1YNKL

Identification of key residues of the nc6.8 fab antibody fragment binding to synthetic sweeteners: crystal structure of nc6.8 co-crystalized with high potency sweetener compound sc45647
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
219
structure length
219
Chain Sequence
ELVMTQSPLSLPVSLGDQASISCRPSQSLVHSNGNTYLHWYLQKPGQSPKLLIYRVSNRFSGVPDRFSGSGSGTAFTLKISRVEAEDLGVYFCSQGTHVPYTFGGGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords immunoglobulin kappa light chain
publication title Cocrystal Structures of NC6.8 Fab Identify Key Interactions for High Potency Sweetener Recognition: Implications for the Design of Synthetic Sweeteners
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 48
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2005-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ynkL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ynkL01
4G8GD 1J9CT 3VG0L 4NFBA 4R7NB 1VFBA 4UZGA 3VXSE 3IVKB 5HHQB 1T7ZA 3ZT7A 2GTWA 3U79A 5CHNA 5FA4A 2GFBB 3Q5OA 3OSKA 3CX5K 3OPZH 5FGCB 3EYSH 1LNUB 4ENED 5BO1H 1A3LL 1SEBB 3EJYC 2FCBA 4U0RB 3L5WB 4J3WA 4EXKA 5I1HL 4WWKD 4BKLB 5IMKA 4NHUB 2G9HB 4WDIB 2B7DT 3TO2A 5C0GB 1Z9SA 3Q3GB 5MERB 4AEIH 3BFOA 4V1DA 1YEEL 4YDVB 1GSMA 3BN9D 1A6TA 1VESA 5LCVH 5A43C 2J2ZA 5TE6L 3W39B 4R0LC 2HN7B 3OXRB 4XPBL 4WI2A 4Y5YA 1RUPH 1G9ML 4NKIL 4BSVB 1A14L 1ORSB 1TJGH 3DUUB 4FQLL 3FO2B 4HBQA 1M05A 1U6AH 1EHNA 3I02B 3NTCH 1UC6A 5KSUB 3FN0H 5C8JB 2XT1B 3WBDA 1PZ5B 5LG1A 4G7VH 3L7EB 3EYVA 2APWA 3S5LA 1VGEL 1PD6A 1K2DB 1P7QD 1FVDB 4NJAL 3T0AA 2P1YA 5AG9A 4M93B 5E8OA 4MNQB 5F1NB 5C0AD 2UYLA 5JPNA 4LKXA 5IB3A 3BP7B 3TLRA 2CIKB 1HHGB 3AXLA 4KDTA 5DVKA 3ZE0F 3DNKA 4LCWD 4LARH 2Q7YA 2VJXA 3O6KL 3FRPA 1BLNA 4P2QB 1BBJA 3ZHDA 1ZLSL 1UB5A 3QEUA 4AIOA 4YHOL 4J3OC 1LO2H 1FFQA 1DQDL 5E6YA 3JSSA 3MCLH 1A22B 3N1QC 1JIBA 1VSCA 4Z78A 1JNHA 2W65A 4D8PA 4TVPL 5I6XB 2CKBA 1FIGL 1I8KA 3IDYB 1I1AA 1FBIL 4UOW1 1P84K 2B1AL 4JANA 4A2LA 1D5XB 5T3XH 1BVZA 5A16B 3KYMA 4QXGL 1WIUA 1FYTB 5CLWA 4N90E 3KHQA 3DXAB 3DYMA 1SYVA 3ARFA 1ERNA 4PREA 5DRNB 2EDLA 5IB5A 3FMGL 3GKWL 4GBXA 3GMRB 1F2XK 3LKPA 5DWUH 2FWOA 1ORQB 3L3GA 4GW1B 4RFEA 2LTQB 1PY9A 4M4RA 2VZSA 2XY2A 4OLWL 1ZHKB 3SCMB 3VXMD 5ERWA 2AV7B 2BNUA 5DURD 5TE4L 4LVOC 4JEGB 3QP3A 3E6HB 3OPZL 4QHLA 5BO1L 2BDNL 3CFJB 1PFCA 1ACYH 2I60H 2JB6B 5B8CB 5GRXG 3KPSB 3V5DB 4LVNB 2IALA 5K9OA 5HGBA 3WSQH 5D7SH 4AEIL 5FM8A 1G0XA 3MV7A 4QOKA 4XNMB 3L3JB 2RJMA 3RPIA 2F19H 4JKMA 4Y2DB 1A5FH 1RUPL 3SY0B 4PR5A 3ALPA 3QXUA 3H7LA 1CICC 2H45A 4P4KB 4K94C 3W11D 2C9AA 1U6AL 3IXTA 3NTCL 1NFDE 1L6XA 4ONOA 5KG9B 3MLRH 2VDPH 2WWKT 5LBSH 4ORZC 4M8QB 4G7VL 5EFIA 2DQCL 1MFAH 4Z7NE 2XZQL 4Z18A 4OQTA 1P4BL 2BVPA 5EZJA 4POZC 5J0BA 2VLRE 4U1KA 2IG2H 4KI5E 5HVWA 4NPYB 1IKFH 2GTZB 5HGHB 3VD3A 4GKOA 2R2CA 3ULUE 2VR4A 4WFHE 4PRDA 1NEUA 2AXHA 5H94B 3O3BB 1CR9H 3ZHKA 5GS0C 3T0ED 2EDWA 4CADB 4G6AD 2HAZA 2VISA 1N59B 4Z5RA 5IMOB 2F74B 4JPVH 3IDNA 3X3GH 2CSPA 4LCCB 4K3DH 3MCLL 3QUYB 3U4BL 2AXGA 1HHKB 5JIHA 4AYFA 4AY0A 2ATPA 2X89D 3CMOL 4TUJB 2BCKA 5DD1H 5I66B 2C7UA 5F7YC 4XPFH 5BVJB 1LEKA 3NABH 1UENA 4N9GA 5T3XL 4UTAH 1IGTB 1I3VA 1ZHNB 1DQMH 3WJJC 4PRHB 5MENB 5ANME 1QFUH 3IJSB 5DHVA 4O5LH 3K8MA 1R3LA 3RZCB 1JP5A 1U8IB 1BREA 4M5YH 3O2WH 1EO8H 1IGIH 4EUPG 1EERB 3CFEA 4L3CA 1F3JA 1UZ8A 3KYOB 3BZEA 2OSLB 4DFIA 1MCDA 2ESVA 2NZ9C 4NQXB 5DWUL 2Z31B 1A2YA 3RBSA 3HAEG 2R23A 2J12B 4M48L 5J1AA 3V6BR 1D9KA 4Y4KC 5GJTH 4X7TB 1X5ZA 4CU6A 5I1DA 4Y88A 2I60L 4P9HC 5F7FA 2JJSA 1I8LA 5EUKA 4QRSB 3WSQL 4M1CD 5D7SL 3S4SA 3DBXB 2MWCA 1JWUB 3VXSD 1QNZH 4XNQB 3SE4C 3T8XA 4DQOH 3QEQE 2AJXH 2CUMA 1H3WM 5GZND 1AIFA 2F19L 3MYZA 2Z8WC 2EDFA 2NY0C 1A5FL 3FRPG 2I27N 5GRZA 5C6TL 4LASL 1EIBA 5E4IA 2V2XB 1S5IH 3W2DH 3LCYA 1DLHA 1HKLL 3LMJH 4OIBA 3SKOA 2VDPL 3LV3B 5D7LA 3GHEL 1U8OA 4OCRH 2VZ1A 5HVHC 4EN3D 4OFKA 2CGRL 4ZXBD 3UJIH 5DK0A 1GZPB 4X6DE 5J9PA 2OR7A 3T0XA 1ZANH 1J0HA 4NC2B 3WD5H 1BD2B 1IKFL 1U42A 5E94B 1H8SA 4L8SB 3O2VH 4QO1A 1X6LA 3G6JF 2X9YA 1TNNA 1CR9L 5ESVA 2BVTA 5AYUH 1KXQE 2ZG3A 4NJ9H 5EN2A 1AGBA 1DEDA 4YDKL 3VFTB 2QBWA 3GK8H 4J8RB 3HUJE 1EDQA 3FRUB 4S1SL 2KH2B 43C9B 4DTGH 1ULVA 3EUUA 2ZJSH 3K8KA 4JPVL 3X3GL 4GRLC 2UUDH 5HXMA 4K3DL 1U8LA 4GQ9H 4G8GB 1RK1B 1RZIA 2LABA 2YRZA 4JAMB 2YA0A 4MA8H 8FABA 1FJ1B 5CAYB 3UTSE 3BZ4B 5DD1L 4LIQE 3H9HB 1TVHA 1DANT 5DD5H 4XPFL 1RZ8B 3NABL 3LKNA 1PQZA 4UTAL 4LQ1A 3WFHA 5C86A 1G7JA 1W0VA 5GRJH 1E4WH 4WWKB 4U1NB 1DQML 1H5BB 1NJ9B 1WFNA 2DJ4A 1QFUL 1BZ7A 1RHFA 4YNYB 2FO4A 3BUYB 3O2WL 1EO8L 1E28A 1IGIL 2BVYA 2B2XH 3OKLA 3DX9B 5CZXD 2D7TH 4JKLA 1I9RH 5IHZA 5L2KE 5SX5K 1MUJB 4HC1H 5C0JA 2UZYB 1T89A 4MX7B 3I75B 4JKWA 2R29L 1SHMA 4UT7H 1ZXQA 1LDPL 1VADA 1FFNB 4EOWH 4ZPVA 4OZIB 4N90D 3HZKA 1AGEA 2R9HD 4HWNA 3T77B 2QHLA 1H3UA 3CGTA 4FFZH 3ZKSD 3ZLQC 4KK8C 4ZFOB 2VZUA 1P7QB 3QPXH 1UGNA 4HKZA 4HPYH 3HE6D 5CEXB 1ZEAL 3ZKXB 1X5XA 4MNGE 4LCUA 1BVKA 5C0AB 4JZJC 4RWHA 4ORGB 5IT2H 3LKSA 3ARBA 1QNZL 4M1GL 2FJGB 2R0ZH 3BH9A 4LCWB 4DQOL 2AJXL 2CRMA 3LRSB 3UPCA 1WJ3A 5I30L 1WIPA 3BGMA 1DDHB 1V5JA 1P53A 5B39G 1S9VB 4DOHE 3G6AA 1XGUA 1CIDA 5IROC 1S5IL 2FNBA 3QFJA 4L3EA 3W2DL 3LMJL 3VFSA 4MAYA 3GSXB 3E8UH 1LO5A 2O5ZH 4U6HB 3R0MA 3LPFA 5GS2D 4OCRL 1N6UA 1XIWA 3FTGA 4H25B 3P9WB 3UJIL 1BWWA 4C83A 5D5ME 4ZUSB 5FKAA 4QHNB 1T22A 1ZANL 3WD5L 4OBRA 4LNVA 1CTNA 3O2VL 1MHHA 4LLQB 5C07E 3OKOA 4YXKH 1RHHB 5I71B 2R2HB 1Y18A 3EBAA 5I2IA 4QHUB 4NJ9L 4JREC 5D96B 2V9TA 3GK8L 4NQCE 2R15A 1H0DB 3QG6B 4X6EB 4XXDA 4DTGL 1OGAE 2VLRD 2ZJSL 1MAKA 2NY1D 4KI5D 1RJLA 1U95B 4HKBA 4GQ9L 3ULUD 3HI6H 4YBQD 5INCB 1KPVB 1CG9B 1U91A 2YWYA 1AR2A 4MA8L 3VXMB 5EBMA 4KJPD 3S88H 2E6QA 2YK1H 5DURB 3EOBB 1I1FB 1WBXB 1DN2A 1A0QH 5DD5L 1ZA6B 5ALCH 1D5IH 1ZLVH 4AT6B 3FAXA 3CVIH 4HS3B 1FL5A 4TUOB 5GRJL 4XCCH 4Z7OE 1NAKH 1O7SA 3LQZB 4M9PA 4AQOA 4OZHF 1KTLB 3DO7A 3S4SG 5HGGS 4X4YA 3MOAH 4Z7UF 2E7LC 5SWZD 2YA1A 4WV1C 1FG2A 1I9RL 2XWTA 3R8BB 4FG6D 4HC1L 2YD1A 4ODSH 1JWSB 1N26A 3W0WE 4ZDHB 5E8DH 2ZNXA 4EOWL 2A2QT 4XZUA 1IEHA 3C9NB 1X4XA 3RDTC 3W9EB 1VACB 3UROR 4FFZL 1W8OA 1ZMYA 3PWUA 4NO3B 5IHLB 1A4KB 5C6WH 3NA9H 1SVCP 2YEZB 2ZUUA 5I75C 1T6VN 5IT2L 4GG6A 5F72S 2R0ZL 3T0EB 4E0RA 4N0FB 5JOEA 5L88H 3D39A 4HCRA 4AH2A 5L2JA 2IQAB 3MROA 3T1WA 3RTQD 2Q6WA 4OZHB 4HX1B 3RI5K 1R5VB 3MRDA 2Y06H 2DKUA 3RHWF 4Z7UB 3JTSA 4NYLA 1IFHH 4G6JH 2Z4QA 3E8UL 4P46C 2O5ZL 5ICYA 5F96H 3SDXF 3SGDH 1WIOA 3QEQD 5DZLA 4KKLC 4K7PL 3TIDA 1FSKB 5BRZE 5HY9B 4MCYA 4NQSA 4OT1H 2IAMB 4HMDA 4NZUH 5D6CB 1NDMB 2YD5A 3EDFA 3DV6A 4YXKL 3CFKB 4Z0XA 3MRLB 4BUGA 3HMXH 2LE9A 1SVZA 3QISA 4JFED 1QSEE 5IW6A 2GT9A 3DX8B 4X4XA 2XTJE 3QPQD 4G43A 1IC7H 1KLUB 1GGBH 5GIRA 3HI6L 5ACMA 4X4ME 5E08H 1BOYA 1AD9A 3L3HB 3L9RA 1MWAH 2YK1L 4MWFB 4CJ0A 4NT6B 5IFAH 3G5YA 2I9TA 4OV5B 1CD1A 4ZFOL 1QR4A 2VLJA 1NCUA 5FGRA 1SJEA 3B3IA 1XF2B 5ALCL 1LHZA 1FGNH 4PJ5A 2FO1A 4FTVD 2EKSB 4KAQH 2FDBP 3CVIL 4IOIB 1YN7B 1P7KA 5IWLA 1NAKL 4I1NB 3BKJH 5DJAA 4R2GC 1T1ZB 4N5UA 4PRPA 5F9AC 5GRVK 2IMNA 4CAGA 1ZTXL 3VXSB 3ILQC 3UTSD 3BJ91 3MOAL 4FFWC 5KSAD 3SGDI 4C57C 2VO5A 5F3BA 1OQXA 4MQ7A 5F6HI 3KWWB 3MOBH 3IKCB 2E9BA 4XTRC 4JVPA 2DMKA 4H0HB 4JN2B 5E8DL 4J2XA 2X44D 1A7BA 5F9DC 4F3FB 4XCEB 3DVFA 1G7QA 4MJ5A 1MCKA 2HT2D 4FP8H 4PGBB 1D5BB 4NFDA 5DJDB 5DEFB 4QTHA 2GSIA 3IJYB 4EN3B 3VXRE 3WLWD 4ZXBB 1GCFA 4S11A 5L2KD 2WBJA 3RWFA 4O58H 2WNGA 3IDYC 3H9SD 5FUOH 5D7IA 5E2JA 3NA9L 4ZUWA 3A0OA 1FPTL 4XP4H 1QFOA 5EPMB 3Q6FA 1K4CB 3KNBA 5TFSL 1N5AA 5TDOA 3V6OA 2V2WA 2B5IB 5C9JA 2FX7H 3QCTH 4JFYA 4P2CG 4HLJA 4ODTH 4GFTB 3FQTA 4OZ4B 1EXUA 5A1AA 3O2DA 2Y06L 2VLME 1IAOB 1WICA 4R26H 2ZCKH 4M00A 5IQ7L 1T1WA 2BVQB 1IFHL 2MTPA 4XX1E 1UT9A 4G6JL 3INUH 3MO1B 1R5WB 1YMHA 2MHAA 3BEVB 3MBXL 2CRYA 5F96L 2NTSP 1JYVA 1UVQB 4LQFH 5DJZA 2YD6A 4OT1L 1RQ5A 3LQAH 4NZUL 1S7QA 2A73B 5DDHA 4RGND 1S9WB 1T0MB 1MCEA 4LPWA 3U7WH 2BX5A 3HMXL 4FQXA 2HT3C 3PV6B 3DVIA 2XQYG 3IJHA 4OLXH 2WUCH 1KTDB 1ZS8A 5DUPH 3OL2A 4Z0BL 1KIPA 3UBXA 4X8JB 1WK0A 4RAVA 4QLRA 1IC7L 1KLFA 2A6JA 5ICZB 4XVUC 5SWSD 1XCTB 4HWZA 5C07D 5E08L 4NNXA 1QSVA 3LKOB 4P4KC 3DGGA 5IFAL 2DQGL 3B9DA 5KW9L 1LVEA 5FUZH 5D1ZA 1NFDF 2ZSWB 1A9EA 4NQCD 4MB3A 1T04A 1VEPA 1FGNL 5EU7C 4E42A 1FDLH 1OGAD 4L4VE 3HE6B 3QQ3A 4KAQL 2WK2A 4TPRL 4Z7NF 3PL6A 3BKJL 1CFQB 5T1LD 4ODUB 3UAJC 1HQRA 4KI5F 5EO1A 4WTXA 1ZLWH 2H32A 3ULUF 1CXIA 2IBBA 3MYJB 4X6FA 1FLTX 1NGXB 2J6EA 1NFIA 1O5DT 1BQHB 2A83B 3PJSA 2WIIB 1NGWA 3LB6D 4ODWA 1XF5B 3STBA 3OGOE 4MQTB 1I7RA 4NFCA 5DMGD 1B4RA 2PTVA 5GZOC 2APFA 1D3CA 4I48A 4O58L 1P7HL 4PB9L 4NZTH 5T5NG 3W0WD 5CD5D 5FUOL 4MCZB 4O2CA 5IBUB 3UJJH 1NFDB 3O3EB 1QPXA 4XP4L 3R8QA 5INDB 3SBWC 2F5AL 3UTZB 3MRJA 5T5FL 2FX7L 3D6GA 3TFKC 3QCTL 4WW1B 4ODTL 3OAYK 1BM3L 2VLRB 3HS0B 1KUMA 4RMVA 5CP7B 2NY1B 5IB1B 5F89B 3OAUH 1A1NA 4R26L 2ZCKL 1HOCB 4EBQL 3INUL 1KB9J 4NO0D 4Y5VB 3RIAF 2Z31C 4Y8AA 3WIFB 3E1F1 4UV7H 4CMHB 3ZKND 1UWGH 1EBAA 2VXSH 4LQFL 1SJVA 3LQAL 4JGUA 4KFZC 1Z6JT 5EU3B 5CJQH 1QLEL 4XHJC 1Q72L 1VGKA 3IAQA 4UOW0 2Q7NA 3U7WL 4MJ6B 4I4WB 4WHTB 1G84A 3MLZH 2AEPH 2NTFA 4PJ9A 4TN9A 5C9KA 5K9QG 2OJZH 4TNVF 5SWZB 4P4RA 5BRZD 1A7RH 4P3DA 4OLXL 5ACZA 3ULVD 1T21B 2CK2A 4D0CA 5KJRH 3LN4A 3PWPA 1XH3B 2NW2B 1J12A 3VFUB 1E4KA 2XTLA 1X4ZA 4EQ3A 2EDQA 1RD6A 3C5ZD 2OQJA 3VH8G 4DVBB 3ILPB 5ANMB 4JGMA 5EO9B 5AZEH 1VDGA 5GS2H 5EBLA 1AJ7H 1UJ3B 5FUZL 1JWMA 3GB7B 1QSED 5BVPH 4ZSOE 4RIRA 4X99A 1S7VB 2XTJD 2AERT 1KACB 3TNMA 4WNQB 2AV1B 2VDMH 3VRIA 4LLMB 4EQ2A 4DN4H 1EGJA 2BSTA 1NFKA 2OXHA 3RY5A 2MKLC 2BK8A 2ZUQC 3BJLA 4MVBC 2EO1A 4HUNB 4HQQH 2B39A 1BQSA 3JBG7 4N8VG 1FNGA 4Q74A 3RTQB 4R0LA 4E41A 3BGFC 1B9ZA 3EDKA 4KZDH 3ULUH 1RZFH 5LWYH 3EJJX 4WJ5B 4AIZA 4KWUA 3X12B 3FOLA 2UVFA 3BPCB 3TBWA 4F33A 3QIWD 3QEQB 5HHMD 5LVEA 2GJ6E 3RWGA 4HUXA 4NZTL 3RUGE 1JZ3A 1WITA 5BOZG 5E4EB 4WRLA 3UJJL 5AD0A 4S1RH 1DUZA 5F6IC 1AQDB 2Z91A 1IMHC 1KV3A 5FGBC 3U0PB 3LVEA 3VGHA 4LSUH 3VXRD 4JFEB 4BYHA 3KPRA 4UDUA 4X6DB 3VXOA 4K71C 5C0BA 2ZUYA 1B6DA 3DSNA 4F7TB 4DKEL 2EIZB 1XGYH 3OHXB 3UBXG 2FSEA 1V05A 1LEIA 3F7VB 4GW4B 3LY6A 1BEYL 4QHKJ 4ZYKB 2J7LA 1Y6KR 3MBED 3DWTA 1SJHA 1U8KA 4UV7L 4ISVB 1HILA 4ODHH 4K2UH 3BIAX 4U1HB 5BS0A 3ARPA 5E5UB 3HUJB 1HH9B 2BSRB 4UILL 1MCQA 5CJQL 4FTVB 5FYJE 3LRGA 5I17B 2BERA 1MFBH 2QR0A 4Y1AA 2VLMD 2D7PA 4WUKL 1QSZA 2VC2H 3PWVB 3UZVB 3MLZL 3ZKXC 2AEPL 1D5MB 3JV0A 4F9LC 3UTSB 2OJZL 2DIBA 1ACZA 1W8NA 1ROWA 5KSAB 4M6OH 2BFVH 3WLBB 3F7YA 5GRUL 1DBJH 4JCMA 5IEKA 1Z5LA 4F8QA 5KJRL 4URTB 3ROLA 4MQXD 5GGTA 1MJ8H 1AKJA 3TCXA 2HJLB 1PYWA 4O2FB 1FV1B 5AZEL 2FGWL 3I50L 4HPOL 1AJ7L 1JZ6A 3C8KA 1NGZB 1JHTA 1ZSDB 5L2KB 3GGWA 2EDEA 5J3HD 4F9PA 3SGJA 3H9SB 1T0NA 2VDML 2BP3A 5IFHL 2BHZA 4DN4L 4ZOEA 2NLJA 4OFPA 2D0FA 1N6VA 3E2HB 3S97C 1LD9B 3DURB 3SKNB 2Y23A 1YYMH 2DWEB 4OFYA 3KPQB 2EDTA 2HFEA 1DFBH 3GFUA 5I71C 1RZGB 3TESA 4NN7B 5D2LA 3FO1A 4F7MA 4ETQA 4QRQA 1RUKH 2P8MB 4L4VD 5D96C 3ZKQD 1JFQH 2P8PB 1CICA 4OF0A 4KZDL 4MNGB 3GSUA 3ULUL 5LWYL 3MRIA 1WZKA 4I0PD 4HKXA 4X98A 1CDYA 1M4KA 4YK4C 3NZHH 4CL7A 1GC1H 3IDUA 5D1XC 3QUKB 5E9DE 3NFNB 3KS0J 4G5ZH 1T2JA 4P2OD 4Y16D 1PZUB 4DOHB 4NKDA 3GIVB 4RGNB 1JL8A 4HHAA 2APBA 4GKZB 2RR3A 4FQQA 3WNLA 1JPSL 4S1RL 3VXNA 2HFFB 1JNJA 1NLDL 2G75B 1AGDA 4HJ0D 4PJ7A 4Y5XC 4ZUVB 2JJWA 3IKKA 5FM5M 4PBWD 3H0TB 2VH5L 4LSUL 2CLVA 1YECH 3TBSA 5I18H 5M94B 4HZLA 1FO0B 5D5MB 5JA8B 1G9NH 1DN0A 1XGRA 1XGYL 1ND0B 5SWSB 3UDWC 3FQUB 5C07B 2RIKA 4OLVH 2VE6A 2XQBL 4PJXE 1CE6A 5DRWA 5IJKC 3HZMA 2DYPD 1J86A 4V2BA 2D7NA 2NW3B 1OCWH 3VGGA 4ODHL 3RY4A 4NQCB 3G04B 3LD8B 5BZDA 3N85H 1OGAB 2EXWC 1RI8A 1BZQK 4EEEA 5EG6C 4XI5C 5I1GH 3QHFH 3NVQA 3WJJA 2VC2L 5T1LB 3FT4B 4LF3B 1QBML 2VITA 3OJVC 5F1KC 5TQ2H 3EGSB 1IM9D 5FKPB 2P44B 2ADGA 4S1DD 3LSOB 5D70H 3NACH 2BFVL 3MGTB 4HS8L 5DVMA 1DBJL 3RVXD 2C4FT 4UIKH 3IGAB 4R96B 2GCYA 3TA3A 3BIKB 1MJ8L 3FQNA 4OFVA 4DAGH 5HI5D 5FA3A 3QRFM 1CFSA 5EU5B 2VIRB 5F7HA 2PXYC 4FFYH 3TYGH 5DZOA 1YY8B 2NY6C 1GGYA 3GSNA 3GRWA 2R39A 5F7NC 2ZCHL 1BIIA 4Y4KA 3HMWH 3L3OB 5TGBA 4P59H 4JFHD 4UT9H 1FSKC 6FABH 3W0WB 4D0BB 4ZNCD 5LAXB 5E2TL 2IAMC 5DF0A 4QCIA 3HTLX 3PABA 1LO0H 2IMMA 1FFRA 4Q6YA 1YYML 1FNFA 2W60B 3B4NA 3O8XD 4L9LB 3VFRB 5TDNB 1U93A 4MA1B 5IQ9A 2JLLA 1RUKL 1U3HC 4I13B 5F6HJ 3VWJC 2P24A 3BRDA 1JFQL 5T33H 3ARQA 4U1JA 1BJ1H 4NBYB 5IMMA 2WP3O 3PWJB 5CP3H 4NO0B 3NZHL 2OXGA 1GC1L 1U2HA 3GBNH 4HH8A 5BMFH 2ICEA 3K80A 3RP1A 3KR3H 3FB8B 4PRIE 4H1LB 1C5DB 1P5UA 3ES6B 4O02H 4G5ZL 3UPRB 1CFBA 3SJVE 3DVGA 2E8ZA 1HNFA 1EFXD 1A4JB 1N0XH 1PDKA 1KXTB 4BQBA 4IM8A 2GAZB 1WC7B 3GMQA 1ZLUK 1LILA 1A7QH 3CUPA 2DM3A 3QNZB 2BY0A 1VFUA 1A7PH 1OVZA 4LIQL 2GJ6D 2FRGP 5BRZB 4G8FB 1YEKH 1G9NL 4PJDA 4R3SA 1G9EA 4TNWK 1M6OA 5F3HB 3G5ZB 4HT1H 4GRLA 1I9JH 4PP2B 3UPAA 3C5ZB 1WWAX 3I6GB 4YAQA 4NQDD 1MREH 2EDJA 3BH8B 3BHBA 2RFXA 3BYTA 1H15A 1OCWL 2ADJB 5HDLA 5CJBA 2QV2A 1QSEB 5J1TC 5JR1L 4YJZL 1IC1A 5BOPA 2XTJB 4HAFA 3QHFL 2ADFH 1JPTH 4KTEH 5JIPA 4FQHA 1OAXH 4LFHG 2SEBB 5ITFA 5D7KE 5TQ2L 5HYSB 1NUGA 3LKRB 4BH7B 3SPVB 1CGVA 4AJ0A 1TZIA 15C8H 5D70L 3NACL 1FC1A 1EAPB 1AHWB 4JM2D 3LS4H 5FYJD 5JW4R 2Q1EA 4DAGL 2V7HB 3EYFB 4GRMA 5F8QC 3DX6A 4FFYL 3TYGL 3QIWB 1XCQB 1HSAB 5HHMB 4XVSH 5IIEA 4H1LH 1C08A 2MQCA 4P59L 5JQ6L 3KVQA 4QRRA 4UT9L 4D0DB 4X5WA 6FABL 3WNPA 3IFNH 3HE7D 4EDXB 3FB5A 4OF7A 1LO0L 1U58B 4JZJA 4G3YH 1WQVT 3OKMA 1TQCC 1QZ1A 1N64H 3VXRB 3EDEA 4UV4H 1FO0L 3B6SB 5T33L 2HYMA 2Q86B 3WDHA 4UQ2A 4BQ6A 1NQBA 2OTWB 4RX4A 4HIJB 1I7ZB 3O3UN 2R69H 3GBNL 3SE3C 5BMFL 3IFOA 3H8NA 3MBEB 4IS6B 5IB2A 3KR3L 3ARRA 1DUYB 3EYOB 4BSWB 4FXKB 3E6FA 4R90H 2VLKE 1UH3A 1N0XL 2XYCA 2JF1A 3RJDA 1ED3A 1X5GA 1GGTA 1HHJA 3MX0A 4JG1H 4C58B 1A7QL 5DUBA 5E95B 1LQSR 1A7PL 3EJZC 2R2BB 1A6WH 1YEKL 1X6NA 2HKHH 5AAMA 5LGHL 1PLGH 3DMMD 1KPRB 4PGZA 4PGDA 4HT1L 1HYSC 3BIBX 1DBBH 4OJFL 5EU6A 1I9JL 3H2WA 1EEZB 2DBJA 2IF7A 4KUZH 1A1MA 2QSVA 1DQLH 1JNLH 1MREL 3P77B 3WS3B 3QDMA 3PIQA 5GGRB 3IETA 4ZNEE 5T1KD 3WN5B 3U7YH 5C0CD 5CBAA 2NNAB 1QG3A 1U3JA 4P5KB 3RNKA 4G9FE 3U2SB 2J8UE 4L29B 1T1YB 2EDHA 2DLGA 4DKDC 1S7WA 1JPTL 1YPZA 3F7PC 1HCVA 2P5WE 4FQ1L 5IJVB 5JDJA 1GZQB 1OAXL 5IVXA 5J12B 5IVOA 1HXMB 1H3XA 1L9NA 2FATH 5JZ7D 4KVCH 3VU2A 2KUTA 1HDMA 4HDIA 3V79C 3MCKA 1NPUA 2NR6D 1W0WB 1V7MH 1NEZA 4WV1A 3QJFA 5I1IL 2Z8RA 4L4VB 4L4TE 1SYSA 2AQ1A 1UEMA 1C16A 2HG5A 4NQED 5JNYB 1OTTC 2H6PA 1FFOB 1FQ9C 3BP6B 4OCXH 2X5PA 4I0PB 1QBLH 4KI5C 1PAMA 3V8OA 3LPWA 2P47B 3RY6C 1YYLH 2PUQT 2W9EH 3FQXA 4XVSL 3RDTA 4U1MA 3K81A 2FH8A 5DJ2A 4KJPC 3EYQC 4X7CC 4WI8A 5CIPB 4P2OB 3OZ9H 4Y16B 4OGZA 1MI5A 2I24N 5IK3A 3T08A 3IFNL 2VDQH 4RFOH 4KRPC 1C5CH 2NY3D 4GS7B 4XC3H 3STLB 4R97B 2C3VB 2IGFH 4XH2B 4G3YL 4ODVH 2ID5A 2JE8A 4CU8A 5B38A 1N64L 1GAFH 1NC4D 4RISL 4R4ND 3P0VH 4LPTA 3ULVL 2AK4A 5SX5H 1X5AA 1W2KT 2HTLD 1KIQA 3A6OA 3QSKB 4PY8I 5JDSB 4WW2F 5IHBA 2AXFB 3DUSA 4TOYH 3SDAD 3VFPB 1ONQB 3WUWA 1CU4H 4F58H 1FLRH 3PWLA 2ARJB 2DYPB 4PJCE 1BZ9B 1N4XH 1OF2A 1R3HA 3BPLB 3PGFH 2K9UA 4AENA 3S35X 3K7UA 2QADC 1QFHA 2WAHA 1YA5A 4RBPK 3IVKA 4R90L 1BPVA 3N0PB 1DR9A 1KEMH 4P5TD 4YFEA 5CSZB 1MF2H 3C6SB 5CJXA 1SEBA 4JG1L 4YBLB 3L5WA 3CSYB 1WFTA 4H0GA 3ARDD 1IM9B 4BKLA 3WKNA 4NHUA 4QT5B 1A6WL 5MERA 4ZAKD 4GKNA 2HKHL 4DUWA 1PLGL 3D87B 4YDVA 1RV6X 4IBLT 1M7IB 3BZFB 1DBBL 3PXHA 4QXUH 2V5SA 1FIEA 3GNMH 4KUZL 1NKOA 5BJTA 3JXAA 3O4OB 4BSVA 1DQLL 2D4DA 1JNLL 2HLFC 4KMTH 2FX9H 2R2EA 4R7DB 2P43B 4WW2B 4V2CB 5KSUA 3U7YL 3HNTL 3QUZC 1I7UB 2H8PB 5LQBH 3L7EA 5F9WC 3VWKC 1T80A 5BCAA 1NBZB 3GMLA 1FE8L 1K2DA 1FRGH 1FVDA 3RUGF 4KVCL 4EZMA 4XAKD 5JHDE 4PLKD 1MLCA 3FOMB 3MV8E 4MNQA 5F1NA 3O8XB 5FYJU 4YFLF 5AEAA 1T5XA 3HC0A 4LL9A 3QDJA 2CIKA 4XNXH 4HG4K 3DVNB 4IRSD 1KCSL 2DM2A 1AGFB 3BESR 1YNTA 4OCXL 1RU9L 1QBLL 4MDIA 2ED9A 5D2NC 2FGZA 1NCWH 3G9AB 3MMEB 2QQLH 5HBBA 5EO0B 4G8IB 2W9EL 3R1GH 1DSFH 4WGVB 5EBWB 3PP3K 3C09C 4BUHA 5J8OA 2GKIA 1QVOB 1A7OH 5FHAH 4OZFB 2VDQL 1EFXB 4RFOL 4ZFGH 3CAFA 2VERN 2GJJA 1LO3H 3RVWD 3TBVA 3MXWH 2IGFL 1D5XA 3AM8C 4JM2F 1N2RA 2N4IA 4CBPA 5A16A 4ODVL 2R1YB 4E9LA 1MFNA 4KKBD 1GAFL 5J6GB 2HFGH 1FYTA 4DGYH 1WZ1L 2E7CA 2GJ6B 1ADQH 2FEEI 3DUHA 2OR9H 3TPUA 5I1LB 1G0YR 5DRZB 2GHWB 3DXAA 4XP6H 4YHNB 3RUGB 4PY7A 4TOYL 1DEEB 1G9NC 3U83A 4LBEB 1WT5C 1EBPA 4JDVB 4NQDB 1TQBC 4F58L 1N4XL 4MJ4A 1V7NH 3EDJA 3PGFL 3KLAA 3EFFA 4ZUUB 2OM5A 1ZHKA 1BIHA 2HTKC 1QUNA 1W0YT 4HLZG 1IEAA 2AV7A 2UZXB 1ZHBB 1J0ZA 4CJ1A 3MNVB 3E6HA 3EO1B 4OD2A 4WY7H 4W6WB 1MF2L 3ZDYE 3STZB 4PJGF 2AJUH 3L1OH 1JGLH 2JB6A 5B8CA 2MOVA 3KPSA 4J6RH 2AJ3B 1UZ6E 2M2DA 1F3DH 1KNOA 3ULSA 4BK4A 3IXAA 4PJHE 3CXDH 3BRGC 2GSGA 4H26B 4XNUH 1F11B 4JM2B 3CVHB 1JK8B 2VLKD 4NN7C 5F97E 3MA7B 2HFTA 4QXUL 3GNML 4GMTH 4AL8H 4Y2DA 5GPRA 3SY0A 5LJYH 5KVGH 2QSQA 2D03H 4P4KA 4KMTL 4QRPA 4M7ZC 2ZZUT 1K6QH 4WHDA 5D9SB 2FEEL 1JZ4A 2D7QA 5H37H 4QRUA 5KG9A 1CLYH 4NKOB 4ZO8A 5LQBL 4M8QA 1CFNA 2PYFA 4U31A 3RWJB 4OZFH 4RGMB 4XWOC 4KKAC 4D94A 1JGVH 3V0VB 4H20H 3P11H 3HE7B 4X0KB 1S5HB 2YWZA 1KC5H 2Y36H 3SDCD 1A6AB 4OLUH 4NPYA 5HGHA 1WUNT 4Z76A 1IE5A 3OWEA 2BC4A 5H94A 3VGFA 4EI5C 5B38G 3O3BA 4KROC 1AE6H 4KK9C 4M7JH 4XNXL 2WQRA 1JTOA 2E6JA 1QSFE 4G9FD 4JFFE 4JCLA 3D48R 1HYRC 5GQBA 4U6XA 1I75A 5IMOA 3R06A 5IOPA 3UTTD 2P5WD 2AEWA 2BOBB 1NCWL 2YD3A 2QQLL 2EDKA 5E7FA 3R1GL 1DSFL 5I8OH 4OUUB 3FT3B 3F65A 3DTXA 2H1PH 2ITDB 4PJXF 1N0LA 3SKUD 1A7OL 5FHAL 3T1FB 4L4TD 3DROA 4TUJA 2P8LB 2FIKB 1SEQH 4LPCA 4I0KA 4XBPA 5I66A 1FZJB 4ZFGL 1FNHA 4P49A 3MXWL 4PJ8C 5H2BB 5FECA 2OJEB 2DI7A 5IVZA 3MGAA 2DI9A 1IGTA 3HC4H 3WO4C 3NPSB 2HFGL 4PRHA 1T7XA 1ADQL 3IJSA 1P1ZA 3CVHH 3DMMB 1BQUA 3PHOB 4XP6L 3NOIA 1FL3B 2BJMH 2WMPA 5FYJH 2VNCA 1IKNC 5CSBA 1UH4A 1F4AA 3HZYA 4NQXA 4PJAB 2Z31A 2Y9RT 1F4HA 5T1KB 2K7PA 5C0CB 4LKCB 2NY5H 2A74B 1YC7A 1EMTL 1I8IB 1T20A 3T2NH 2Z8VC 3MUHL 3V7AE 5CEYB 1VCAA 4GUPA 4WY7L 3T3ME 4OM0H 5J13B 2X4UB 2DTSA 2OCFD 25C8H 3X17A 4YFLI 2AJUL 5E2WL 4PJXB 2FJHB 1X5YA 3NGBC 4J6RL 4KRMB 5I19H 3CXDL 2VL4A 3RVTC 4HMCA 3IAGC 4XNUL 1JWUA 1YNKH 5LGJB 4XNQA 4LU5H 1CQYA 2CIIB 4NQEB 4I2XA 3GMMB 4GMTL 4XCFH 4AL8L 4ELMB 3PUCA 4IHOB 5JMRA 4HC1A 2D03L 1X7QB 2V2XA 4OD1L 3FZUD 4QKXB 3B9EA 3BD5A 1CLYL 5C08D 1S9YB 1HWGB 4M6NL 1L7TH 4OGAD 3N1PC 4HFUL 3ZKNC 1JGVL 2NY3B 3P11L 1GZPA 1I7TB 3IDXL 1KC5L 1EUUA 3MNZB 2Y36L 1C5BH 2WLZA 4MD0B 3HFMH 4CVZB 4OLUL 1BD2A 3NZ8B 1WBZB 5E94A 4RFNB 1P69B 4L8SA 1NC4B 1G0DA 1R3IH 4HIEA 3SGEH 3D1MC 1T03H 1AE6L 1T4KB 4D2NA 4M7JL 4B7LA 2B8OT 2XQYK 3TIEB 2RGSA 2A0LC 4J8RA 3SDAB 2RHEA 3Q5TA 4Z7QE 4X6CE 1CT8A 1KJMA 1DVFC 5E5MA 3VRJB 3MV8D 5I8OL 4G8GA 5DFWH 1RK1A 3BQUD 2H1PL 5IKCB 3QULA 3P73B 2XN9A 5JQHC 4Y5YC 3ZL4H 5EOQH 3U6RB 1SEQL 4NCC1 4UBDD 2O5XL 4YHMH 4P5TB 5DQ9B 3QCVH 5TQ0H 3HC4L 4HZAA 5IW1A 1WFOA 3ARDB 1RUMH 4X7FC 3CNKA 1H5BA 1NJ9A 3QO0B 4X7EC 1WGOA 3DSFL 4P2RA 1NBYB 4ZAKB 3BUYA 2YKLH 3CVHL 5FYJL 4LPVA 1HI6B 2BJML 3NFPB 1AHWC 3DX9A 3GMNB 3U30B 2DD8H 5JW4N 4J3XA 3G6JA 5C70A 1IAIH 1MUJA 1BF8A 1VPOH 5KZCD 2CDGB 2A6IB 4IIQB 1QKZH 5EUOE 4HF5L 4LCIH 4G7YL 3D0VB 5C09E 4NNYA 2NY5L 4FXLA 3D2UD 2YZ8A 3T2NL 3SGEI 3S37X 5IMLB 4MSWB 1YEDA 4LEOB 3T77A 4ONHB 4WU5B 5GSVB 1QACA 4KQ4H 1T66C 4OM0L 4MNHA 5FOBB 2VUOA 3MRBB 2I5YH 3TC9A 1RULH 5BV7B 5CEXA 2H3NB 5HDOA 2N1KA 5I19L 3LQMA 1AXIB 1CGTA 3OAYH 4Q6IB 2DQTL 1S9KC 3O6FD 1I1AC 4LU5L 2FJGA 4BQ8A 2H2SD 4LCWA 4IRSB 3LRSA 2Y6SD 4QWWC 4Q58C 4Y19E 1WAAE 5B22A 1PG7X 4KPHH 4Z7VE 2ICWB 3TT3H 3W82A 1UXWB 3O3DB 3MLPA 5I8EB 4I3RH 3O6LL 4UU9A 1MLBB 2VDNL 4ZO6A 3MBEC 4PRBA 2NXZD 1L7TL 5CEZE 3CC5A 4P23D 4H25A 3RGVC 4X9HA 1JYNA 3C5JB 4ZUSA 3BUTA 1C5BL 3RBGA 1IAII 5IBTH 4U2ZA 1R3IL 2E8YA 4LLQA 1V8HA 5D7JD 2OZ4H 3JV4B 4YDLB 4J4PD 4HBCH 2V9RA 4ZS6C 4V1DD 4CW1B 5EZIH 1TZHB 1ZT4B 1H0DA 3K0WA 4X6EA 2HVKB 3RX5A 4NRXA 1G7PB 2ZPKH 4MQXC 1U95A 3QJHA 3FFCE 5DJ0B 2EE3A 3HA0A 5D1XA 1KPVA 5INCA 4ZFZA 1I3RB 1AI1L 1QRNE 3EOBA 4JFFD 1WBXA 3ZL4L 5EOQL 4WFFD 3ARUA 4YHML 4PRAB 3EHBC 1ZA6A 2ARJQ 1RJZB 1AD0A 1JHLH 1MPAH 5JIKA 3AAZB 5FO9B 3CZJA 3QZWG 4WTZA 5ABDE 3ZDZF 4HS3A 2J8UF 4Y5XA 3HRZB 1SY6H 5I9QB 5DT1H 3OKDB 3LQZA 1FC2D 1I3GH 2AQ2A 2OX5A 4KXZH 4M5ZH 4NO5A 4X8XA 1Q9KB 4YHPB 1KTLA 5D71H 3HMXA 4LSTH 3SE9H 2EYSB 2VLKB 4JFPB 5CGYC 2ZCLH 2P5EE 2XG4A 2DD8L 4U1SB 1IAIL 2C1OB 2XZAH 1JF5A 1QKZL 5IJKA 4F80A 3MV9E 2X4OB 5FV1L 4UDTB 5GHWH 1S9XB 4U1IB 1I1RA 2D31B 5CZKA 1MWAA 4C56E 3W9EA 1VACA 5CLTA 2WINB 5DO2C 4KQ4L 1G1CA 1K8DB 4WO4B 2QQNL 4NO3A 4ETYA 2I5YL 1UB6A 3SDCB 1RULL 1YY9D 4MDJB 5E03A 4I5BB 3D25B 3EYUH 4I77H 5TH2B 5FB8B 4HJ0C 2Q8BH 1JPGB 4DKAA 3TBYA 2Q20A 3T0EA 4G9FB 5BZWA 4Y4HC 3ARFD 5F93C 3O3AB 3MJ7B 1F58H 3MRRB 5CD3A 4KPHL 1HNGA 2DAVA 3UTTB 2P5WB 3TT3L 4OZHA 1R5VA 3BYYA 1EJOH 4GBXD 4I3RL 2PXYA 4Z7UA 4RRPA 3PHQA 4H5SA 4YFDB 3NCFB 4KXZI 3JUZA 4QXTB 4NP4H 4L4TB 4PJCF 2CDEB 3D9AH 3WYRA 1ETZB 2E3VA 3BT2H 3DX7B 2IAMA 4L8BB 1MFEH 3FQWB 5D6CA 1NDMA 1YEGH 1FAIH 4DGVH 1T83C 1HSBB 4HK3J 3X11B 3NN8B 4YC2B 5FO8A 3MRLA 4YBLC 1D9KC 4X6BB 2X4SB 3MV7D 2IPKB 1IGFL 4QOKD 4QNPE 5EZIL 2EEDA 4R4BB 1ZT7B 2P7TA 2J5LB 2JJSC 1I8LC 1VERA 4N5EC 3KPPA 4HMEA 1XEDA 1A1OB 2ZPKL 3DI2B 4IOFC 1IT9H 1KLUA 1BAFH 1CFTA 3C6LD 3SGKC 1RJCA 2OI9B 1CGSH 2VXQH 3L3HA 1EJ6A 3IRZA 4MWFA 1BWMA 4NT6A 5I73C 4N1CA 4JHBA 4LLWA 4NC1E 3V6ZB 3KLHC 1MPAL 5D72H 4G42B 3RL2B 5BV7L 4UAOB 4HV8B 5F88B 5IUSA 3SDXA 2ENSA 3EOAB 4PJCB 1SY6L 3OKYA 5DT1L 1P5VA 3DO3A 4L5FL 1I3GL 4M5ZL 5EC1B 3JVGC 3ECBA 4HUMB 1T1ZA 3RNQB 5D71L 4P2QE 3VXSA 3O8XC 4LSTL 3SE9L 5E1AA 1FFPA 4FOMA 3T65B 2H2PD 1FVCA 5DS8A 3IKCA 1FNEB 4NQVB 2YMXH 2CXGA 4ZOAA 3PNWB 4GAJH 3L5XH 1VFMA 4XCEA 5GHWL 4F3FA 3RL1A 1B0RA 5C08B 1ZGLB 1OARH 4GLRH 4PGBA 1D5BA 3GSQB 4G6KH 3BPNB 5DEFA 5FOJA 3UCRA 3K3QA 4YDJB 5F7UA 4PTTB 2GK0A 4ZXBA 4JQVC 1XT5A 1RUAH 3CH1A 1IGCH 2DB8A 4HGWA 4DZBB 4TNWF 1V3MA 1Q9OB 5K9KA 5ID1B 1CFVH 1F45A 3TV3H 4NCDA 3EYUL 3MLXH 2AW2A 2Q8BL 5C09D 5EPMA 2LU7A 4LPYA 4B5EA 1L6ZA 4OCWL 1OOAA 3PDGA 1CDBA 4MZ2A 2VAAB 5HHOE 4EI6B 1FZMA 3AB0B 2Y72A 3HG1A 3U9UA 2IBZX 1J8HE 1EJOL 2O61B 3IU3B 4QTIH 1IAOA 1J88A 3MV8B 1Z3GH 3BQUB 4KGLA 3MO1A 1R5WA 2G5BA 3DOSA 5DGRA 1CGWA 4NP4L 2DKMA 4FABH 1X5HA 1UVQA 2WUBH 1MCJA 4Y19D 1T89C 3FL7A 3BT2L 1DLFH 1U8HB 2A73A 1MFEL 3P4LA 4IMLA 1YEGL 1S9WA 1T0MA 1QR1B 4GXVH 3F6IA 3VMNA 4WTZG 4YO0B 3VD9A 3O9WD 4C59B 4GLRI 5ICXB 5CEZD 1UZ6F 5MEOB 3EW3B 3GSOB 3FFDB 4NM8L 4PJHF 1XGQB 5KN5B 1KTDA 5KZCB 5J6HB 4KUCD 3V95A 4X8JA 1U8JA 2EH8H 1JF1B 1IT9L 5ICZA 1BAFL 3SE3A 1XCTA 3B9KB 4PP1D 1D7FA 2DQUH 3QQ4B 4RNRB 1CGSL 2VXQL 2IPTH 3AU1B 3D2UB 5C0DB 4FN0A 2VQ1A 1NBQA 2BNRE 2K1MA 2IWGA 1TTGA 2NQCA 3PP4L 3TVMD 3RWIB 2ZSWA 2FECI 2OTUB 5D72L 4ZMAT 4MJIE 1YC8A 4MAYC 1OP9A 3HE6A 3UYRH 3FFCD 3BP4A 5DMKB 4Z77B 4JPKH 1S78C 3V5HB 4PJ7F 1CFQA 4HKJB 4LK4A 3LEYL 3O6FB 3K4AA 5HD8D 4HK0B 1QRND 1IBGL 1T0PB 3D69B 2YD8A 1J5OH 4PJ5E 2YMXL 3LDBB 1NGXA 3WIHH 2CK0L 4GAJL 4ZTOH 3L5XL 3K8LA 1BQHA 2A83A 4PJHB 2WIIA 4KJWC 5C7XH 3ZT6A 2NXZB 2ZKHL 4G6KL 1XF5A 4RMQA 1HIMH 4P23B 5J7CC 5CHNB 5FA4B 2P5ED 1RUAL 1IGCL 1U9KA 4NOFA 3UO1H 1ZLUH 2H9GB 3QFDB 1CFVL 3VDBA 1WTLA 3MLXL 3O3EA 1NFDA 3MV9D 5D7JB 5IMKB 2DWDA 3VFMB 1EHLL 2C3HA 2OBGA 4C56D 4U2YA 4V1DB 4A2MA 4EUPB 3S36H 1QA9A 2FECL 4WHYH 4WW1A 1MIEH 4XCNA 3DMMC 4KJQD 5C0FA 4YH6A 1OD7A 1RY7B 2VLRA 5HGDB 3ABZA 3ET9F 5F89A 1JZ8A 4QTIL 3RY6A 3HAEB 2GJZB 1P4IH 1M05B 2C1PA 2CDFB 4Y5VA 3S96B 3GBLA 3GUTA 4JFFB 3WIFA 4FABL 2GI7A 2GYSA 3U4EB 4PJIE 2WUBL 5HHVH 2D0GA 5DSCA 4YWGH 3LN5B 1F02I 2ZOLB 1DLFL 5EU3A 1OY3B 1JGDB 2XACC 4X83A 2GUOB 5J13C 4GXVL 3T3MF 4TYUA 1INDH 4PV8B 2VABB 4WHTA 5DHYB 5IG7A 5JZ7C 1M71B 4IRJC 5JPNB 4M4PA 3AVEA 1BHGA 4LKXB 4YXLH 5B3NA 5DJYB 1EHXA 3ARBD 1AGCA 2Q7YB 1BLNB 1BBJB 1R3KB 4LSVL 4DKFL 1C1EH 1UB5B 3QEUB 3DHMA 1XH3A 1Z2KA 3GI8L 3TNNA 2NW2A 3QDAA 1C12B 3VFUA 3RA7H 4L3ED 2DQUL 3MFFA 4MQSB 2Y4SA 2IPTL 3ILPA 5ANMA 4HEME 4K8RD 5EO9A 3MLYH 3TO4C 1E4JA 1UADC 1UJ3A 3HCVB 3L7FA 2W65B 1EPFA 1H8OA 1UM5H 2YRPA 4D8PB 3GB7A 1XIWD 1HH6A 2ORBL 2CKBB 1I8KB 1HHHB 1S7VA 3CXHJ 4Y4FD 4JANB 3UYRL 3CU1A 1N3NB 4LLMA 5L0QC 5DMYA 3B83A 4PLOB 4XP5H 4EUPH 2HT4D 2Z35A 3ARFB 1NMBH 4WTWA 4TTDC 1T7VA 1J5OL 2X2YA 3OB8A 3TJHD 3ELAT 4KK5D 3ESVF 4GBXB 3HAEH 4L8DB 4ZTOL 2FWOB 2P4AB 4Z7QF 1PW3A 3S37H 4X6CF 3X12A 5C7XL 4JN1H 5I8CA 3VDCA 2EXYD 1I1YA 3ARYA 3QEQA 1HIML 1H3VA 1OTSC 5ERWB 2NYYD 3HNSL 5I76A 3MLTA 3F6LA 3OR6A 4NQUA 4HIXL 1G6RB 5C0RL 4UINH 3UO1L 5HYJE 3WHXB 1MJJA 4FA8A 2IALB 1AQDA 1IC5H 1WVZA 1OLLA 3ARDC 3U0PA 2EE9A 1M7DB 3S36L 3MV7B 4LCYA 4QOKB 1XGPA 3ARZA 3MV01 1AQKL 1AO7A 4ZAKC 4AZ8A 2DQIH 1PG7H 4X6DA 2FB4H 4YIQA 4W68A 4KY1H 3SKMA 1N6QH 3U30C 1E6JH 4F7TA 2EIZA 4OZIE 3OHXA 3C6LB 5F1SA 1P4IL 1BFSA 5I16B 2E9WA 3F7VA 2Z93A 4GW4A 4IIQC 3RGHA 3SDYL 1AXSA 4LSSH 4WUUE 4CNIA 3JWNC 2PTTB 4ISVA 5EFIB 5HHOD 4U1HA 3VD5A 4YWGL 1HH9A 4CRPA 4X6CB 1CL7L 3G08B 1RMFH 3TJEH 5BXFA 5I17A 4EVNA 1J8HD 4GMSH 5C0AE 3S7GA 4QY8A 3SQBA 4M7LL 3QAZB 1INDL 4P0DA 2DQDL 2AJZB 1R5IB 4LSRH 1MH5B 4PLKC 2VDKH 3UTSA 3U36A 4Q6IC 5KSAA 1VHPA 5LGKA 2VISB 1PGRB 3D39D 4Z5RB 5B39B 1C1EL 4IRSC 5DI8A 1WT5A 1IAKA 1S7XB 4WEMB 1NCAL 3RA7L 1WAAF 5T1MA 2JK5B 1CXEA 4UNVA 4OI8A 2HJLA 4Z7VF 3B2UD 1FV1A 3MLYL 4JO4H 5F44A 4HIHA 1AR1D 1MHPH 2ATPB 1UM5L 3VFNA 3JWOH 1DBKH 4PS4H 1RZJH 3F5WB 5L2KA 1KG0B 3VGAB 1G6RH 2C7UB 1R24B 3RVUC 4N9GB 3JWDH 4W6XB 5C1MB 1U36A 4Z95L 5EUOB 5C09B 2EECA 4KUCF 1LD9A 3DURA 3JV6B 1YDPB 3SKNA 2BNRD 4OV6F 4XP5L 5EOTB 2DWEA 3KPQA 4B0MM 1NMBL 4LSQH 4Y2OA 4PJFE 3CFEB 3ARGD 5JA9A 4MJID 1UZ8B 4GXUN 3CX2A 2AGJH 5D93C 4MNGA 4FQXC 3WO3B 4F8TA 1A2YB 3WHE1 3S37L 5A2FA 4JN1L 4RBPH 2XRAH 4PRNA 2J88H 4Y19B 4M02A 3SO3C 5J1AB 3NFNA 5DEGA 1KBGH 1CK0H 2VLJD 5E5RB 4Z7VB 4UINL 4PJ5D 4E41E 3SEPA 5CKGA 5I1DB 3VG0H 4BZ2H 1F3RB 4GKZA 4TVSa 1IC5L 2HFFA 5D1ZC 2IH3B 2V5TA 1KCVH 2QQKH 2ZUVA 3O9WB 3S4SB 4EI5A 3S3PA 2DMCA 3H0TA 3DI3B 3WKMH 3T8XB 1MRCH 1JJUA 5L8KB 2X4RA 1SMAA 1AIFB 2FB4L 3GIZH 5D5MA 2CLRB 2AS5M 1RIVL 4KY1L 1N6QL 3AY4C 3QR2A 1E6JL 1P2CA 1I9EA 1ND0A 3DECA 2B20A 3TF7C 3L3KB 3FQUA 5C07A 1HINH 5ITBL 5CP3A 2DF3A 4I9WD 4LSSL 4QXWA 3GSWA 3TVMB 4HJGB 1A14H 4NQCA 5C3LD 4Q0XH 3MJ8B 3KPRE 1Y6NR 1OGAA 1RMFL 3TJEL 3ARSA 2JB5H 1T1XB 3FFCB 1IVLA 3U4AA 4WO4C 4JVUA 4J3VA 4O51A 2YUZA 3QXAA 3MUZ1 3CFIC 5T1LA 4LSRL 2ENYA 2VDKL 3EGSA 1QRNB 5FKPA 4OM1L 5ISZA 4K7PX 3VD4A 3LSOA 1T2XA 4O9HH 5EN2B 2CXKA 1IKNA 4NJAH 1NLBH 1HQ4A 1IAIM 2X4NA 4JQXA 4R96A 1I8MA 3BIKA 5FYLE 3PP3H 1U8LB 3HB3D 4AK1A 3O6KH 5EU5A 2VIRA 4JO4L 8FABB 2X1QA 1MHPL 1WSST 1DBKL 3Q48A 3THMH 4PS4L 5ADPL 5IFJB 1RZJL 4YHOH 2X7LA 2P5EB 1G6RL 1TVHB 3GEWB 4LEXH 4RMUA 1DQDH 3SO5A 5H35A 3W9DA 3W0WA 4D0BA 3AS3A 5LAXA 3DRTB 1G7JB 1CBVH 3MV9B 4TVPH 2X4QA 1FIGH 4C56B 5CEZH 2W60A 1JMZA 4YC2C 1ZE3C 3QYCA 2EDNA 1E27B 1QEWB 4L9LA 5TDNA 4JQIH 2W0LA 1MVFA 5DFTA 4QXGH 5C0JB 4QNPF 3OF6A 4U6VH 4Y89A 3WS6C 4AM0B 1VADB 4NRYB 1ZHLA 3QXDB 4ZPVB 2XRAL 1AGEB 2J88L 1BBDH 3RKDC 3OJ2C 1DBAH 3FMGH 1WBYB 4H1LA 1C5DA 1KBGL 1CK0L 1E4KC 3ES6A 5D2LE 5KOMC 4BSJA 4OLYH 3QUXD 4HKZB 4BZ2L 4OLWH 1GGIH 3C5SA 5ESQA 3PL6D 2GAZA 1EA9C 2JTDA 5TE4H 1KCVL 2QQKL 3KLSA 1WC7A 1IGJA 3AREC 3QNZA 3WKML 3ARBB 5CCKH 3BH9B 1MRCL 2BDNH 3QT2A 5BRZA 1Y0LA 1MCOL 4G8FA 5IF0A 3GIZL 2WM0A 3BGMB 2MJWA 3RX8A 5F3HA 3U1SH 3G5ZA 5HYJD 1W72B 1XGUB 5IR1A 4L3EB 1DVFA 1HINL 3C5ZA 5F1IA 5C2UB 3I6GA 3VFSB 5DFVD 5AAWA 3V52H 3BD4A 3BH8A 2FR4A 3UXFA 1LO5B 1Q9WA 2ADJA 5DR5L 1CDJA 3OGCB 2ERJB 1XIWB 1QSEA 4MXVE 4Q0XL 5M7QA 2GEEA 4CKVX 4Y4FB 2JB5L 1U8MB 3TPKA 5SWQB 5HI3D 4X4MA 4B41A 1TETL 3NIGF 3OKOB 2DQCH 2SEBA 4LHQB 4WUUD 2XZQH 4LDLB 2V5MA 1P4BH 4S1QH 3EIFA 4BH7A 3VCLB 5FDWA 4O9HL 1X9QA 5A3ID 1AHWA 3QIUC 5FDYA 3KDMB 1NLBL 1OPGL 1UWEL 2X9XA 2MQ0A 5TJWK 3IDMA 2FHBA 4F37K 2V7HA 3T4AA 3MNWB 1U91B 3HKFA 5E99H 1XR9B 5EBMB 3QIWA 3BQUC 2KQNA 1JPFA 3THML 2DTMH 3BMWA 5HHNA 3P0YL 2PO6C 4LEXL 1JBJA 4D0DA 2M1KA 3U4BH 1XR8B 4EDXA 1CBVL 2BXZA 2Y5EA 1FL5B 2EIDA 4RSVA 5CUSL 5DYOA 4WEBH 3CMOH 1H3PL 4NDMB 1RVFL 5CEZL 1JI1A 3DO7B 4WU7B 4WVRA 2PCPA 4PJ9D 1J1XH 2VRAA 1XFPA 3VXRA 4X4YB 1LK3H 2HP4A 4HFWB 4JQIL 1AH1A 5E6ID 1FG2B 2XWTB 3A6CH 3M8OL 2Q86A 1W72H 4RMWA 4U6VL 2OTWA 4XRCB 4K3EH 2ITCA 2YD9A 1I7ZA 4N8PA 4K8RH 3H9ZA 3FO9B 4LP5A 2VL5A 2R0LH 3MBEA 3B9KC 4XZUB 1BBDL 1CYGA 1DBAL 3NPZB 5HHOB 1IEBB 1DUYA 4O00A 5KSVB 4BSWA 3RGVA 4Z6AT 3MRMB 4FXKA 5C2BH 4OLYL 3PWUB 4A6YB 4KH2A 1J8HB 4LLUA 5KAQG 1GGIL 1S3KH 4M48H 1R3JB 2I07B 1UQSB 5BQ7B 4DWHA 2DQEH 1DQQA 32C2B 4XGZB 4L4JA 5CCKL 4F9PC 2R2BA 3SGJC 3BPOC 5ADOH 4Q9QH 2F15A 3D39B 2H2SC 4GW5B 4JPIA 3MROB 2W38A 4AH2B 1KPRA 3U1SL 4E41D 3P9LA 1EEZA 2J1KA 2EEAA 1Q0XH 5EOCH 1MJ7L 4LRIC 3JTSB 2X1WL 3V52L 1UKQA 1NCDH 2VKXA 5MEQB 2BVUA 3WS3A 3KJ4B 4FQIL 3N50A 4OKVA 1MCIA 2NNAA 3WXVH 5C6TH 3TIDB 4LASH 3DHJA 2VLLB 4P23C 4NQSB 1HKLH 4YGAB 4L29A 4GQPH 1T1YA 3B5TA 4DUVA 1S7TB 3BWAA 5FCUH 3GHEH 5IJVA 3VXUE 4ZD3L 3VFVB 4Z0XB 5I1CH 2BNRB 2CGRH 2I26N 1URLA 4S1QL 4TSBH 4FNLH 4JHAH 3NA4A 1W0WA 4J4PC 1OAZH 4F7EB 3KPRD 3ARGB 3S34L 2GT9B 4MJIB 3U82B 2X4PB 3DLQR 4I0CC 3IT8D 5C0BD 1A6PA 3WE6A 3LPGA 1FFOA 1QP1A 3BP6A 3JV5A 5GIRB 5C0NC 4I0PA 4BK5A 5E99L 1JE6A 4JFDE 3UC0H 1AD9B 4YDKH 2OLDA 4LAJH 3L9RB 1JPST 2A77H 2DTML 4S1SH 2I9TB 4DGIH 1FGVH 2VLJB 1SJEB 5BS0D 1TPXB 4Y16A 3CLEH 3R4DA 4PJ5B 4A6YH 1PSKH 2PETA 4BFIB 4PJIF 2UV3A 3STLA 2C3VA 1JHKH 5FYLD 1DE4A 5DD0H 3P4NA 4WEBL 5SWZE 2B0SL 3BGAA 2CLZA 1KB5B 4X7SH 4DN3H 1J1XL 2EEBA 4Y4HA 1LK3L 1KB9K 4HCRH 5F3BB 3D5OF 3TT1H 3A6CL 5JDSA 1W72L 2AXFA 1RUQL 1F13A 4JO1H 3SHSA 2V2TA 3VH8B 4K3EL 3VFPA 3FAWA 2L4OA 4K8RL 1AKJD 1NC2A 2MCPH 2R0LL 2ARJA 2ILLA 1BZ9A 3V4UH 3B8YA 4NIKB 5KANG 4QTHB 2AP2A 2GSIB 4GAYA 3TA3C 1YEJH 4HWUA 5C2BL 2R29H 2K3TA 3BP5A 1LDPH 2YZ1A 4POYA 1S3KL 1FNSL 5CSZA 4JY6B 4ZUWB 4LFHD 1T83A 3C6SA 3Q6FB 4OLEA 3KNBB 3CSYA 2DQEL 1IM9A 2V2WB 3S5LG 5HGAB 5DA0B 4OFYD 3KXFE 4PJIB 4N8VB 5C9JB 5ADOL 4QT5A 1ADQA 4Q9QL 4JFYB 1ZEAH 2VR9A 4AEHL 1EXUB 4MA3A 2MSPA 1JN6B 3MRNA 1CICD 1MCFA 1Q0XL 5EOCL 3TYFB 3SGKA 4M1GH 1XZ0A 1T1WB 1NCDL 5IP4A 3TZVD 5I30H 2MHAB 4R7DA 4HEPG 4WW2A 1PVHA 2DJSA 3WXVL 4S0SD 1I7UA 4AMKH 3JWOC 3AS1A 1RZJC 4POZD 5DDHB 2NXYC 5FCUL 4X9BA 2N56A 3JWDC 4Z9KB 3JVGA 5I1CL 1KB5H 4JFEE 4NUGH 3ZYIA 1T7WA 3FOMA 3RVVC 3O8XA 4TSBL 4FNLL 4JHAL 4L1HA 1UCBH 5GS0D 4FXGB 3IJHB 3QNXA 1OAZL 4ZSOA 4LP4A 3DVNA 2W07A 1KIPB 3UBXB 4HWBH 3V4PH 4CGTA 1AGFA 4OGYH 1CDIA 2A6JB 3PQYA 1CGUA 1IM3B 3UC0L 3C6LC 1U8NB 3MMEA 4OZIF 4F2MA 4G8IA 2A77L 2Z9TA 5EBWA 4DGIL 1IGMH 5E24E 4FTVE 1FGVL 1A9EB 4JQVA 1QVOA 3QDGE 1T04B 3CLEL 4OZFA 2KDGA 4A6YL 1PSKL 3QUXB 1OP3K 1EFXA 3GI9H 3QQ3B 2QTEA 3H3BC 1JHKL 1FP5A 3MJGX 3PL6B 1MHEA 5DD0L 4C55A 2R1YA 4X7SL 3JTTA 4XX1G 5HJ3A 3QDHA 4DN3L 4YR6B 3MLVH 4XHQA 4EJ1C 5J6GA 3U9PH 3RJQB 4ZOCA 4HCRL 5I1LA 3CLFL 5DRZA 3TT1L 1E4XH 4NWTH 3RUGA 5HYJB 2H2PC 3O2DH 4JO1L 3AS2A 2NZ9D 4LBEA 1JVKA 2MCPL 4OZGE 4JJHA 1XGTB 3TN0C 4PV9B 5FIEA 3V4UL 1WLHA 4ODWB 4NN6C 3BVNB 2EC9U 4ONGH 1I7RB 4PBXA 3H9SE 1YEJL 2D4FA 4DCQB 2AK4E 3QI9C 2DI8A 1ZHBA 2EYTA 1G9MC 3EO1A 4YHYB 1BECA 4JRXE 1JCKA 2HVJB 4O2CB 1TJHL 2NMSA 3VFOA 4WUUB 2HH0L 3MRJB 3BE1L 4H26A 4JM2A 2IQ9H 2R0KH 3CVHA 4JFOB 2NY0D 1GIGL 1A6UH 4PJFF 3HPJA 3QWOA 1A1NB 4ALAH 2WWMC 3CDGA 4JDZB 4JHZA 1SBSL 1KTRL 4P48A 1UACH 4NKOA 5FYKE 4RGNE 4AMKL 3LAFA 1E4XI 1GH7A 3O4LA 1PKOA 4UOJA 3HE7A 1KULA 4X0KA 2Z8SA 4YZFF 5CKAA 3TBTB 4OLZH 1G7IB 2CR6A 1KB5L 4K7PH 4NUGL 3WL9B 2YRLA 4PJ9B 1UCBL 2CKNA 4NN5C 5E6IB 4P3DB 4PJGA 3BISA 5SWSE 4HWBL 3LN4B 3V4PL 5F21B 4KU1A 4OGYL 3ZT5A 3VXUD 4HWEH 5EIQA 4F7PB 2UWEE 1A64A 5EBLB 3FT3A 3QEGL 1IGML 5ID0A 1MJUL 1PG7W 4PJFB 1JWMB 2ITDA 1AY1H 1LEGA 3T1FA 1L0YA 3TVMC 4RIRB 4QF1B 4X99B 2P8LA 2FIKA 3GI9L 1FZJA 3TNMB 3BD3A 4G9DB 4XMKL 2OJEA 3PWNB 2BSTB 2QHRL 4JFDD 2JJTA 2BMKA 3IDGA 3MLVL 2ICES 1I9IH 5E9DA 3U9PL 4YPGA 5HI4C 1E4XL 3DMMA 3PHOA 4NWTL 2YSSA 1FL3A 4R0LB 4E41B 3MRHA 4MLIA 3O2DL 1Q38A 1CXLA 3JUYA 4NC0B 1ZTXH 3J7HA 3MQIA 1UM6H 3NCJH 4AIZB 2V9QA 2ZSVB 4HG4J 4Y8DC 3RFZC 4ONGL 3L3IA 1I8IA 3RWGB 4KK8D 1L7IH 4QRRD 5CEYA 3MJ6A 3OXSB 4IJ3B 2V5RA 4PJXA 5AD0B 1P4LB 3ZYJA 1T3FA 4IRJA 1CGXA 4UNTA 5DJ8A 1CF8H 5ETUB 2MKWA 1UXSB 2IQ9L 3KPRB 2R0KL 2CIIA 2GY5A 1FPTH 1A6UL 2YUXA 5C0BB 4KJQC 2DDQH 5TFSH 4FZ8L 3UYOD 1QBAA 4ALAL 2FSEB 5JOPE 2MNUA 3DPBA 4DFHA 1X7QA 4KV5E 3TO4A 1X5LA 3ALWA 1U8KB 3KXFD 1HILB 1F00I 1UACL 4TSAL 1S9YA 2DQHH 1L9MA 3VXTA 5BS0B 1PKQE 1IQWH 5IQ7H 3AFLA 1I7TA 2YBRA 4XCYB 3MNZA 4MD0A 1FN4B 3MBXH 5DQDH 3TH4T 4CVZA 4XBGB 1F6AA 4OLZL 3MR9B 2VMFA 1D6EA 2HJKA 1WBZA 4HK3N 5DD3L 3ULVE 1NC4A 3F7QA 1XAUA 4YEFA 1T4KA 2HMIC 3L6FA 4NZRH 3CIQA 5IHUH 1QRKA 5EU7E 3TIEA 3PGDB 4K3GA 5CJXC 3ROLB 1FNLA 5IM7A 4U0RC 2WLYA 2DLIA 5EU6D 4Q9RL 4HWEL 1AKJB 2R0WH 1PYWB 5IBLC 3WHE0 1AFVH 4Z0BH 4OB5L 1AY1L 1D6VH 1JHTB 3P73A 2KZWA 3TCLB 3GGWB 4S2SB 5KVEH 2ERJC 3U6RA 3LN9A 4P5TA 4Y4FC 5DQ9A 2NLJB 2DQFB 3H7BA 1VKXB 2DQGH 5KW9H 1FL6B 3KPLA 3ARDA 1C7TA 5B4MC 5FO7A 4YXHH 3GJFK 1I9IL 3QO0A 2HJFB 4PRIA 2HFEB 4YDIH 2OZ4A 1CLZH 4ZAKA 3HR5A 5D2LB 3FO1B 4TPRH 3QDGD 4ETQB 5IGXH 4QRQB 3SJVA 3KYAA 2VXUH 3NFPA 4AIXA 3DV4A 3GMNA 1QBBA 4FQ2H 5CGTA 4M93C 1CICB 3VXQB 5JXEC 5JLZA 1UM6L 3NCJL 2CDGA 2A6IA 4TRPH 5HHME 4HKXB 3UTQA 1F42A 1S8DB 4IIQA 4RMSA 3TZVB 4KKNA 2X4TB 3D0VA 4NO2B 3RDTD 5E1HB 4MSWA 3RWHB 1B90A 4LEOA 4ONHA 1L7IL 4WU5A 5GSVA 3V7MA 4APQD 5F9OH 3FB7A 3MV11 1FCCA 5FOBA 3CFDB 5FYLH 3ZKMC 4HHAB 4FQQB 4UIMB 5AUMA 2AJVL 2FLRT 4Q9CA 2H3NA 1BFTA 1RIHL 4XPHH 1SY6A 4M7KH 5I6XC 1CF8L 4Q6IA 3RPKA 4PB9H 3QUMB 2AK4D 3P30L 3O11B 4IRSA 2WP3T 5E8EA 1DN0B 1XGRB 2DDQL 4EKXA 4KJYB 2F5AH 4JRXD 4BZ1H 2B4CH 4G6FD 2DBLH 1UXWA 3LKQA 3O3DA 5T5FH 5DRWB 4P46D 3HZMB 1ZVHA 1BM3H 3EO0B 3FKUS 4LLYB 1MLBA 2DQHL 4BQ9A 3KPNB 4KKLD 4H8WH 5BZDB 1IQWL 3P3YA 4M1DL 3MRPB 2IANA 4N0RA 4EBQH 4G80A 1YEHH 3M07A 5DQDL 4UNUA 2LTQC 2VDRL 3X13A 1E0OB 4OAWA 3QNYB 3SCMC 2XWJB 1NDGA 3JV4A 5FYKD 1QLEH 3T4YB 1Q72H 3KAAA 1K9TA 4NZRL 4CW1A 5IHUL 4XP1H 3EAKA 5D6DA 3VDAA 2ATKB 4POUB 2FD6L 4FQCH 3VE0A 1TZHA 5B8CC 1ZT4A 3B9VA 3VJ6B 4K94H 4LVNC 3FQNB 1G7PA 2R0WL 3QA3A 1CFSB 4HGKC 4NSKB 3IF1B 1AFVL 3B2UC 1I3RA 3PXJA 4KK6C 1D6VL 2IBGA 3KJ4C 1AR1C 1JTPA 4Y2DC 5TGBB 5KVEL 2VXVH 5D1QD 4G8EB 5DTFB 5C71A 3PF2A 4PRAA 2OMBA 1HZHH 5CGMA 1KCRH 1RJZA 3P9MB 1NUDA 5FO9A 4J1UA 5I1AB 5EOCJ 4QCIB 3MUGA 3PABB 1A6ZA 4R2GD 4YXHL 1UA6L 3KJ6L 2WSKA 3IRPX 1G1YA 5GS0H 3ILQD 4YDIL 1CLZL 1Q9KA 4YHPA 3QUMH 4FFWD 5IGXL 2XN9E 4OF3A 2D9QB 3QDJD 5EULV 2PW2A 2EYSA 2NY0B 2O26U 2HLAA 2VLKA 2VXUL 2P24B 3DGCR 2C3GA 4XTRD 3RWDB 5KVFH 2YR3A 3AY4A 4FQ2L 1GOHA 4U1JB 3ARGC 4L8CB 4LAQH 4TRPL 1QQDB 4P3CH 1KLGA 3B2VH 2X4OA 1UM4H 4UUJA 2E7BA 4UDTA 5KS9E 1S9XA 3D3VA 4WI9A 2CQVA 4J7RA 5F9OL 5GSRA 3KLDA 4N0CC 4KZEH 4LCCC 5FYLL 1TPXC 4WO4A 1SMOA 3QUYC 3SDCA 1ZWIB 4MDJA 1J05A 2RCSH 3QQ9C 3GMQB 5FK9B 4XPHL 3CUPB 5TH2A 5IB4B 5FV2A 4M7KL 1MVUB 3QEHA 2J8UA 3O3AA 3MJ7A 4LVHB 3D18B 3MRRA 3L5JA 2JIXD 4BZ1L 2B4CL 2P5WA 2DBLL 3VXUB 2L7UA 3MJ9H 3OAZK 1PX4A 1JF6A 5DRXA 3RZCC 1S7SB 1NANH 1FVEA 2NY2D 2RFXB 3BHBB 3W81A 5TPWH 1H15B 3RWCB 4M6AA 5TF1H 4QXTA 4H8WL 1XF4B 4DKEH 4L4TA 1ZT1A 1MRFH 4CU7A 3E3QC 5JHLH 2DM4A 2CDEA 4YX2L 5SX4H 2XKNA 5CJ8A 1ETZA 4KDVA 1YEHL 1BEYH 2F54E 4P9HH 3L3DB 4L8BA 5JOPD 4JFDB 4E5XB 3F8UB 4FQHB 1HSBA 3QWRD 4BJLA 3X11A 3NN8A 4UILH 2HT3D 5FXCH 1TZIB 3CZFB 2W9LA 1Z9MA 3ORJA 2X4SA 4X4ZA 3LEXA 5DC4B 4XP1L 2AABH 4FQCL 4WUKH 3WEXA 1KJVB 4R4BA 4K94L 2IBZY 3ZHLA 2FLBT 2IADB 3UMTA 4XVUD 2X40A 1A1OA 3WS6A 4GRMB 3S9DB 1JGEB 3BSZH 3N06B 4QRPD 5F7WC 5GRUH 3HB3C 3U0TB 4JFHE 5FUCE 4U3HA 5IIEB 1J7VR 3M17B 2VXVL 3C8DA 4QRRB 3UTPD 3V6ZA 1HZHL 1KCRL 2FGWH 3I50H 4G42A 4HPOH 3FB5B 5M95B 2ZOKB 3UZEA 2E27H 3QCUL 4HV8A 1SM3H 3AREA 1RK0B 1OTUC 4JZJB 4PJCA 4XB8A 4YBHA 5GS0L 1NANI 5EC1A 3RNQA 3QUML 1WWWX 5MEPB 5AYQA 4MGXA 3OJDA 3ZE2E 5IFHH 3MRGB 3I85A 4X6DF 3LZFL 5KVFL 4P5MB 5SX4I 5ESAB 4UQ2B 4L8SC 4LAQL 5I1JH 1NAMB 5JPMB 4XNYH 3GKZA 4P3CL 3B2VL 4QYOA 3IFOB 1UM4L 3KXFB 3MODH 1ZGLA 4Y7MA 2BVEA 3GSQA 2FBOJ 5GZOD 4YDJA 3E6FB 3HUJF 5GGUB 4PTTA 4Q97A 4KZEL 5DQJA 5JW5B 4XVTH 4PLNC 3I3EA 2H26B 2RCSL 5ID1A 4RQQB 1LE5A 2F8VA 2W91A 1XF3B 3NIFE 5EC2B 4D9QE 3AUVA 1I4FB 3EO9L 4JREB 3TFKD 1R0AL 3QIUA 5GS3A 4ENEC 2VAAA 3OR7B 1JPSH 1YQVL 4NQDE 1NLDH 2CD0A 2OTPA 4OTXH 1YMMA 4WWKC 5EU6B 3IDJB 1RURL 4ZUTB 1H5BC 1A1MB 4DEPB 2VH5H 3MJ9L 3WIHA 2E9IA 2O61A 5JHDA 2AKRB 3IU3A 3PIQB 3DRQB 4JY4A 5TPWL 3BQUA 3BN9C 4GSDH 5TF1L 4OZGF 2VAJA 2DM7A 1JV5B 4HUUA 4K9EH 4UQ3B 2PO6A 4YGVB 1MRFL 5JHLL 1CS6A 3RNKB 2VDLL 1V3JA 4NKMB 5E7BA 2XQBH 4XHJD 5CJOH 1KPUA 1B0GB 4LGSB 4P9HL 1S7WB 3ROOA 4WWID 1DJSA 3H3PH 1YPZB 3I3DA 5FYKU 3RIAK 5EWIL 4YHYC 1QR1A 1T5WA 4X9GA 4F37F 3ZTJG 4YO0A 1MY7A 4HDIB 2KBGA 3S8WA 1CLOH 3QDGB 5ICXA 4Z8FH 3QJFB 1U92B 4RAUA 1TMCB 2AABL 3GSOA 3FFDA 2HG5B 1C16B 1EHAA 1XGQA 1QBMH 2H6PB 5J6HA 1NAMH 2VDOH 1Q1JH 1JF1A 1U8PB 3OKEB 1TIUA 3U0WH 3FONB 3BSZL 4HS8H 3RX7A 4XMPH 5GS1B 5HHPA 2P48B 3B9KA 5EIIB 4RNRA 2XPGB 2Q76B 3D2UA 3FQXB 3PE9A 3RDTB 4U1MB 1OL0A 2QJDA 2MFNA 3BKMH 3NH7H 1KIRB 1ZOXA 1B2WL 3RWIA 4APQB 5IK3B 2OTUA 3A6BL 4ZO9A 5FFLA 4OZGB 2YOCA 2E27L 1SM3L 5DMKA 2ZCHH 4Z77A 5A2JH 5B38B 4HKJA 4MVBD 2R8SH 4HGMA 2AK4B 3BDYH 4JE4B 5E2TH 1O7VA 1KIQB 5D5MF 5E6IC 1JYWA 4JRXB 3D69A 1HHIB 5I1JL 4G6FB 4XNYL 4LRIA 4P9MH 5JO5B 2FBJL 3GMOA 5DHXB 3FT2B 2C26A 4P46B 3REVB 4J23A 3SDXE 3MODL 4LSPH 4PJHA 4HLZH 4DZ8B 4AENB 4OQ1A 5C0IA 2XN9D 5IESH 2UWEF 1TFHA 4P23A 2GITB 1F97A 5C0EA 1ZVSB 1TENA 1LK2B 4XVTL 2FYYB 1Q8MA 2H9GA 3QFDA 1CXKA 2V7NB 5D7JA 3VFMA 4J4PA 2WQ8A 2R4RL 4P2RD 5KSBE 4GKNB 4EUPA 4YQXH 2DLEA 4OTXL 2P49B 3D85D 3GSVA 1F4YH 4PJAE 2JELH 5EZLB 4YHKH 1OAQL 5HGDA 5BJTB 3HLAB 4Z7OF 5C0CE 2NZIA 4LIQH 1HE7A 1NCBL 1OD9A 5E56A 1KCKA 2GJZA 3HAEA 2R2EB 4GSDL 2CDFA 2APTA 3ZO0A 3S96A 3O81A 5JW3H 2YC1B 1NCTA 4K9EL 2A6KA 3KYKH 1OP5K 4JFFA 1QSFA 4HD9A 4GT7A 3U4EA 5D1QB 5CJOL 3W11C 3LN5A 2ZOLA 5DMIH 3H3PL 3GMLB 5E00B 1FZKB 1JGDA 3HG1E 2GUOA 4IJ3C 2UWEB 4R2GB 5JR1H 4PV8A 3M1BB 1MLCB 2VABA 5DHYA 1M71A 1MCPH 4NQEE 1CLOL 2G2RA 4XMLH 4Z8FL 1T5XB 3HC0B 5DJYA 1TXKA 3QDJB 4ELME 1R3KA 2F54D 5HDBE 1YNTB 1NAML 4JZNB 1OSZA 3BXNB 2VDOL 1CVSC 1Q1JL 4O2EB 4S10A 4RA0C 3VXPB 4MDIB 3U0WL 1C12A 3PDDA 2I9LA 4XMPL 5DD6B 3MA9L 2WW8A 4R6UA 3T0EC 4G6AC 4KTYA 1KCUH 2VWEC 4YHZH 3BKML 3NH7L 1QD0A 3P40A 4KV5F 4MS8D 3HCVA 1KT2B 4YHLH 5E70A 3MACH 2IH1B 1CLCA 2EH7L 1UWXK 3Q1SH 4BZYA 1HHHA 43CAB 4BH8B 2R1XB 3TBVB 1N2RB 5FM5O 1N3NA 2HRLA 2EE6A 3QO1B 1EVUA 4XBEH 1NGQH 5JQ6H 4HH9B 5FYKH 2R8SL 2J3SA 3D0LA 3BDYL 3TPUB 3V9FA 1CZ8L 1JI2A 9CGTA 3ULVF 4NUJA 4WI4A 3CD4A 2JIXB 2LU3A 4PY7B 1TVBA 4GG8B 4F15B 4P9ML 4GKSB 2NX5A 1FO0H 3F12B 2NY2B 4L8DA 3G6DH 2B4CC 5DVOA 3WFEH 4RWYH 4LSPL 1QO3B 2PYEE 5D1XD 1INQA 3EFFB 3KLAB 4XXCC 4LHUA 5HTSA 3C60D 5IESL 2XG5A 4PGJA 1IEAB 4H8WC 4OD2B 4XNZB 4GOSA 1G6RA 1VFAB 5TF0A 3EYSL 4M8VA 4W4OA 4I18B 3WHXA 4P99A 2ADIA 2J8HA 1KNOB 2ED8A 3ULSB 3IXAB 4CMMB 4EXPX 2JJVA 2GSGB 1PKQB 1CN4A 1M7DA 4YQXL 3LQAC 4LRNH 4DK3A 4LPXA 4JDTH 3VGDA 5LCVL 3GDBA 4PIRF 2F53E 3I3BA 1ITBB 1F4YL 5EZOH 4CVWA 3L5HA 2JELL 1I3UA 4WHYG 4YHKL 3VFWB 4M1CC 3QXTA 3HPLA 1TJGL 3C6LA 4QRPB 5I16A 5LGHH 1OW0C 3NCCB 3FN0L 3ZSSA 4D9QD 5GZNC 3TZVC 4QRUB 5JXAH 1GPOH 1HEZB 5JW3L 3KYKL 4OJFH 5E2UH 1A9BB 1CFNB 2PYFB 2PTTA 1BOGA 4PLJD 2A9NH 3A67H 4GAGH 2EXWD 3B5HA 1LP9E 5DMIL 4XAKE 3IDIB 4X6CA 4XI5D 3G08A 3LEVH 3ARVA 1OB1A 1FZOA 4ELKB 4Z76B 4KQ3H 2AJZA 1JZ7A 4U6TA 4EN3C 1R5IA 1MCPL 4JLRA 4ZXBC 2BC4B 2NPLX 4XMLL 4PGEA 1MH5A 5T3ZE 2K7QA 4LARL 1WWBX 4FQ1H 1HXYB 4U6XB 5B39A 1G7HB 2WV3A 3IS0X 3R06B 5DJXB 1LE9B 2CRZA 5IOPB 2W0FB 1S7XA 1S7UA 3TN0A 1LO2L 2B5IC 5DEZA 4PGCB 2JK5A 2PXYD 5I1IH 4Q2ZB 1KCUL 5F7DA 3DTXB 4YHZL 2NY6D 4WCYH 3FN3A 4YHLL 3QI9A 5DK3A 3MACL 3DROB 3F5WA 4XBPB 3WMSA 1KG0A 3Q1SL 5IV2A 5DVLA 4NBZB 1R24A 1FAKT 1KJ2B 2IAMD 5FECB 2HA1A 5IVZB 2FL5B 3T0DA 5HYQA 1AP2B 5EUOA 4XBEL 1NGQL 3WDJA 2FEDD 5C09A 3OKNB 5FYKL 5KVDH 3JV6A 1NGYA 1YDPA 4XVJH 4K7PY 5EOTA 1MQ8A 1P1ZB 1BFOB 1U3HD 5HYEA 4JJ5A 3VWJD 4LLDA 1Q94A 4ODXA 2OR8A 2V6HA 2Z92B 3HZYB 4RISH 4OCLC 3ULVH 4AQ1B 3G6DL 2BNQE 4IDJH 1II4E 3WFEL 1BVLA 4U7SA 4U1LB 4RWYL 4PJEE 2G60H 2XXCB 5CZXC 1T20B 5HYFA 5HSFA 4FQJH 1RZKH 1J18A 1U8QA 4Y19A 4JKPH 1WAAA 3NIDE 4P2YA 4JRYE 4GUPB 3MRKB 3QZWB 2CR3A 4KKCD 3REWB 4Z7VA 1ACYL 3PGCA 2R9HC 2RQ8A 2BRRH 3Q6GH 2IH3A 3O9WA 3MRCA 1VA9A 5JMOC 4LRNL 2EICA 3HE6C 4JDTL 3K74B 5EZOL 4I2XB 2CLRA 4U6YA 3FQRB 2P46B 5DLMH 3L3KA 1MQKH 1DQJB 3K1DA 5JXAL 1GPOL 3MLRL 5DXWA 4PB0H 3N1FC 5E2UL 5LBSL 5ILTH 3TVMA 3CSGA 4FQPA 4HJGA 2A9NL 1MFAL 3A67L 4GAGL 5KS9F 1AO7E 3MJ8A 3QQNA 4QGTA 3AGVA 2VZVA 1KJ2H 3LEVL 5GJSH 3HNTH 2IG2L 1T1XA 2JCCE 3FFCA 5KOVC 1AC0A 3O45B 5DJ6A 3QBTB 1EX0A 4PD4J 5D2NE 4KQ3L 2ZUQB 5CMAB 4JZOB 4HIEB 3Q0HA 1QLRB 1QRNA 3KPMA 4OFDA 3UTTE 1FE8H 2FZ3B 4HIIB 4KC3B 3BGFB 3V7AG 2BHYA 4LVHC 3HG1D 1CT8B 1KJMB 2Q3AA 2MPAH 2VB5A 5E5MB 5JOFB 2LQRA 4WCYL 1KCSH 3QULB 1HKFA 4B7IA 2XN9B 4KVNH 3V5KB 1OP3H 1LMKA 4K55A 4LHUG 3L95A 3S98A 5IFJA 1QHPA 1RU9H 2W0KA 2NY1C 2LV4A 2AQ3A 2P5EA 3ULUC 4YBQC 4M62H 1P6FA 1F4XH 4Y5VC 1AXTH 1OGTB 5F6IB 3DRTA 4LLVB 3MV9A 4XPGH 5IW1B 1KYOJ 4C4KO 5KVDL 4CMHC 5KS9B 4X9IA 5F7EH 4XVJL 4P2RB 4O5LL 4C56A 4M5YL 4K71B 1E27A 1QEWA 2XY1A 2CUIA 3D85B 1CDHA 5TDPB 3G6JB 3UP1A 1WZ1H 3E0GA 4IDJL 4J3SA 4W4NA 3FHQA 1IQDB 3K4DA 4AM0A 2G60L 4NRYA 4NNYB 4HXAH 3QXDA 2VOTA 3CCHB 4FG6C 4FQJL 1RZKL 1WWCA 1YEDB 2M8XA 3QXVA 3U46B 4XPTH 4JKPL 1WBYA 4K9EC 5GJTL 4MNHB 4FMFA 3VD7A 3CDFA 1CVRA 4R7NA 1UJ3C 2BRRL 5EH1A 3Q6GL 1K5NB 1YUHB 2LVEA 2PYED 5HHQA 4XPAH