA 4Z7WE 1YYML 4JRYB 2CDGA 4XZUA 3T77B 5M7QA 1KC5L 2YKLH 3EO1A 4D0BA 4HIEB 4R4ND 5E7BA 2HRLA 2AAVA 4ONHA 4PRPE 4GQ9L 1PKQB 1JPGA 3VE0B 4PB0H 2IGFH 3ZTNH 4OQ1A 4KDVA 2XG5A 1KELH 4NQTA 4HWNA 4MHHI 4PB9L 1J18A 5DC4B 4FXLA 5CBAB 4U33A 4Q6IA 1U41A 2BJML 1O5DT 5J6GB 5DO2C 4U1IB 4U6HB 1JWUA 1CG9B 4ODWB 5FGBA 4YAQA 5GRVL 1FZKB 3QJFA 4PJFE 3B9KD 2Q7YA 3CXDH 3O2VL 3V52H 5ESQB 4XP6L 1L9MA 4JN1L 3T4YB 4WO4D 5TGBB 1P7QA 1K2DA 2ADFH 3KLHC 1Q0YH 2SEBB 2NW2B 4FQ2L 1E28B 3QIWC 5DT1L 1S7WB 4R97C 5KSUA 4NOBA 3C60A 4ONFH 5EU3B 4L8CB 1TZGH 3ROOA 3C2SA 4XMPL 3RL2A 4Z6AT 5EOQH 5K9QI 3LS5H 3HI6L 2DQEH 3CSGA 1T66D 3C5JA 3P0VH 3LRHA 3NFNA 3WNMA 2E6PA 1XCTA 5IVZB 4W68A 2RQ8A 3IF1A 1CIDA 5HGDB 1KIQB 1I1AA 4GSDL 5BS0D 4FXGB 3DO3A 4LVOB 2YD4A 1J0IA 4OKVA 2E7MA 3V4VL 4APQA 1EO8H 5HHOA 4S2SB 4OM1L 4HKXB 4YEEA 2NY6B 1I1YA 2LABA 2Y1VA 5DA4A 1S9YB 3ZSSA 1MHEB 4PP1D 3H9YA 5FK9A 3LEYL 1CXHA 5SWZD 4DKDC 5IWLA 4GXVH 1FO0B 1Q9LA 4Z7VB 4ZDHB 1BAFL 1IAKA 5DDHA 2VQTA 1GOGA 3O2WH 3W9EB 2R0LH 5D6CA 5EIQA 6FABH 4URTB 3TP4A 4M1DL 1LNUA 2EDNA 4WUKH 3D3VA 1YNTA 4OLZL 1TJIH 2F53D 3MACH 4M93B 4YHKH 1JWSA 5JW3L 3UPRA 5DQ9B 4R90H 1MAJA 5E03A 1WAAA 2KBGA 4F7EB 4F3FB 2VLLA 3RZCB 3EO9L 5E8EA 3DMMB 2DQJL 2ZOLB 4LLUB 2R1YA 5JO5B 3HC0B 4FXKA 5ISZD 4IMLB 1ZSDA 4PRAA 2DL2A 4XBEL 1MCJA 1C5CH 5C0IB 1UEYA 2XI9A 4EI6A 4YGVB 4YQXH 4NQED 2QKIB 1FSKB 4M7ZB 3EOTH 1YNLL 3EO0B 1QNZH 3QUXD 1MHPH 1BM3L 1S5HA 1KBGH 1S78D 2X4NB 3RWIB 4K3JH 1MREH 1T0MB 2VLRD 5IKCB 1L0YA 4KK5D 1CQKA 4M43H 5FF6A 5D1ZD 4NUJA 4WEMB 2OL3A 1MJ8L 1XGRB 4HS8H 3SGEI 3EYOB 3RUGF 2F15A 4XB7A 5IVXF 1FRGL 3B9EA 5E9DB 3VXRE 4NWUH 2CDEB 5CD5D 1H8SA 3P30L 4LOUC 5MENA 2P1YA 1D9KA 1QSVA 3ARFA 4HGWB 1N59A 4KMLB 1RAMA 4QF1A 5C8JB 4UIMB 5IW6B 1WITA 3ARGD 4QO1A 1FVCA 2P24A 3C6LB 1TQBC 3LQZB 3OXRA 4WY7H 5E8OA 3G08B 1LWRA 3GHEH 1BJMA 1DQLL 1C8PA 4Z8FH 8FABB 3SBWC 1CK0H 4MNQE 3MBED 3HS0A 4LRIC 4W6XB 4YPGA 2DQCH 2VIRA 2W65B 3C2AH 4K7FB 3BIBX 4KUZL 4M1GL 4LQ1A 1FL6B 4NUGH 2WBWB 5HPMB 2DTML 1NLBL 4Q6IC 3SDCD 2R23B 1I8LC 1DUYB 4IIQA 4OLXH 4YK4C 3G6JF 3P11H 2VDML 5JR1L 2Q8BL 1J1PH 3T1WA 4NN5B 1F8TH 3H3PH 5I8KL 1MQ8A 3BJLA 4QRRE 4OGXH 3PGDA 3ZKQD 1A6UL 3FT4B 3GSWA 1WZ1L 1ZT4B 1LO2L 5AG8A 1I1FB 3V0AC 4Y4FA 3C60C 2EC8A 1CDIA 5C7XH 1UCTA 3HA0A 3HCVA 4BUGA 3QCTL 2P45B 4Y19D 1KJMB 1RZJC 4OF5A 2A6KA 1DQQA 1KTLB 4CJ1A 3LHPH 3FQRB 3DVFA 5DUPL 3VXUB 3HZKB 2BNQD 1SBBA 4PJBB 5CMAB 5H2BA 5ITBH 3HMXH 3D2UB 2RAMA 5TE7H 4B7LA 5KSVB 3HAEB 3WN5C 4UAOC 5D71L 5M95B 4EUPG 1ZXQA 4DFHA 5GJSH 1CXFA 2J8HA 3QCVH 1AXTL 3OPZL 4N8CL 1LE9B 5D7JD 4JFEB 4FQXB 4M6MH 2UWEB 2W0FB 1LDPL 3BFOA 5SV4A 5IWLC 3QUZB 2YPKB 3NTCL 4J1UB 1QQDA 4JZOB 1HSBB 5C92A 1F2XK 2OTWB 1Y18B 2WIMA 3GI8H 3WMSA 3FQTA 2ERJB 4QHKI 4KKCC 4LCYB 1CLCA 3HN3A 2A6JB 2HT3D 3CD4A 3L3GA 5DLMH 5HYJD 4XPFH 1MRFH 4NNYA 2FX8H 4P99A 1OLLA 4XP1L 3UYOD 1W72L 2NY5C 1XF4B 3LKSA 4DEPC 2A77H 3JV4A 4NJ9H 5ESAB 3WJLC 3D18B 1BEYL 1A7NH 3QUKA 3ZKNC 1VFUA 4LF3B 5C3TA 4ZXBC 4WCYH 3BPLC 3JWOH 5E6ID 1G9ML 4HUUA 4QLRA 3UTTE 4WGWB 1BLNA 1ZWIB 4RSVA 4X6BA 3X13A 2FBOJ 3GI9H 4TVPL 3MLZH 4N8PA 5HGAB 3G6JE 2W9DL 4PRHD 5DWUL 3UTPE 3WIHL 5EB9A 1M6OA 3RX5A 3MUY1 1FV1A 1NL0H 2DLHA 3ABZA 4OD2B 1FN4A 1N8ZB 3MUJA 5ALBL 4RRPG 1CLOH 4OTXL 1KCRH 4Y1AA 3S3SA 3CH8A 2PYFB 4GAFB 3VFGH 4R6UA 2GT9A 4L1DA 2WZPD 3QIBD 1PYWA 3UC0H 2H3NB 3BXNB 1ZGLA 3FONA 4PIRF 4LVNB 3NABH 1NEZA 4A6YA 2Q86A 1KLUB 5DF0A 4LL9A 5ITFA 5EO9B 4XX1E 5AYQA 3CFKB 3CSYA 3TBTB 1T4KB 5D2LB 4IRJA 4OZ4B 2B39A 1P2CA 4KMTL 1F6AB 5EWIH 2X1WL 4S1DD 2CRIA 4P2QD 1T22A 5DD0H 3GSVB 4L5FL 1HXMB 3O8XD 1RHHA 1RJYA 1A4KA 2VABB 3P4NA 1DDHB 2Y4SA 1PQZA 3DV4B 1S7SB 1D5MB 2X4SB 1Q0XL 2BY1A 4MSWB 5IB4B 2YD9A 1D9KC 2EDFA 3HNVL 3U4BL 3TYGH 2C9AA 3RVXD 3OZ9L 5IW1B 4G43A 1BIHA 3TPKA 3SGDH 4HUNB 2B0SL 2GCYB 3I2CL 3O0RH 3SE9L 3Q1SL 5HI3D 1YDPA 2R8SH 1GGCH 4L4VE 5EC2B 3ORJA 5DHXB 3L5XH 4YHIB 4JFDD 1ZT1A 4RMQA 3B9KB 1CICB 4WV1B 4MCYA 2APWA 2I5YL 3UROR 4WDIA 5I19L 1HYSD 4WO4B 4ZTOL 2XY1A 5J12B 1TJGH 1WIPA 5KN5A 4UQ2A 4QT5B 3IDXL 5DZOA 4V2CB 3HNTL 2CPCA 4TSBH 3NPSB 4QRQB 5FO8A 3VFVA 3D69B 3DYOA 2V6HA 5E2JA 1T5XA 2KZ1B 2BSSA 4MHHG 3KVQA 4ETYA 3O6LH 3LMJL 3HR6A 5E5UB 1CFBA 4CMHB 5I1JL 3QHZH 4ZSOB 1UWXK 2XA8H 5C0CA 5LKNA 5DJYB 1S9KC 3OKNA 1TQCC 3L95A 4R4BA 4UT7H 1JWMA 5L2KD 4QTIH 2X9YA 1M7DB 3KPRE 1AE6L 1F3JA 3B5GA 1DEEA 5BMFL 1LO3H 4H0GA 1XGQB 5CKGA 4E5XA 3MYZA 4F9PA 1JGLL 3IKKA 3MRJA 4POUB 3SCMA 2D4DA 4E41E 1OAQH 3QDHA 4K8RH 3ME0A 2E7LA 3VFRA 1UACL 5FHAH 1S9WB 4BSWB 1A6WL 1IC4H 3BGMA 3NFSL 1XH3A 3EFFA 5MERB 3SOBH 1G7QA 4NN7B 4KPHH 1R3LB 1Z9OA 5K9QG 4QY8A 4ODTL 4JQIH 4UILL 2LVCA 4TVPE 3RDTA 3D39A 3DSNA 1HZHL 2WSKA 3GMNB 4OGAC 5DJ0A 5HVGB 2D9QB 2Q8AH 3PWNA 4OF3A 3IU4H 3VD4A 1YUHA 3K2UH 4KGJA 1PAMA 4JM2D 1OAXH 2FJFB 1LP9B 2E27L 1MCPH 2CRMA 1JGDB 3BZFA 4JG0H 3OHXB 1K5NB 5TH2A 5I8OH 1IE5A 2FX9H 1KFAL 1IFHH 3NN8A 5I16B 3MFFA 1HIMH 3MMEA 3U7AA 3U9UB 4LAQH 4QOKB 3RWHA 4B41A 1MCKA 1DCLA 4FQJL 2AJSL 3MGAA 4OZGF 4Z7UE 5JQ6H 4HWZA 4U6VH 5D1XC 4Q7DA 1FC1A 4Z5RA 3G5VA 3FFCB 3NCJH 1NMBL 2VDLH 1J0YA 1J1XL 2DIBA 3K3QA 4RIRB 1ZHBB 3QRGL 3BD5A 5GGTH 1KPVA 4OZHB 4XHJC 3WUWB 2AKRB 3OL2A 5EU7E 1RZIA 3DROB 1KCUL 4L3CB 5KVEL 4FHBD 1KPUB 4OFYA 4OGYL 1CBVH 1BBJA 4JKKA 5SWSB 1RIHL 5FCUH 1IT9H 3KLDA 1C1EH 1K8DB 1AHWC 1BD2A 3LQAH 1DQDL 5GSVA 3HFMH 2YBRB 3FOLA 4PTTB 3IFPA 3IU3A 3SGKA 2FCBA 5TDPB 1G1CA 2X7LB 1VGEH 1H3VA 2EIEA 1U6AH 4U0RC 3F7PC 4KQ3H 3FRUB 5DURD 2VLRB 2J5LC 3G5ZA 2OR9H 3PDOA 4DGVL 1N6QH 1V7NH 1VPOH 5D9SA 2NPLX 2X4RA 4XP4H 4GRWB 5HGBB 4C55A 1I8MA 4G6AD 4FFYL 1QSFE 1T1YB 2PYED 4LSUL 1KOAA 3GNMH 1XGPA 2Q20A 1RUMH 4OB5L 1QKZL 5LCVL 2QQQA 1VCAA 1JRHH 1F42A 4IM8A 4RISL 2R2BB 1KJ2B 2P42B 4U1GB 1MCIA 3EYSL 5JIPA 2XN9A 3IAGC 4QRTB 5CKAA 1HEZB 1NBZA 2HH0L 2VERN 3QDGD 2AABL 4CVXA 1DR9A 5KW9L 4WHTA 4F7PB 5FKAB 1OTSD 2C1OB 2H32B 4P4KD 5H35B 1AY1L 4P2YA 2NLJA 3QNZB 4HJ0D 1P84J 5I6XC 1RK1A 3UYRH 3RPIB 4PGEB 3JWDC 1Z9LA 5F9JB 1DFBH 3K8KA 2QADB 2Y7QA 5SX4H 3ULVD 1P84K 6CGTA 2IBBA 3QAZC 4UINH 4DJMA 4DAGL 5L6YL 1FNGA 4ODUA 4PP2A 3SO5A 1H9VA 2IBZY 4V1DA 3PABB 4R26L 1OGTA 1MCEA 3LSOB 5C2BH 1PJ9A 3C5ZB 1ND0B 1U42A 1S7QA 2VJXA 3IJSA 4HIXH 4U1SB 4R0LA 2PXYB 1OSZB 5IEKB 4X5XA 4NQVB 2VQ1B 4TNVK 1MCRA 2EKJA 3CFBB 4LSSH 2FR4B 1MFEL 4WUUA 5IEHA 1MCWM 1CZ8H 3KPSE 3IETB 4WFFE 3JBG7 3FT3B 4LHUD 3S36X 2BP3A 1I1RA 4P3DA 5ACMA 5BV7C 4WFHE 1PY4A 3FMGL 3TA3C 5E2WH 3O6FA 4BSVA 3FZUC 4ZUVA 5KVGH 4PJ9D 1EAJA 3QI9C 2PO6A 4PV8B 3MNVA 3HRZB 5I18H 3PHOB 4Y5XA 2JB5L 4DGYH 2LU7A 4LKXA 3S36L 2CRZA 2YR3A 2H2PD 2X1OA 3GSNB 4KKBC 1I8IA 4HIIA 4MXWL 2BSRA 4G6JH 1T83A 4MA1C 4F9PC 4J7RA 1EPFA 5BXFB 1HE7A 1UB5A 2QHRL 3F12A 3O4LB 1G9NL 4D0CB 4P59L 5IHUL 3SCMC 1J0KA 4EXPX 5E5RB 2KPNA 1P7KB 2EDKA 1F45A 5KZCB 5EN2B 3MJ9A 2YN5A 2WWKO 4L29B 2VWEC 4QXTB 4U05A 3HG1D 3QQ9C 5E2UH 4NCC2 4O02H 4R96B 1F90H 4IRSD 5I17A 3X12B 4MQXC 3F6IA 4U3HA 5K9JH 3U48A 1EUUA 1G7MB 5CBEA 2JCCF 3RNKB 1S5IH 3JWDL 2E9IA 5CZXC 1YEFH 3OKMB 4KDWA 3CK0L 3RVTD 3MREB 3EOBA 1UYWL 1NSNL 15C8H 5HYJB 1KEMH 4LLMB 4X4ME 3CU7A 3FQWA 2OBGA 5F7FA 1WUNT 3NCMA 3VFTA 4BZ2H 3TZVC 2QHLA 3LDBB 4Z77A 1B6UA 3KXFD 5FOBB 2HWZL 4U1NB 1T1WB 4MQ7B 3BPCB 3MRCA 4XNQA 4ZUUB 4PJXE 1AGEB 1JV5A 3DYPA 4IOIA 4TNWK 2YD1A 2Z35B 5CEXA 5L8KB 1NMAL 2C4FU 4QRUB 5IHLB 5JNYB 3TIEA 4MJ4A 3IFOA 1MH5B 4L4TB 4WW2B 2ARJQ 3V0VB 4AG4L 3WHE1 3BH9A 2VNCA 3LH2H 3VWKD 1JF6A 2M1KA 4ZFFB 4YX2H 2EIZA 3U1SH 4LASH 2QSQA 2CLVA 1NCWH 5JW4Q 1XGUB 1VFBA 4MD0A 3QSKB 3L6FB 5IG7A 4H0IA 2WWMD 4FZEL 4XP9L 4RFOL 3IXTB 1R5WB 1YQVH 4PJ5E 4PRPD 4MNGE 4G7VH 1JNLL 3ZTJG 1RUKL 4NQDB 1AR1D 3TESA 2O26U 4M7JH 5EOTA 3P4OB 3VG9B 2DWDA 5E8NB 3QIBB 1QVOA 5IOPB 4MJIE 1XIWA 3PWVA 4M5ZL 4WTWA 2EXYD 43CAA 3BEWB 4G6MH 1NBYB 4I3RH 1FVEB 4XMLL 5EDXA 1WVZA 3PV6A 3BZEA 3PWJA 3WS6A 1EAPA 3NCCB 1UZ6F 4BKLA 3QXAA 4E0RB 5E6ZA 4TSAH 2VDQL 3L9RB 3WIFA 1JI2A 2VB5A 3V4UH 4P2QB 1EVUA 3TJHD 4HCRH 1H5BB 5IHBA 4IJ3B 4JAMB 3O8XB 1WBYA 2HFTA 2XKNA 3MV01 3KPOA 1YPZE 4K9EL 1IQDA 4TSCL 2OCFD 4JFXB 3T4AA 4OQTH 5D93B 3MODH 5JPMA 1D5ZB 1JPSH 1QFUL 1NEUA 5IFHH 4FQ1L 5F3HA 5ILTL 3GO1H 3SDXA 1CL7I 5FO9B 4J4PD 3F5WB 4P9HH 4JJHA 4LCWA 3AY4C 3OXSB 1IGTB 3WXVH 5C08B 5BZWB 2W9LA 2MWCA 3HE6D 3QEHA 2WBKA 1QLFA 4HW6A 4PRIE 1CU4L 5IB2B 2VC2L 2IQ9L 4PRNB 3RVWC 1UM4H 4JFDB 1QFPA 4LPYA 1NUFA 1VADB 4XPHH 1F4WH 1YECL 5J11C 5CHNA 1AQDB 2PTTB 5AZEH 1C16B 1MEXH 1N64L 1X3DA 1QSZA 1N0XL 4HULB 3PHSA 3NCFB 1KXVC 3MYJA 4GRLD 4JREB 2JJSC 4R7NA 1EFXD 2MSPA 3S96A 1S7RA 3DGCR 4XWGL 4P5KA 3AAZB 2FWOA 3O2DH 4TUKH 2DQFA 3IDIA 2MHAA 4AEHL 3V79C 2X9XA 1FL5B 3RKPA 4TQEH 1AO7E 4JZJB 1KIPA 4MAYD 1F4HA 3TV3L 3MRPA 1MY5A 3MGTA 3QEQD 1WQVT 4TOYL 1AGBB 2LTQB 3UXFA 4ESKA 4NBXB 1HK6A 3H7LA 4PJCF 1QBBA 1IC5H 4Y5XC 2X89D 1UZ6E 4XNUL 1UB6A 1JE6A 3AS0A 5JUEL 4KRMB 5DTFA 3FN0L 5ABDE 3MLYL 1UZ8A 1DBAH 4I0PB 3O9WD 3NAAH 3FB7B 3LB6C 1H0DA 3BE1H 5DEGB 5ACLA 1F6FB 4OZIF 5I66A 4D9RE 3T65B 1FFPA 1IKFL 4I2XB 5HHME 2RIKA 3TPUB 1YC8A 3L1OH 2ESVE 3RBGA 1I9JL 2W9EH 4RWYH 2GJZA 4KJYA 4XHQA 3LKPA 3MRKB 4DKEH 5F1NA 2BVOA 1A1OB 2A2QT 4WWKC 3U46B 4K3GA 1SBSL 25C8H 3FQNB 1CFSB 4UU9B 2E9JA 3JV6B 4PGBA 4ODVH 4ZFZA 5EU4A 1OAZL 1AD9B 1P6AB 3OJMB 1JZ2A 3CDGA 2A83A 1UEMA 4LU5H 1CDYA 2RR3A 2GK0A 4PJDB 3VXME 2EYRB 2Y36L 5EBLA 2A9NH 2VWEE 4MD5A 5KTEH 1MCOH 2HG5B 3VXRD 4ETQB 3IRZA 1CGSH 1RZ7H 1RIUH 1IGJB 2JJVA 4XPTH 5C0BB 4B7IA 4GG6A 3GSRB 2IPKB 4Y4KA 4JY4A 4PJAE 4DZ8B 5D7LB 1X5HA 1Q72L 5C6TL 4GKZB 4Y5VC 5T5FH 2LAGB 3S5LA 1AI1H 3W0WD 4NNXB 1ZVYA 1F4AA 4IOSD 1AKJA 1FORL 4KHTH 3KR3H 1Y0LA 1WJ3A 4O58L 3TBVA 1CS6A 2CGRH 4X6DF 4C56A 4JPVH 4MNQD 3DARA 4DVBB 1IMHC 3TWCH 4GFTB 3PE9A 3SKUD 4JFFA 2A1WH 3RIFF 2GAZB 3OG6B 3CLEH 4K94H 4AEEA 4HUMB 2G2RB 4PJCE 2PYEB 2AEPH 1UQSB 1WSST 4JQXC 4FQCH 3K7UA 5DMIL 1QBAA 1MFDL 3H3KA 5ICYB 2DI8A 4ALAH 5DRWA 1LO0L 3LPGA 5I1GH 3G5XB 4H26B 1A3RL 4F7MA 2MPAH 4YXHH 4OZIE 1KJ2H 1J12A 1NC2B 2I9LA 4P4KB 2E5EA 2IPTH 5HTSA 4QRRD 2G60L 1PZ5B 3VFWA 2FNBA 4RMTA 3MGOB 2J7LA 3NZHH 5A3IC 3O81A 4I4WB 4M3KB 2NXZC 4ZFOL 4L3EE 1FBIL 4U6YB 3MJ6A 1X5IA 1ZVHA 2ZZUT 1HHKA 4DGIH 1RK0B 1JGVL 3L3HB 3I02A 4X7TA 3OB8A 5EIVA 1AQKL 3AGVA 3MLRL 1MOEA 2B1HH 3VD9A 3U0TB 3W5MA 3X3FL 4TTDD 5D1QB 4FFWC 4YDIH 5DSCA 1UJ3A 1K6QL 4GBXA 4LP5A 1DLFL 4ZO9A 2GY7B 5AUMB 1NGXA 4JO2H 2D0GA 4O4YH 3PP3H 2F74A 3S88H 4HKJA 4BFIA 1FZJB 4LHUB 5FYKE 1EXUA 5DZNA 4MZ3A 5IIEB 1U95A 3DUUA 3UZQA 4LLVA 3B43A 3TN0D 5B8CB 1OW0C 1FGNH 1A2YA 4IHOB 1Z0NA 2X4PA 2XZCH 4X6DE 5CJOH 4PLKD 2MQ3A 5ESVA 2YKLL 3A6BL 4NZDA 1MLCB 2FL5A 3TNNB 3UAJC 1QSEE 1CFTA 2G5RA 4E42A 2QV2A 5F89B 1D5XA 3E3QC 4XRCA 1SYSB 3VXSA 1U8IA 1FIGH 5EFIB 5CJXA 3GSOB 1T0NA 1Z0MA 2IGFL 4DK6A 1CTOA 3GSNH 1LVEA 1KELL 3O6MH 3LVEA 1IGFH 4B53A 1NFIA 2V9TA 1IEBB 3BHBA 1ZLWK 3PL6B 2ADGB 2FEDC 1RZGA 1F3RB 4HKZB 3HG1B 4IRSB 3UTPD 4UNTA 4LLDB 1SJXA 2R1WA 5EZJB 4JPKH 1B0RB 1NLDH 2QBWA 4LSTH 1FFNB 3V52L 4LEXH 4KGLA 4XNMA 1U91B 4Y89A 5HDBF 5E94A 5IROA 3O3DB 4GMSH 4P5TB 5HYQB 1Q0YL 5GRUH 5I1IH 3VXPA 1KSRA 2H2SD 3ARBC 4ZTPH 4KUCF 1ZLSH 3Q48A 3TCLB 4RGMC 3DUSB 3VFSA 1CFNB 5GJTH 4QHLA 4ONFL 5EOQL 3UZEA 2HFEA 1WFUA 3VGGA 1KN4H 3QUYA 5EA0L 4M62H 3P0VL 1QLEH 4AT6A 3MZTA 4E9LA 1R5IA 4KV5F 3EJJX 1ORQA 1JGEA 1YMMB 5J57B 1MJJA 5IJVB 2N7AA 1DBMH 5TFSL 4Z7WB 4PGCA 2YD5A 2ZKHH 3BI9X 4NP4L 2BVQB 2E3VA 4OV5A 1TITA 3MPCA 5CP3A 2H6PB 1EO8L 5GRYA 3QNXB 1T1XB 3ARSA 1YY8A 4YDLC 4J8RA 2VLKA 2FZ3B 2Z4QB 1XEDA 3JV0A 3C6SB 3EDKA 5H94A 3EGSA 3HE7D 2DD8H 4UDUA 3O2WL 3QHFL 4JRYA 3RWFB 4S1RL 5EO1B 3QUML 4KKLD 4PJFB 3RVVC 3T77A 5B38G 1YEIL 4XWOC 1YN7B 3V9FA 1PKQA 3WLWD 4JFYB 1T7VA 3VE0A 2FLBT 3SDAA 1G7PA 3MACL 5FM8A 4H1LA 4YHKL 3SEPA 4I1NB 4JEGB 2AV1B 4R90L 4ZG1A 1QEWB 1FZOB 1CIUA 5CBAA 3MRMB 2B5IC 1B2WL 5E8DL 2YN3A 5J6GA 4U6HA 2ICWA 3WNNA 5HDBE 4X7DC 5KS9B 4ODWA 1FZKA 2A6IB 3ILQC 5TQ0H 1D5BB 1ORSB 2IAMD 3LN5B 1MFBL 2C3WA 5ESQA 3U6RA 3T4YA 3IYLW 1GSMA 4BFBD 1C5CL 2SEBA 3JV5A 2NW2A 4FFVD 4H25B 3VFOB 4NKIH 1KXTB 1N0LA 2A0LD 4KK8C 1ZOXA 5C0JB 1S7WA 1EGJH 1QNZL 1YEEL 3OAUL 2XA3A 4DUXA 3HUJA 4KHXH 1MHPL 1MCCA 4LGPB 1U8PB 4JR9L 4KV5E 1KBGL 5EU3A 4L8CA 3AREB 1ADQH 3NGBC 2DF3A 4I5BA 4K3JL 1MREL 2NX5E 4L9DA 4QXGL 3P2TA 1JPFB 1HHGB 1WZLA 3NBNA 1Q9WB 3S3JA 4M43L 1L0XA 4IOFC 5IVZA 4EUPB 5IF0B 1BECA 3ZO0A 1JFQH 3WHE0 4U1JB 5FA3A 1JGUL 1KIQA 1OSPL 5HGDA 4HS8L 4NKDA 5CCKH 4F58H 2OK0L 1F4XH 3OKDB 4NWUL 4P46C 2VH5H 4S2SA 4MAYB 4HKXA 4YIQB 1P9MC 1DQTA 1S9YA 5ENWB 1MHEA 3ISWA 3H9SB 4NFBA 2ZP0T 2DBLH 3INUL 1FO0A 5FUCC 3TO4C 4PLNC 1NBQA 5EZIH 1NFDF 3GHEL 4ZDHA 1WZMA 4K2UH 3BP6B 3W9EA 4JVWA 1CK0L 2P49B 5CJXC 5EH1A 4B5EA 5F72S 3DGGB 1BWMA 3C87A 3GBML 2WIIB 1CTNA 1TTFA 3F7QA 4JKLA 5ELIA 4O9HL 1PG7W 1NGYB 4KROC 2EIDA 3BP7A 1MQKH 5DFVD 3RZWA 1MFAH 2GEEA 3OMZA 4JHAH 4F7EA 4OLXL 1PLGH 3RZCA 2FATH 3DMMA 3P11L 3JWOC 4U0QB 5IFJA 4RNRB 1F8TL 1MCDA 4LLUA 5JO5A 5F7EH 1A5FH 1JNHB 4J3VA 5DD1L 5GGVH 4IMLA 1FJ1B 5C0IA 1SJHB 5E08H 2L7UA 4YGVA 5JW4N 3FB5B 4RAUB 2QKIA 4ENED 5C7XL 5IMKB 3EO0A 4AENB 7FABH 4M6NH 4G6FD 1RIVL 5B4MD 3QUYC 1TLKA 5C0NC 2X4NA 1WT5A 1F3DJ 3MV7D 1OARH 3LHPL 1YYLH 5CIPB 2D4FA 1T0MA 1CVSC 1ZA3B 4F80A 3OF6A 3FRPA 4YUEH 1ZT7A 3OV6A 1A7OH 1FNFA 5F6HJ 2Z31A 2DQDL 5BW7C 4MZ2A 4FTVD 1JZ7A 1XGRA 3EYOA 1MI5B 2GW5A 5FUZL 5GJSL 4KFZC 4MNQB 4WWID 5T3ZE 3FAXA 1IGYB 4NQCA 2XKUA 4NIKB 2D3VA 2CDEA 1TNNA 5F1OB 3M17B 2X4QA 4OCRL 4M5YH 2FD6H 3EFDL 2XXCB 4Y4HB 3IDJA 4HGWA 3QPQD 3D25B 5C8JA 1NFDE 3NCYP 1S3KL 3GI8L 5IW6A 3MLTB 4ODHH 3RTQC 3BYYA 3C6LA 1SEBB 5HHPA 3LQZA 5DLML 4XPFL 2FRGP 4HC1L 5HXMA 3ZHLA 8FABA 2JF1A 2A77L 1AFVL 1RHFA 2YS4A 3KPSD 5HGHB 4GXUM 2W65A 2NTFB 4KTDL 1XGYH 4QRRB 5EORL 3ALPA 4K7FA 1EVTC 3SY0B 4NRXB 4AEIH 4AL8H 2VLJE 4X6FB 1FL6A 4F37F 5HPMA 3AMKA 3HI5H 2QSVA 1PBYA 3MNWB 5KSBF 2BNRD 1XR8B 1J8HD 2R23A 1F11B 3D85D 1DUYA 5TDOA 4F7CB 1BZQK 5F88B 5EBWB 1D3CA 1WTGT 5IHZB 2UUDK 3AC0A 4Z7OE 2F5AH 5IQ9B 3MCKB 4C83B 4QGYA 3ULVH 2P46B 1E6JL 2V5RA 2R2HA 4JN2B 4POZD 3A67L 3RUGB 4U1HB 1UT9A 3MV9E 1ZANL 4ONGH 1TVHA 3FT4A 1ZT4A 1AXSB 2NXYC 3UC0L 5DVKA 4FZ8H 5AD0B 5DK2B 3TGXA 3WXWH 1DN0B 5A2JH 2FHBA 4WEBH 1KJMA 4P2RE 2VAJA 3MRQB 1KTLA 5C0AE 3TN0B 3FQRA 5C9JB 3VXUA 3HZKA 2EDLA 4K8RC 5CMAA 1J8KA 4NGHH 3D2UA 5DD0L 5F70A 4LSDA 5D72H 3EYQD 5KSVA 12E8L 3HAEA 5T1KA 4OI7A 4LVOC 2MQCA 4AIXA 3RX8A 5L2JB 4YC2C 1W0VB 2ZJSH 2NY6C 5A16A 1LE9A 5K93A 4JFEA 3B2VL 4FQXA 2UWEA 5A2LH 2W0FA 3TYGL 5BOZG 4HWBL 3UTTB 3QUZA 2VXVH 3QDJE 4JZOA 1EEZA 1HSBA 1BJ1H 4D0DB 2R8SL 1GGCL 1C5BH 3M8OH 3G6JB 4XC3H 5D6DA 3PP4L 4PJIF 5FGSA 5TE6L 4LCYA 3L5XL 2A6JA 2HMID 4W6YB 4HH9B 3MLPA 2IANA 4LSPH 3LCYA 1EO5A 1G7IB 4O51A 2DRUA 5GHWH 5ESAA 4PJ5D 3THML 1TJGL 3S3PA 4LF3A 4PY8J 1XF1A 4TSBL 5KSBE 4GAJL 2PETA 1BIIB 3CVHH 1P4LB 1ZWIA 3O6LL 5FUCE 4HT1L 5F44A 3TJEL 2HKHH 3PP3K 3L7FB 1OB1A 5HGAA 4NQXB 2NY4D 4NRYB 4WI6A 5FYJL 2Q6WB 4UT7L 4OD2A 4YFLI 3I50H 1N8ZA 2EDDA 3LQAC 3T0EC 4L4JA 2VDNH 1LO3L 4YJZL 4F15B 1UM5H 4JRXA 3BKYH 2KQMA 3PXJA 4QRSA 2PYFA 2HJLB 5KJRH 3UO1L 2Y5EA 2AW2A 3RKDD 1KN2H 2X41A 1IBGH 3BXNA 3MJ8B 3GBNH 4BSJA 1CGWA 3KJ6L 3W39B 2Y07L 3SOBL 1KLUA 1B4JH 4EDXB 4KPHL 5EO9A 3CFKA 4G3YL 3QG6A 4PG9B 4WJ5A 5D2LA 3TBTA 4JDTH 3DBXA 4OZ4A 4KJQD 3B83A 1JRHI 4PRID 2Q8AL 5JPNB 4L4VB 4AIZB 1ZEAH 2RGSA 3GSVA 1HXMA 2EZ0C 5KANI 1OCWL 1OAXL 4H20L 1MCPL 2VABA 1I7UB 2WINA 1DDHA 1P4BH 3DV4A 4JG0L 1S7SA 1D5MA 4XCNB 2X4SA 2XWJB 5I8OL 2FX9L 4MSWA 5IB4A 2HLFC 5HVWA 2V17H 1MPAL 1N2RB 5J89A 4LAJH 1ZAGA 3O6KH 43C9B 5IW1A 3BQUA 1OM3H 2N7BA 2OXGA 2ZSWA 4PJIE 3C6LC 5JQ6L 4U6VL 2GCYA 5DHVH 1TQBB 5ID0A 1LO5B 4FMKA 3NCJL 4LDOB 2WP3O 5SX4I 2IMMA 2VDLL 5EC2A 2F9BT 3DXAB 1WWWX 4UIKH 5GGTL 4YHIA 5EO0B 1KULA 3S4SB 3B2UC 1I8KB 3B9KA 3MXWL 1CICA 3BT2L 4NQUA 1TETH 3KPRB 3AMLA 4JY6B 4WO4A 1AO7D 4JFOB 3KPMB 4WI5A 4QT5A 5JOFB 3O41B 3L3OB 4PLJC 5FCUL 3D69A 1IT9L 1W72B 2F19L 4E41B 1OAYL 4F2MB 3LQAL 4HZLA 4K55A 3HFML 5DQDH 2QJDA 2C3VB 4ZSOA 4HK0B 4X9GA 1U92B 4Z7VF 4YK4B 1WCQA 2E8YA 4MVBC 2J8UA 4KQ3L 5JZ7D 4Y5YC 1FGVH 5EZLB 1Q94B 3BO8B 1IL1B 1GGUA 1GPOL 1VPOL 1BZ7B 1M7DA 3L5HA 1JTTA 4D9RD 1XGQA 3U7WH 1FNSH 1BOGA 5HHMD 5HYSG 4KVCH 3MLXH 1FZMB 4Y2DC 1RUML 2ESVD 3DI2B 1KF9B 2AXHA 1GC1H 4CUCA 4BSWA 1TZIB 4RA0C 3VWJC 4JO1H 4K7PX 5MERA 3D3VE 3RWEB 4WI4A 1R3LA 5TJWK 4RGOH 4MJ6B 3ZLQC 5ID1B 2BNUB 4X5LA 5IJKA 2UV3A 4KJWC 5K33A 4OZFA 4YFLF 3WN5B 4OD3H 3GMNA 4KZDH 4KTYA 1PG7H 5FYJE 1SY6H 1K4DB 1T04B 1LP9A 2FJFA 4Y2OA 2D0FA 1JGDA 2O5YH 3OHXA 1DFBL 1HN1A 4YDVB 4UINL 5I16A 2P5EE 3U9UA 4QOKA 1F4YH 1D6VL 1HI6B 4NC0B 3VFMB 3BIKB 4LIQH 5C2BL 1YYMH 3BN9D 4F9LA 1DQMH 5E4IA 4XMKH 2HT4D 3FFCA 2AGJL 4HIXL 1HCVA 2AV7B 3ZE1E 1T7YA 2GYSA 3U4EA 4RIRA 1ZHBA 2OM5A 4AIOA 1FCCA 2XACC 4LSSL 4GQ9H 1MHHB 1QFWL 3WUWA 3MRIB 2AKRA 1YY9C 2DMKA 4I48B 3DROA 4L3CA 4ZXBB 1HKLL 1KPUA 1QSFB 3U0PB 3GM8A 4HAGA 5SWSA 1I9RH 5E2WL 4X7FC 4BQ9A 4MXQC 4EZMA 5KVGL 2YBRA 5GS0D 1J7VR 3KYMB 5TDPA 2DLTA 4DGYL 2OYPA 1UXWB 4XP6H 4X4YB 4KC3B 4JN1H 3FRUA 2VLRA 4HX1B 4FQ2H 4KK9C 5HGBA 2GK2A 3GIVA 5CIPH 3RNQA 1T1YA 3VRLF 5KVMC 4ZS6D 4O02L 4QHNB 4LVHC 1F90L 4XMPH 2R2BA 4L3ED 2UZIH 2X2YA 4U7SA 5K9JL 1BWWA 4QRTA 1HEZA 4YGAB 5ADOL 2BFVH 3KPQB 4LCIL 5J0BA 4I9WD 1S5IL 5FM5O 3PGFL 1YEFL 4F7PA 2H32A 4QTHB 5H35A 1G0YR 15C8L 1B3JA 3QNZA 1IZKA 1KEML 4GSDH 2B8OT 4BZ2L 4R4NC 5GS1A 5T33L 4P9HC 3RPIA 1U2HA 4OM0H 2M26A 1K3ZA 3A0OA 3KPSB 4PGEA 5F9JA 1S8DA 5CFHA 5FYKD 1X44A 2DIAA 2WV3A 2YD6A 1CFQB 3PABA 4PJBF 1BAFH 3LSOA 3D85B 3C5ZA 1ND0A 4YX2L 4XXCA 3U1SL 1S7UA 3RU8H 1NCWL 4GAYB 4U1SA 3MLSH 3B9KC 2PXYA 4WV1C 4M1DH 1X4YA 1OSZA 5IEKA 3MV8D 4NQVA 3BGFB 1QSED 5DRZB 4HFWB 4WO4C 1I7ZB 2VQ1A 2FR4A 2HT2C 1A0QH 5J12C 5K9OB 3IETA 4N5EC 5EPMA 1I1CA 3HZMA 1HWHB 1OP5K 3VRIA 3FT3A 5AEAA 1VACB 1HHJB 1KTKE 3GIZL 4L9LB 3OKOB 2AK4A 4PYHA 4MQTB 4LCUA 5C6WH 3QG7L 3BKCH 3OKLA 5HHXH 4MLSA 3EO9H 1U3HA 1JVKA 4WHCA 2DQJH 4PV8A 4ZAKD 3W5NA 3HRZA 3UTSD 1T66C 3PHOA 2VKXA 3K2MC 4TSAL 5LWYH 1KCLA 4UTAL 4XBEH 4HCRL 3EYVA 3U7YH 3VRLE 2X42A 3O4LA 1CD1B 1EBPA 1FP5A 3MRLB 1IM9D 2NY1B 4OQTL 3MODL 1P7KA 5EN2A 3NIFF 1JPSL 5IP4A 4QXTA 3SJVE 5IFHL 1BM3H 3EOYG 4R96A 2DIJA 4G9FA 4NN7C 3X12A 4C54A 4PP1C 2G5BB 3DO7B 5IJKC 1BREA 2J6EL 3V4PH 4NO0D 1G7MA 1C7SA 2VZUA 3RNKA 3MREA 1KIUA 2MNUA 2R56H 4LLMA 1FQ9C 3TM6A 1FRGH 1MLBA 1KJVA 4XPHL 2DJ4A 3E6FA 1H3XA 5FOBA 2FJGB 1T1WA 4MQ7A 1TZHB 3BPCA 4PJ5B 2QR0B 4MNGB 2VL5A 4QCIB 1GH7A 5AZEL 5I1CH 1AGEA 2DDQL 2LFGA 4N1EA 2CMRL 4JQVA 2Q3ZA 3T3PE 2ADJB 4QRUA 5JNYA 2YPLD 4U1KB 4MJIB 2NW3B 4MCZB 5D1XB 1MH5A 4L4TA 4WW2A 3B5TA 4ZMAT 3E8UL 2C3HA 5JA8B 2YSSB 3OKKB 4ACPA 4MB3A 4EJ1C 4ZFFA 4A2MA 2NY4B 2ZPKH 1KB9J 1NCBH 4TUKL 3RJDA 1XGUA 3L6FA 2CLZB 3NFPB 2XTLA 5DJ8B 3QB7C 1U3YA 4TQEL 3IXTA 3CH1B 1R5WA 3EDEA 5LGJB 1KB9K 5D7SH 4NQDA 1NLBH 1YPZB 4HUVB 3P4OA 3ARZA 4GMTH 1AHWB 5E8NA 1NFKA 5LVEA 3OAZH 2DN7A 3GK8H 3QUXC 1IC5L 3BEWA 1BJ1J 2DYPD 4XCEA 1FVEA 3S97C 3WV0A 1URLA 2ADIB 4K94C 2VDMH 1MCFA 5JR1H 2BERA 2P7TB 2J5LB 5I8KH 4L8BB 4E0RA 4KK5C 1M7IB 2IMNA 3BE1L 3L9RA 4LQFH 1NC4D 1FLRL 5D1ZC 4PRIB 1WZ1H 4P2QA 2GSGB 1O7VA 2I07B 1LO2H 3NIFE 4JAMA 5MEPB 2P47B 1V3MA 4JFXA 3H2WA 3L1OL 7CGTA 1R3HB 2W9EL 4RWYL 4DKEL 2Z92A 1D5ZA 5CD5C 1ZS8B 1LQSR 2N56A 2C7UB 3ARDA 25C8L 4RGNE 2VDRL 3WYRA 3ZE2E 2X70B 5FO9A 3V5DB 2EEDA 5DUPH 5JW5B 2VXTH 3F7YB 3RY6C 2ICWJ 1G6RL 3R06B 1T2JA 2NZIA 3ARGC 3FO1A 2GJ6E 1PEZA 1OP3H 1IGTA 5C08A 5BZWA 5D71H 4LU5L 5IB2A 4EEEA 1K3IA 4PRNA 5K59E 4R2GD 5I6XB 5KANG 3MBEC 2AJ3A 1VADA 2A9NL 4WNQB 3VD7A 5KTEL 3M07A 3OPZH 1MCOL 2QADC 2WQ8A 1CGSL 4CBPA 1RZ7L 1OP9A 5HI4C 2YD3A 4PGZA 4CN1A 4N90E 1AQDA 4XPTL 1AO7B 1MY7A 2PTTA 1CDJA 1OD7A 3ESVF 5LXGL 3FFDB 4JHWL 5AWNH 1HNGA 3CCHB 2X4UB 2VE6B 5E2TH 3T08A 1FL3B 3FHAA 3BPOC 5J1SC 4X99B 4JPVL 1BEYH 3TWCL 4JDVB 5F8QC 2A1WL 4QWWD 3D39E 5DI8B 5TQ2H 1FL5A 4MJ5B 1G9MH 4JZJA 5DUBB 5C09A 1U8QA 5INCB 2AEPL 5HHMB 4FQCL 4S10A 4TVPH 3TA3B 4OFPA 2ESVB 1PX4A 5F7NC 1AGBA 2R1XB 3HZYB 2DLIA 5F9OH 5I1GL 3QZWG 4ZNCD 5ALBH 5F7WC 4ODXB 2MPAL 4YXHL 3GHBH 1KJ2L 3DX9A 4I0PA 5T1LB 2UY6A 4OZHF 4JFHE 4JDZB 4MA1B 2IPTL 4XAKD 3H6JA 3MUHL 5DEGA 2RCSL 4PV9A 5JXED 3F6LA 1WWCA 3T65A 3VXMB 4I2XA 5GSRB 3TPUA 4Z76B 1CQYA 1OD9A 1TCRB 3NZHL 4M1CD 5IK3B 1N3NB 5D7JC 4OLWL 3T2NL 4AEFA 1A1OA 3WE6B 2P4AB 4J6RL 3STZB 3FQNA 1CFSA 3D0LB 4ZOAA 1M1SA 4PJAB 1INQB 4ODSH 1ZA6B 3V6ZB 3BPNB 1AD9A 3NCEB 1BD2E 3V95A 3BD4A 4L5FH 5D2NC 3ZE0F 4YDIL 3IVKB 3PF2A 5BS0E 4PJDA 1SVZA 2AERT 3TZVB 1S9VB 1Q0XH 2VR4A 3T04D 3V5HA 3ZYOA 5A2IH 1AGCB 4DZBB 1QR1B 5T3ZD 4JO2L 1TMCB 2HG5A 2PF6A 1IGJA 5E6IC 5C0BA 3W2DL 4WW1B 3GSRA 4PJCB 3VGEA 4DZ8A 2JJTC 3ZTJH 4WW2C 3SE9H 3CLFH 5D7LA 4FN0A 1ZLUH 3B9AA 5A2KH 3QIWD 4NNXA 5CJOL 3MXVL 3PQYA 3QNYA 4G8EB 2ATKB 5DR5L 2DMBA 5B38B 4HEPG 3TVMD 3MRFB 3IRPX 4OZIB 5IV2B 1UVQB 1HCFX 1GHFL 2VYRE 4DVBA 3S37X 2X4TB 5ACZB 2CIKA 5DGRA 3VG9C 1ITCA 3QIBC 3O6ML 3Q5YA 5FV1L 3V6OE 5J6HA 1IGFL 2PYEA 4LRNH 1UQSA 1J0ZA 5GISH 3LQMA 4PS4H 5KSAD 2YUWA 2Q3AA 5T1MB 4L3EB 5ICYA 2C26A 2XG4A 4JPKL 3G5XA 3O4OC 4H26A 4OLYH 3NA9L 3ZKMD 4LSTL 5IM7B 5ISZE 4LEXL 1AE6H 4S1DC 5F6IC 2ICEB 4M7LH 1NC2A 4V1DE 1HQRB 1MNUH 3L5IA 3FL7A 1H5BC 1XF5A 4GMSL 3N1PC 4IJ3C 3O8XC 4P4KA 1JGLH 3K8MA 5GRUL 5I1IL 3SE8L 3KLAB 1X7QB 4NQEE 4IBLT 2IALB 1B4RA 1PZ5A 1D6EB 1U8KB 4XPAL 4ZTPL 1ZLSL 1CR9H 1BOYA 1A6WH 3MGOA 3NFSH 4I4WA 4U6TA 5I0ZA 4WUUE 1MCLA 1PGRB 2LVEA 1BX2A 5E6YA 3RVXC 2AVGA 4U6YA 3QDMD 3U36B 4P2RD 1KN4L 4M62L 1QLEL 1RK0A 1A8JH 3L3HA 5HI3C 4FNLH 3JVGA 1R3KB 1V3KA 4G42B 3IAPA 4X6DB 3U0TA 5D1QA 2E27H 4G8FA 1CF8H 2YA0A 2XNAB 1JPST 4KI1A 3RGVA 5DK3A 1MAML 3EHBD 5IR1B 1CGYA 2CK0H 5J11B 1HYSC 3I3DA 1QO3A 5AUMA 5LBSH 3WFZA 2R69H 5DYOB 1JYWA 3MO1B 3QEGH 1FZJA 4LHUA 4FQJH 5IIEA 4JREC 3QDJD 5B8CA 5F7UA 1NMBH 3F7VB 4IHOA 3U30B 3VI3F 5D5MF 2DD8L 1VB9A 4GKOA 2D31A 4NSKB 1X5FA 4ZAKB 5JLZB 4OCSH 5EUKA 1I9IL 4HK3N 4XI5D 5GQBA 4IMKA 1MLCA 1YNKL 1L9NA 3DRTB 3SHSA 3MUGB 3GMOA 1Q9KA 1KCUH 4KK6D 5BOPA 5KVEH 4Q0XH 4JZJC 3WBDA 3ZDXF 1SYSA 1ZGLP 5EFIA 3FJTA 2PTUA 3GSOA 1W8NA 1RIHH 3KJ4C 1RMFH 1IM9B 5FO7B 1KJ3H 3KLSA 4UOJA 1FYTD 3PL6A 2ADGA 1VFAB 4HKZA 4YFDB 2AJYH 1C12B 1NJ9B 4LLDA 4DVRH 4S11A 5EZJA 5K9KB 1B0RA 2DJUA 4NO0B 3PWLB 2X1QA 3QQ3B 1LEGB 3CFDB 3T3MF 2NY3D 1SEQH 4P5TA 5HYQA 4LSUH 4XB8A 2DBJA 2CUHA 2IEPA 2DS4A 1N5AB 4OB5H 1QKZH 3BZ4A 4NKIL 4OKDA 5J9PB 2NZ9D 4MXVF 4Y19E 1EGJL 3DUSA 4WWKB 2GSIA 4NWTH 5L9DL 1TCMA 5KG9B 2A9MH 2HH0H 1MIMH 2AABH 2JELH 4L3AA 2BNQE 5E5MB 4P23D 2IQAB 4LLQA 4I13B 2V2TB 1U8HB 2JE8A 2FYYB 4BH7B 1MUJB 1YMMA 4ZFOB 3PWUB 3MA7B 5IJVA 4ZUSB 1Z2KA 4HH8A 4DW2H 2IPUG 3JTTB 5CCKL 4F58L 2OTUB 1F4XL 5HSFA 2H6PA 2RFXA 5T1DL 4DAGH 2VH5L 5L6YH 1X5XA 3QNXA 1P7QD 1VEOA 2HLAB 3F58L 3WL9B 2H45A 4JFZL 4M9PA 5D5ME 5I1EH 2FZ3A 2Z4QA 2F54A 3MLVL 3C6SA 2R4RH 1T21B 3SKNB 3C60D 4YHPB 3QH3B 3SDXE 4K2UL 5JDSB 3ZDXE 1MFEH 5EO1A 1BFVL 1U58B 4LCWE 3C5SB 4G6AC 3EYUH 1YN7A 4KH2A 3OSKA 4NBYB 4JFYA 3WFBL 3FMGH 1ZHKB 1XF3B 4WTXA 4IDJH 4PJ7F 1I1AD 1IM3B 3ILPB 2AV1A 3GJFH 3LKRB 3G04B 5I8EB 2EC9U 1QEWA 2FIKB 4FQQB 4APQD 1FZOA 2JB5H 3MRMA 1J0JA 2FATL 2X6MA 3OR7B 3LPWA 1IGIH 5KS9A 2NX5B 3CFCL 1OTSC 2A6IA 4P4KC 5CP7B 3GMLB 1D5BA 2FO4B 2QHRH 5F7EL 3LN5A 3CUPB 1G9NH 3VXTB 4P59H 5IHUH 1G0DA 4HJ0C 5EU5B 5GGVL 3EIFA 2OI9C 3FCTB 4MXVE 3WHXB 4R2GB 2MFNA 4KKCD 5E08L 4H25A 1CDUA 3CFIC 1NAMH 3VFOA 2VDKH 4I0KA 2NXZB 3ULVC 5GGVY 5C0JA 7FABL 4JZNB 5IB3A 1HSAA 1U8PA 3P4MB 3D3VD 5JW4M 3AREA 1OARL 4JLRB 2R0KH 5EBMB 1YYLL 3JVGC 3OAZK 3VXQA 2Z93B 4XH2B 4XVTH 1JPFA 1HQ4B 3KHQA 1HHGA 4RX4A 5D1QC 4CU7A 4YUEL 3VFUA 4EUPA 1PKOA 4HG4J 5IF0A 5HDLA 4U1JA 3QXVA 4JM2F 3WIIH 1CE1H 3DVGA 5A40E 4HG4K 3T2PA 1LEIB 1NMAH 4HUXB 1F97A 2FD6L 1LMKA 1JHTB 4TULH 2ITDB 4AG4H 5ENWA 5CZKA 3GKWL 4CNIB 3H9SA 4ODHL 4NPYA 4RZCB 2W0LA 4XCYB 4UT9L 4HQQH 1K9TA 2H2PC 5KBNC 3BP6A 1A7RL 4FZEH 1OP3K 3V7AE 1V3JA 1RUKH 4O5LH 1A9EA 3DGGA 5DFTA 4MAUH 3WLBB 3N1QC 5AZ2H 2NY7L 3LAFA 4AL8L 3NH7H 4NRZA 3QUMB 3HI5L 5GRXG 4IRSC 1NGYA 3GRWH 4XNZB 4G5ZH 5CSGA 2VUOA 3UTQB 4LEOB 1A9BB 1ITBB 4JPIA 3REWB 5MEND 3NIDE 1YEHL 3ARFD 2F5AL 5L2KE 1DUZB 4NKMB 4RRPA 1ACZA 4Y16A 3GSXB 3RVTC 4RNRA 3CC5B 4K9EH 1JNHA 2Y25A 1A64A 4ONGL 5DJ6B 4RQQB 3ARBB 3BYTA 4LVEA 1DBJH 1FJ1A 1WGOA 3FB5A 4FZ8L 1DBBL 4HJGB 4RAUA 4C56E 5ILTH 4FFZL 1JN6B 5IMKA 4JFFE 1GAFL 4WEBL 4HDIB 4AM0B 3OR6B 2JIXB 2J88H 2ZCKH 3VGHA 1NFDB 1CU4H 5CIPA 3UDWC 1L0QA 3VWKC 5F21B 4NGHL 4NJAH 1N6VA 1ZA3A 1P4IH 5D72L 3S9DB 4UV7H 5FA4A 1I3RB 2HTKD 1T1ZB 2AI0H 2WWMC 3TVMB 4OFVA 3K4AA 1MI5A 2X05A 5LAXB 3FOMA 5GS0H 1IGYA 4HLZH 3WS3B 2F58L 1AR1C 5GGUB 3ULVF 4DN3H 3SGJC 1EHLH 4YDLB 2VLJB 3GSQA 2EXYC 4Y4HA 2EYSB 5IVNA 3V5KB 5ANME 3D25A 3WDHA 4Y4FD 3NCYS 3MLTA 3M8OL 5KSAB 4GKSA 4XC3L 1B6DA 2VOTA 1SEBA 4YLQT 5JIKA 3MRGB 5DC0A 3QO1B 1Z3GL 4LSPL 3DNKA 1VFOA 4OUUB 1EBAA 3E6HB 3TJHC 1T5WA 5HGHA 3ZKSD 2ID5A 3MV9B 2NTFA 4U4BA 4TOYH 3GMMB 4NRXA 1MIEL 1H3WM 3CVHL 2VMFA 1H3UA 4X6FA 4OIBA 4Q58C 3MNWA 1ZHLB 4U49A 3U2SA 2B5IB 1F11A 3HB3D 4XAWL 3MCG1 3FN0H 4J4PC 4F7CA 1J86A 2CK2A 1RJZA 5F88A 4P2RB 4ORZC 5IHZA 5B21A 1GGBL 2DQIL 1T2XA 2OS7A 5C0AB 3HE6C 3I50L 5IQ9A 4CW1B 3MCKA 3R1GL 2VDNL 5FYKH 4UQ3B 1IKFH 1UM5L 1QRKA 3MOBL 4NQSB 3RUGA 4U1HA 4XPBL 5IVXA 4OSUH 1AXSA 5TF1L 1KN2L 2IWGA 3U4AA 1KYOJ 1UH2A 3N9GH 1IBGL 4MX7B 3BUYB 3IFLL 1OWWA 2H9GA 3O45A 4I18B 3VXSE 1DN0A 1S7XB 3QDGE 1B4JL 1T7XA 3NGBB 3VMNA 1KYOK 1OAZH 3MRQA 5E00B 1NGPH 4GRLC 4MGXA 1A3QA 3TN0A 4XNXH 1G7LB 5C9JA 1S7TB 3GB7A 1GGIL 2ZUWA 1GC1C 4BUHA 2IFFL 2XTJE 4ZS7H 1ZEAL 1TENA 2Y36H 5JW4R 1HYRC 4GW4B 1CE6B 1S9XA 5D4QA 1P4BL 2DKMA 3ET9F 2DQHH 4GLRH 2X10A 3BIAX 4P46B 5L2JA 4MAYC 5H8DA 4U7KA 4Y1AD 5KSBB 5C6TH 1OM3L 3UTTA 4JJ5B 3FQUB 3P9MB 3TO4B 3JSSA 2EO1A 1JHKL 4D0DA 1FORH 3BISA 2YPVH 3G6JA 4ZOBA 4O58H 4Z7WF 2E6JA 1P6FA 2EDEA 2EKSA 4UBDD 3O9WC 1NDMB 3OKYA 4HH9A 1RJLA 4IRJD 1UH4A 3SDYL 4EVNA 1H3PH 1TETL 2O5ZL 2NY3B 1JP5A 5CEZD 2DQUL 5DMIH 3RY5A 1MFDH 2CDGB 4AJ0A 1A6ZA 1BIIA 2PN5A 2A74A 3EO1B 4KROB 1P4LA 3KNBA 1LO0H 5DQDL 1CGXA 1WBZA 4DK3A 2C3GA 3L7FA 3VGDA 4NQXA 5E0QA 5EC1B 1VKXB 1XFPA 4NRYA 4P23B 3CSBA 2Q6WA 5HVFB 1FGVL 2ZSVB 4LCCC 4PJFF 3WO4C 1L7TH 4KI5E 3FN9A 4KRPD 1J5OH 1LEKB 5DVNA 4N5UA 5BQ7B 5GRWA 4NM4L 1JWUB 4KVCL 2HJLA 4P4RA 3MLXL 3BH8B 5I1HL 3QJFB 5EZOH 1GC1L 4HWUA 4JHZA 2XFXA 3EKCA 3VFPB 3MJ8A 3PXHA 3W39A 4JO1L 3B6SB 4RGND 3L7EB 1JGVH 3HPLB 3ZMRA 4EDXA 2HA1A 2WAHA 3DTXA 4PJIB 5DMGD 2ZCLL 2CJUH 4OD3L 4KZDL 5JPNA 4L4VA 3H9ZA 1SY6L 1MCBA 5C0CD 2F8VA 3PNWB 1FAIH 1I7UA 5I1AB 1QACA 2O5YL 4XCNA 1KIRB 2XWJA 1UWXH 1I4FB 4N90D 3U83A 4LKCA 2FDBP 5CSZB 1N2RA 1JZ6A 1F4YL 4G8IB 1I1AB 2PCPB 4LIQL 3SCMD 5J56B 3RTQB 2CKBA 4NT6B 1DQML 1LO5A 4XMKL 3HUJE 4GKNB 3A6BH 1BZ9B 1E27A 3QQ9D 1DJSA 2D03L 3MCLL 3DXAA 5I1KL 5EO0A 2ITCB 2O5XH 5E24E 1UFUA 3SBWA 5DJDB 4CJ0A 4D3CH 2I9TA 4YHYC 4LRIA 1T80A 3RDTD 3D39D 3KPRA 4JY6A 2WMPA 3ES6B 3MROB 3VRJB 4JFOA 2UZXB 1IAKB 5DDHB 1HH6B 3KPMA 3DOSA 1LO4L 1UXSB 5JOFA 1EK3A 3O41A 3VXNB 3L3OA 3M1BB 5EUOF 4N0CD 2XYCA 1I9RL 3UTZA 1X5GA 2XQYG 1W72A 4E41A 4HMDA 4F2MA 5IGXH 1UWGL 1I8LA 4X9FA 3ECBB 5F7LB 3IAQA 5JHLL 2C3VA 1U92A 3D3VB 2Z91B 3MRDB 1HWGB 3KDMA 5FB8B 1JWSB 3SE4C 5EZLA 3UPRB 4JFHD 1Q94A 3BO8A 1IL1A 3BRFA 4TTDC 2OZ4H 1BZ7A 3WIHA 3IT8D 1PVHA 4NO3A 3EDFA 2NXYB 2R4SL 3TF7C 2WBJB 1VDGA 5T3XL 1E4KC 2R1YB 4GW1A 4LNVA 2UZIL 4NYLB 1A47A 3RL1B 2EDHA 1MWAH 5EA0H 2P5EB 4P49A 2BFVL 4OFYD 3TN0C 1OAUL 3GJFK 4MJ6A 5TFSH 3MTRA 2BNUA 1BD2D 4EI5B 4PLKC 3WN5A 4NP4H 3QWQB 1A3LH 5M94B 2EDTA 1K4DA 1T04A 4Q97A 4YC2B 4OM0L 3SDDB 5E8PA 1BFOA 1CD8A 3VA6A 4YDVA 4L8SC 4LHUG 3DVNA 2W1NA 4HV8B 1HI6A 2C1PA 4F8QA 3VFMA 3CZJA 3BIKA 4HJJH 3QHFH 1NCNA 4S1RH 4JKWA 2YZ1A 3QUMH 3RU8L 1KB5L 2DWEA 2AV7A 4OFDA 2XN9D 1YEIH 3MLSL 3TYFA 3H3BC 4PYGA 4C59B 3DX8B 1YN6B 4D2NA 5FIEA 1V7MH 1A0QL 1MHHA 4HHAB 3WJLA 3MRIA 2VZSA 4DQOH 1P7HL 5EUOE 2H2SC 4I48A 3QEQE 1C08A 3L3JA 2E7CA 4U2ZA 4ZXBA 3B5HA 4F57H 1QSFA 3U0PA 1A6PA 3BKCL 1B2WH 5HHXL 5SWQB 1ZKAA 5E8DH 4DOHE 4NQCE 5KVDL 4YDKL 5CZVH 3KYMA 4HFUL 3H42H 5T3ZH 2DLGA 3ESUF 1FHGA 2Z8WC 3IDUA 1MFBH 1UXWA 3CIQA 4X4YA 5LWYL 4LIQE 3N50A 1MRCL 4V1DD 3B4NA 3T0EB 4F15C 4DUVA 2VXQH 4HX1A 4N0UE 3GJEB 3U7YL 1FIEA 5CGYD 2NY0D 4J23A 2VUYA 3G5YB 2AJZB 1K8IB 4X6EB 1YEEH 3OAUH 4ERSH 2MCPH 4JR9H 5C0FA 4WUUD 4HXAL 4QHNA 4XVSL 4QXGH 4N8VG 3PGDB 2Z8VC 4OZGA 3RI5F 3V4PL 1WC7B 3S7GA 1NQBA 4QYOA 3HE7C 3O6FD 1JGUH 1OSPH 4QTHA 2PO6D 2R56L 4KKLC 2OK0H 1ERNA 1WCBB 5IQ7L 3G6AB 2R2EB 1FFQA 3LKOB 1KTDB 3WLWC 1OHQA 5I1CL 5DD3L 2JB6B 1JNNH 4N1CA 1X6LA 4PG2C 3INUH 3W0WE 4KZEL 2APTA 2BDNL 2WM0A 4BZYA 1CFQA 5T3XE 1T3FB 2NYYD 4XC1H 3M45A 2ZPKL 4CAGA 4GAYA 1NCBL 2IAMC 2E7HA 1FPTL 4LFHD 1QQDB 4HFWA 1I7ZA 3GBMH 5K9OA 2AXJA 4U2YA 4K3DL 5I76A 5DJCB 1NCCH 4O9HH 4FFVC 3MJGX 5D7SL 4DCQA 4GMTL 1YEDA 4FQLH 1HHJA 2A0LC 4L9LA 3OKOA 3GK8L 4G9DB 3SJVB 2P48B 3QZWB 5F7KC 1G9MC 2JJWA 4Y5YB 1SQ2N 2O93L 2N4IA 1NUDA 4LQFL 2P8PB 1TPXC 5DD1H 3GMRA 4FQPA 1A14L 4NZRL 1M6OB 2HKFH 1CD1A 3MRLA 4Y2DB 1HH9B 2OXHA 5B22A 1M7XA 2IANE 3BSZH 1RIVH 4O2CB 4PJ8B 3VWJB 1N6UA 3HC3H 1DVFD 3H0TB 4X8JB 2VXTL 1B9ZA 2G5BA 3FN3A 3DO7A 3ARRA 1EHNA 1F58H 1EJOH 1PYWB 4NZTH 1XIWD 4N0RA 3FONB 3MRBB 4MLIA 2DQDH 1NEZB 3BRGC 5EULV 5FUZH 4PY7B 1XF2B 3CSYB 3QCUH 1CGVA 3L3IB 4IRJB 5EU7C 5ECJE 2FJGA 4H8WL 2XIDA 1I85C 2FH8A 4X9HA 3LN9A 1OQXA 1TZHA 3VCLB 5CJ5A 4OCRH 2CO7B 1EUTA 2QR0A 1T22B 3EFDH 4QCIA 5GRJL 4G8GB 3TBSB 4HLJA 4JE4B 3EJYD 4JRXE 1M4KA 4P5MB 3VFNB 4NO5B 4X4ZA 1RJYB 1S3KH 2EECA 5AWNL 2ADJA 1QRNA 3MV11 3P4NB 4LGRB 5DFVC 4MJIA 1QUNA 2NW3A 4MCZA 5D1XA 4GXUN 1AXIB 3PWPA 3DX6A 5E2TL 4HC1H 2YSSA 3OKKA 2VDPL 4IDLA 3IS0X 3P3YA 1AFVH 5CILL 1DSFL 5E7FA 3NFPA 4LCWD 5EORH 4KTDH 1QBMH 5TQ2L 4KRPB 3CH1A 5LGJA 1KT2B 4HIHA 3H7BA 5E1HB 1XCQA 1ZT1B 4ENEC 4X6CF 1AHWA 3BMWA 3TT3H 1WIOA 2W0PA 5B4MC 4RMRA 4RGNB 5F9OL 4CVZB 1RU9L 2JCCA 2ADIA 3NCBB 3LZFH 5FO8B 2P7TA 2JJUA 3GHBL 4LSVL 2P5WB 2BMKB 1B0GB 5GGSY 1E6JH 4FABL 1T5XB 2GJ6B 2EO9A 3A67H 3FTGB 2BSSB 5DMYA 4NHCH 1ZANH 3BX7C 1A7QL 4LSQH 2GSGA 2I07A 5MEPA 3NPZB 5IT2H 3U79A 5EU6A 3L95B 1R3HA 4LVHB 2XOTA 1F3JB 1AGFB 1DEEB 2C7UA 2FO1A 1T7WA 3F8UB 2X70A 3QPQC 3V5DA 5JW5A 4ODSL 3F7YA 3MRJB 4HSQA 2LAAA 2XV6B 4XCFL 3R06A 3ULUD 5CINH 1MRDL 1Q9OB 12E8H 1GIGH 2D7OA 3S34L 2FEDD 2BHYA 5F9AC 3AM8A 4PJEF 4OCWH 5F3BB 2J8UE 3UJIL 3B2VH 3RDTB 5HJ3B 4HWBH 1AO7A 3UPAA 4MMZC 4MQSB 4U31A 3BEVB 4GQPH 4TYUA 3FFDA 3QFJA 3CLFL 2EE9A 3PP4H 5TE6H 3CCHA 4Z7UF 4PGDB 4EQ3A 3UYPA 3EW3B 2GUOB 2VE6A 2B20A 1NCDH 1TJHH 3UBXI 3W11D 2DAVA 3MMEB 5HD8D 5HY9B 3BGFC 1MJUL 1QYGH 4NC1E 3RWHB 4CVWA 4J12A 3THMH 1FNLA 4POZC 4JDVA 4RMVA 4HWZB 5MHSD 5CEYB 1ODAA 5DI8A 1SVCP 4MJ5A 4X6CE 4GAJH 4L9LC 4H0HB 5INCA 1X6NA 4LRNL 4HT1H 3TJEH 2ZUQB 3E0GA 5J7CC 1VESA 3TA3A 1KPRA 1MJ7L 5GISL 1FG9C 2MMXA 4C4KT 3IDNB 4PS4L 1BFTA 5FYJH 3QI9A 3HZYA 1ETZB 5FUOH 4OLYL 1AP2B 1KCVL 4Y4KD 3GMQB 4ODXA 4JFPB 5FECB 4OJFH 4M7LL 5GIRB 1IC1A 1MNUL 5T1LA 1Q1JH 3O3AA 4JDZA 1BD2B 2EIBA 2F5BH 3EYQC 1WBXB 5ERWB 5E2VL 3IFPB 3UO1H 3IU3B 4K71B 5BS0B 2NY1C 1AKJD 5C0RL 3VXMA 2A73B 5GSRA 4Z76A 1CR9L 5AAMA 3KJ6H 2Y07H 3G5ZB 5IK3A 4C56D 3D9AH 3E1F1 4CDHA 1N3NA 4HBCH 5D9SB 3WE6A 4JFFD 4OLUL 4YBHA 4YHOL 1YJDL 4G3YH 5SWZB 1I8MB 2X4OB 4BA8A 3CAFA 1KLGB 1TTGA 3D0LA 1INQA 4OF0A 2IC2A 1PSKH 1ZA6A 1JBJA 5SWSE 1AJ7H 4FNLL 1JF1B 5FGRA 3V6ZA 4PJEE 3VGBA 1NGZB 2HMIC 1OCWH 4H20H 1CF8L 2OL3H 3IVKA 3TZVA 1S9VA 1G6RB 2CK0L 1UA6L 1NKRA 3VI4F 5LBSL 1AGCA 2R69L 1QR1A 1MPAH 5I8CB 2F53B 1IILE 3FHQA 3QEGL 3V8CA 3AS1A 4W81A 4WW1A 5GRVK 4PJCA 1XR9B 1EA9C 3BWUC 1RK1B 3N06B 3OX8B 4M4RA 3TBWA 2NY4C 2BC4B 2Y7QB 2V7HA 5IW3A 2X1PA 4G8EA 2ATKA 2YUVA 5LGKA 4OCSL 5B38A 3MXWH 2XQBH 1I7RB 3BT2H 3MRFA 4LSRH 4PP2B 2W60B 3CNKA 4K3EL 3I9GL 5ISZB 1JJUA 4OZIA 5IV2A 1E6OH 4V1DB 4Q0XL 4PBWD 1IRAY 5ACZA 4CRPA 4LLWB 2CD0A 1S7QB 4NQEB 1QHPA 4GT7A 3RKDC 2NY0B 2F19H 1OAYH 1RMFL 1KJ3L 4GBXD 4BK5A 4X5XB 3QUXB 2CSPA 4G6KL 3BZDA 2FHCA 2LU3A 2PW1B 2BK8A 2AJYL 4BFGA 5T1MA 4LPUA 4H88L 4DVRL 4XX1G 1A4JB 1T6VN 4WFGE 2P8MB 1GPOH 4KJQC 5IM7A 4M7KL 1YEGH 2XWBB 4P3DB 5D1ZB 2ICEA 3WKNA 5JIIA 4BSVB 1SEQL 4XCCL 5I73B 3BDBA 3KLAA 1X7QA 5B39G 2IALA 3KWWB 1D6EA 1U8KA 1Z5LA 1FFOB 4HIIB 3ZT7A 1JYVA 2DLEA 4NWTL 1SYVB 1G9NC 3VXSD 2A9ML 3B3IB 1V3LA 3MV7E 1MIML 2JELL 4W70A 3RIAK 3MRHB 3U36A 1T6WA 3ARGB 3LKNB 5JHDE 3AY4A 2ED7A 3VDAA 2AK4E 1Y6MR 4K7PH 3AM8C 5BRZA 1R3KA 1RZ8A 4NKOA 4BJLA 2XTJD 3BVNA 1IQWH 3CDYA 4FTVE 4X6DA 4DW2L 3VI4E 3QPXL 4MA7H 4W4NA 3VMOA 2XNAA 3MBEB 1ZLWH 1BF2A 3GDBA 2Y6SD 3QXDA 5AYUL 3VGAB 2OSLB 2CR6A 1WZKA 4NDMB 5DYOA 5BO1L 4LGSB 3ZT5A 4PJXF 5JMRA 4LARH 1D6VH 3SDCB 1EO7A 3ARPA 2Q7NA 4LDEB 4NM8H 5I1EL 4TPRL 3CXHJ 5FGCE 4Z77B 1FNHA 2YUZA 2JJSA 2AGJH 2R4RL 3F7VA 5C0DB 1L7IH 4R7DB 1UENA 4L1HA 4G9FE 5JZ7C 3S4SG 3BPOB 5CEXB 1QFWH 5JLZA 2B4CL 3HZVA 2VL4A 1QA9B 1R5VB 3TIEB 3DRTA 2NQCA 3MUGA 3EYUL 3T0WA 4JGMA 1HKLH 5CSBA 4GAGL 2EE3A 3P9LA 3L3KB 3SQBA 2YEZB 2EXWD 2H1PH 3I84A 5IBUG 2BNRE 1T03L 1J8HE 4IDJL 1IM9A 2R29H 3N85L 5IB1B 4PBXA 1UH3A 4Y19B 1VFAA 4CU6A 3WSQH 1DVFB 2ILLA 2R0ZH 3OJVC 1NUNB 5L88H 3H9HA 3DI3B 1IGIL 2BNQB 2O61B 5K9KA 2VLKD 3CVIH 4CU8A 1GXEA 3PWLA 4WVRA 4L8DB 5D7KD 4KI5D 3QQ3A 2ZOKA 4XBGB 2W91A 2XZAL 2YMXL 3IFNL 4Q2ZA 5H37G 1N5AA 1YPZF