1YNKL

Identification of key residues of the nc6.8 fab antibody fragment binding to synthetic sweeteners: crystal structure of nc6.8 co-crystalized with high potency sweetener compound sc45647
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
219
structure length
219
Chain Sequence
b'ELVMTQSPLSLPVSLGDQASISCRPSQSLVHSNGNTYLHWYLQKPGQSPKLLIYRVSNRFSGVPDRFSGSGSGTAFTLKISRVEAEDLGVYFCSQGTHVPYTFGGGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords immunoglobulin kappa light chain
publication title Cocrystal Structures of NC6.8 Fab Identify Key Interactions for High Potency Sweetener Recognition: Implications for the Design of Synthetic Sweeteners
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 48
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2005-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ynkL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ynkL01
4MJIA 4I48B 3RI5K 5TE7L 3KPRB 1B0GA 5IB1B 1G7LA 4JHBA 2PETA 3OWEA 5LWYL 3V0WL 1HQ4A 1D5BB 3TC9A 3EFFA 5C7XH 1HDMA 5FOBA 5CEYB 4CN1A 2Z4QB 4HXAH 2RCSH 3TBSB 2QKIA 3R8BB 1QA9A 1CTNA 4UOW1 1J1XL 4PJAA 5C07E 3RGVD 2FX9L 5HYJD 2W9EH 5DD6B 4WGVB 3RWGA 1FAKT 3OL2A 1BZ9A 1NL0H 3QQ3A 4GAGL 3DETC 1GOFA 5D7LB 4C56D 3O3EB 2EYSB 1T2JA 4CKVX 5C0FA 1EIBA 3ARFD 5C6TL 3T1FB 2JCCA 5F3HB 3SDCD 5IQ9B 4ISVB 1ORQA 3BN9C 4GQPH 5F6IB 4LPTA 5IBTH 1NUNB 1J8HB 4P2RB 4YHML 1FFPB 2YKLH 3QUYD 3DTXA 1QLRB 1QBML 2B2XL 4YZFF 5F7EL 5D96B 1RURL 2QADC 1G7IB 1QLEH 4I1NB 3RJQB 2E9BA 1QR1A 4OLUH 1ZVHA 1U36A 1NDMB 5IB2A 3QIBA 2ESVE 1EHLH 3MRLA 5KSAD 3NCYS 4NJAL 3ARSA 3QXWA 4PJHB 3WFCL 2YPLE 4FHBD 2FHBA 4QTHB 2X42A 2ZPKL 1RIVH 5EA0L 3DX7B 2PCPA 4F15C 2DLGA 4OCMC 4LQ1A 3GMQB 1RK1B 4J4PA 4ODUB 5FYLL 3P0VH 2VLKA 3WFHB 2V2WB 4X6FB 5F9OL 3PF2A 3QIWB 3ZL4L 2I07B 3VXSB 5CEZH 3DROA 4TTGA 3GGWB 1QVOB 1CFSA 5GRJH 4NBYB 2OTUA 1HILA 2M8XA 4F7TB 3A67H 3WS6A 4L8SC 1Y18B 1TJHL 1BBDH 4YDKH 1CDJA 5JNYA 1BGXL 1LO0L 2YBRB 5EZJB 3DURA 5ETUA 3O6LH 3RKPA 3BPOC 4IDLA 1NSNL 2OJEA 2ZSVA 3W2DL 2EYRA 4JFXA 5C0DB 1I3RA 2J6EL 8FABA 1KIPA 4WTZA 1WWAX 5DMKA 5GPRA 4HBCL 4NQDE 1UJ3B 1G7IA 2D7OA 1MFCL 3FQTA 4YR6B 3AREC 4J1UA 2X4PB 1V8HA 4HJGB 4IIQA 4WTWA 3FOMB 1S9XB 4MJIE 4GMTH 4JKMA 5HVFB 5F1NA 5C0AB 4PGBB 3UYPA 4UIMA 5E70A 4G6MH 5CJOL 4Z7QE 1YMHB 2HLAA 3MV7E 2CJUH 2DQDL 3UTTB 3MA9L 4HS6A 4KVNL 4U31A 3TYGL 2XY2A 4P5TB 4ELME 3VGAC 2APBA 5C08E 5F1IB 3IRPX 4OIIH 3MXWL 4UBDC 4PRBA 3U9PL 5JUEH 5KVGL 5M95B 1RZJL 1OAZH 2FYYA 2XWBB 3MRNA 3I6GA 5BRZA 4BKLB 1KCUH 1LO3H 1ZT7B 2BSSB 2Q8AH 2Z31A 4OZHB 1XGUA 2QSQA 5F88A 4WI7A 4NNYB 3WCYA 3QZWB 7FABH 1UM5L 3K46A 5C0IA 1FV1A 3CDGA 2DWDB 3SEPA 4NCC1 3F7QA 3GMOB 1A1OA 3FQNA 4GSDL 4HH9A 2FECI 3NGBB 1KEMH 1QSFE 1OTUC 4UMGA 4PS4H 3O6FB 1OAYL 2P5WB 2XA8L 2XN9B 4PJ8C 3EW3B 4KROD 1KT2B 3Q0HA 1I85A 3KPRE 1DVFD 4WEBH 1T1YB 5DUBA 4WV1B 1PEWA 4D9QE 4U3HA 3FB6A 1B0RB 5F21B 4JG1H 1OAUL 4D9LH 3BP4A 3H9SB 2LV4A 3PJSB 2ZUQB 5DD0L 2GAZA 1F58L 1UGNA 1AO7A 2A6IA 5DUPH 5I18H 4QLRA 3HUJA 2KPNA 1ZLVK 3PWUA 3S5LB 1IL1B 5D7LE 3SGDI 1JZ8A 4ORGA 1G0DA 3IDNA 4XPFL 3EOTL 2R29H 1MVUA 3PV6B 3T2NH 3VG0L 1J8HE 4P2RE 4FABL 2YS4A 4JLRB 4DUVA 3HA0A 3NCFB 4OF0A 15C8H 4YFLI 2AJZB 3D69A 4KPHL 5EOCH 4JPVL 1D6VH 1FYTD 3CLFL 2AXFB 3QUZC 4P4KB 1XGYL 4WVRA 5DUMH 3T3PF 4X6CF 3WJJC 3H9HB 2F74A 3FTGB 5F7KC 5B39A 2OMBA 5J13C 3MUGB 4L8DB 3KPOA 1FNSH 1RJCA 4XVSL 4Y4HA 4PJHE 3C2AH 1NGWB 2JK5B 5C86A 4EUPA 4JY4A 1MI5B 1QSED 1VFOA 1JGUH 5CD3A 2V2TA 1ZLVH 2VR5A 1T89C 1A1MA 2H32B 1RUPH 4U7KA 5I1HL 3LS5L 1JYVA 2AGJH 1IJ9A 4GXVH 4HK0B 5DEGB 3HPJA 3PJSA 4OD3L 3DUUA 1IKFL 1MY5A 4TSAL 5CIPH 1I8LC 1JWSA 2WIIA 1S7VA 5EUOB 4L8CA 1HXYA 5LAXA 2WUBH 4WJ5B 1A3RL 4G5ZL 3TNNA 4U1NA 4DKAA 2G60L 2E9WA 4O51B 1ZSDA 1NBZB 2NLJB 1X4YA 1IGCL 3QJFB 4JRXA 3DIFA 1J7VR 5GGRY 3GMNB 3EYFB 3HR5A 4I0CC 1C16A 1PGRB 2DJSA 4WHYH 4NHCL 3HMXH 3UTZB 1DBML 1NMAL 3EDKA 5E2TL 1J10A 3HE6B 4F3FA 4KRPD 4FQLL 1F90L 2KL6A 2MQ0A 5D7JA 3TEUA 2IPTL 4PIRF 5DJXB 3MLWH 2Q7YA 2XXMB 1UKSA 1OTSC 4OAWB 5C0AE 5HHVL 2DI8A 4L3ED 3OKLA 4NKDB 4X98B 1IAIH 1T1XA 3O2VL 5JIHA 1X5AA 3N85L 5T3ZL 2XZQH 3RRQA 1AKJB 3D87B 4LGPB 3HC4L 5CJXA 5ICXA 1IC5L 5F1OB 1FO0H 3KHOA 3UTTE 4ZUSA 4U1IB 2DBLH 2VO5A 2DIAA 4ZS7L 4N9GB 4QRRD 3SE9L 5D1QD 3STBA 3TA3A 3MLYH 3UTSB 3F58H 3CUPA 5L0QB 3IS1X 4HK0A 5CGYD 1WT5A 4X4XB 4JM2C 3EJZC 3GMRB 1BREA 4JHAL 4OZHE 4Z5RB 1Z3GL 3I6LE 3BZEB 1EFXA 1ETZB 3HZVB 4YXKH 3RBGA 1MCOL 3U6RB 3NACL 3WHXA 2EYTA 4LDEB 3LHPL 4NN5C 4PR5B 3UYRL 1T6VN 1U8KB 3CSPA 4HLZG 4NWTL 3FO2A 5CP3H 5EH1A 2VXSL 5H37G 1A21A 2GQHA 1AY1H 1QKZL 3BKCL 2A2QT 4G8EB 1D3CA 1FJ1B 4ETYA 4OQ1A 2ICWJ 2XFXA 2P5WE 2FL5A 2XN9E 3NN8A 4X7EC 1N5YL 1JI2A 5GS2H 2X4RA 4GG8A 4U1GB 2IAMA 4ZPVA 3MLXH 2PYEB 1F2XK 1UWEL 3B5GA 4HUXA 3LKPB 5MEOB 3GSVB 4KGLA 3BP6B 2D9CA 3H9SE 4GFTB 4MA7L 4ZFOB 3CPLB 1NCTA 1XIWA 4ZNEE 2ID5A 3RWDB 4FXKA 3IDGB 1DL7L 2GW5A 4J6RH 4X5XA 4ZMAT 4XTRD 1ZEAL 4U49A 3I84A 3H0TA 1H9VA 3LEVH 1FZOB 3WKNA 1LDSA 1HSBA 2N56A 4MNGB 1AC6A 3Q1SL 4KC3B 3HAEA 3MOAL 3GMRA 5FECB 4NYLA 3I6KA 1BIIA 5EU5B 1DQLH 4OZFH 1DQQB 3QDHA 3WMSA 4YDLB 3HE7D 2AABL 4Y4FA 5DJ0B 4XXDB 4QRUB 3SOBL 2ZUTA 3IKKA 1CE6B 1DN0A 3KPPB 1HYSC 5CBEB 4PB0L 4NDMA 1GZQB 3MJ9H 4Z0BH 2J8UB 1Z9LA 1NCNA 2BY3A 1S7TB 1ACYH 2VN4A 4MCYA 4MHHI 1SEQL 3K7UA 4LIQL 3X12B 2RB8A 1FNGA 5I19H 3NFSL 1DBKH 2IG2L 3ARZA 4PJXA 1A9EB 1MI5E 1CGWA 3FMGH 5I66A 5IGXL 1YEHH 4XP5L 4P23A 4C83B 4NNPH 4V2BA 4PJ5D 2VKWA 5FAAA 3S36X 2E6PA 1M7DB 1R0AH 3H3PL 4LFHG 3BGMB 1D5IL 2R0WL 1I9IL 4U6VL 2VSDA 3RZCB 3QEQB 4G9FB 4YUEL 1YEFL 1CXFA 1U8OB 4F7CA 1YUHB 2BVQB 5C0CA 2VUOA 5T1MB 5D7SH 3DXAA 5EUOE 4EVNA 1RK0B 1YECL 3OX8A 4ZFZB 2C3HA 3MCG1 3CMOL 4E41D 5FK9B 2V2XA 2ZNWA 4RGNC 3UDWC 2XRAL 4O9HL 2Q7NA 5EU5A 3TO2B 1KPRB 3GNMH 5ANMB 5EU4B 1K8DA 3LEXB 5AEAA 4QRUA 4UV7H 2X89D 1N59B 2GTWB 2NW2A 4HH8A 4U2YA 3P9MB 5EO1A 5JPMB 2I9LA 4X9FA 2GHWB 1YJDL 3EKCA 2WINB 1G7QA 4LGSB 5JOPD 3VXTB 4OV6F 5F8QC 4K3JH 3BGAA 4HJJH 3TO4B 2EDBA 4RISL 4JY6B 1RZ7H 5IG7A 1EFQA 3VWKD 4M1DL 2OSLB 2MHAB 1A9EA 1CFTB 5D96C 1I7RA 4QOKB 4A2MA 4QGTA 2VKXA 3ETBF 3UTSE 5EU3B 1JGDA 5IP4A 3BGMA 3VXOA 5K9KA 4PLNC 1QSZA 2IGFH 3SDDD 4XNYH 4BQCA 1S7XA 2MCPH 3VXQA 5E5RB 3MO1B 3KPSD 2CRYA 1NEZA 2FLBT 3GSXA 3U4BH 4BM7A 3QRGH 2VDKH 1RK0A 5FHBL 2WNGA 2WIMA 3F12A 2Q1EA 3IRZA 4NN6B 2R2HA 4CN4A 3LPWA 2NXZD 4IRSA 4ONFL 2EDWA 2BZDA 1NLDH 4JRYA 5IM7B 1EEQA 1YYLL 3MPCA 5T3XH 4X4YA 4UDUA 35C8H 4JDVB 3V4VH 1I1AA 3KDMB 4RAUA 1NFIB 1HZHH 1H3PL 4HXBH 4NQVB 4OKDA 5JORA 3U7WH 3OXSA 1BD2B 3TT3L 1VGEL 2F19L 1EO8L 2H6PB 4KI1A 5D2NB 1G9EA 3ZMRA 2PYEE 2A83B 1G9NH 1XF1A 1M1SA 3LEYL 1U2HA 1XMWA 1MJUH 2QR0B 4JGMA 4WUUD 3FQWB 1HSAB 2BMKB 1QYGH 1W72H 3MRGA 2YRPA 2EIZB 2E27L 5IHZA 1RJZA 3GHEH 4K3DH 2OYPA 1FVDB 3X13A 4MNGE 2VAAA 2BNUB 2D7TH 3QA3B 4HUVA 3HI5H 2JB5H 2HN7B 1NC4B 1EAJA 1VA9A 3ZYIA 4NT6A 3Q3GA 2BNQB 4WDIA 4P5TC 1F4WH 4ZTPL 1ZLUK 3WN5B 3UZEA 5FM4A 1FPTH 1AGCB 1SY6A 1F4XH 3TVMC 2J8UE 1TZIA 2EIBA 3ARUA 3LH2H 4PJAF 4CVXA 4O2FB 4NFDA 3SKMB 3WV0A 3HNTL 1OCWL 3QUMH 2V7NB 1P4LB 1ZTXH 1FIEA 5I71B 5JW5A 5DFWH 1BZ7A 1RY7B 3QXDA 5C0GA 2DQTL 2JCCF 2XWTA 3A6BL 2CUIA 2YEZB 2DQUH 3TBVB 4MB3A 4NC0B 5GJTH 1KJ3H 4JCMA 4WUKL 4HUWA 2V7HB 2R23B 4GMSL 3E8UH 3NGBC 2H2PD 4FZ8H 4BH8A 5JHLL 4HFWA 2F5AL 4QRPB 3D85A 1LQSR 3QEQE 4G9FE 4N5EC 3RIAF 2DQCL 1JWMB 4CMMA 3ABZA 3QJHA 1R5IB 3WE6B 1FNEA 3C08H 1ZLUH 5CSGA 4NZTL 3MFGB 5D1ZC 3WYRA 5CEZD 5L8LB 3U0WH 3K81A 4QTIL 4RZCB 1DUYA 3VA6A 1IGIL 1OSPH 1BJ1H 2ZUQC 1P1ZA 5ANME 2BNQA 5I1LB 3HPLB 4NP4H 5D1XA 1RZ8A 4IS6A 5E6IC 2AEPL 1F6AB 1PY9A 2FZ3B 3O11B 2BRRH 4P5KB 5H2BB 5I0ZA 4K7FA 2BHZA 3T0DA 4HMDA 3EFDL 4HUMB 2VZSA 4M7KH 4KTDL 1WAAA 4O2FA 1WWWX 1Q8MA 4HLJA 1U3HA 3MRKA 4R7DB 5I1EH 2MPAL 3CGTA 2A73A 3WUWG 5HBBA 1IGJB 2P42B 4ZPTB 1CLZL 5I8OL 1J5OH 3ARGA 1Q9WB 5CSBA 2Q86B 4DVBA 3LB6D 4XC1L 1UH4A 5IQ7H 1S9WA 1N5AB 2P48B 2VR4A 4NWUL 4HPYH 4QOKE 5DD3L 2Q3ZA 5E4EB 3FQUB 1WITA 5IHUH 2NY2D 3AB0B 1T03H 1BAFL 1OTTD 1FQ9C 5TJWK 4HKJB 5E24E 1QUNA 4LLMB 1L4IA 5DGQA 3HN3A 5FM5M 4PREA 1VEOA 3W11D 1X6NA 1WBXB 3UZVB 3FOLB 4MAYD 2I26N 4MS8D 1UB6B 4ZUTA 3CFDB 5C7XL 5KSUB 2Y6SD 3GSNH 5HYSB 3VRLF 1FG9C 1I3VA 4R2GB 1I8MB 5DMIH 1PQZB 3O9WC 2W38A 2EDFA 4XI5C 3OJMB 1Q9KA 3O2DL 1I7TB 4Z7WB 2W9EL 1NL0L 2AV7A 1D5ZA 2H9GB 4HMCA 5GGTH 3WL9B 4H0IA 1KTLA 3JTTA 5DRZB 5F1KC 2VIRA 4MXVF 4QRSA 5DFTA 1JGEB 5H2BA 2IH3A 2YKLL 1TLKA 2XQYG 3B9AA 3MLUL 3MV9A 1UM6H 1BD2E 4WCYH 4H1LG 1EAPB 1QLEL 2NR6D 3OKKA 4OLUL 5DXWA 4DN3L 2NTFB 2EH8H 1EHLL 4HJ0C 4HX1B 3BMWA 4HKBB 3KYAA 2X44D 3KPLB 4LOUC 1ZT1A 3TPUA 2BC4B 3MX0A 2HMIC 4KGJA 4YEFA 3HE6C 3CDYA 2XG4A 4LLUA 3ULVD 4IMKA 3KLHD 4JPIB 1RIVL 2Y4SA 2DI9A 3L5JA 3QO0B 5BZWA 3FO0H 3STLA 1OP9A 3FB5B 5JOFA 2D0HA 3ARDA 4I2XB 4PRIA 3VGFA 2QQNL 4GS7B 5T1DH 5L7XH 2P8PB 3AM8A 4JFED 2D03H 2LTQC 3VGGA 2ARJA 5DQDH 1IM3B 4MWFB 3REVB 2UZIH 3C60B 2BNQE 3MR9A 4YHIB 4GKZA 2AXJA 3UTOA 5L0QC 1LK2B 3WIIH 3QDGD 1HOCB 2HT2C 4Z8FH 2WBJC 2Y36H 1WAAE 1BBDL 4POUB 3HUJF 4YDKL 4K23H 5C6PB 1X5HA 4AL8H 3DI3B 2YMXH 4H8WH 4JPWL 4BFBD 2CH8A 4O58H 1D9KD 3P0YH 1LO5B 3NCEB 4YHKL 3JSSA 3S35X 1A8JH 4WHDA 1CU4H 1PEZA 4H20H 1MCDA 5HHNA 2ZSWB 5DC0A 5BS0B 4RX4D 4P2YA 4NOFA 5GGUA 2XPGA 4GMTL 2ZCLH 3RA7H 1KTDA 2X7LB 4H25A 2BC4A 3DHJA 9CGTA 4XHJD 1CE1L 3WLBA 2Y06H 4ZFFA 3FL7A 4HHAB 4JPIA 5IV2B 2BHYA 4G6ML 3O6MH 4RMWA 2CJUL 3V6OE 5C09B 3GJFK 4U1GC 1TJIH 4KZDL 3LKNB 3DYOA 2CIKA 3ESUF 4CNIB 3HB3C 1JV5B 4A2LA 1GYAA 1E4JA 4OIIL 3SGKC 3G08B 4GRLB 4QHKJ 4MWFA 5JUEL 3H7LA 1OAZL 1WFUA 4LRNH 2Q8AL 3T0VA 1JTPA 4OI9A 2X10A 3QXVA 1ZA3A 4RIRA 4OM0L 4QT5A 1SJVA 4PJIB 1KLFA 5EOCJ 2EDEA 5L2KB 3MV9E 4N8VG 3RTQC 4NZRH 3O0RH 5J11B 2EO9A 2R69H 4GW1B 4WW2B 3FB8B 3OR6B 3QRFM 3VRIB 3TZVB 3L7FA 1UXSB 4OQTH 1KTKE 4KK6D 5FM5O 3H3BC 5HHQA 5KVDH 4PS4L 5DURB 4XPGH 1WZLA 3QDMA 3REWB 4G8GD 3IVKB 1YDPA 3RNQA 1VSCA 3EHBD 4KK5C 1U8HA 5FCSH 3MREA 3QQ9C 3U7AA 3QWQB 2IADA 3P11L 2D7PA 3EAKA 4Q6IB 1N2RB 1A6AB 2Z9TA 4H5SA 2DQEH 5DUPL 5I18L 3UAJD 2OI9B 4Z7WE 4EXPX 4Z76A 4AIXA 3V5KA 4RQQB 3PL6B 1KLUA 2E7MA 4Q7DA 1HXMA 3MGAA 4YBLB 4UQ2B 4GRMB 4U33A 3RGHA 3RZCC 3WO4B 2Y5EA 3U79A 2R29L 2YPKA 1QD0A 4YGVB 4IMLA 2FEEI 2ZJSH 3L3OB 3T09A 3FT2A 3B8YA 4QHNB 2GKIA 3HNVL 5L2KA 1MHEB 4L8BA 3QI9B 5EOCL 3WFBH 1UH2A 1E4KA 5HD8D 2F53A 2FH8A 5SWSA 3I02A 2J4WH 5DUML 1J05B 4P46B 5A2JH 1F02I 1ODAA 4UNUA 5D93C 5GS2D 5GZNC 4ODVH 4PJ7B 3G5ZB 1G1CA 1NKOA 3O8XA 4JVWA 4MLSA 3C2AL 4ZNCD 1DE4A 2BVPA 4PY7A 4WEUD 2O61A 2OJZH 3MXVH 4CADA 4FQXC 3KPNA 3J7HA 5BQ7A 3LS4H 2FX7L 3TO4C 4F9PA 4I2XE 4PP2B 5IUSA 4OFPA 1RUPL 1I1YA 4QYOA 5GS1B 2PO6B 4NQXA 1RMFL 4GXVL 5E7BA 2IWGA 3GHBH 1A14H 1S7SB 2MTPA 2W65A 3RQ3A 1ZGLA 3GBML 4YDVB 3ZE2F 1GXEA 2VQ1B 1YN7A 4PBXA 4PD4K 1OM3L 1K3IA 1S9VA 2QSCH 3IJSB 2WUBL 1M71A 4GRMA 5DWUL 4GW5B 2MFNA 1MWAH 1F4YL 5D8JH 4AH2B 3W9EB 1E27B 1KJ2B 2VLJB 3QCVH 1EA9C 3CZFA 3CVHH 4NN6C 1PAMA 3C8HA 4R4FH 4AIOA 1YN6A 3FAWA 4X0KB 3ZSSA 3CC5A 1V7NL 5BS0E 2ICCA 3MLWL 1A6PA 1JN6B 5DJAA 4KKAC 2ZG3A 4Y0GA 2FRGP 4WFED 2YWZA 3GSRB 4KMTL 2YRZA 1IAIL 3MBXH 4K9EH 3ZDYF 4L9LB 2VN7A 1TZHA 1FO0L 5C09E 1GJIA 3CFBB 5CHNA 5D2NC 2DBLL 2V5SA 3EO1B 1MELA 5F7DA 1CFQB 2EDHA 3MLYL 5JMOC 4MNHB 2PW2A 4PJXF 2FGZA 6CGTA 3RGVA 2OR7A 4KJWC 5HYJA 1ZKAA 1L7IH 3BKJH 3FB7B 4C56A 5BVJB 1BJ8A 4OZ4A 4LCWB 4PY8I 3UJTL 2HKFL 3ARFA 5IOPB 3SDCA 4KQ4L 4YXKL 3SE4C 4PJIE 4ENED 4XWGH 5L2KE 3MRFB 3JTSA 3RFZC 2BVUA 4JN2B 1FNAA 3QUYA 4PPTA 5SWSE 1FVEA 4I3RH 3UTPD 3WFZA 4L3CB 3QUXB 4XBPB 5HGDB 3PDOA 3ULUL 2KKQA 1AY1L 4MD4A 2VXUL 1NMBH 3DVNB 5L2JA 5KSAA 4YWGH 1TMCB 3MBEC 2D3VA 3FCTB 1W2KT 5DS8B 3MLXL 4DZ8B 5IVXA 2EIDA 3QO1B 1PLGH 1TVBA 5I71C 1G9ML 4WTXA 1B4JL 4WW1B 1QFWM 4K2UH 4RNRB 3KNBA 1TZGH 1AQKH 2IQ9L 3K8KA 3GMLB 4JQXA 3PNWB 5GRVL 1LP9B 1RZKH 4OFYD 1QFWI 4J6RL 3CCHA 3ORJA 3H7BA 1CLCA 4PJEA 4MNHA 3B3IB 2HFTA 1UKTA 1X5YA 4PGCA 3LEVL 4ETQA 1CGVA 3MCKA 1N7ML 1NGZA 1FNHA 4X5WB 3MUHL 1R5VB 3V6OC 1UXWA 2X41A 4L4JA 2OZ4A 5BJTA 5T3XD 1HINH 3FFDB 1AIFB 3RY6C 1OARL 3TN0B 3W0WD 3PWJA 1XR9B 4Y4KB 4FQ1H 3MJ9L 2DLEA 2OCFD 4Z0BL 3FN9A 1PKQA 3WFDH 3U2SA 1FL5B 3IFOB 3OPZH 3F5WB 4HKZB 1MNUH 1ACYL 3D0LA 5ESVA 3S8WA 1H5BB 4PJ7E 2SEBA 5E2WH 1M7XA 3DRTA 5I19L 5MEQB 4WFHD 4GG6B 1SJXA 4PTUB 1RZIB 3QWOB 2APTA 4J7RA 4EKXA 5HI5C 4MQXC 2ZG2A 3QO1A 3GSQA 4NNPL 2QTEA 3HKFA 1X5KA 3UX9B 1KLGA 1SJEB 4R96B 1J1OH 2XWJB 1FGVH 1EO5A 5T1KB 4HT1L 1CN4A 5E4EC 3PQYB 4EN3B 3GIVB 4F7MB 1S3KH 4ZYKB 5D7SL 3D2UD 3O4LD 1LE5B 4LCCC 2AJUH 4P2QD 1MJJB 4KI5F 4YIQA 4O00A 2PR4H 2W92A 1QNZH 12E8H 1R5VA 3QDJB 3TP4A 3C8KB 1A9BB 1C08B 3LV3B 4CAGA 4BQ6A 4R7NB 3JUZA 4G9DB 4D0BA 3IDXH 4UV7L 3BZFA 1SYSA 1KENL 4ELKA 1CBVL 1KCSL 2FSEB 3EIFA 4NSKA 4CUCA 1QFUH 2I9TB 4DEPB 5E95B 4LSVH 3IFOA 1PDKA 5IB3A 1UM4H 4ACPA 4OSUH 1VFMA 2B39A 4JZJA 4HJJL 4J3UA 1KYOK 2VZUA 1OQOA 1QSEB 5HHMB 4H0HB 1DVFA 1NUGA 1IC4H 4R4BA 1JNNH 2EXYC 1A2YB 3TPKA 3U9UB 3ARRA 5JPNA 1FNFA 3G5XB 1H0DA 2HFFA 2C3VA 4P48A 4JFFD 3IETA 4ODSH 1NC2B 2EDRA 1IGMH 4PJEE 4G42B 2HJLA 3ECBB 4NM4H 1GC1C 3NIDF 1CFVH 2NW3A 2IGFL 4OGYH 4ODTH 2MCPL 3IXTB 3PGDA 1MAJA 3U4BL 4LCWE 2VDKL 1W0YT 1W0WB 5IROC 5HYQA 2YA2A 2BDNL 4PJBB 5EBMA 1E28B 1XGQB 3EOYG 4GS7C 5EN2B 1MLCB 1YEKH 2HRPH 5LXGH 3W39A 4MZ2A 1VFAA 4PJ9C 3GB7A 2ENYA 2BVOA 4LHUG 5T3XL 3L95B 1FYTA 4G7YH 2V17H 35C8L 1JCKA 3V4VL 3E6FA 4JO3L 3AUVA 1A7RH 2FIRT 4GKNB 1FORL 1WK0A 4XVTL 1HHJA 2L0DA 4HXBL 5T5NF 5BXFB 3FT4B 1DLFH 1NJ9A 3WD5H 5JO5B 4YQXH 5K59F 4HKXB 2GJZA 1RIUH 4LLAA 3X3FH 4EUPH 4IRZH 1BFTA 1QSEA 3NIFE 1J88A 2VXQL 3S37H 3VMOA 4EIGB 1P7QD 3NZ8B 4N68A 4OF3A 1WAAF 1A7OH 2VZTA 1AI1L 3VH8G 1X5JA 2RBLA 3D18A 3MMEB 3JWOH 2Z93A 4XMLH 2A74A 4Y5XB 1MCJA 4GUPA 1QYGL 3B9KB 4JQVC 5H94A 3GHEL 1LNUB 4K3DL 3UROR 2D7TL 1CGSH 2LFGA 4XPTH 3V0VB 3MRMB 3HI5L 3INUL 2JB5L 1EEYB 1BJ1J 1BZQK 2CDGA 5FF6A 5GISH 3F7PC 4HZLB 3DBXB 2NXYC 4NO0B 3E6HA 5AD0B 1MH5A 2AK4B 3OR7A 4YHZL 1X5FA 4K7PY 4Y16B 4UV4L 2X1QA 1QBAA 2GJ6D 3ARED 5F89A 3X3GH 3QBTB 5BMFL 4GRLC 1FPTL 4WHCA 1F4XL 3DV6A 3VU2A 2GFBA 5KJRH 3SGDH 3TJEH 4PJGA 4ODWA 4ZTOH 3EYOA 5FO9A 3QFDA 2HVJA 3MGOA 5IW3A 4EQ2A 1HIMH 1TVDA 4XBGA 3F7YA 1CICC 3QUML 3PWVB 2D4DA 1ZTXL 5TDPB 5K9JH 4GG6E 3M07A 1HI6A 5IMLB 3CSBA 4LSRL 4U3XA 4LSTH 4L3EA 2PYFA 2DQUL 5C6WH 5J11C 1Y6MR 32C2A 5GJTL 1KJ3L 4WW2C 4WO4D 1KXTB 4UBDD 1R3KA 2P8LA 3E8UL 3TCXA 5HPMB 1ZHLB 3L6FB 4FZ8L 4QRRA 5D1QA 2AS5M 2H3NB 1T0MA 4XRCB 1MFBH 3D39D 1UENA 1LD9B 5ACZA 3OGCA 5E8EB 3WDJA 1LEIB 4LLVA 4M8QB 5HY9A 1ZA6B 4LPCA 1GGYA 5MENB 3BP7A 1GGCH 1DBJL 3QDJE 1DBBH 3BRDA 4PRDA 4Q6IC 1S5IH 5J12C 1FYTE 1U8NA 1J9CT 2X4TB 4UU9B 4EDXA 1KBGH 1A5FL 3PL6C 2BRRL 2APFA 5I1JH 2IJ0C 4JREB 4NNXA 4AENB 3WO4C 3MA7A 4M7KL 5E8OB 1KJMA 3VI4F 2JJTA 5ITFB 4DN4H 5D70L 1BQHB 5MHSD 5FO8B 1QSEE 5HHME 2CSPA 4DVRH 1G7MA 1TTFA 4J8RB 1UWXH 2B4CH 3QEUA 4R26H 3RPIA 5J3HD 4XMKH 3MV8D 5IHUL 2B1AH 5CSZA 4WHTB 4HCRA 1O7VA 5I16B 4JDTH 2Z91B 5CS7A 1G6RL 4G80A 4JVPA 1R5WA 2H3NA 4QY8A 2UYLA 3ARBD 4FG6D 3VJ6B 1KELH 1HCVA 4PRHB 4Y5YA 1X7QA 3MRBA 3GSNL 4KUCF 3CLEL 3IJYA 5DMIL 4GXUN 3CSYA 4PJBE 2ED7A 4XNMB 1ZA6A 1SVZA 5L6YH 4KDTC 3B2UC 1J0JA 3QUZD 2ERJC 5GS1C 2PO6C 1D5MA 4JR9H 2GY7B 3LN9A 4F9LC 5GGTL 3HE7A 4XNQB 3RL1B 1CZ8H 1A3QA 5C0BB 5FDWB 3VFSB 2PKDA 1N8ZA 2A1WH 4GKSB 4HIEB 4RMRA 3U7YH 2GK0B 5ID1B 1MAKA 1UM6L 4WCYL 4ZDHB 5DJ2A 2P5ED 3BESR 2B1HL 5ESAA 4RWHA 3ZTJG 5A40E 4JQIL 5GS0C 1AGEB 3AFLA 3PWNB 3KYOA 4DW2H 1NCAH 4CW1A 3B2VL 1BM3H 5TGBB 2EH8L 3HNSL 4RDQF 4Z7UB 4QRRE 4PJ5A 2QJDA 1CDBA 2XKNA 5IEHB 1OGAB 2DIJA 2NY0C 3G6DL 5EC2A 3QIBC 1FSKB 1N0XL 5EFIA 3ZKMC 3O3AB 5T1DL 2YC1B 5L7XL 3X14B 2D03L 1PG7H 4R0LA 3S34H 5C07D 1IGYB 3HI1B 4E5XB 4E41A 2UZIL 3NFNA 4AIZB 1UZ8B 3EUUA 2AK4E 1OSZA 3SE3A 3G5YB 1FVCB 5EWIL 2BNRB 2ITDA 2YR3A 3RX5A 1OAQH 3QHFH 4J4PC 4PG9A 2YD4A 1FH5L 4XNQA 1FZMB 4OGAC 2X89A 4Z8FL 4U1SB 2X1OA 3ROLB 2Y36L 1OTSD 1PW3A 5B38G 4UAOB 3LOWA 4N9OB 3AAZA 4FTVB 4AL8L 3ARXA 3MGTB 4H8WL 3HRZB 1H3TA 5ID1A 1T04B 2H8PB 4O58L 3OBAA 3NCYP 3P0YL 3BUTA 4MQ7A 3WS6C 2YZ8A 5C8JA 1YPZB 4XNXL 1NGPL 4P2CG 3OJDB 5DMJB 2ESVD 4LHJB 3VWKA 4H20L 3Q6FA 1MQ8A 2R1WA 3MLTA 3PHQA 5EBWA 1MQKL 1UQSB 3RA7L 3RWCB 4PLOB 3L7EA 2FO1A 3EJZD 3RY4A 2Y06L 5KS9B 1T4KB 2BJML 5DEZA 1NCBL 4K8RH 5EZLA 5AZEH 5I8CA 2CKBB 3SDDA 5C9JB 2W91A 3UBXI 1IAOB 4IIQC 1TJIL 3KPSA 5DC4B 1NMCB 1RHFA 1KULA 4HUUB 3V5DB 4F7EA 4RCAA 3GRWH 4ZO6A 3GKZA 3QULA 5F6HJ 4Q9QH 5IKCA 2W59A 2NY7L 5L9DH 4LRNL 4O2EB 4GKOA 2VABB 1FVCA 5IWLA 4U6HA 5DJDB 1W0VB 1ZS8B 2VJXA 3LQZA 4PGDA 3BW9A 4Z7VB 1BFVH 1FZMA 1FDLL 4W6WB 4TYUA 3OZ9H 4JZNB 3EOBA 3SCMB 5HGHB 3F7VB 4YHPA 3SHSA 4NQDD 4H88H 2JB6B 3ILQC 3TN0C 3O3BA 4PJ5E 4XPGL 5CLWA 4OCWH 1JVKA 4WUUA 5CWSB 5HGBA 2DKMA 4XVUC 4BH7B 4D0DB 3C9NA 2QSTA 3FQXB 2DAVA 2BCKA 5KG9B 3MV7D 2CDEB 1PG7W 2UZXB 1NGXA 3QIUD 2EXWC 1GOGA 2YZ1A 1E6JH 5C08D 3QT2A 2DQEL 5I1IH 1NAMB 3EYUL 2FEDC 1BX2B 3V5DA 3HFML 3UMTA 1FZJA 5IW6A 4G8FA 4ZQKA 1JUFA 4FP8H 3BWAB 5ALBL 3B9VA 3L3IA 4YHOH 5C0BE 3DGGB 4KMQA 3UBXA 3JV0A 5FM8A 2ZJSL 4XZUA 3VD9A 1S7RA 1MHPH 5IW1A 3TCLB 4PYGA 5JOPE 1WJ3A 1U8MB 1LVEA 3VI3E 4XWOC 3UO1H 1EGJH 5ENWB 3NBNA 3RZWA 2J4WL 4MD5B 4XX1G 3TIEA 1BEYH 5GGSA 3FN3A 1QSFD 2O5XL 3ZE1E 4MAUL 1FE8H 2R1XB 4UTBH 4ZD3L 1O7SA 2HG5A 4Z7UE 1EHXA 3OAZK 3EDFA 3RWJB 1T0NA 2DL9A 3MLRL 1HWHB 4DEPC 2JJSC 2FIKA 1OGAE 2VZOA 3KPRD 3WUWB 3MXVL 3NCBB 4S0TD 1BQSA 4D9QD 3MRJA 3LS4L 1KPUA 4TPRH 1R24A 1OAXL 3GMMA 4PD4J 3BPLB 3BEVA 2XYCA 2E3VA 4Y4HC 1QPPA 3N9GH 3I75B 3R4DA 4X4ZA 3MRHB 3BIBX 1A14L 5DVLA 1JPFA 1QFPA 2EE3A 5IVXF 3QFJB 2QQQA 3ESVF 5D7LD 2B0SH 4BFIB 1KFAH 4P4RA 3NAAH 3QQ4B 1QPXA 4EEEA 5A2KH 1J8HD 4P2RD 4OCSL 3QNZB 4HGWB 3S4SG 3OHXA 4B7LA 1MWAL 4PJEF 3C5ZB 3LRSB 4I5BB 4MZ3A 4FTVE 4YC2B 3OB0K 3CVHL 3KPMA 3OAZH 2IPKB 3CXDH 2XTJB 3LPFA 3T0AA 4JFYA 4YJZL 3SJVB 3BDXA 3CVIH 1CDCA 2PW1A 3MTRA 4LKXB 4S1SH 1YPZE 4HIHA 3KWWB 4XBEH 5EBGA 5ICYA 3C6LB 2VNCA 2CK0L 5JIIA 1XCTA 2P7TA 1TFHA 4X99A 1DR9A 2F54B 1FP5A 3T4AB 3CH1B 2OTPA 4H1LB 4N5UA 3W9DB 4F37K 4BFGA 4JFHD 1MLBA 3MBXL 5KS9E 1S7QB 5KN5B 5IK3A 4K9EL 5INDA 4I0PB 3MCLL 1RUMH 2VC2L 4JFDD 5D7JC 3IAPA 2APXA 4MAYA 4XNUH 3SQOH 5A2LH 1IGFL 4PUBH 4NQCD 4NKIL 3VFUA 1AP2A 2A6JB 1I8KA 3QIWD 1LEGB 4KHTL 3I3EA 4F33A 5ITBH 3VXSD 4NJ9L 1L7IL 3AS0A 5CJXC 3ZLQC 2RFXA 4Y5XC 2ICEA 3BKJL 2HWZH 3MACH 2VQUA 2CD0A 2YA0A 1U8LA 3OB0H 1WCBB 4Z7VE 5GS0L 5TDOB 4XWGL 2FJGB 2Y9RT 4X6BA 3ARWA 4DFIA 4NPYA 4JFOB 1ZAGA 5TQ0L 3VRJB 2QBWA 3C5SB 5J1AA 1JGLH 3QP3A 4OTXL 1JNHA 1H15B 4K94C 3MOBH 4OZIB 4Y16C 1N6UA 4HDIB 1NMBL 3GFUA 1BF8A 2R4SH 4OBRA 5DHXB 5I1KH 2GT9A 1JHKL 3L9RB 4YWGL 1UA6H 3CMGA 1I4FB 4ZAKB 3NTCL 1S5HB 1WVZA 3BEWA 5C0AD 2ICES 2C7UB 3LKOA 3T2PA 1JFQH 3P73A 3T1WA 2ZOKB 5I75B 5B3NA 2WLZA 3UTTD 5DJYB 3PE9A 1T7ZA 3IGAB 1TETL 4HFUL 3RNKB 1TZGL 1AQKL 4P5TD 1EEZB 2OR9H 4JFEA 3S88L 1RZKL 2IAMC 1ZT4A 4OZGF 3R06B 4ZUWB 4N0CC 1KOAA 4YBQD 1R3HB 3NFPB 1LEGA 5BV7B 2FATH 3WXWH 3T04D 3I6LD 4HF5H 5FKAA 2ZOLB 1BVLA 3EDJA 3LKSB 1BQLH 3QNYA 2J7LA 3QDGA 2Q76A 4QO1A 3RWEA 1EX0A 3FRUA 3VE0B 2IQAA 2ADJA 4MMXC 4APQB 4JFOA 3MZGB 4FQ1L 1RZGA 3Q5OA 3WFDL 1D9KA 4PRAB 1IMHC 3OPZL 3UJJL 1OLLA 2VL5B 3O6FD 3B6SA 4N8VB 2P5WD 4Y4FC 2DJUA 2VLRD 2XN9D 4BSWB 4YGAB 4RX4A 4BK4A 5SWQA 4JREC 2AKRB 2BVTA 1GC1H 3P9LA 4M48H 3TBYB 1RUQH 3VFPB 4XHQA 2OTWB 4M1CC 2C7UA 1ITCA 3NA9H 5T1LB 2EC8A 3N50A 2WWKO 3H9SD 3V9FA 3H9YA 6FABH 2KQMA 1ZE3C 3G04A 1A4JA 2HLFC 1FGVL 4JZOB 3WEXB 3BGFB 3MSPA 3QFJE 4P23C 1S3KL 2OXHA 3WNKA 3DSNA 5E1HB 5CBAA 2AJUL 3O45B 1HHHA 4X8JB 3PXHA 4IHOB 2UWEA 2X4UA 2FJHB 5E8DL 2PR4L 1QNZL 4QEGA 3MRDB 5C0RH 5FYJD 1FL6A 3AMLA 4KQ3H 1YEJL 3HMXA 1KYOJ 3IDXL 3HCVA 3KYNA 4Y19B 3GK8H 3HZYA 4P4KD 2WZPD 2XTJE 1KCVL 5IJKC 3BDBA 3GBNH 2N1KA 3IDJA 2NZ9D 3OKNA 4HS3B 1QFUL 5DA0B 5TH2B 4LSVL 1F4HA 2XQBH 3QYCA 2HJFB 1H8OA 4OSUL 4G8GA 1CCZA 2Z35B 3ULVE 2ED9A 1GGBH 4S1DC 1YNKH 1HN1A 1MI5D 2GEEA 4HK3N 4PJGF 4OGZA 4I18A 1IC4L 4XI5D 4TVPH 3VFRA 5J1SC 3U36A 4JFEE 2A38A 2A0LD 2DM3A 2BOBB 2QQLH 4M43H 2R56H 3ZHDA 1U8QA 4ODSL 1WEJH 1IGML 5JXED 1HEZB 1CFVL 3MJ8B 1FG2A 1BBJA 1K4CA 4GBXB 3DO7A 5JOEA 1BFOA 4LLDA 4ODTL 5EORL 1I3GH 3V6ZB 3VXNA 2HT3D 1NBVH 2A6KA 3RWHA 3QB7C 4NQSA 3ZT7A 1XCQA 4YEEA 1Z5LB 1BP3B 2NYYC 3JVGA 1OGTA 3UP1A 3NVQA 3VMPA 1YEKL 4GRWB 3IDIB 2HRPL 1G7PA 5LXGL 5CP3A 5DI8B 3IU3A 2VTFA 4DCQB 3PGFH 4HJ0D 3OKOA 1BVKA 3DX9B 3RVUC 4OZIE 1SBSH 5E1AA 1A7RL 3HE6D 2E8YA 1EZVY 2EDTA 4UTAH 5BO1H 3VG9B 4W68A 4W4OA 3V5HB 2P43B 4IRSC 2J8OA 3WD5L 4QHUB 1FFNB 4FMFA 1YNLL 3IXAB 4IJ3B 1NEUA 4UAOC 1BMGA 3S98A 1RIUL 4OBSA 3HI6H 2X70A 4O2CA 1AKJD 4IRZL 4UUJB 3T4YB 4YX2H 1I7UB 3S37L 2W0FA 1X4ZA 4Z0XA 4FFYL 1A7OL 4HWZA 2FECL 4WU7B 1A22B 1U8PB 5DDHA 3JWOL 4XMLL 5IB5B 1DQDH 3UTSD 5C70A 2GITB 1TNMA 4TUKH 2HT2D 3O6KL 4PTTB 1V5JA 5HI3C 5BCAA 5T5FH 3VFGH 1TENA 3L3DB 4QCIA 4FNLH 4OZFA 5DQ9A 5BOZG 3WBDA 1NMCC 5EUKB 3MJ9A 3X3GL 3BSZL 5FHAH 1PSKH 4XP1L 3LZFH 5KJRL 5JLZB 2AJ3B 3ZYZA 25C8L 3VWJB 1ZHKB 4LEOA 4RFOH 2CLZA 4XCNB 4RA0C 1DCLA 1HIML 2IALB 3V5HA 5DJZA 1JHTB 2PTTB 4JG0H 1ITBB 1CDIA 4LSTL 2PYED 2MCG1 4FQIL 1YQVH 1MRCH 3IF1A 3UJIH 3BKML 2W9DL 2FNBA 3JV6B 4LCIH 4YNYA 4Y5VB 4GW4B 5F9JB 2YUZA 3BPNC 1TQBB 1CTOA 1A0QH 3BUYB 1B0WA 4ONGH 5ICZA 4OLVH 1WC7B 4TUOB 4XPAH 1KIQB 3MRRB 2VWEE 4U1JA 1AE6L 1ZXQA 3FZUD 3NA4A 5FGRA 2HTLC 5HHPB 3FRPA 2A6DA 1LEKB 4QKXB 1Q1JH 2X4OB 5GRWA 1DBBL 4Z18A 5DT1H 1JI1A 1HKLH 1EXUB 4MDJA 4X7DC 3BP5A 1KBGL 4NZJA 4Y19E 4WI6A 1ED3A 5DRWB 3UPRB 5I1JL 2OS7A 5CJQH 2K1MA 1MHHB 2XT1B 1FFOA 4G43B 4KK5D 4RGMB 4Q2ZB 1RIHL 4Y2DB 2LQRA 3L3JB 3QQ9D 4HGMA 3H6JA 4IDJH 5FYKD 2VERN 2G75A 2G2RA 2IFFH 3Q48A 2R15A 1INQA 5DYOB 4NHUB 3Q5TA 2B4CL 4R26L 1GL4B 5DEFB 1T5WB 3TGXA 5LG1A 3PHOB 5DK3A 4XMKL 4OCYH 4EI5B 4JDTL 4K8RD 1JPGA 1T5XB 1I9JH 3RZCD 3QEQD 4G9FD 4OFYA 3S9DB 5CFHA 1QEWA 2AQ2A 1IGTB 2AEQL 4OD1H 2HH0H 1KELL 1VENA 5AUMA 1KIRB 1YEIL 5I8EB 2ZCHL 5GGQL 5L6YL 5GSVB 5I9QC 3W82A 1N26A 1RHHA 2M2DA 1MUJB 4HWBH 4GRWE 4JR9L 1XF3B 1Q0YH 2HJKA 1WUNT 4MJ5A 5ISZD 3L3KA 3W0WA 4LSSH 1MCWW 4HUKB 2ITCA 2A1WL 1NCCH 3CH8A 3U7YL 3VDBA 2DB8A 3TESA 4ZSOA 3MNZB 5K9OB 4PV9B 4G43A 5A16A 1PZUB 1XH3B 4IOFC 1KGCE 1DLHB 2VDML 3IFPB 4NO2B 3TO4D 5D7IB 4P9MH 2X4SA 4YHNB 3C5ZC 5KSBA 3U46A 3WS3A 1T21B 4YC2C 4G3YL 1H3UA 1BM3L 1ORSB 2IC2A 5D6CA 2A9ML 4OZGB 3WLWC 4QOKD 2XTJC 3ALWA 3BPCA 4P2OB 5DEFA 2NY4C 1ZWIA 2DMKA 3IU4H 1W72A 3G5VA 3SY0A 3STZB 3PP3K 1KF9B 5HI4C 5ECJE 2OQJA 3C6LC 3TBWB 5JA8B 3OJ2C 4QHLA 4ZFGL 3D2UA 3IDMB 2VUYA 3O4LA 1JTTA 2JJWA 4ODXA 1SYVA 5GGSY 3RIFK 5ACMA 4P2QA 4KJPC 2QADB 1FYHB 4QNPE 1E4XI 4Q6YA 1ZHNB 1MFDH 5C3LD 1QFWH 4AT6B 1OAQL 3QHFL 2UVEA 4PFEA 1WZ1L 4AK1A 3IFLH 4OM1L 4U6XA 4BK5A 4YAQB 4F80A 1XGTA 3EO0B 1XF5B 4PG2A 3G9AB 3GJEA 2KUTA 5FB8B 3M1BA 4A6YA 5BVPH 2H45A 4QRTB 3MRCB 5F9WB 1BD2D 4F15B 5E6YA 2DQJL 2NCMA 5EBLB 5IVZB 4X6EA 3EOAA 3TBTB 4LHUB 1MFEH 3SDAB 1DLHA 2XTLA 3F6LA 3LPGA 5GQBA 1LK3H 1INEL 4R97B 2VDNH 1DZBA 1T21A 1CFNA 3BHBA 3KLAA 3BO8A 1RU9H 1MCIA 4WWKB 4OIAA 1HH9A 2DLFL 1YY9C 1A6ZB 2X4QB 3CFEA 4JFFA 1UB5A 3RI5F 3V4PL 2FLRT 4P0DA 1CXHA 1OD7A 4EXKA 1J18A 1PY4A 3MRQB 5AZEL 4CVUA 4LLQA 4NZUL 2HAZA 5C0JB 3EDDA 3DSFH 1MJ7H 1AGFA 1IFHL 1NC4D 3BQUB 2E7HA 3BPOB 3VH8B 4QXUH 3UC0H 5L8KB 4Q9QL 4BZ1H 3LRHA 5DK0B 5DK2B 1NPUA 5IFAH 4L29A 3VD7A 3C2SA 2AV1A 4NC1E 1F97A 1AFVL 1BFVL 1RZFH 4WEMB 1F13A 3ZTNH 1L7TH 5IF0A 3DYPA 4QXGL 3IKCA 5KSBE 3MV11 2Q87A 4H88L 3U0PA 3VGAB 4APQC 3C6SA 1I1FA 5DVOA 2QQKL 3TM6A 1KXQE 3MRIA 4ONHB 4WNQA 1P7QA 4D94A 2WMPA 4JN1H 2BSTB 1QR4A 5JZ7D 2PTVA 3PUCA 4QRPD 4KTEH 1AR1D 4X6DA 5EOTB 5J9PA 1MCPH 2NY5C 1DBAH 1VACB 5J6GB 3GSNA 5CP7B 2EDNA 5IMMB 2NQCA 4W6YB 4L8SA 4KKCC 4NRZA 3S6CA 1E6JL 3LVEA 1EJOH 4OF8A 1DFBH 4OI7A 4XCCH 1RJYA 1XAUA 2W60A 1ADQH 4FP8L 1RUKH 3EGSB 2AVGA 2GJ6A 3AREA 4YHOL 5HXMA 1JK8A 2C4FT 1SY6L 4PJ8B 1TCRB 2XXCB 5E00B 1MHPL 4JM4L 3T0WA 2BERA 4X4ME 1DQJB 1QHOA 4YPGB 1I8IB 4KAQH 5FUCC 5D2LA 5HI5D 3CDFA 5I30H 2R9HC 5D7IE 1BEYL 4KJQC 4LQFL 3D5OF 2EO1A 3S7GA 4GAJH 3GSWB 1FE8L 4U1LB 4WO4A 3TJHC 4HD9A 2DLTA 3NZHL 1M05A 3MUJA 1MRFH 2LABA 5F7FA 1LO4H 3CIQA 2L7JA 5TE4L 5JW4N 1K5NB 2WM0A 4KJYA 3DUSA 4HG4K 2R1YA 1CG9B 3SDXA 4OKVB 3D39A 1R3IH 4TPRL 1C5DB 1OT1A 4J3VA 4R2GD 5CP7A 3QEHB 4MXQC 4XCEA 3SDYL 5E8NB 3ULVF 1WIUA 1MFAL 1RVFL 4F2MB 3LQAH 3OJVC 3MNWB 1BOGB 3UYOD 4ORZC 3L3HB 2B0SL 3NMEA 1XFPA 2VSCA 2QHLA 2VITA 4NRYB 4F9PC 4K94H 1A6TA 4EIZC 3KR3L 5CKGA 1KFAL 3LMJL 4K3EL 1QFOA 5ESQB 5KAQF 2DRUA 3GO1H 1WLHA 4LBEA 4TUJB 1UACH 2H26B 3PGCA 4QHMA 5DRXB 4DZBB 3RKDD 4NO5B 4I0KA 2XICA 2E9IA 1Y0LA 3KXFB 3RJDA 3SBWC 1JMXA 3CXDL 5J1TC 2JF1A 3QWRD 1L9NA 2ORBH 5C3TA 4PJDA 3CVIL 4B5EA 5IFJA 5FCUH 4Z7OF 4S1SL 3F62A 3KAAA 4XBEL 1M7IA 4NQEB 2XZCH 3N1MC 5KVEL 3MV8A 1DDHA 3GKWH 3VXPB 3OXRB 3J8F7 2Y7QB 4Z7NE 4UINH 2GSIA 2X1PA 5I1DB 5E2JA 4OI8A 3TYFB 1RUML 2AK1L 4IJ3C 3ARBA 4XNUL 3SQOL 2RR3A 3QPQC 3D3VB 3LKRA 4CU8A 4PJ9D 5JW4R 1D6EA 3C60D 5EO9A 5ITBL 2NY3B 5MEPB 5A3IC 3QUZA 5DSCB 3NCMA 2HWZL 2ZKHH 3GMPB 3WJJA 3RVTD 2ADGB 1BVZA 4JPKL 4NUGH 4KDVA 4MSWA 3JZ7A 5IMKB 2AJVL 4JDZA 1HHIA 3KGRA 4NUJA 4JFZH 3D0VA 5SWZB 5IESL 5CGMA 5EZIH 5JR1H 5IR1B 4OQTA 3R0MA 3ARFC 1ZGLP 3HC3L 2DQHH 2UWEF 3SDCC 3LKQB 2P5EA 4F58H 1UJTA 5E2UH 2R4SL 3WDHA 3GJFA 5BS0D 3U4EA 5B38B 4MX7A 4C58B 4GAYA 1M6OA 4JM2B 4WI9A 1EBPA 4NQEA 1Q0XH 5IEKA 1X5XA 1JFQL 2N4IA 4JCLA 5DRNB 4ZO7A 5C09D 5KW9L 4FQ2L 5JHDB 2CIIB 5KSAC 1QLFA 1QRKA 4NN5B 3KYMB 2FBOJ 4AMKH 1SJHB 4FQHB 3VW3L 2OR9L 1VDGA 1ZVSA 4OCXL 2L4OA 2X40A 2VDQH 3BXNA 4GRLD 5C07A 3SKNA 3CX5K 4HPOH 1DEEB 4U7SA 3QG6A 3MLZH 3IS0X 3WXWL 3FO9B 4HF5L 1YY8A 1BQLL 1RSFA 4JQXC 1NUDA 1XGPA 3QCUH 4L4TB 3RU8H 4M7JH 4TQEL 4FQCL 4GAFB 2BSRA 3ALPA 2CUMA 3TZVD 43C9B 5HDLA 1PZ5A 2D31B 3VXRB 4MXWL 2YD9A 4OV5A 3JV4B 3JWDH 1KG0A 4RAVA 3V0AC 2BOCB 4AYFA 4NO3B 5DURD 5IT2H 2ESVA 4MD0B 3MV8E 5DJCB 4NC1C 5SX5K 4HV8A 3U0TA 5FKPB 4LPUA 3EBAA 4M48L 2OP4H 1RUQL 4CMHC 1KN4H 4MA1C 1VKXB 3NA9L 4NKMB 4NFBA 1UVQA 1PBYA 3SO5A 3PABA 3VDCA 1AXSA 5GHWH 2AI0H 1AGBA 1WTLA 5B3JF 4ZODA 5FA3B 6FABL 1MJ8H 4UIKH 1P84K 2E7CA 1MCKA 1T1WB 1A3LL 4JJ5B 4OUUA 3PL6D 4EI5C 4XGZB 2EDLA 1TVHB 4GXUM 3I3BA 5JMRA 1DEEA 4M1GH 4PRNB 4LRIA 4S2SB 1U3JA 2AXGA 4JAMB 1CD1B 5INCA 1TPXC 3FO1B 3VFWA 5F7UA 4FQQB 3TIDA 3PWPB 3QI9D 1MCQA 4OLXL 5JXAL 3QUKA 3MFFB 3KXFE 5DQJA 4EI6B 3GSOA 4ZUVB 1ONQA 4M7LT 4JHZA 2VXTH 3HZKB 4P46D 4NQDA 3UPCA 4BSVB 3S37X 1R3JB 2NY5L 2ATKA 3RUGF 4XH2B 3K4AA 3JV4A 2XQBL 4NQEE 2ADIB 5IIEB 3UEZA 3PIQA 4U1HA 3IAQA 4YXLH 1GGBL 4JHWH 1YNKL 4GQ9H 4MNQB 4JKKA 5JDSA 4C55A 4TVPL 3OG6B 3MV7A 4JANB 4RGNB 3B2UD 3VXUB 3QIUA 1LO2H 2FJFB 3D3VE 4LVOB 4OD2A 4XT1C 1IM9B 2QQLL 4KU1A 1MHCA 2PO6D 4CVZB 2R56L 4JZJC 5LGJB 1WEJL 4TNWK 4ELMA 2OR8A 5C08A 1NDGB 5I1AA 1HHKB 1CLYH 3O41B 1H3XA 3DJ9A 2XZZA 3FONB 4P2OC 4TTDC 1CQKA 5I76B 1I1CA 1I3GL 1G7HB 3F7RA 4IOIB 7CGTA 1NAKH 2BRQA 1NBVL 1HNGA 1F11A 3QPXL 4LNRA 1J0KA 5DR5L 4LCUB 2DQGH 3P4NB 1F6LL 3AMKA 4P5MB 1Q72H 2VDOL 2VLJD 5SWZE 3G6JB 4O02H 3AU1A 3PGFL 4M61B 2C1OB 5CLTA 2FGWL 4LPXA 1XF2B 4TSCH 1SBSL 1TCMA 1WBYB 1JF5A 1RJLB 1QSFA 3AS2A 3G6AA 5BO1L 4G6KH 4YDJB 5TDNA 3S4SB 3VFNA 2OK0H 1T1ZB 2HFEA 4KHXH 3GDBA 1A4KB 5GRYA 2C1PA 1IEAA 2XOTA 4I48A 4NN7C 3PWLB 2M1KA 3HI6L 4TRPH 3KPRA 4WI3A 5F9WC 5TFSH 2AEWA 5IB1A 2UY6A 3RVVD 1GZPB 2DD8H 2DKUA 4JFDB 1XGRB 3MYJB 1D5BA 5JHDE 3SDAC 1ND0B 3WJLA 5DD1L 5CEYA 3QCTH 3FQRB 1S9KC 4R97C 2CLVB 3UDWA 4OFKA 4AEIH 1IBGH 2Z4QA 4KV5F 3TBSA 1TJGH 1CGTA 4NQCB 5FDYA 1N4XL 1S8DB 1FZKB 4P49A 4MYWB 4WWKC 4TUKL 5DD6A 3T0EC 1YA5A 2FO4B 4LLYB 1D5XB 5D7LA 3O3EA 2EYSA 5T5FL 4JY5L 3VFGL 4LCWD 3GI8H 3T1FA 2DQFB 3KVQA 5F3HA 5GIRB 4Z77B 5IQ9A 4H26B 1DUZB 4QXTB 4ISVA 3VDAA 4WTZG 4L4TE 1J8HA 1GIGL 4P2RA 1P2CB 1FFPA 3BQUC 1NGYB 3LY6A 5IB4B 1QLRA 3FAXA 2FBJH 3QUXD 5FHAL 1PSKL 3MLVH 1R3LB 1N64L 3VXRE 5F96H 4RFOL 1Z6JT 1NDMA 5ILTH 1AC0A 3ZDZE 3OSKA 4L1DA 2ARWA 3GI9L 2CO6B 1Q94B 4MVBD 4PJHA 5GRZA 3ME0A 2B20A 2VMFA 4YE4L 4QTHA 5TQ2L 1JMZA 2Y07H 2G5BB 1YQVL 2AQ3A 4PLJC 3DX7A 3UJIL 2FB4H 4EQ3A 1CXLA 4LCIL 2YN3A 4RSVA 3GMQA 4M5YH 1RK1A 2X09A 4JFDA 1UG9A 1EHNA 4ODUA 1XGRA 4PJFB 4HC1H 2O5YH 3WFHA 2V2WA 4X6FA 4ONGL 4OT1L 3TVMB 5KSBF 2FHFA 3S36H 4NQCA 3H2WA 4OLVL 5AYUH 3QIWA 1FZKA 1KB5B 4XPAL 5H35B 1ZV5A 4CVWA 2I07A 3QXUA 3VXSA 3GGWA 1QVOA 2FO4A 4LVHB 2D2OA 5FA4B 5D1QC 3P4OB 5HDOA 4F7TA 1Q1JL 4D8PB 1Y18A 1X9QA 1V3KA 1U6AH 5DT1L 5CGYC 3BKYL 3PWPE 4XP6H 3BE1L 2YBRA 5EZJA 3ILQD 5EO0B 3ES6B 3TN0D 3HZMB 1P7HL 1P7KB 4Y4KD 5IB4A 1IEHA 1QHPA 3OMZA 5C0DA 4LEXL 4PY8J 4F7PB 1HH6B 4OF5A 5CJQL 2HP4A 1R3LA 1UJ3A 1QZ1A 4XVUD 2I60H 4YR6A 2VLRB 5AZ2L 1AHWB 3LN5B 3HLAB 2X1XR 2X4PA 1OOAA 4HJGA 4S1RH 3FOMA 1S9XA 4FRWA 4IDJL 1M4KA 5EPMB 5C0AA 4PGBA 2EE6A 1CF8L 4XX1E 3ULVH 2FX8H 4MNQE 2RJMA 5D1ZB 1YJDC 1HQRB 1YMHA 1J87A 1BLNB 4QF1B 4RGNE 3UTTA 3VXUE 4OCYL 4M5ZH 3S96B 1T2XA 4P5TA 1LWRA 2OM5A 5E6IB 43CAB 5F1IA 5T1KD 3PQYD 4ZOBA 4EN3D 4OD1L 4IRJB 4Z95L 1RPQA 3V4UH 1IQWH 3V8OA 2XWBA 3BZ4B 4BKLA 5CIPB 1ZT7A 2BSSA 4JO1H 4OZHA 1RFDH 1T22B 5E94B 3RWIB 3MNVB 2DMBA 3BH9B 4NNYA 3QDJD 4XWOD 3QZWA 2F8OA 1S7WB 3OKDB 4XTRC 1MF2H 4HWBL 2OZ4L 5GSRB 3QHZH 5DHVB 5B39G 1IAIM 4OFDA 3G6JE 2DWDA 1K4DB 1H8NA 1TTUA 3GMOA 1O0VA 4UNTA 1IAII 4EUPG 1NCCL 1MAML 4EZMA 1AGDB 1CQYA 3O6FA 1P4BL 4M9OA 2P5WA 3HE7C 3FT3B 4LKCB 2VLRA 2FR4B 2XN9A 1WICA 4JFHE 4P9ML 5HHMD 1KT2A 3DLQR 3O9WB 1QP1A 1CI5A 3KS0H 1T1YA 3AXLB 4WV1A 4JFDE 4O4YH 3X17A 5EU6B 1OAKH 1B0RA 1FO0B 1IE5A 2DM2A 3H9SA 3HG1B 4ZNEA 1EV2E 1PYWB 1NC2D 3KPQB 4X5LA 4NQCE 5DO2D 3VXSE 2GSGB 1V7MH 1XR8B 2JJUA 4OLYL 4L5FH 3S5LA 1IL1A 2Q6WB 3FFCB 5DLML 1AQDB 4UI2A 3DV4B 1SHMA 5BV7H 1OB1B 1YNTB 4LHQB 3PV6A 4X6DF 3ZE0E 4XAKD 4LF3B 4JLRA 5FO7B 2AJZA 3VFOB 5FFLA 5J06A 3IDYC 2DTMH 3IFLL 2NY3C 3T0BA 4HWUA 2AXFA 4P4KA 4R0LC 5CZXD 1WWCA 3V6FB 3H9HA 4TULL 3FTGA 5DTFB 5BVPL 4V1DB 3SE3C 4I3SH 3MUGA 4L8DA 1IARB 1FFQA 4PJCB 1NGWA 1JZ5A 2JK5A 3IJHB 1RULH 1MI5A 2LTQB 2BY1A 1FN4B 2WBWB 4X8XA 5TE7H 4BUGA 2H32A 5HHXH 5D2LF 4PJFE 3MLSL 2GUOB 3KLSA 3B9KD 5DEGA 3O3UN 4JE4B 1JPTL 5JXEA 2O26U 4FA8A 1C5BL 2DN7A 2WBJB 3VWKC 2VISB 2DLHA 2RAMA 5AWNH 4YLQT 1MJ7L 5EUOA 2YXMA 5FGCB 1U95B 5TE6L 1VADB 4QXUL 2RIKA 1X3DA 4WJ5A 4NO0D 3NABL 4O51A 1KCRH 1NBZA 2NLJA 2AK4D 5C6TH 3SDXF 3QJFA 4Y16D 5CGTA 3GMNA 3EYFA 5I2IB 4JFPB 4UT7H 4I3GA 1GPOH 5D5MB 3O81A 3UTZA 3P3YA 4R3SB 1RZFL 1EK3A 3HE6A 3VCLB 3V6FA 4JJHA 5F7EH 4Q58C 4U6YB 1RURH 2VLRE 4MJ6B 4QRQB 4RMUA 1TNNA 1L7TL 2NXZC 2R4RH 5DJXA 4Y1AB 1U91B 4RMQA 4OAWA 4RMSA 3ELAT 4NKDA 4X98A 4NJAH 2GIYA 1AKJA 3WFCH 2YD2A 3B9DA 4I9WE 4N0CD 5EA0H 4U1IA 4LLWB 3EYVB 1IQDB 3NOIA 4N9GA 5IMOB 2EC9T 4U1KB 4KTEL 3HAEG 3UTSA 1UFUA 4E42B 4PJDF 3VGDA 5ALCH 1MCPL 5JQHC 3BIKB 4OUOA 4X4XA 1CR9L 1HHGB 2R2BB 1JIBA 3AY4A 5F9OH 4Z5RA 3RTQB 1XEDA 5MEND 3BZEA 2F8XC 3OF6D 1A7QH 1EJOL 3N1FC 5ADPL 1ETZA 3HZVA 3U6RA 4XCCL 2Y5TB 1FIGH 3MRPB 2VLLB 3VFMB 5FYJE 3SKUD 3KLDA 4ZS6D 1ADQL 4PB9H 4PRPB 4PR5A 1F3JB 1U8KA 4GRWH 1BGXH 1LO0H 4JFPA 5DMGD 3OKMB 2F58L 2EDKA 3W2DH 4G8EA 1QO3B 2XZAH 1FJ1A 2J6EH 1ZANH 4KAQL 4N0FB 5HGAB 4P9HH 3DX8B 4HBCH 1SMAA 5I30L 1MFCH 1YMMB 5DJ8B 4HG4J 2WWKT 4GAJL 4YHLH 2PYEA 1PD6A 1VHPA 5KVFL 2EEAA 5C92A 3SKOB 5FGSA 3LKPA 5J89A 3GSVA 5MEOA 5EU6E 4YXHH 5F3BB 3BP6A 4G6JH 1QQDB 3HG1E 5CJOH 4EJ1C 4ZFOA 3CPLA 1OL0A 1LO4L 2C5DC 4LLWA 3ZT6A 3RWDA 5ABDE 3CFKB 3IDGA 1KPVB 2DQDH 5B8CB 3UPAA 2EICA 3MA9H 1MCFA 3TYGH 4FQJL 2XNAB 2J2ZA 1R3IL 2DS4A 4PRHD 1FZOA 3GUTB 4JFQB 5I17B 1S7UB 4MNGA 1NFDF 1RZJH 4LFHD 5J6HB 3O3DB 5FECA 1A6WH 1JGVH 3LQAL 4LVOC 4HWEH 1DQQA 5HDBE 5DJ0A 5ISZB 2E7LC 4XXDA 3QAZC 5D93B 1IAKB 1CE6A 2X9YA 3KPPA 3VFTB 5C0BD 3V8CA 3T3ME 1F3JA 4RRPA 1VCAA 5CBEA 3GO1L 1GZQA 2J8UA 1UACL 4X80L 1JYWA 3ULUE 1OVZA 1S7TA 2DYPB 4FQXB 4P59H 4V1DE 2PXYB 3HHRB 3RVWD 4CJ0A 4K7PX 3X12A 3BT2L 1JRHI 3ET9F 4PJCE 2EECA 4S0SD 4UOJA 5CD5D 2ORBL 3P9WB 5KTEH 1KSRA 4D3CL 4L1HA 4C83A 1N3NB 1HWGB 1U58B 1Z9SA 5K9QI 3BX7C 3S35H 5EZOH 3GKWL 1M7DA 1NEZG 4HCRL 3BVNB 1OGAD 4UINL 5CJ8A 1AD0B 2O5ZH 1J8KA 3RZCA 1OAUH 3QEQA 4G9FA 1IKNA 3ILPB 1U8OA 1YUHA 2BVQA 3SGJA 4U05A 5T1MA 3VFVB 2YPVH 5E4IA 1G7JB 1CYGA 4S1QH 2CRMA 5FGCE 3GRWA 4ZFZA 4K3HA 4HULB 1DQMH 1IT9H 1N6QL 1FL3B 5FK9A 1A1NB 1IEBB 1MREL 1U9KA 2BNRD 5TF0A 1CWVA 3TO2A 1KPRA 3W11C 5ANMA 2ZKHL 4MS8C 3VG0H 4PBWD 5D5ME 5EU4A 1G84A 3LEXA 5ISZA 5C0EB 1N59A 2GTWA 4NUGL 1NCUA 2Z92B 3WSQH 3P9MA 1MCNA 4JPVH 5DFVC 5JPMA 2V5MA 5IJVB 4JFZL 4FTVD 4KVCH 4DTGL 2WINA 1WZKA 1XGYH 4DAGL 3VXTA 5EZIL 4Y1AE 3TO4A 2OL3B 1SBBA 4JY6A 4WFGE 4NM8L 5E2UL 5KSVB 2OSLA 2MHAA 1CFTA 4FFVC 5ID0B 4UDTB 4DKEL 4QOKA 5C2UB 4E0RB 1MCRA 1Q0XL 2BP3A 5HI3D 2HFGH 3CX5J 1AD9B 3HS0B 5EU3A 4LCYB 3BVNA 4JO2H 3LS5H 2DWEB 5E8PB 4OD3H 3MO1A 2X6MA 4AMKL 1IKFH 3LSOB 4YZFE 1Z0NA 4D9RE 3UXFA 4X7CC 2VDQL 5CMAB 1G0YR 4X6CB 5EOQL 4X9IA 5E9DB 4Z7QF 1A3RH 2FWOB 2AW2A 4PV8B 1MIEL 3MLZL 2DICA 1K6QL 4GLRI 4MA3B 4GH7B 4PGEB 5IM7A 4JDVA 5F7MC 3MBEB 4ELMF 3KDMA 3QCUL 2QSVA 3RU8L 4M7JL 1NFIA 1VEMA 1C5CH 4OLZH 2YD8A 4LVHC 5D9SB 5C0NC 1L6ZA 4NHCH 4A6YH 1EGJA 1NMAH 4NQVA 4OLWL 1BD2A 3SCMD 4FQLH 5FYKE 1YMME 3DI2B 1SEBB 2H6PA 5D2NA 1WBZB 2IPTH 2A83A 3JWDL 1ZHBB 5HHVH 5IT2L 4OCRH 2QR0A 3V2AR 1G0XA 3HC4H 3FQWA 2OP4L 1HSAA 2R0KL 4M93B 1IC5H 2BMKA 5EIQA 1KN4L 1XZ0B 1AHWC 2COQA 1D9KC 5BW7A 2EIZA 1G6RB 2EKSB 3SE9H 1QSVA 5T5NG 4X7TB 2ATPB 2N7AA 1FVDA 2ZUSA 3SE4A 2BNUA 3QA3A 5CCKL 3SPVB 5DJ6B 1MJ8L 4UIKL 5ERWB 1QRNB 2QHRH 5EULV 2HN7A 1OWWA 4AM0B 1NC4A 1MCBA 1DANT 2C26A 3U1SH 4LSQL 4I4WB 3ZT5A 3T2QA 2VE6B 1I7ZB 4JHAH 5EC1B 5HJ3B 4LDLB 5ISZE 4HMEA 3WN5A 4NFCA 1AGCA 5CEXB 4IRJC 1JPSH 4NWTH 2J88H 3SKMA 2VXSH 2GTZB 3DX6B 3UTQB 4TNVK 2OLDA 1T83C 4R90H 3BKCH 1E4XH 1QKZH 2V7NA 1P4LA 4WI4A 2VXTL 2DLIA 3K4ZA 2MKLC 2YEZA 1MY7A 2DIBA 3TBVA 2DQIL 3C09B 2V7HA 2R23A 1X5IA 3ROOB 1U92B 2CLRB 4YXLL 5GGRB 4JHWL 3K80A 3E3QE 2V9RA 5FEBA 3DVGB 4LCCB 4GQ9L 3F65A 4QRPA 4KK6C 1JWMA 1R5IA 3GSUB 3V6OA 3WE6A 1H3VA 4X9GA 4HXAL 1LO2L 2RCSL 1ZEAH 1JYXA 4KY1H 1L0XA 4PJHF 2NY1B 1XF4B 2VYRE 3EHBC 3TWCH 4I18C 1KNOB 3QFJD 2VLME 4RZCA 4EBQH 4M9PA 5I1LA 5EIIB 4ZUUB 4N0UB 3HPLA 1NAKL 4WU5B 5IBTL 5I0DA 1F6AA 1EVUA 1JWUB 2AABH 2FZ3A 3O11A 4IOFD 4P5KA 4GO6B 3VXMB 2HKHH 1S78D 3C5ZD 5HVWA 1Q72L 4KRMB 4PB0H 3L5XH 5MERB 1HYRC 3QXAB 3IB4A 4O02L 4R7DA 1Q9OB 4MDIB 5D2NE 3WLWD 1H3GA 2XTJD 1IGJA 4TSCL 3SJVD 4ZPTA 3JVGC 2R39A 1Q9WA 2Q86A 4G6KL 4WFFE 3L5HA 3V7AG 2OK0L 3C6LD 3ZE0F 1N5AA 4KHXL 4ONOA 3MROB 2CKNA 2F54D 1S9YB 3FQUA 5IGXH 2P24B 3RHWK 4WIQA 4XP5H 3ULUC 4G6AD 2MNUA 4HKJA 4LLMA 4I0PD 2ZZUT 2FD6H 4KJPD 1WBXA 3P0VL 3FOLA 1I9IH 2HVKB 1T20B 1UB6A 2NZIA 5J0BA 3CFDA 3QCTL 5KSUA 5HYSA 1YEFH 4P57B 1F4AA 1I8MA 1IBGL 1PQZA 3QNXB 3TNMB 4URTB 4PJ9B 4QWWC 1I7TA 1G9MC 4Z7WA 1YECH 3T3PE 4X6CE 5CEZL 3ZZ1A 1LE9B 5E9DE 5GRJL 4Z9KB 1PX4A 2H9GA 1NBYB 3CMOH 3Q2CA 2W07A 2X2YA 3GI8L 3WL9A 3A67L 4I8DA 2XRAH 1T3FB 4O9HH 4X9HA 5DRZA 3JWNC 5DZLA 5BZDB 3QXTA 1JGEA 2X1WL 3O6LL 1FRGH 1CT8B 4K71B 5MERA 2IH1B 2NX5B 4FXGB 4NRXB 5E03A 4OZHF 5F7YC 1EAPA 1KJVB 3BN3B 4MDIA 4GJTB 4LVNC 3QWRA 5F96L 2NTFA 3H8NA 3BD4A 4XXCA 1U8JB 5MI0B 4HX1A 3V52H 4HKBA 2X4NB 3KPLA 4ZAKD 3MJ7B 4QRPE 1WTGT 1GSMA 4KUCD 3TH4T 5HHOB 3QO0A 2FB4L 2IMNA 3FB5A 5I8KH 5F8RC 5IROA 1PVHA 1T66D 3OB8A 3L5WB 2NXYB 3T8XB 4M5YL 4I2XA 4G8IB 4BZYA 4NKOB 4JKLA 3HC0B 2W0LA 2P8PA 2XIDA 4HC1L 1K8IB 4P57A 2R2EB 1IM3A 4AEHH 5CZVH 5E5MB 3S36L 3REVA 4PJ9A 3C60A 1TQCC 1KCUL 1LO3L 1OPGH 4YHIA 4RDQG 1K2DB 3C5JB 3QISA 1FLRH 1LK2A 1CICB 1VGKB 1HOCA 3RDTB 2LAGB 4ONFH 5FV1L 4YO0B 7FABL 4ZXBB 1Q9LB 1U6AL 4XP6L 1YYLH 5GZOC 4APQD 3DVFA 3ULSB 1UZ6E 2JIXB 2PNDA 1YEEH 4L3AA 1KEML 5E99H 2YK1H 1LO5A 1U93B 3TT3H 4ENEC 1VGEH 2DOCA 4KK8D 2I60L 2IBZY 3GJFH 5BS0A 2ZSWA 5A43C 4S1RL 4JQVA 3PXJA 3LEYH 3KS0J 2WWMD 2X7LA 4WEBL 4KKCD 3ULVL 4I13B 3IDUA 5IV2A 3EJYD 4HHAA 5T1LD 2YPLB 4BQ8A 3DMMC 4JG1L 3ZTJH 4D9LL 5C09A 2YSSB 4M5ZL 5JW4M 3RVXD 4YFLF 5J12B 3LKNA 4G8IA 4CNIA 4OJFH 1JV5A 1A6UH 4HIIB 3BH8B 3FN0H 3G08A 4PLKC 4GRLA 4L4VB 4N1EA 4KK9D 5B8CC 4N0UE 4RMVA 2VDRH 3EYQC 4JO1L 2PUQT 1RFDL 4XCYB 3B4NA 4WY7H 3KHQA 3T2NL 4DGYH 3RWFB 4ZTPH 1C12B 4YFDB 1P69B 3VXME 2R9HD 4PJIA 15C8L 2VXVH 4KJQD 1MF2L 1JPST 1D6VL 1MWAB 4Y19D 4GW1A 5EUOF 4WW2A 3DWTA 1GHFH 2G9HB 3FB8A 1VFBB 3OR6A 3VRIA 3CVHB 3TZVA 1FC1A 3WKMH 5EU7C 1ES0B 1UXSA 1OCWH 4W6XB 1PX3A 1FNSL 2DQTH 3A6BH 3REWA 3IVKA 5HDBF 4UQ3B 3M17B 2PXYC 1JGUL 4MJIB 4CDGC 4GMSH 1WCQA 1MCSA 1B0GB 1B6DA 4NGHH 4O4YL 2X5PA 1G7LB 4J12A 2ERJB 2AGJL 1HQ4B 5FYLD 3EFFB 3AGVA 1HDMB 5FOBB 1G9NC 4Q6IA 1N2RA 1A6AA 2QKIB 1QA9B 4GBXD 1V7ML 1WISA 4PJAB 4RQQA 3SN6N 3PL6A 2DM4A 1CS6A 3E3QC 3RWGB 1CDYA 1BZ9B 1JHLH 1YYMH 3QQ3B 1MFNA 2GY5A 4UQ2A 5C0FB 1U3YA 4YGVA 3DOSA 4FZEH 1P5UA 2JCCB 4M8VA 3L3OA 2P47B 1ORQB 4QHNA 1OT2A 1NH6A 3FKUS 1MHEA 3QI9A 5DZNA 3HMXL 2E5EA 3DTXB 1DQTA 4N90E 3EZJB 1P6FA 1J05A 4P46A 2MPAH 5IBLD 1QR1B 2L7UA 2NY0B 2JLLA 5D72H 4I3SL 5IB2B 1CLZH 3QIBB 4PJ7A 1KGCD 3G5ZA 4M3KB 3MRLB 4LSDA 2XZQL 4NWUH 3QPQD 5HHOE 1OW0C 3BRGC 1QG3A 1ZVYA 5AAWA 2YD1A 3K4DA 1BAFH 4PP2A 2PCPB 5HHXL 1A7NH 4KDTA 5A3ID 3F58L 2JTDA 5GS1A 2PO6A 1RV6X 4F9LA 1F5WA 1S7SA 2VLKB 3DHMA 4YDVA 4RBPK 3U48A 5AWNL 2VQ1A 3O2DH 3DROB 3R8QA 1QBLH 1EVTC 4POZC 1CFSB 3PP4H 4PBVC 8CGTA 3IJSA 2XKUA 2BXYA 5LJYH 2UVFA 2OTUB 4AY0A 1HILB 1KCRL 3I9GH 4C54A 1JZ6A 2H41A 4GW5A 4MCZB 3CD4A 5JNYB 4AH2A 3W9EA 4UT7L 3AS1A 1E27A 1KJ2A 2VLJA 2YN5A 5CKAA 3DGCR 1GPOL 2W1NA 3DURB 5ETUB 2HTKC 2OJEB 3MLUH 3VWJD 2ZSVB 2EYRB 4JFXB 3T0XA 1I3RB 1MRDH 8FABB 1KIPB 4FOMA 5DMKB 4X0KA 4WI8A 3FQTB 2NPLX 4DN3H 2R4RL 4J1UB 1JN6A 3WUZA 1BIHA 4IIQB 4MJ4A 4FXLA 3GSRA 5CINH 4RFNC 1XT5A 5F1NB 2EZ0C 5JW3H 1KEGH 2J8UF 4L9LA 4UIMB 4RBPH 2HLAB 1I3UA 2ED8A 3CFBA 4OF6A 3EO1A 1CIUA 1CFQA 1A6VH 2W9LA 4HS6B 3LD8C 2QQNH 5ALCL 4L4VE 3G9VA 1EERB 3WO3B 4PRBB 4M93C 3FB7A 1MCHA 1MOEA 5BVJA 2FYYB 3MRNB 1SMOA 3I6GB 5BRZB 4LCWA 1A7QL 2Z31B 5IOPA 1J0YA 1CL7I 1DQLL 1XGUB 4HWBA 5F88B 1FIGL 2BK8A 3MRFA 4JN2A 4PB9L 1FHGA 4MCZA 3I2CH 5C0IB 1FV1B 3CDGB 4L3CA 3QUXA 4XBPA 1YEGH 4YBHA 5HGDA 2RGSA 1A1OB 3FQNB 4JPWH 4HH9B 2XZAL 1J0HA 5JIPA 1ZANL 4N1HB 3DVNA 4P9HL 4Y2DD 4O5LH 4YHKH 1DBKL 1CLOH 3I3DA 1YEDB 3SO3C 3FCTA 3H42H 3FMGL 3U30C 5DS8A 3CNKA 4CBPA 1YEHL 4YHLL 4JB9H 2I24N 4DZ8A 2B7DT 3OKEB 1EZVX 1CE1H 2V5YA 5DUBB 3JV5A 4WW1A 4YXHL 1R0AL 5FUZH 4G6JL 4EI5D 3FB6B 4RNRA 4R4NC 3GMLA 3BP4B 3C09C 3PNWA 1LP9A 3NIGE 2GAZB 4KZDH 4PJAE 1AO7B 2A6IB 3B3IA 5FOJA 5I15H 3HUJB 4WO4C 3PWUB 1DN2A 4X5WA 4HIJB 4ORGB 2P1YA 3IDNB 2JCCE 4PGJA 2R2CA 1A6WL 1JGVL 1MVUB 3GNML 4HWEL 4M4RA 3ARTA 1EBAA 2VLJE 2VDPH 3BZDA 3FFDA 2NY1C 4OM0H 1AIFA 3VGBA 4LGRB 3TN0A 1XR9A 1J11A 3D69B 4Y4KA 2C4XA 2VAJA 2X9XA 1GGUA 3X11B 3P4MB 1FL5A 3F5WA 4HKZA 4P59L 4K3JL 1T80A 2F74B 1H5BA 5B39B 3TFKC 1WFTA 3KPOB 5MEQA 1RZ7L 4GG6A 4Y4HB 5C71A 1YEDA 4PTUA 5KTEL 2QL1A 1RZIA 5F1SA 3QWOA 5T3ZD 4EUPB 4JY4B 4H8WC 4TTDD 4P2OD 3HR6A 5CD3B 3DETD 3OKEA 2V2TB 3S35L 1SJEA 1Z9OA 5EZOL 4Q97A 1A1MB 4R96A 5HYIA 2XWJA 2VLKE 3B8SA 2O5ZL 3P11H 3WXVH 5T1KA 3HPJB 3BN9D 3DUUB 3PQYA 1II4E 4XNYL 4EN3A 3GIVA 4F7MA 4D0CB 4ZYKA 1Z0MA 3QRGL 2YPVL 4Z6AT 1KB5H 3N1PC 4S1QL 3M45A 5J3HC 1LE5A 1JWSB 2WIIB 1S7VB 1DQML 1IT9L 4EDWH 3CFCH 4BQBA 1MJJA 4L8CB 1AR2A 1HXYB 2QADD 5LAXB 3QDJA 4HIJA 3C8KA 1T2QH 1A9BA 1C08A 3LV3A 3TNNB 4U1NB 4R7NA 1ZSDB 3ARBC 1NLDL 4FG6C 2VDLH 1W8OA 2MQCA 3LDBB 4JRXB 4G9DA 3DIFB 4MJ2A 5I73B 1CIDA 3HR5B 3HNVH 1C16B 1HZHL 3WSQL 4LPYA 2FSEA 2I9TA 4KVCL 3X11A 3U7WL 2JJSA 4F3FB 3P4MA 1SM3H 5D7JB 3VRLE 4LHUD 1GRWA 3MODH 3SDAD 2Q7YB 1G9NL 2F9BT 3OKLB 2JKXA 4K71C 3CJJA 3O4OB 1T1XB 1MJUL 3WDIA 1A2YA 3U9UA 4WWKD 3G5XA 3T0ED 5ICXB 1LP9E 4ZUSB 1B6UA 1CDGA 1W72L 4KXZI 4YK4C 2HFGL 4DWHA 5KZCB 1NC2A 2FX7H 5MI0C 4G42A 3ECBA 3TA3B 5TPWH 4JO2L 4MXVE 3CUPB 1V3MA 1RMFH 5CJ5A 3IXTA 3BQUD 2V9TA 3GBMH 4D0CA 5BRZE 1W0WA 2A9NH 2YA1A 4PJBA 1E28A 3MQIA 1XGQA 1EFXB 1ADQA 1F4WL 5EN2A 1J1PH 1OM3H 1MLCA 2ZUUA 3WHXB 3DRQB 5DWUH 3OAUH 2EYTB 5FYJH 5DHVH 3L95A 1F4YH 3LH2L 3FO2B 1W8NA 4GKNA 2VOTA 4OLZL 1C5CL 5BXFA 4B41A 2LVCA 4A6YL 4OGXH 3FT4A 4PLJD 5E08H 3RDTC 5JO5A 4ZXBC 2EDXA 2XFXB 3PHSA 2FL5B 5I6XB 3NN8B 1V7NH 4HKXA 3VD3A 4LP4A 2X4RB 4GG8B 2IAMB 4ZPVB 4ZG1A 4OCRL 4KMTH 3NZ8A 1BWMA 1AH1A 3QHTC 4HUXB 2H32H 2D0GA 1P9MC 3MMEA 4F37F 4Y5XA 1GOHA 1XIWB 1UZ6F 2ZP0T 3B9KA 3PQYE 1T7WA 3D1MC 4FXKB 1AO7E 1E4WH 3C08L 3IFNH 4X5XB 3HUJE 1LNUA 2C3WA 3H0TB 4XAWH 3V79C 3V0VA 3MRMA 2QHRL 1HSBB 1EEYA 4NZDA 3U1SL 3U0WL 1OSPL 3HAEB 4NOBA 4HZLA 3DBXA 4NO0A 5GRVK 3UJTH 1OTUD 5AD0A 2HKFH 4NYLB 4B50A 2AK4A 3I6KB 1BIIB 4NP4L 5HTSA 4Y16A 4KQ4H 5AG8A 3TV3H 4Y4FB 3DRQA 4PJ8D 3K2MC 4DFHA 1DN0B 1JPSL 3F6IA 3BJ91 2J88L 4NDMB 4Z7WF 3ZKXB 3BISA 5I1EL 4MCYB 3CXHK 3ULUH 4LRIC 4R90L 1E4XL 3PWVA 2VXUH 5TDPA 4ODHH 5CILH 5IMLA 1CK0H 1J5OL 1FNGB 3OKYA 4LAQH 3HTLX 4IM8A 5EDXA 5IQ7L 4PJXB 4HPYL 4PYHA 5I66B 3ZKSD 1MCEA 4P23B 1T03L 5HPMA 1ZHLA 1HE7A 3L6FA 1G9MH 1B4JH 5KOMC 4XRCA 1LD9A 2IQ9H 3B5HA 5E8EA 2IPUG 4LNVA 1MIMH 4F7CB 3LCYA 5C0CB 1LEIA 4M8QA 4OCLC 4KY1L 3DXAB 4DQOH 4EVNB 4RWYH 3OX8B 4K9EC 5MENA 5FV2A 4XAKE 3OF6A 5LGHH 3TWCL 1N7MH 4EBQL 2V2XB 4K3GA 1H3WM 3W5NA 4JRXE 3QIUC 4X7SH 2X4TA 4UU9A 1K8DB 3OG4B 1OARH 1BQHG 2HKHL 1UCBH 2NW2B 4AENA 3C8DA 5EO1B 3L5XL 2I9LB 5E8OA 3KXFD 5ITFA 1G7QB 1BQHA 3SE8H 2J1KA 3QSKB 5FO8A 3WNOA 4CU6A 4J8RA 5FYJU 5I74B 5IG7B 4NQED 4TN9A 1I7RB 4WHTA 5I16A 3FO0L 2Z91A 2WW8A 1JGDB 2FD6L 2BVEA 5DVMA 4DUWA 3WIHH 3O2WH 3VJ6A 3VXOB 5K9KB 5F70A 4PRHA 3D3VD <