1YNLH

Identification of key residues of the nc6.8 fab antibody fragment binding to synthetic sweeterners: crystal structure of nc6.8 co-crystalized with high potency sweetener compound sc45647
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
219
structure length
219
Chain Sequence
RVQLLESGAELMKPGASVQISCKATGYTFSFYWIEWVKERPGHGLEWIGEILPGSGRTNYREKFKGKATFTADTSSNTAYMQLSSLTSEDSAVYYCTRGYSSMDYWGQGTSVTVSAAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPSGPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cocrystal Structures of NC6.8 Fab Identify Key Interactions for High Potency Sweetener Recognition: Implications for the Design of Synthetic Sweeteners
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Ig gamma light chain
total genus 42
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2005-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ynlH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ynlH02
4KZDH 4NM4H 3C2AH 1ZLWH 1KJVA 3PUCA 4L5FL 1MIEL 1CR9L 4WWKA 1WC7A 3HZYB 3KYKL 2WQRA 1E6OL 2APFA 4X9HA 3FOLA 1P4BL 2R56H 3BPCB 2X7LB 4JFDA 1HNGA 3HTLX 3VFRB 3ETBF 4PB9L 4UB0H 1JHKL 4P2OC 4XWGL 3GJEB 4IIQB 1F3RB 2NW2A 3NZHH 2ATKA 1U8KB 4H1LA 1EVUA 2YUZA 1WSST 4M1CC 3GSQA 2X70A 1G6RL 3MOQA 2UZIL 3OKLB 5EO9A 1M05B 3QO0B 4PJBB 1U95B 1HDMA 4JDZB 4HIJB 4EEEA 4RGOH 1SJHA 3LKOB 2CRZA 3MC0A 5T3XD 4BSJA 3ECBA 2EEAA 1PZUB 3FJTA 4ZO8A 1PY4A 2Y25A 4RFEA 4MCYB 1CD9B 4DTGH 1RUKL 3DX8A 3SOBL 4M62L 2DAVA 4QYOA 4XCCH 1I8IB 4HK3N 4J3WA 2GT9B 4ZAKB 3RWFB 1NAKL 4OV6F 5TDOB 5EORL 1DLHA 1TPXC 4JHWH 3CJJA 4V2CB 2IF7A 1JPSL 4KMQA 2MPAH 3R8BB 1WBYB 3QG6B 2UYLB 4JZJA 4TTDC 3QI9D 3RNKB 4I0PC 4ZPTA 2DIAA 3DX6B 1K4CA 1UT9A 4LCWD 1P7KA 3MTRA 3QJFA 5AUMA 2PUQT 5I1CL 4Y4HB 1CS6A 4GQ9H 2DBJA 2AJSL 4M43H 2WQ8A 3OG4B 2I9LA 1JZ4A 5TDPB 2QSCL 1FFQA 4EJ1C 4WHYH 1WZ1H 1K8DB 1X44A 1CT8B 2BNUB 3T4YB 5J1TC 5FYKE 4G8EA 3TVMB 3B9VA 2E27L 4XP9H 2RR3A 4P4RB 1B6UA 3A6BH 5CGYD 5KSAD 2DQHL 3ILQD 2BJML 4L8DA 3BN9D 2OQJA 5IBUB 4BK4A 2QL1A 4N5UA 1FH5L 1GPOL 5SX4I 4FQCL 5D7KD 3D48R 4MNQA 4NZDA 4QF1A 4PJIA 3QO0A 4PJBA 1H5BA 4RNRB 2OTPA 4LVHB 4S1SH 5SWSB 3RWEA 3TP4A 3RRQA 4R6UA 1KT2B 3DURB 1K5NA 5CBAB 4JFFE 1BREA 1RIVH 3BRFA 4PJIE 2Q20A 4YHKL 5DK2B 1UB5A 2P8LB 2FL5B 4I18A 1XGTB 1R5VB 1KJ3H 4P4KA 4ONHB 3HI5L 3OAZH 4MJ2A 3P0GB 4M1GL 2NXZD 3L3OB 4YNYA 3MV8B 3I6LD 1UM6L 5ID1A 1KB5B 1YQ2A 5INCA 3ARGA 2ZG2A 2ZZUT 1LO5B 2DLEA 5GGRB 2HFEA 5TF1L 5GSRA 4KMLB 4Y4KA 5C0ND 3ZTJH 1AQKH 4JY4B 3GNMH 1HH9B 1FO0H 5C8JA 2F5BH 1CDIA 1BLNA 1IGIL 2JKXA 3REVA 3K0WA 1MHCA 1YNLL 2DIJA 2W9EH 4DAGH 4BELD 4YR6A 4WW2B 1E6JL 1SBSH 3QPXH 2ICES 1QACA 5I1KH 1BIIA 1HI6B 4G6AD 1EO8H 3W82A 3WBDA 5MI0C 3HS0B 4NOBA 4Q2ZB 1CXLA 4KC3B 4ZUWA 2EDTA 1P84J 5HGBA 3O6LL 1FAKT 4XNMB 1A7QH 3BZDA 4M8QB 4NQEE 3RZCA 3STZA 4FP8L 4NQCA 5D7IB 2VXUL 4AEEA 2DM4A 3U0PA 5FOBB 3BH8A 3UTQB 4OCNC 3MQIA 1TENA 4QGYA 3Q6FB 5DQJA 4GRWF 1FAIH 5ETUA 1U42A 3EYQC 3ALPA 1XGTA 3OGOE 2J8UA 1QFWI 2VH5L 1MI5A 2PXYC 4MAYD 1U36A 3DO3A 1DSFH 3REWB 1H3UA 4FQIH 3U36A 4FQXC 3VXME 2WBKA 1KIPA 4PY7B 4QTHB 1FYTA 2MQ3A 2VDRH 5GPRA 2GJ6B 5D96B 2VWEC 4JRYA 4I0PA 4O4YH 4U1NA 2HRPL 3IKCA 5CMAA 3QSKB 3HNSL 3GHEH 5CLWA 1KB9J 2PTUA 3WNOA 5GS1B 1DBKL 1F2QA 3IDUA 4QOKD 3UBXA 1DBMH 4XRCA 1NEZA 1RZKC 3V52L 3AS1A 1BFSA 4PJAB 4YHNA 3ARYA 2CKBL 1H3PH 2A9NL 4YHYC 1MJ8L 1MCOL 3ARDA 1AR1C 4F15C 5BV7C 4EOWH 5KVMC 5D7LA 2DQFB 1IEBB 2CR3A 1SY6L 4OM1H 4LNVA 1NCNA 2MHAA 3CFBA 2VLJB 3U0WH 1YMMA 4JPVL 4OLWH 2HFFA 4OF5A 5DQDH 4K2UH 1T3FA 1I9JH 3IFPB 5I30L 5MHSD 2CDGA 4OB5L 2EC8A 3DRQA 1OD9A 2VDLH 3T3MF 5JIKA 1RUAL 1IE5A 4DN3L 1IAKA 5L8KB 1D5XA 4QXGL 4WV1C 5FYJH 3VFUA 2OR9L 3UJIH 5D8JL 5DFTA 4MNQD 2A6IB 5FV2A 2RIKA 2VL5B 1EBAA 2FLRT 4FFYL 5F9JA 5DJCB 3IJHB 2VIRA 1F3DJ 4OJFL 3RHWK 1I9IH 4LLQB 2AXGB 1NBZB 3EJYD 5CJBA 3EYVA 4BSVA 3T0XA 5JLZB 4LDEB 3ARED 5JXEA 2X89A 4GRLB 5CJOL 3CH1A 3LKNB 3T0EB 1BJ1H 4YHML 1T21B 3O81A 3TF7C 3JVGA 5E5UB 3K80A 4WVRA 1YA5A 2R29L 3B6SB 4NN5C 3MO1B 4DK6A 1AXSB 5DDHB 3NH7H 4DKEL 1NUFA 5JHLL 2JCCE 2LTQC 5FUCE 3BKJL 3VXSD 2XN9E 3F5WB 4GJTB 4LSDA 1RJLB 5L0QB 4NDMA 1R3LB 3T08A 1S9XB 5DD0H 4P2QD 1IKFL 4GKNB 4H88H 1D6EB 5JMRA 1M71B 3VFSA 3EOTL 3ZDXF 1A6ZA 4NZJA 4BZ2L 5DLML 1X6LA 3FT2B 1KN2L 4QRUB 2C1PB 5EU7E 4P23D 1MVUB 4BUGA 4C56E 3DOSA 4U1SB 4KJWC 1MUJA 3IRPX 4NC0B 4S1RH 1T7WA 2PXYD 4JAMB 2V5YA 4PP2A 3QJHB 3UCRA 1CXHA 2F5AH 4R2GB 4EI5B 4JRXB 1F4WL 1WC7B 3MYZA 4ORGB 4FQXD 2ADJA 4JO3L 4CN1A 3TH2T 1U58B 4NM4L 5DURD 4KRLB 1UEYA 3AS3A 4CW1A 1MLCA 1JWMA 4LNRB 1PLGL 5CZKA 1DBAL 1HCVA 1YDPA 4Y2DD 4HWBL 4X7SL 1IAMA 2I9TB 3QQ9D 3GMPB 3O4LB 1IAKB 1JGVL 3U79A 4KK8C 3VJ6B 4QHNA 5J1SC 4RAVB 4Z9KB 3B2VL 4ODTL 4H26A 5I76A 1D6EA 5EOTA 3VH8A 2DD8H 2FO4B 2IG2L 1IT9H 5E4IA 1VFBA 2AAVA 3U7YH 4H8WL 1Q38A 2ZWLT 1EO5A 1D5BB 1N5YH 5DUPH 2LTQB 3MXWL 2C26A 1J0IA 2X44D 1A3QA 3M8OH 1T0NA 2R0WH 5D93C 3NPSB 4HCRH 4LQFL 4BFIB 1JP5A 3BE1L 4HH8A 5C07A 4K94C 4LPVA 5FKPB 2LFGA 4NQXA 4UV4H 4Q0XH 4UOW0 5LVEA 4PGZA 1AR2A 3T8XA 3MRCB 2XN9D 5CP7B 4UAOC 4CVXA 4YXHL 3GSUA 1UCBL 1IEAA 2VISA 3REWA 4U7KA 3THMH 5CJXA 2VL5A 2IQ9L 4X6CF 3GMMB 3U46A 4DEPB 5H94A 2E3VA 1T03L 4ORZC 5IB1B 4OD2A 1VCAA 2CK2A 3C8KA 4N0CD 5CZVL 4M7LH 3L95B 3H0TA 4U6XA 5DK0A 1AGEB 1EAPA 2VOTA 2XTJE 4APQD 1FCCA 3ZKXB 4N90D 3FN9A 2IBZY 2Q3ZA 4M43L 1KLGB 4D3CH 5GGQL 3L6FB 4V1DB 1QLEL 3O11B 5DRWA 3STZB 3TO2A 1MCQA 1INEL 3ARGC 5I1AA 4MQXD 3CFDB 5GIRA 1KBGH 2CLZA 3IDYC 4K3DL 4HDIA 5IHLB 5C0EB 5CD5C 1IL1A 1E27A 2V6HA 3VWJA 1NEZB 3EDDA 4XRCB 2NY0D 3VXOB 4HMCA 4PJDA 4RIRA 5EC2A 2D7TH 4NUGL 3F6IA 4LRNL 4Z7WF 1UM4L 1QG3A 4JFFA 5I1JL 5CEYA 5EUOB 1H0DA 3T1FA 5DEFA 4RAUA 4LIQE 2ARJB 4JFEE 5ITBH 3AREC 3NIDF 1BIHA 1YEEH 2BCKA 4OLYL 2X9YA 3ROOB 2PN5A 5IT2L 1FFRA 3V4PL 2R0KL 3OKOB 4XNYL 3PWNA 2R4RH 1G9NC 3QFJB 4OFPA 25C8H 1LO5A 3VWKC 2QBWA 4B7LA 3QUMB 3RWIA 2ZJSL 3S97C 1T66D 1TJHH 3ULSB 3L3IA 4IDJL 5E0QA 5DT1L 1BJ8A 2YBRA 3CMGA 4GSDH 5E99L 3TJHD 4M8QA 5D5ME 5IGXH 4OI7A 4Q97A 3DVGA 3OKOA 3OHXA 4G8GB 4FQXA 4YK4C 2Q8AL 1DQJA 3MRDA 3VXRD 5DRZB 2EEDA 3DGGB 1IM3A 4F57L 4XHJD 3KR3L 2OJZH 3LKQA 3MRMA 5D71H 3D2UB 3EO1A 4MDJA 1NGYB 1QFHA 5B38A 3L3HA 4PJ7B 4ZMAT 3GBLA 3QIBC 5F72S 2WSKA 4KKLD 2JTDA 3DGGA 4PBXA 1CN4A 4UDUA 4P3CH 1PKQE 1LP9E 1WIPA 2GEEA 1MFEH 3AAZB 1JNNH 4U7MA 5HYSB 3N9GH 3V5HB 1J0JA 4TUJB 4F8TA 3IDNB 4KQ4H 5ESQA 3O2VL 4JPWH 4RBPK 5DMKA 5BRZD 4YPJA 1Y6NR 1S5IH 2PYEA 4OTXH 1B88A 1Y6KR 3HE6C 3X3FL 1XCTA 2HT4D 2HVKA 3DETD 5CD3A 1YYLL 2EXYC 3AFLA 2QQKH 4DGVH 3ARGD 2DLTA 5AWNH 4O58L 4Y16B 5D2LE 1A4JB 4XCFH 1LEIB 1E4KC 1WF5A 2BVQB 1AXIB 1FNEA 2DMBA 4HUNB 4QXTB 5GHWL 2X5PA 3KPLB 4U0RC 4Y4HD 1OWRM 4HS8H 3ARBA 2YD5A 3B3IB 4ODUA 4MWFB 5DJ8B 4N1CA 3HRPA 3RWEB 1H0DB 4MVBD 1LK3L 2EIDA 2DTSA 4O4YL 4JFPA 1QLRA 4NC1C 2WUCL 5CSGA 4NNPL 3QCUL 5DJZB 4KPHL 3DX8B 1GGTA 5FO7B 1T0NB 3WKNA 3LKRA 1S5HA 1A7OL 1FFPA 1AJ7H 2QHLA 3MLZL 4WDIA 2Y07L 1MJ8H 4XNZC 1EX0A 3VXPB 4RGMB 1II4E 5ABDE 3A67H 4Q74A 2R2EA 4HBCH 3B83A 3VH8B 2DLFL 1I7TB 2I9LB 4TQEL 4GKZA 1MRDH 4IRJB 5GGSA 1N6VA 1NPUA 3G5XB 1FE8L 1X5KA 2C7UB 3SDDD 4ENED 1QTYT 1R5WB 4HV8B 2IQAB 1JZ8A 1KIRB 3QEGH 5GSVB 3NTCH 4PJEE 2HT3C 3QWRD 4GXVH 4OLZL 4CAGA 1CLOL 2NY1D 2Y36L 4HZLA 2FH6A 4ZOAA 4JGJA 4LVOB 3T8XB 2VKXA 4N0YH 1FORH 4OZHA 1RUKH 4R26H 5TE6H 2XA3A 1FFNA 4NRXB 3VRIA 1TCRA 1EJOH 2OSLA 2FWOB 2EDNA 5FCUH 1UKQA 4MA8L 3P30L 4Q9RH 2WIIB 1DQDH 4Y8AA 2HJLB 4QY8A 1UADC 3Q5OA 3VGFA 3GGWA 3KS0J 4KFZC 1IGTB 4U1GB 3ZZ1A 3HZMA 4L8SB 8CGTA 3UJTL 1C1EH 4PJFF 1A6AB 4HIJA 4D0CB 5IM7A 1Z9MA 3SDCA 4OGXH 3MLYH 4NDMB 3OKLA 3KPRE 4Q6IC 3WNKA 5E56A 1G6VK 3NCYS 3N50A 3TO4B 5J11B 1XMWA 4H1LB 2DI9A 2BNQB 3O8XB 4NJAH 1CLZH 3H8NA 3MACL 3BX7C 5F96H 4KTEL 2XPGA 3QXTA 5F6IB 2GY7B 2OTWB 3QIBA 1PG7L 4P9HC 5I0ZA 2NY2B 5LAXB 5K9KB 1DQQB 1KPVB 3RWJB 3RVVD 1J0ZA 5J6HA 3SDXA 1NANH 3E3QE 3FHQA 4LKXA 5EU5A 4KROB 3BAEH 3TA3B 4WFFD 3WXVL 5GRJL 5ENWA 1MVFA 4ELME 2VIRB 1DN0B 4R7DB 4G8GD 2E8ZA 4LCCC 3UP1A 1A6VH 4XB7A 4WHTA 1G7JB 1RZKL 4JRXD 1PDKA 3DUSA 1FDLH 2PW1A 1U8JB 2JB6A 3B9EA 1IC5H 2C3XA 3GK8H 3SGJA 3CFJA 1MCBA 4Y1AD 4JREB 4FNLL 1JGUL 3RBSA 1ZHLA 1UM5H 4LSPH 4LLWA 4U3XA 4F33A 1MCFA 3QDJD 4YHLH 4HWUA 4NGHL 5E5MA 3MRKA 1FSKB 2JE8A 5ERWB 5FUOH 2HKFH 5JW4R 3O2DH 4PPTA 1FRGH 3BVNA 3U7YL 5C1MB 2R8SL 4UNUA 5HXMA 1U93B 3J7HA 5FXCH 3G5VA 1BF2A 1Z9SA 1GRWA 5AAMA 7FABH 2YEZA 4OFVA 2DF3A 3MOBL 5D1QB 3PWPD 5EZIL 1J5OH 5ANME 2DL2A 4UOJA 4DZ8B 1JF5A 4G6ML 3ARVA 4RGND 4JFZL 3TT3H 2FJFA 1IGIH 4M7LT 4QOKB 4YQXH 5J3HD 4M6OL 5A2LH 2VXUH 1N59B 1YNLH 2FEEL 4YDLB 3KGRA 2HLAA 1C5BH 1QFWL 2IQ9H 3MRQA 3VWKA 2E8YA 1WIUA 3NPSC 3VXUA 1CICD 3BDBA 5IFHH 3KYMA 4ZYKB 3SDAC 2C7UA 3ARWA 3KLAA 3KPPB 5DS8B 2J1KA 2X05A 5CEXB 3WS3A 4IOIB 4X4YA 1EUUA 4ETYA 4Z95L 4XBGB 2IGFH 1A7QL 1HHKB 5A43C 3NGBC 4MQ7B 2Z31D 4TOYL 3HMWH 1NFDF 1M6OA 4DKAA 3OAZK 4ODVL 5GISH 4JDVA 3VXSE 4OGYH 3EOBB 3MUY1 2GCYB 5DRNA 3S3JA 3NCFB 4JG1H 3H7BA 4BFBD 4I13B 3IKKA 3WCYA 4ONGH 3MROB 1MFAL 1LNUA 1MFBL 2AKRA 5D1XC 4G6KH 3G9AB 3GSRA 1M7XA 1PSKH 3MRIB 1AH1A 5JQHC 2OL3A 3QUYD 1U8HB 3RWDB 2E7MA 1E6OH 3AMKA 3F8UB 3AREB 5GZNC 5FM5O 5CAYB 3AU1B 4CRPA 1RZIA 5F9OH 5F8RC 4HGMA 3QDGB 5ESAA 2ERJC 3HKFA 4LLDA 3V4VH 1DBJL 4KDVA 2XWTA 4NN6B 2QQLH 2GW5A 4EUPB 4JCLA 4HHAB 4N5ED 3DHJA 4M7JH 3UTTB 5KVFH 1XGQA 1H3PL 3EYUH 1BJMA 1H3VA 2EE3A 5KVEL 2HVKB 3GB7B 4Y5YA 3PHOB 2W92A 1S9YA 3K2UL 4AL8H 2JLLA 2H8PA 1BF8A 3P4MB 3ZYOA 3W9EA 5IFJA 2NY5L 5EOCL 2R2BB 2H26A 3IJSA 4X98B 3K1DA 4JANA 5HGBB 2L0DA 1YEJH 4R9HA 2CDEB 4P5TA 3RAJL 1OAKH 1LO0L 1OAYH 3ARBC 3RZWA 2OP4L 1KLUA 1HYSD 5ADPL 4XVJL 4DN3H 1CXEA 3GHBL 4ZXBC 3F62A 3MBXH 3QT2A 2YD3A 4POZC 2DWEB 3MRFA 1EHXA 4PG9A 3BKJH 3QHTC 2FHBA 1MCPL 3LKQB 5C8JB 4U1IB 5I17A 1RU9H 1TJGH 3H7BB 2ZCHL 3N1MC 1BFTA 3MYJB 3D0LA 1YPZA 3DIFA 4Y1AA 4I5BA 2A77L 4OZIE 2GSIB 1FZJB 2QSCH 3VXRE 1Z3GH 2YWZA 1KB9K 3Q6GL 3CIQA 5J06A 2FD6L 3ZKMC 4XBGA 1HINL 3OKMB 3G6AB 5DMGD 5ICYA 5DK3A 1FZMB 2Y7QA 5DZOA 3EDEA 5CGTA 1V8HA 3QZWB 4S1RL 4OCSL 2I60H 3RGVC 2AS5M 2VLRA 3L95A 2W0FA 4EI5C 2Z31C 3ZHLA 1G0YR 4W70A 4MMXC 3U46B 1YY9C 3F58L 4QRRE 5JORA 3NIGE 1QZ1A 3I3BA 4LARH 3RJQB 2ENYA 4XBPA 3RI5K 4KI1A 3QI9A 1NCTA 2XT1B 4AIZB 5CILL 2OJEA 3LN5B 4RISL 4MAYC 4XT1C 5EULV 4HLZH 3SKMA 4I4WB 4I3RL 4NC2B 4RZCA 1GHFH 4R96B 1RD6A 3RWGB 3RP1A 4JM4H 2IAMA 1JHLL 1N3NA 4AQ1B 3Q48A 3LIZH 4JY6A 1CFVL 3IAPA 3V5DB 3R06B 4P3DA 4L3EB 5BXFA 3VFMB 5E08L 2VDPH 2C3GA 2YS4A 1X7QB 2A73B 1RHHB 1R3KB 4AIXA 5H35A 3WLBA 1JYVA 3WS6C 1IVLA 4RZCB 4XGZB 1SEQH 5EPMA 5EH1A 2HMID 1FFOA 1LK2B 4YC2C 4KJPD 3NOIA 1KPRB 5FM4A 3F7QA 1OAQH 4PB9H 4HQQH 1DUYB 4U0QB 3SJVA 1AO7D 3H0TB 4FQQB 1Q9LA 3ARZA 5JZ7C 2YD4A 3MLRL 4E42A 1A0QL 1K8IB 2DQDH 4NCC2 3UTSE 4YXHH 3FQXA 1QKZL 4LSSH 1XF2B 4PJ7F 3WE6A 2OR8A 2DMKA 3RGVB 3FQNA 4NT6A 2B4CH 3X3GH 4RFOL 4M5ZH 1DTUA 1UCTA 4WEUD 1JPTH 4IM8A 3JUZA 2Y36H 4QTIL 4ORGA 5GS0L 2DJSA 1QSFB 4IRSB 4X6DF 4F37K 2LVEA 1FZJA 3GMOA 2DBLL 2AEQL 4Y5YC 3GIVA 2Q6WA 4DZBA 3EDJA 3ZKXC 1K85A 5DJ6A 3GM0A 1JK8B 5MEPB 3RX8A 4AT6B 5D7IE 1IAII 2GI7A 5F7UA 5HI4C 2OXHA 3WN5A 4PG9B 4K55A 1XGUB 5E4EB 5BS0B 3CVIH 2FZ3A 5J11C 4DFIA 4F7TA 5IBLD 1AR1D 2GAZA 5JOFB 3HAEG 2CXGA 3N85H 4IIQA 1R3IH 3MV9E 1BPVA 3JV6A 2Q8BH 3MV9D 5JO5B 2DQEH 4HWNA 2GJZA 5GGTL 4LLYA 4M93C 4Y4FA 3S88H 3U2SB 5IVNA 5M94B 3SBWC 4MNGB 2GJ6E 3HG1E 1YMMD 2F54B 4JO2H 4N0FB 4LNRA 3W39A 2KL6A 3O6KH 3QWRA 2QQQA 4NQEA 1NLBH 1ZVYA 4LSRL 4PJFB 4OLUL 3KPRD 3P77B 1F4XH 4FN0A 5J0BA 5HGHB 1E28B 1RUQH 3P73A 4M9OA 3VXTA 3CFCL 1RIHH 1CICA 4PJAE 1EHNA 4MJ4A 1JCKA 4TVPD 3FAWA 4TVPE 4D9QD 1FIGH 4KI5D 2VLJE 2ZPKL 2C1OA 1AD9B 4GAYA 1RULL 4YO0B 3VXQA 4PTUB 1MWAA 4YFLI 3AREA 2DN7A 2O5XH 3CGTA 4TPRH 4M1DH 1TPXB 3CU7A 1FG2B 4UQ3B 1KACB 5TJWK 2Y9RT 1QBLL 2DIBA 4ZUUA 4J3VA 3QEQE 5F97E 1OWWA 1P9MC 1RZ8B 2EZ0D 1ZANL 1B0WA 4JFQB 3UX9B 3RX7A 5CEZD 3QDJB 5F88B 1R5IA 3LN9A 3IAGC 5LCVL 4YUEH 2VDMH 5BO1L 4F58H 2VRAA 3IDXL 3IKCB 5CMAB 1BFOB 3QISA 4HKJA 1B2WH 2EYRA 1V05A 3QG7L 4HF5L 4NZRL 3L7EB 1ES0B 3SO3C 3O2VH 5D71L 4L8BA 1MRFL 3UC0H 2G5BA 2WUBH 1F6AB 3DVNB 2RB8A 4TVSa 2AJXL 1I85A 5CIPB 3KYNA 1B6DA 1X4YA 1KTLB 1YYLH 4X7TB 4UOW1 1D5ZB 1QHOA 2UVFA 2CD0A 4GW5B 1BZ7A 1CF8L 1N59A 2YD8A 4N8CL 5LGJB 2ZG3A 4KZEL 5FUCC 4L8BB 1L6XA 4KKCD 5TQ2L 3RVXD 4P46B 4LMQI 3TFKD 4LLUB 2P43B 3IFPA 3C5ZB 4DQOL 2PYEB 4AM0A 3NCJL 3D39D 3BHBA 3I3DA 4HS8L 3SGEI 1HSAB 3OJVC 1WCBA 3MA9H 4LPWA 1PQZA 2XZZA 1M7IB 2DQIH 4NM8L 2UVEA 1KSRA 4X5WA 3JWOC 1LO4L 5JPNA 1W8NA 3ARFA 1IC7H 5FGSA 3MRLB 4Z7QF 5D1XB 1LGVA 1NMCB 1HI6A 2Q76A 5EG6C 3UEZA 4RAHA 4O2CA 5AWNL 5F3HB 5IJVB 4O9HL 3ZYJA 1C5CL 1MFBH 5IB4A 2GHWB 1KB5H 4LSTH 5I15H 3L3HB 2Y23A 2P5WB 1MHCB 1JNLL 3IDIA 4F3FA 3BGFB 4PTUA 5HVFB 5CP3A 4PGDB 4S2SA 5D2LA 5C0AD 4I3GA 1A3LL 4W6YB 3MRDB 5F9OL 4OCWH 3T0WA 2P5WD 2ZOLB 4YX2H 5HDLA 3PXJA 1CE1H 5GS2D 5ETUB 4PREA 3NCYP 1GOFA 5BW7A 2CMRH 1XGYL 2XN9A 3UTQA 2BHYA 2Y07H 1KXQE 3QDAA 1WISA 3MV8A 4O5LL 4QO1A 4G9FB 4H1LG 2VDKL 4LEXL 3FQNB 3RGVA 2B0SL 1FGNL 1F11B 2ITDA 2Q7NA 4P2OA 4M4PA 4K3JH 4NQTA 1UYWH 3B2UD 2O5ZH 3QQ3B 4MDIB 4QHLB 4NN6C 1CD0A 4KVNL 4FQQA 5ICXB 4M5YL 3QR2A 1S3KH 1JNHB 5FKAB 4U1LA 1U6AL 2GAZB 5JOFA 4PD4J 2ADFH 1XEDA 3F12B 5EU6B 4RNRA 4F7TB 4OLZH 4NKMB 5D8JH 5DMJB 2VQ1A 1T03H 5I18L 1PG7X 4YHIA 5EB9A 1NMCC 3V7MA 3C5SB 4PJ9A 4L4TE 2YSSB 5C0EA 1ITBB 1DLFL 3B4NA 3KJ4C 5I1HH 3PP3H 3VFNA 5I1IH 4JFDD 2DM3A 3OKDA 1ORSB 3T65B 2P47B 4CU8A 2PXYB 4RCAA 5CUSH 1Z3GL 3T77B 1T04B 3G6JB 3OZ9L 3PWPB 3RZCC 5IROC 1TIUA 4OFIA 5BV7H 5HI5C 4JFHD 5IMMB 2EIZB 3UYRH 4DVRH 3BKCL 5DD3H 1B4RA 1RMFL 4M61A 4PJAF 3RKPA 5L6YH 2X4NB 1YPZE 1FVEA 3KPOB 5AUMB 2FLBT 3C8KB 4XWOC 1KTKE 2LAGB 5CBEB 3G5YA 4O51B 2OLDA 4PJHA 3GEWB 5EFIA 1GGBH 4XMPH 1T80A 4XPAH 1MI5E 4JM2C 4GKZB 4PLJD 1K2DB 1OSZB 3OAUL 1U8MB 4KKNA 1NANI 1A14L 3B9KD 4PRPD 1FNSH 1A22B 5IVZB 2QJDA 5T3XE 4LVNB 4XAKD 4HJJL 3Q5TA 3DYOA 1ZT1B 1CIUA 2H9GA 3QFJE 3DX7A 3OV6A 1W0WA 2X09A 3ARDC 1OP3K 1W0VA 4EXPX 2BHUA 3QAZB 1PYWB 3OKYA 5BVPH 4NKMA 1CGXA 3TZVC 1CXKA 1SM3H 2D03H 2YMXH 3S5LA 3MLTA 5IV2A 3TFKC 2VO5A 2X70B 1I7ZA 2XKUA 3OG6B 4XCNB 4CMMB 5MEND 4I2XB 1FPTH 2Z92A 4E0RA 3HR6A 1CXIA 1J18A 4GW1A 4ONFL 5LQBH 2AP2A 5C0BE 2B1AH 2CO6B 1A1MA 4J3TA 1A7RH 2E6PA 2PYED 1FC2D 2VLRB 5E2WL 5C08E 3GSXA 3LAFA 1CCZA 1AC0A 5IMMA 5D1ZD 5IKCA 4RQQA 5I9QB 1T89C 3MJ9H 3X14B 3I2CL 5F9AC 4U7SA 4LF3B 4HS3B 5B8CB 4LFHD 2VITB 1JF1A 2XZCL 4N1HB 4PV9A 4QYOB 5F9DC 3ULVE 3INUH 2FEDC 3V5HA 3FAXA 4HX1A 3VFNB 4RFEB 5MP6L 4JB9L 3MZTA 1TJIH 1H15B 1NC2D 5GISL 2XACC 2EDHA 1ZV5A 1U91B 2AEWA 2P45B 4J1UA 1J8KA 3CLFH 1QPXA 3LS5H 4HPOH 3F7VA 5GRYA 2XYCA 5F3HA 5IJVA 4O2CB 1FLRL 1IAOA 2XKNA 2NW2B 4PJIF 1J0YA 4OKVB 3GSNH 2MQCA 2P8MB 1BQHB 3I3EA 4BH8B 2Q8BL 1HILB 2CDEA 1TZGH 4P5TB 3BPCA 4FTVD 5L2JB 4ZUVB 5GGQH 1FQ9C 1T7ZA 3NCEB 2CLRA 3WEXA 3NIGF 4KPHH 5IVXB 5H37G 2XQBH 3EYVB 3SO5A 1S9YB 3TV3L 5GGVL 1IKNA 3EDFA 4KMTH 1GOHA 1JTPA 3UAJC 1F00I 1VADA 3GO1L 5INDA 3IJHA 5IESL 3TJEL 4S1QL 2X2YA 4X0KA 3QWOA 3D85B 1E4XH 1KEGL 4X9IA 3LCYA 2VLLB 5CIPA 4NP4L 2V5MA 5T3ZH 1A7NH 2V5SA 4OCXL 3BEWA 4OAWB 5SWZA 4PFEA 3TCLB 4WI7A 3STBA 4WRLA 3SGEH 1M4KA 4YHPB 3BMWA 2FIRT 2OP4H 1S7VB 4UDTA 2F53E 4DZ8A 5I1GL 1TITA 2W1NA 4XMLH 3QNXA 4IHOB 2MHAB 3GHBH 1YEHL 3RKDC 3IFLH 4IOSD 4U6YB 3X13B 1AKJA 4D9QE 2FBJL 1MFDL 4K7PH 3OXSB 4LRIC 5I74B 3NFNB 2KQMA 5F3BA 1Z6JT 1OLLA 5JHDB 5CGMA 4EBQH 3LOWA 4ZO7A 4IHOA 3PQYE 3S35L 2NXYD 4OD1H 2B20A 1HHKA 3R1GH 4PBVC 1QRND 1JYWA 4WW2F 1OAYL 3FO9B 4X4ME 1QNZL 2F58L 1DQDL 1EDQA 2JIXB 3LV3B 3QG7H 1T1XA 1JWUA 4P5TC 2DDQL 4PUBL 3PE9A 2NXYB 3QIUA 5IB5B 4HXBH 3BEWB 1J1OL 2VABA 1C1EL 2VDQL 4GXUN 4TNVK 3QUXA 4KK6D 2V9QA 2FH8A 1S7UA 4JQXA 1UXWB 2EH8H 2O61A 3OAYK 4X6EB 2FB4L 2VUYA 4UINL 2ZNWA 1F6AA 2L4OA 2D31A 2ZCHH 3O9WD 1A6WH 1T1XB 3ZT7A 4GAFB 5DD5H 1NAML 3TN0A 3QDMB 3FO0L 1P1ZA 4PRIA 1NCAH 1G7MA 4JRWA 5DZNA 2V7NB 5E9DA 5J6HB 3FRUA 1TZIA 1QO3B 2WP3O 4ZQKB 5J12B 4NBZB 4YLQT 2EECA 2IFFL 3EOAA 4L4VB 1CL7H 1ED3B 2GJZB 2AQ3A 4BQ8A 5JO5A 1I3VA 1ZGLP 1BQLH 1CDHA 3S36H 4KTYA 3VXRA 2X4SA 3F7RA 1CD1A 4P46C 3RY6A 5F1OB 5GGTA 4PR5A 3T0AA 2A38A 3MUGB 3V5KB 1HSBB 1VFAA 3W9DA 5E8OB 3DBXA 4J1UB 5HYJD 4GMTH 5C09B 4MA3B 4CVUA 1U2HA 5DI8B 2F53D 5KSBF 5CJQH 4YXLH 2CLVB 2Z35A 1UJ3A 3C08H 4OZFH 4RGNC 4UB0L 1J87A 2V2TB 2NCMA 1HHJA 3MJ8B 4L8SC 4YDVA 1GHFL 2V9TA 3WL9B 1PZ5A 3RI5F 5J1AB 1I7RA 2HFTA 4NNPH 1TVBB 4P9HH 1G6RH 5HDOA 4ZOBA 3IDGB 4GKSB 3V9FA 5F1NB 3MZGB 3Q3GA 2OTUB 5IVXA 1I7UA 3LN4A 4MJIA 5GGRY 5HYFA 3IGAB 5B3NA 4KK5D 3H42L 3CH8A 4YE4L 3PV7A 3ARSA 3VWKD 4Z7UF 1EO7A 5EO1B 3HLAB 1BVKB 4G6MH 4HQQL 4IRZH 1OF2A 3SE9H 5DA4A 3ARPA 1A5FH 2FIKB 5CHNA 3CVHA 2Z92B 1KTDB 1HNFA 3MBEA 2FHCA 2C3VA 1U3HA 4WEBL 5EPMB 1WWAX 3CMOH 3MUZ1 5C7XH 4TNVF 1ZVSB 1ZEAL 1G7IA 2JJTA 3H3BC 1DFBL 4ZS7H 5HD8C 1GJIA 5E9DE 5HDBE 4DZBB 2FATL 5FO7A 3T0EC 4JQVA 2EE9A 5TE6L 1OARH 1FL3B 3DECA 4IRSA 3O2DA 3SE8H 1EJOL 5FCUL 2J6EL 4TOYH 3O3DA 3O9WC 2FNBA 3MMEA 3TZVA 1MAMH 3BP5A 4LLQA 5IQ9A 4KK9D 4ZTPL 5LGKA 4HWEH 4P5MB 3KPLA 1KJ2H 3DGCR 1ROWA 5DXWA 3KJ4B 4NWUL 5EOQH 3VMNA 1G7QB 3IRZA 5GSVA 3FQRB 3MRHB 5A3ID 4PJCE 3MLYL 2X4PB 5GGUA 4GAGL 1VKXA 1KIRA 3OQ3B 3DTXB 5FO9B 3QDMD 4K8RL 3D69A 4R2GD 4RGMC 1S7RB 5C07D 1CDGA 2K9UA 2CKBB 2DQCH 4M1CD 1ADQA 4MB5A 4PGCA 1YY9D 3DROB 1MCWM 1ZGLM 1NJ9B 2HFFB 2W07A 3QUXD 5F7LB 2A9MH 1G0DA 1AGBA 2BNRA 2QQLL 1M7DB 3O6KL 3F7YA 4MD5A 5DTFA 1LO3L 5H35B 2O5XL 3QULA 4MCYA 2BY2A 3GJFH 5GRXG 4EN3C 3NMEA 2ESVB 2XWJA 3DX7B 1B90A 1ZGLA 1A6TB 1ZLUK 1QSEB 2I24N 1F6FB 3ZL4H 2VQ1B 5HYJB 4LCWB 5GXBB 4NQDB 4HUMB 4I0PB 3CUPA 3S35X 2ZPKH 5KANG 3MJ7A 4KKAC 5TF1H 4S0TD 1NBYA 3CSGA 4OLVL 4FFZH 1RK0A 4Z7VE 3BPNC 1URLA 1F02I 1A64A 3VG0L 2CPCA 1FNEB 1VSCA 4CMHC 2F5BL 3O9WB 1KIQA 1A1NB 2NY4C 5AG8A 2J4WL 1DP0A 3HC3H 4D8PA 4RMWA 4LL9A 2AEPL 3M07A 1A7RL 4GG8B 3O2WH 2OYPA 3T0EE 3U0PB 4IMKC 1X5HA 3ULSA 2F15A 2FECI 3B5GA 5I1KL 2MCG1 1U2CA 1IKNC 5MENE 3OKMA 4ZXBD 3LRGA 4ELMA 1QBBA 3B9KA 3FFDA 2EYTB 5ILTL 4GG6A 5AYQA 4KJYB 4OCRL 5ALCL 3NCJH 4M4RA 4U2YA 3P11H 5IP4A 4OSUL 3ROOA 2AV7B 4XAWH 1LD9A 1D9KB 1YNKH 1JVKA 2IANA 1F3JB 1N5AB 3KWWB 2BX5A 4MLSA 5T5FL 4WW2A 3IU4H 4UBDC 4LVEA 1CFTB 4FQHB 1UZ6F 3LEXB 4KZEH 1CBVH 3H9ZA 1QEWA 4G43B 4WFHD 3E1F1 4F7PB 3FL7A 3KYKH 3GJFA 4OFYA 4QHLA 2WWKT 4U1HA 1M6OB 2EYTA 5DRXA 3E3QC 4GG6B 1XIWA 4X6CB 4Z95H 4LGPB 4ZQKA 4L29B 1YMHB 1WIOA 3BHBB 1G7HB 5INCB 4Y5VA 4ODVH 1B9ZA 3DYMA 3BD5A 2IH3A 1CFVH 5C2UB 4CMHB 4JG1L 3ZSTA 1DEDA 1JPGA 4L3EE 5CSBA 5C0RL 4XPGH 1PSKL 3AM8A 3O9WA 4NKOA 4L3AA 4FRWA 3VCLB 1EEYB 4OZHF 4YZFE 3IXAB 4Y16D 2BOCA 1XR8A 4M62H 3MJ7B 1FVDA 3G9VA 2R1WB 1Z2KA 1ZHBB 2VZ3A 1E4WL 3WJJA 5EUOA 1GCFA 5FF6B 1CE6A 5J4MA 5FKPA 4QXWA 4FZ8H 3QEHB 3GSRB 1BVLB 3MRIA 2X42A 4QHMA 3RDTA 4HZAA 4NZTL 5C6TL 3WDJA 4G6AC 5DYOA 1T7YA 3WFBH 4PRHA 1KF9B 5I18H 5HHQB 4OJFH 5ERWA 2F8XC 1R0AL 3HC0A 1FYTD 4H0IA 3QUKA 3PGCB 4U31A 1TZHB 4OD1L 2EEBA 1ETZA 3HI6H 4B50A 1MWAB 2AEQH 1TQCC 4KJQC 2MJWA 3FZUC 4XP6L 4JQIH 1N7ML 4DGYH 1CDBA 3V0AC 1YMME 1BZ7B 4GW5A 3OBAA 3GMQB 1AGFB 4PIRF 1D5ZA 1KGCD 1AD0B 2JK5A 2VLLA 1XAUA 3NBNA 2DQHH 1V3LA 3LDBC 2EH8L 5E2UL 4JN2A 3K4ZA 1OP5H 4V1DE 3SJVD 3MGOB 4JG0H 2BVEA 5DD0L 2E7BA 3N85L 1KTRL 1MJJB 4JFXA 4PRBB 2AJSH 4N90E 4TSAH 1MJ7L 3WSQL 4F7EA 2AI0H 1FP5A 4L9DA 5J12C 1TQBC 5A1AA 3UTZA 5K9QG 4BFIA 1JHTB 3KXFE 3TYFA 4XP9L 5F7WC 1J1PH 1MCJA 2IADA 3G5VB 3RUGF 1ERNA 4Q7DA 4G8FA 2XZAL 4KGJA 2DWDB 5EUOE 1AKJD 5KN5A 4XP4L 4LDLB 4PJFE 5BRZE 1MOEA 2XTJC 4ZFFB 3SDCB 1JI1A 3DSFH 3LKSA 4PG2A 2XQYG 4NHCL 1RIUL 2IFGA 2WWMD 5FYLH 1AXSA 1CI5A 5FM5M 2RQ8A 4QHUA 3QHZH 4UILH 3OB0K 2ICEB 5I6XC 3BI9X 3W5MA 1M1SA 3UO1H 4M1DL 2XZQH 3HRZB 1WITA 5A2KH 4R3SB 1PX3A 2VWEE 1ND0B 4KHTH 5ADOL 3MCLL 3NIDE 2GKIA 2OTUA 5D7KE 4X6DE 5L88L 2PYFA 3W0WE 4HKZA 1U8OA 3JWDH 4NQEB 4NNXA 3SGKC 3WIHA 1ZANH 1TVBA 4TSBH 5L9DH 2AXJA 4OZGA 3PWUB 2J5LB 4CJ0A 2HJKA 4PBWD 5IMLB 5GS0C 1QHPA 4WTZG 3TC9A 3WMSA 4YHZH 5IMOA 5DZLA 2HJFB 3O6LH 5FYKL 1ZLSH 4P57B 2OX5A 5KS9F 3AM8C 4QNPF 1UFUA 5TDNA 3JWOL 3BH9B 4NQSA 2HH0L 2DQUL 2FX7H 4XP5H 1NAMB 1I4FB 4AIOA 3BGMB 1I8KB 4M7LL 3PF2A 3RL2A 1IFHH 2W0KA 4UIMB 4TN9A 4L8CA 5A16B 5EU3B 1IGCH 4WIQA 4U1KB 2GTWA 2CUIA 4Y5XA 5ACZA 4JFPB 5IVZA 5C0AE 3O41B 5IHZB 3TBSB 1NBVL 5DJ8A 4XPHL 4F9LA 3TN0B 3MODH 4XCEB 4YDKL 3IYLW 1P7QD 4JVUA 2BVOB 4K8RC 4YGVB 2AGJH 5FYJE 1K6QH 3FB5B 4CDGC 2G75B 1B0RA 3MOAH 1JGLL 3UJJL 2P5EB 4AEIH 3FN0L 3SY0A 5E94B 3K3QA 2FCBA 5CD3B 4MGXA 1NQBA 3VXNB 4NNYA 5DR5L 1RUPL 1NCDL 2NMSA 4HEPG 3VU2A 1X5FA 1GGYA 3P0VH 2XA8H 2DQEL 2FYYB 4K2UL 3TNNB 3D6GA 1DR9A 3VG9B 12E8H 4OB5H 4HGWA 3S3PA 3ZDXE 4X6CA 5D93B 5HHQA 3DJ9A 3KJ6H 1YEGH 4I5BB 1R6VA 1WQVT 2G2RB 2ID5A 3F6LA 2A9NH 4S1QH 4U6YA 4F7PA 1KYOK 4XH2B 4LLMB 1FH5H 5K59F 2G60H 3O0RH 3RUGB 1HQRA 3S98A 5K59E 5F7KC 2FX8H 4ODHH 1YN6A 4PRPE 1DBBH 2VXQL 3CC5A 5LBSL 2Z8RA 4JHBA 3PL6B 4M00A 5L8LB 3EJYC 4OAWA 4NN7B 4LSUH 4QXTA 3HZVA 4V1DD 3SJVE 2AV1B 3MV9A 4UU9B 4RMTA 2NY1B 3HAEB 1YEHH 3IJSB 5GGRA 3I6LE 5EU6E 5I75C 2BSRA 1MLBA 2H2SD 4X8XA 3M45A 2BOBB 2IH3B 3MNZA 4C56B 5DJ2A 3LPGA 3MXVH 4P9ML 2AJZB 3RWIB 4L4TB 1JE6A 3S35H 2QEJA 2B5IC 3L3DB 3G08A 1CFQB 1CGSL 4KVCH 1Q8MA 1TDQA 4BM7A 1LEGB 5HGAA 5B39A 4H8WC 35C8H 1V7NL 4PRAA 1BQHA 3HE7B 4Z7WB 1NBYB 1Q9OA 2WP3T 1INDH 2WW8A 3BW9B 3HMXL 4FABL 3KAAA 2ARJA 2A1WH 4GQPH 4LAQH 1F4WH 4OZGE 1KFAH 4YR6B 2DKUA 4J7RA 4F80A 3G6DL 2QHRH 1WFTA 2J88H 3WKMH 6CGTA 1E6JH 1SBSL 5I8OL 1UWXK 4JO4H 3MR9A 1NCBL 1CF8H 4P4KC 2G2RA 3ARFB 1IGYA 3ZE1F 3OSKA 1R3JB 3QH3B 3UYOD 4GMSL 4PRNA 4CVZB 1M7IA 1W2KT 5GSRB 8FABB 5T3ZD 4ELMB 4ISVA 3DROA 5F9WB 2VQUA 2MFNA 4PJEA 3EYSL 1S7RA 1ZOXA 2C4FU 4HC1L 2AXFB 3BZFA 3KS0H 4CVWA 1HCFX 4ZO6A 1L9MA 2AVGA 3WHXA 4ZFOA 3B5HA 1NCWH 1NUDA 4AJ0A 4C4KO 1FZKB 4ZOEA 4NRZB 4NWTL 2BCKB 3GI9L 3A67L 4HT1H 4TVPH 1P4BH 3CSYB 3QIWB 1ZWIB 4XMKL 3VGBA 3SCMD 3L3KA 3LEYH 3AUVA 4OCWL 1FL6A 2VC2H 1G9ML 1E4WH 3U30C 4GW4A 2ZUQC 4L3CB 4BZ1H 1W72B 5BJTB 1UCBH 4UIMA 5K9OA 3VD3A 2EXWC 4HFWA 1IL1B 3CMOL 1AIFA 3MLVL 2CMRL 4R8WH 3HUJA 2VLRE 1MCOH 4JKLA 3W0WA 4OFYD 3VRLF 3VE0A 2EDWA 1Q94A 4LLVB 3SN6N 5E2TL 2ITCA 1DFBH 5E5MB 2RCSH 4HCRL 1BBJB 4I0CC 5ALBH 5HPOA 2VYRE 4WHDA 5D70H 3SKNA 3BE1H 4UNTA 1INQB 2C3VB 1YY8A 3B8YA 4JCMA 4IOFD 2AJYL 3C5ZC 5C0FA 4D3CL 4LKCB 5CFHA 5GRUL 3LD8C 4Y2DA 4HPYL 1RUAH 1FN4B 4YPGA 3U0TA 3HHRB 2P5EA 3MRHA 1PVHA 2AQ2A 2YPLE 4YWGL 1HN1A 3FB5A 4MQXC 4XHJC 5D72H 3TIEB 4QOKA 4X83A 1QFOA 3ZSSA 5ENWB 1FG9C 3B43A 3LQZB 5TDOA 4TSAL 1EK3A 2NY0C 3G6JA 3PWPA 4WUUD 4N0FA 3OJMB 1FL3A 2VDRL 4LPYA 5CUSL 2N1KA 4D9RE 5SWZD 4NQCE 2IPKA 2ZUXA 5SWZE 3S36X 2R0KH 2BSTB 5TH2A 5DJXB 1NFIA 1FO0B 4Y19D 2FJHA 4J3SA 25C8L 5DGRA 3W11D 4U33A 2QLVB 1WAAA 3QDGE 4JFOB 4WWKC 4ZFFA 4NJ9L 1UJTA 1RFDL 4RDQF 3M17B 4JDTL 1F3DH 5JMOC 5IB3B 1CXFA 1OPGH 5FDWB 2Z8SA 3GJEA 1IGTA 4G9DA 4FMFA 3WO3B 3ULVL 1JWSB 3GMPA 1KN4L 2WIIA 2F8VA 2Z31A 3HLAA 3KG5A 1A9EA 4X5XB 3V4PH 3DV4B 2HJKB 1MI5D 5DMYA 3PWLB 2V7NA 2X40A 2OR7A 5C0BD 2Z0BA 2EE2A 3E6HA 1T1YA 3MV7D 1U58A 2HP4A 1NCCL 1PGRB 2H3NA 3CVHL 3MGOA 4WU7A 2IMMA 3AMLA 3QDHA 1L0QA 1L6ZA 3B8SA 5B21A 2DQJL 4LASL 2FO1A 1UXWA 4TRPL 2ARWA 4UQ2B 1MVUA 3QIBD 5IGXL 4A6YL 1OGTB 5HHVL 3SKJL 4FG6D 3GIZL 4C59B 3PQYB 3FN3A 4WO4B 3RTQB 2EDYA 1CZ8H 3FT2A 1RK1B 4P5KB 4XTRC 4BKLA 5HYQB 1A6ZB 2BXYA 5HYSG 1FNFA 3C6LA 2E7HA 1QD0A 1MHPL 1R3LA 4UT9L 4I3SH 4TULH 5IM7B 4HIEA 3BT2L 4AYFA 4YBQD 2HH0H 3VXRB 1QSFD 2QADD 5IBUG 3BP4B 4WDIB 1FFPB 5ANMA 4LSVH 1MWAL 5C3LD 3MJ9L 1BZ9B 1IC1A 3UZQA 3DUUA 4X7CC 3U82B 1I3GL 1Z5LA 3RWGA 5IOPB 1DL7L 1S8DA 1KN2H 2VAAA 3CH1B 2ZP0T 3LKNA 2FR4B 1OB1A 4G8IB 3FRUB 4LCCB 4KQ4L 1IZKA 4BQ9A 4FQJH 3JWNC 1Z9LA 5KVGH 1OSPH 4HZLB 4UV4L 1IC4L 3X3FH 4K23H 2E7LC 4N9OB 3BKML 3D85D 4DFHA 4PJ5D 3TBWA 5CKAA 4IS6A 2Z93A 4NSKB 1N6QL 2ICWA 5EC1B 1U8LA 4DJMA 3GSNB 4X0KB 1JI2A 32C2A 1WBZB 1A4KB 5DJ0A 5I71C 4MJID 3DETC 4MQSB 2EXYD 4IMLB 3IDMB 2HTKD 4J4PD 5EBGA 2VXSL 1T1WB 2P5ED 1TZGL 2X4QA 1T22B 1RVFL 3EZ8A 8FABA 1UQSB 1EFXD 2WK2A 3HNTH 3ULVC 5HYSA 4Z76B 3BDYH 5JOEA 4LCUB 4UUJB 2IG2H 5FGBC 4NYLA 4HMDA 2X4RB 2BZDA 4M7JL 4Y4HC 3ZKQD 5IMKA 1UWEL 3SE3A 4KMTL 4KDWA 3VFTA 2G5RA 2ZCKL 3P9MB 4XNXL 1NC2A 4I77L 1YEKH 4YIQA 1P53A 3BSZH 4YBHA 1VEPA 1IBGH 2X9WA 2G60L 5JIIA 4NUJA 4LQFH 4JRYB 3KPSA 3QIWA 3IJYA 4JE4B 4XPTL 3CZFB 5AZEL 2PR4H 5CSZA 1XR8B 3QA3B 2VJXA 1A2YB 1KLUB 2NY1C 1AI1H 3K8KA 4GOSA 3JV0A 1A9BA 1R24A 3QNZA 4IJ3B 3RA7H 2DJUA 2DL9A 5FGCE 3ULUF 1LEKA 2YKLL 1XGRA 2VE6A 1RY7B 2VITA 2VXVH 4YAQB 5FDYA 4HS3A 1QSFE 5B8CA 5SV3A 2AK4D 2YOCA 4EVNA 5K33A 1KC5H 3EAKA 4Y5VB 5FUZL 2ICCA 3RPIA 2X1XR 5FYJU 3O3EB 3RJDA 2X4OB 5DRXB 3ZE0F 3VFGL 1JZ7A 2A77H 4D9LH 4JGUA 1L7TL 5IBTH 1U8QB 5BS0E 1Y0LB 3DXAE 2FD6H 1V7NH 4OKVA 3BIKA 5E2JA 5J89A 3O3BA 1NMAL 1ZK9A 3WD5L 4PUBH 1KJ2L 1INDL 4G80B 4FQHA 4G6FD 3E8UL 5IV2B 4HXBL 1J1OH 5JNYB 4NC1E 3E6FB 5JHLH 1U8HA 1RV6X 3MV8D 2JJSC 3MV8E 5EU6D 1ONQB 2ED7A 3IXTB 1QSEA 3WKML 2ZOKB 4M7KL 1TTUA 4MNGE 2V7HA 3MBED 5ESVB 3QCVL 2CK0L 4LU5L 2BVPA 4EUPG 4GBXA 4E41A 1FDLL 3QULB 3C6SA 1CQKA 5EA0L 4OLYH 3L3DA 3ZYIA 1ZTXL 3QHZL 4D0DB 2QQNL 3X14A 3EUUA 3L3IB 3KLDA 4OTXL 3VXNA 1VEOA 4ZTOH 2VR9A 4P2QE 3EIFA 4YHLL 1OW0A 1WGOA 1DQLH 5JR1L 3QXDA 5I1DB 3VWKB 5F89B 5F1IA 4JLRB 2VDPL 5H94B 3E2HC 5CBEA 1E4XI 4EI6A 5L9DL 2YPKB 5HYEA 3QG6A 4JZJB 1I1RA 1KNOA 5C0CD 1AY1H 5F6HJ 4E0RB 1YQVH 3FB7B 4PJEF 2PKDA 4PYGA 2J5LC 4M6AA 3EYOB 2ZUQB 5CEYB 1JGVH 5FA4A 1Q0XL 5GS1C 4V2BA 3RUGA 3WO4C 3B2VH 3MV11 2DQGH 4LQ1A 3SQOH 4JVPA 1HH6A 4XH2A 4CNIB 1HOCA 5T1LA 4P9HL 3GSVA 2OQJB 4I9WD 3BJLA 5HY9B 4MXQD 1WZKA 2ZSWB 3JUYA 4MA7L 3RU8L 5KSBE 2IAND 3MRGB 5IW6B 4WI3A 2ORBL 3MXWH 1I1FB 3OTTA 1OM3H 3LEVL 1HXYA 5JW3H 4MNHB 1NJ9A 2YA0A 3VXMB 2BC4A 4HBCL 2HG5B 1GGIL 3TWCL 4ZFGL 2ATKB 2VXTH 3FB7A 3LKPA 4LOUC 2F53A 3TYGH 1W72L 2YPKA 1L7IH 4HAGA 2MCPH 3OX8A 2VZSA 3BPLB 3HZYA 5CLTA 1XF3B 3MOAL 2OI9C 1JWMB 2P7TA 2VMFA 4CVXB 1KJVB 3GSOB 1DLHB 5L7XH 1JFQL 4QXUL 4RMSA 4ELKB 5I66A 3TBSA 1XGPB 3HC4L 4NQXB 4N0YL 4KUCF 2BRQA 3HMXA 4EI5A 1JGDB 2I07A 1OARL 1ZHNB 4NN5B 3C6SB 4U1SA 5GGTH 3N1QC 4NKDB 4L9LC 5F8QC 4KAQL 2J6EH 2OTWA 2HRLA 2IPUG 1INEH 3MYJA 4G5ZL 2YSSA 4P48A 1HEZA 1H8SA 1KBGL 3ES6B 3LB6D 3OKKA 3WXWH 3GM8A 2DQTL 5FOJA 3LKOA 4F37F 3ZE2E 1PG7W 4MAUL 4P2RA 3DBXB 5F6HI 4WCYL 3MRFB 3MUGA 1RUQL 5C0RH 5F7EH 4NQDD 1J9CT 3FFCD 3OR6A 1T83A 4AL8L 4X6DA 3WIIL 4H26B 1TCMA 2OZ4A 3CVHB 4PRHD 5D1XA 2DWDA 15C8L 2FGZA 2X1OA 1GGUA 1ZHKA 1IQWH 1U8QA 4FQ1H 3C9NA 3TCXA 4JJHA 1JZ6A 3AXLA 3QQ3A 4OZGF 4QKXB 3RAJH 1DBJH 1MJUL 4X98A 2ZUSA 3MREB 2QKIB 2W65A 1S7SA 3IETA 2VB5A 3PL6C 4OZIB 5C6PB 1DBML 2PYFB 2A2QT 1P1ZB 1NDGB 3ARBD 3V6OC 4AENA 1Q9WB 3UTSA 5T1KA 3GBML 1JN6A 2EDQA 3I6KB 2D31B 1KXVC 4IDJH 1SY6H 2YPVL 3C8HA 3UTPD 2Z4QB 2FRGP 4HBQA 5HHOD 2VABB 2NY2D 2VXQH 5LBSH 1XIWC 1DE4A 5LCVH 4KRMB 3G5XA 4OKDA 4HUUA 5FIEA 4XNQB 3IDXH 1ES0A 3QUYA 2OL3H 1BWMA 1T6WA 2Y6SD 2ED9A 2P5WA 3AY4A 4QHKJ 4NZRH 4U1MA 3ULUL 1ODAA 5DQ9A 4LHUG 3UC0L 1VACA 1MHPH 1YMMB 2F54D 3FRPG 4OLXL 3KR3H 1CDCA 3QAZC 4ZDHB 1GH7A 3VE0B 5I9QC 4HGKC 4G8FB 4QCIB 3VFVB 4Z0BH 1EEQA 3CFKB 2D7QA 3F58H 2EKJA 3TO4C 1I3GH 1XZ0B 3H9HA 1MCHA 1MCWW 1HSAA 4XCYA 1J0HA 3PJSB 4WEMB 4A2MA 1CE6B 3Q1SH 1R3HB 3RVWC 2JELL 2PNDA 1RURL 5T1LD 1A21A 1SBBA 2B39A 6FABH 5I8KH 3BN9C 2CR6A 3RTQD 4ZPVA 3FTGA 3L5JA 2VR4A 3HFMH 3RY4A 3TCLA 1KFAL 5H8DA 2N7AA 4JM4L 1VGEH 1HHIB 4K71B 3W2DH 1BMGA 5F71A 5DD1H 2X41A 3QUXB 5F9WC 3EGSB 3WHXB 2DI7A 3KDMA 2M2DA 3GMQA 2WBJC 1EMTH 1FYHB 1DZBA 3I6GB 5FB8B 1XF5A 3FO2A 4MJ6B 5IFAH 3FTGB 3UTSB 1Q9WA 2X4UA 4GMSH 3BIAX 5K9JH 5JUEH 4HT1L 4TVPL 3PNWA 3T3PE 1R5IB 1JHKH 2IBBA 3VW3L 3QI9C 4HC1H 1ACZA 3QCUH 5EZOH 1HQ4B 1P4LB 5D1ZA 4OT1H 2MKWA 2R8SH 2BY3A 4TSBL 1UKTA 4J6RH 1AJ7L 4JY5H 1WZLA 3SHSA 4Q9BA 3RGHA 2VUOA 2EYSB 3BSZL 5HJ3A 1TQBB 5B38B 4LLWB 1AHWA 1ZLVH 4H20L 2IMNA 3VXQB 5EZIH 1F3JA 3T0DA 2YUVA 5CS7A 5FK9B 5AZEH 1E0OB 3ILPB 1ZLSL 1OTSC 4K94H 1OHQA 3Q2CA 4YQXL 5L2KE 4O00A 1WAAF 4X99B 3D85A 3WIFB 1O7VA 2O5YH 5IIEA 1D9KC 4J8RA 5BVJB 4HWBA 4ZOCA 3HAEH 3OKNA 2AJZA 2ATPA 5ID1B 3N1FC 1DVFA 3A6CL 3E6HB 4Z7NF 5L2KA 4Y19E 4OZIA 3QUMA 3H3PH 1JUFA 2RCSL 2G9HB 1I85C 2IAMD 5DJDB 2KQNA 4XC1H 1TVHB 5K9KA 1R3IL 3FOMB 5B22A 3T2PA 1Y6MR 4K9EL 5EZLA 4Q2ZA 5KVDL 4KHXL 1T0PB 2P8MA 3I9GH 3UZEA 3S9DB 3N1PC 3ZDZE 1TTGA 5T5NF 1P2CB 4UNVA 4G42A 1EA9C 1ZT7A 5DUML 3O8XA 3RHWF 2W0LA 3LEXA 1K6QL 4M7ZB 3TNMA 5B38G 2YHGA 3WNLA 4ESKA 1H3TA 5HDBF 4KGLA 3UYRL 2BRRH 2SEBA 4OIBA 5EC2B 2YK1L 4HUXB 2OK0H 5CWSA 2NY6B 5KTEL 3ALWA 4GG6F 3CDFA 2MQ0A 2P5EE 4JPKL 4LBEA 1T0MB 3V5DA 4YK4B 3JZ7A 4OQ1A 4QY8B 4HX1B 4KJYA 4HJGB 1M7DA 1MQ8A 4J3UA 5HGGS 1RQ5A 3VRIB 3U9PH 1OY3B 1DUZB 4M8VA 4OQTL 4NHUA 4JO2L 2HTLD 2ZCLH 1YNTB 2H45A 4NO2A 3UTPE 4LSRH 1CDJA 3FO1B 5FYLD 5GGVY 5IWLC 4NT6B 5IW1A 1A6UL 3DTXA 1S7WB 3UPCA 3VFPA 4ZUSB 3NCCB 2MWCA 4LRNH 3STLA 3VDBA 5C0DA 5TPWH 4PGBA 1FN4A 1PKQB 1OPGL 2IQAA 2XNAA 2DQJH 1RK0B 1F58H 1KCVL 3EYQD 5JDSB 3MRCA 5I19H 3HE6B 3BEVB 3IB4A 3MGAA 4BQCA 5CINL 3HA0A 5IT2H 3TPUB 3SKNB 3RWFA 5KS9B 1CG9B 5C07B 1I8IA 2NNAA 1KPUA 3VXSA 4Y16C 4PGEA 2NZ9D 3EO9H 3OKDB 4HEME 1DQML 4M6MH 3D25B 3DIFB 3DRTA 3D0LB 4Y1AB 1S9WA 4S11A 1MCPH 1YZZA 2WINA 1IGMH 1TETH 2HKFL 1FBIL 3LDBB 1A1OB 3FFCA 3U4AA 1QFPA 1SJHB 4OF8A 1MHEA 1X5ZA 1B3JA 2DKSA 3GSWB 1VFBB 2BNQD 3L5IA 1QLRB 2SEBB 4WY7L 3L5XH 2MMXA 4E5XA 5TDNB 4HUVA 1M05A 3TPUA 3FT4A 4WI5A 3FONA 3L3KB 5JW3L 2CKBA 1AC6A 4R0LC 3MOBH 4CDHA 3RIFF 5FKAA 4CJ1A 1X5IA 3L9RA 2YC1A 5FO9A 3WFCH 1H8NA 5EBWA 2Z91B 4EUPH 5IEHA 4PGBB 1SY6A 1CTNA 5KVGL 3S3SA 3TYGL 2B1HL 1HZHH 2H1PL 1KXTB 4EI6B 3QZWG 2X7LA 2BHZA 3VMOA 2I9TA 2LU3A 2R1YA 2Z8WC 5C9JB 4MYWB 4PV8A 4OZGB 2VZTA 3C2AL 4FXGA 4W4OC 5CZXD 3LS4L 5E03A 2Y4SA 4O9HH 1N6QH 1MWAH 3BRGC 1OCWL 4FQLH 3WUWB 3VDCA 1NUGA 3D1MC 1OP3H 2VLKE 5IIEB 5GS0H 1NL0H 5DJYB 3NCBB 1KJ2A 3J8F7 5GRWA 1RZJL 4GRWH 2NW3B 3C60D 4HIXL 5GQBA 3WL9A 3CDGA 2FBOJ 3ZKNC 2VZ1A 1QBMH 3JWDC 1X3DA 1A9BB 1R24B 2VQTA 2CLVA 5F70A 4NO0B 4Q9QH 3U4BH 4MD4B 43C9B 4PLOB 3BDYL 3WDIA 4G3YL 1T2JA 3TV3H 5GGVH 4RWHA 5JXAH 3MRRA 2XG4A 4N8PA 4DGVL 3EO0A 1HYRC 2GJ6D 1AGDB 4I1NB 4PG2C 3RBGA 5E8NA 3EHBC 1L9NA 4I18C 4WW1B 2J7LA 4ZXBA 1SYSB 1C12A 3HN3A 3L5WB 1OAXL 3U0WL 3VFRA 1RUPH 1NCDH 2K7PA 3D39E 5EO1A 3O6ML 1CFSB 3PP4H 2I26N 1QOKA 3PDOB 3JVGC 2NY3C 1DQTA 3O6FC 3IDMA 5J6GA 1JYNA 1OTTC 4JHWL 2QR0A 1DVFB 3MSPA 1PX4A 1YEGL 4FQ2H 3D39A 3FFCE 1QLFA 2HA1A 4XPFL 5LGJA 2B4CL 3X3GL 1KELL 4WI4A 4MSWB 4PREB 5FGBA 2JJWA 4DVBB 1PZ5B 4EUPA 2AK1H 4HFUH 3SGDH 1KTLA 2CH8A 1EHAA 3QEUA 1HHIA 3ARFD 1AGFA 1KEMH 1NMBL 3PGFL 4XB8A 5GGSY 1HHGB 5CSZB 4I9WE 5DI8A 2ADIB 4KUCD 2JIXA 1P6AB 3RDTC 4KTDL 3IDIB 2VLME 1FE8H 1JZ5A 1AHWB 1I3UA 1U6AH 5DO2C 2ZG1A 1MPAH 1PEWA 3BQUD 3HC0B 3WD5H 4AEFA 1IEBA 4KK8D 4M9PA 5AG9A 3VFTB 4JFED 4QRPE 5KAQF 1HQ4A 2YPLB 5HI5D 4QCIA 1U93A 1QBLH 4UINH 1DLFH 4JHZA 3MXVL 2NTFA 1HKFA 1PY9A 3MFFA 1RU9L 1SMAA 3D2UD 3SKUD 2NY7L 3QNXB 1GGCL 1TZIB 4FXKA 2W9LA 2WWKO 1MF2L 4G6JH 4U1NB 4AM0B 3NAAL 3P4LA 3Q0HA 3DX9B 1VPOH 1MIML 3ARXA 4LCIH 1FYTB 4X80L 5GJTH 4F7MB 1CDUA 4UZGA 5HYQA 1KIPB 4PJCB 2EDRA 3H9SE 1J05B 1WFOA 2P8PB 1F97A 1TXKA 1MREH 3VG9C 3QCTH 1F2XK 3OPZL 3PQYA 2FEDD 2IC2A 4X6EA 3WJLA 4OD2B 3WHE1 2EDFA 2WBJB 1JF6A 5EUKA 1GIGH 4PJBF 4DGIL 3X17A 1WEJH 4Z5RA 4LHUB 3V95A 3AGVA 4HWZB 4XMPL 2CK0H 1HIMH 1U3HC 4NJAL 4S0SD 3LRSA 3MNWA 5TQ2H 5C0JB 2A6DB 3NGBB 4M6NH 3ALXA 1FNSL 4U1KA 2X1WL 3TZVD 1QSEE 4EDWH 4X5XA 5KG9A 2QV2A 4FFVD 3KHQA 4NM8H 4PJ8C 3WFZA 4S1DD 1CDYA 5C0CE 3BGMA 1MH5B 3BAEL 2IPTL 4NQDE 4AK1A 5E8EB 3WFDH 1NCCH 1FG2A 4UQ3A 3OMZA 4H8WH 2EC9T 1NC4A 2NXYC 3VD7A 1VFMA 4K07A 4HD9A 4NZUH 3BZEA 3KPSE 1U91A 1J1XH 1MRCH 3M8OL 3X12A 2R0LH 3VJ6A 1AD9A 3WN5C 1JK8A 4AT6A 2PCPB 3RTQA 3MRJB 2B8OT 4HF5H 3SE9L 3W81A 1W0YT 2I5YL 5MEOA 4NKDA 4ZS6C 4HJ0C 1MRFH 3IS1X 4U6HA 3NZHL 3ULUE 4JO1H 4UT9H 2D4DA 5DUBB 2DICA 4W81A 3ROLA 1HWGB 4LF3A 4Y8DC 4NPYB 4JQVC 3GSOA 2HKHH 1CTOA 2JCCA 3GSXB 1I1AA 4FXGB 3R4DA 2ERJB 4MX7B 2NX5E 3BO8A 5GJSH 1RHFA 2VDKH 4JRXA 3DV4A 5E2TH 3ZT5A 5LAXA 1AO7E 3HZKA 3NA4A 3TBYB 1R5WA 5H37H 1WV7T 4HK0A 4ZXBB 1G9NL 4KAQH 5T3XL 2EIBA 5EORH 2AW2A 2B2XH 3TBTA 3SGDI 2CUMA 2H2PC 3BUYA 3RVTD 3TIDA 1OVZA 3V4UL 4QF1B 1QFWH 3BESR 1UA6H 1MHEB 1LQSR 3GSWA 2D9QB 5KOMC 4PS4L 3ZDYE 1CR9H 3ARQA 4R4FL 4WCYH 2A73A 5KTEH 1RJZB 3C6LD 5DDHA 2R9HD 4KXZH 1JPST 3OF6D 2YD2A 4QWWD 2NNAB 4PJGF 1JGDA 3RWCA 4P49A 1QSFA 3IAQA 2GTZB 1GAFL 3RDTD 1U3HD 1K2DA 4GAJH 4R4ND 4J2XA 4PRBA 2MNUA 5DFWH 2XFXA 5GS2H 4UV7H 2DYPA 3CX5K 2ZCKH 2H6PB 3MV7E 1F4XL 3NFSL 4ZPTB 5DHXB 4H25A 4FFVC 3T0BA 1KENH 1WBYA 3BD3A 4RMQA 3RNKA 1N4XL 5CCKH 4JDTH 1S78C 1S9VB 2YC1B 3EFDL 4C57C 5IQ9B 5F93C 4KWUA 4PJ5A 4PJDF 3PABB 5E70A 2Q7YB 3UAJD 4D0DA 5CJOH 1QNZH 1TZHA 2HT4C 3VRJB 5CINH 4JFYB 4ODSH 1BBJA 4FTVB 4ZO9A 1PYWA 2D0GA 2OL3L 4WGWB 4XC3H 4PD4K 3SPVB 1ZVHA 1X5LA 3CK0L 4F57H 3I75A 4QXGH 5I74C 4KI5F 4ZODA 3GBMH 1YJDC 4G7YH 2QTEA 5I17B 4U1IA 3GSVB 5EBLB 5JOPE 1ZVSA 4PGEB 1W72A 5BJTA 4JKKA 4C83A 4QRRB 3CU1A 3QEHA 4BFGA 3TIDB 4KK6C 4XP1H 1U8MA 4FFWD 3FQTA 2D03L 1LE9B 3AS2A 2PO6A 4QRTB 1CVSC 3CFIC 3O3BB 3S37H 1KTDA 1F4AA 2DKMA 1UB6A 2IBGA 4D0BB 1LE5A 1EEYA 1OAZL 4LCYA 3SGJC 4MB4A 1NFDE 4PGJA 5F7DB 3U48A 2B1HH 1HZHL 1C7SA 3RIFK 2ITDB 1DEEA 1S7WA 1OLZA 4Y7MA 3H2WA 3FO1A 3VMPA 4M7KH 1RUML 3KXFB 2H32A 3ZTJG 2YR3A 2J8UF 4KROC 1ZA6A 1NAMH 5B4MC 3DI2B 4N8CH 1RZ7L 4LSVL 1YMHA 3QFJA 2R23A 3VI4F 4TUJA 4OZ4B 3Q6GH 2VR5A 4MVBC 5MEOB 1FVCB 3MLUL 3JSSA 2R9HC 3C08L 5EIVA 5ITFA 3M1BA 1LK3H 3K8MA 1WICA 5MENA 5JTWA 3K4AA 3LRHA 1YN6B 2ILLA 5E7FA 4OZIF 1FNAA 3BZEB 3T2QA 1XF4A 3HR5B 4AH2A 4R4NC 4HPOL 4UT6H 1MIEH 2X4SB 4XPGL 4J6RL 2FJGB 1J8HE 1KB5L 4LSTL 2HFGH 2A6JB 4D2NA 4NYLB 4PRAB 2IH1B 4YXLL 3KPMA 1A6PA 3K8LA 1A8JH 1L0YA 4MDIA 5DEGB 1QPPA 1UQSA 3FFDB 3O4OC 3GNML 4X9BA 4OM0L 2E9JA 4XWGH 3C09B 2YBRB 3AB0B 5E9DB 3SQOL 2Q86A 4WJ5B 3HNTL 2A6DA 3P4MA 3PQYD 1ITCA 1CE1L 5CEXA 4GG8A 4D94A 5A2IH 3V0WH 5CEZL 4L5FH 3RVVC 5E2WH 3T3ME 4P23A 1I3RA 2AK4E 1KELH 1S7UB 1ZEAH 4KDTC 4YDLC 2Y5TB 5LKNA 3IFNH 1IBGL 2AV1A 3MV9B 4ZS7L 5L0QC 4ETQA 1BHGA 1CGUA 4D0BA 5C92A 1BEYL 4RGNE 4YGVA 3O6FB 4QWWC 4XXDB 2G5BB 3GSUB 4NN7C 1UGNA 5FGRA 2BSSA 3HG1B 4N9GA 2N4IA 5C0GB 4PJGA 5HYJA 4OIAA 3AVEA 5C0CA 4TSCH 5D1QA 4YIQB 3FCTA 5EU7C 2AKRB 3SDAD 2L7JA 1QKZH 4LSSL 3UTOA 4K3DH 3U1SL 4L8CB 2Q76B 3V6OA 3IFLL 2VXVL 2Y6SC 1ZGLB 1ACYL 4C4KT 4HDIB 1JTTA 3H3PL 1A7PH 1EZVX 3RNQA 2A6KA 4XC1L 2ZKHL 5FA3B 2YRLA 1PQZB 2W9DL 5T33L 1CT8A 2V2WB 1CLZL 1BWWA 1H5BC 2NY7H 4KHXH 5KSUA 3R1GL 1QSVA 4X6BB 4KTEH 4NNYB 3N06B 2HRPH 1MIMH 4X80H 5DUMH 5GJTL 5J13C 3WXWL 1I8LA 3SY0B 5BV7L 4H5SB 2JB6B 1U8LB 3DX6A 3A6BL 3VXUB 5JDJA 1RI8A 4WWID 4U3CA 3KYNB 4BSWB 2OK0L 2V5TA 1BQUA 3D18B 5F7EL 5J3HC 5EBMA 4G9FD 3OR7A 4Y89A 3P73B 1MLCB 4ZPVB 1WVZA 5CP7A 4MJ5A 3QDJE 1IKFH 5E5RB 3U6RB 2AK4A 3SE4A 2JIXD 1R3HA 3O41A 2X6MA 4A6YB 1MCLA 2D0HA 5I8EA 4G8IA 1N64L 1P4IH 5I2IB 1AXTL 2ZUWA 4OLVH 1ZT4A 3CFKA 2Q8AH 5EIQA 4XMLL 5JXEC 4APQA 2NY4D 4PJHF 2CIIA 5ISZA 3SE3C 2CRYA 5E6ZA 2APVA 5E8NB 1M71A 4PRPB 3OR6B 1S9XA 4BYHA 1IGML 1TETL 3DMMB 5DT1H 4WFFE 4TNWF 5TPWL 4JPIB 4CU7A 3BYTA 5EOTB 1QUNA 4P2RB 4ZSOB 1RPQA 1UM6H 3WN5B 4P57A 3QUYB 3QIWC 3D5OF 2PYEE 4HWBH 3CFJB 1QSED 3QXAB 3IF1B 1J5OL 3DUSB 5TQ0L 1N0LA 5IMLA 3QUZA 2ZSVB 1C16B 4HAFA 5E9DD 3EO9L 3BO8B 5D1XD 1CICB 2HAZA 4CL7A 3GMLA 3JV5A 2VN4A 5T1MA 5BV7B 4X6FB 2E7CA 1T1YB 1CGVA 5DVOA 1ND0A 3C5JA 3W39B 1CIDA 4NO5A 1FNLA 1U92A 4CU6A 1C16A 3ZKMD 2Z31B 1K8IA 4R90L 2R0WL 2BERA 4GW1B 1ZLVK 3SDCC 5MHSE 4YFLF 3QXAA 1RURH 2YZ1A 2VZUA 2KDGA 3X12B 5GGSB 1EXUB 2YN5A 1QYGH 4LP5A 1C5DB 4ZSOA 4HK3J 1HSBA 1VGEL 4O2EA 4KJQD 2R1XA 3F5WA 1CGYA 2JJSA 3WLBB 1CD1B 4ONGL 2HN7A 4G9FE 1Q1JH 4EIGB 2XWBA 2VTFA 4MD0B 1IILE 1PLGH 3ARTA 3R06A 3D25A 3DRTB 1TMCB 5GHWH 1ZT1A 3LKRB 3S96A 5IB2A 2VH5H 2HJLA 1G9MC 4R7NA 1ZHNA 3QYCA 4L4JA 4HIHA 2IPUK 3QUYC 4Z18A 5LXGH 1CG9A 5JLZA 4HKBB 4FP8H 3VGHA 1EUTA 3LQZA 4PRIB 5I1LA 3HE6A 2VDOL 4ODUB 4OCLC 2VKWA 1D9KD 2P7TB 4AG4H 1IT9L 1KNOB 5JXAL 4ETQB 2X1PA 4WFGE 3STLB 5C08D 2HMIC 3NTCL 1CVRA 1DANT 4JLRA 4O51A 3SCMB 3QNYA 5IQ7H 1N8ZB 5IESH 5E00B 5J9PA 4X7EC 2JB5H 4U3HA 4TNWK 3CXDL 5C0FB 2XTJD 3ZLQC 1LDSA 4XZUB 5ID0B 4ISVB 4GT7A 5DMKB 4LVNC 1KCUH 1T20A 1YEEL 4MA8H 3V79C 5HPMA 4X8JB 3CFBB 4KTDH 3RWHB 5TE7L 4KQ3H 1BOGA 1F90L 1I75A 1ORQB 2A9ML 5E1HB 4EI5D 1ZKAA 1D5IL 1SHMA 3KPMB 3VFMA 3ARDB 4NBXB 1YPZB 2HYMA 1P7QB 3QIUC 1S5HB 1YYMH 5BOZG 5DHYB 2DRUA 1G84A 1QEWB 3PG2A 4PJCF 1SEBA 3MLXH 3KYAA 1WWBX 1V7MH 4P2RD 4R26L 3VWJC 5IVOA 1PKOA 3GBNH 1JNHA 5BRZB 3QI9B 3BIKB 4XXDA 1HKLL 1BVZA 3O45B 3HE7A 4JY4A 3DV6A 2BVYA 1S3KL 5GS0D 1VERA 3VGDA 4TYUA 2RHEA 3N1GC 2A0LC 4XPBL 3JTTB 4Y16A 3UJIL 3HMXH 4FABH 2BRRL 2NPLX 1JBJA 3CAFA 5HHNA 5E2UH 4TUOB 5JZ7D 3UPRA 4JPKH 2EH7L 4LOUD 4F9PC 5F7MC 4Z8FH 4EVNB 5A2JH 2DI8A 2D7TL 3RGVD 1RUMH 3FZUD 2YA1A 5J6GB 2GYSA 4NQCB 5T1KD 2CXKA 3WEXB 3LMJL 1Y18A 4HHAA 3UTTA 1QVOB 1X5GA 4XNMA 1G6RA 4ZD3L 1MCKA 3DVFA 2ZOLA 4PRNB 1IM9D 4H0HB 5KSAC 5DK2A 3UPAA 4OCRH 5ALCH 1EGJH 3DHMA 2RFXA 4B7IA 2P24A 4PJHE 2A6JA 2V7HB 2IFFH 3IJYB 1KCLA 3RX5A 4DEPC 2FX9H 5JIHA 3HFML 2WAHA 5DEFB 3PIQB 1CFTA 1AFVH 2OS7A 3NN8B 1WEJL 5JNYA 3L3JA 3MRRB 5FUOL 4PJDB 3ZL4L 4YDJB 1F8TH 2JJVA 4K8RD 4NHCH 1NFDA 3NZ8B 4OI9A 1E27B 4Z7WA 3ZHKA 2GCYA 5DRNB 2AV7A 2EICA 5JPNB 4LCUA 4UUJA 5C2BH 4X7SH 1OQOA 5EWIL 5HGAB 3OXRB 4Y0GA 4P4RA 2NW3A 3SDCD 4DUVA 2FDBP 4C58B 4MQ7A 4OM0H 5KS9E 1CLCA 4RBPH 1AGCA 1UENA 5FO8B 3MLPA 4RMRA 2GK0A 1EAJA 5CIPH 4IOIA 1KJ3L 4JO3H 5F7YC 3HC3L 2BOBA 3WFDL 4GRWB 5C0AB 5FHBL 2OCFD 4LPXA 3MLVH 4JJ5B 3PWNB 3JTTA 2R1YB 3QFJD 5LWYL 2YUWA 4DW2L 1IARB 1YJDL 2HLAB 4JY5L 4JZOA 1LHZA 4ALAH 4IIQC 3DV6B 5DVLA 2ZUVA 5IEHB 4QTIH 5ALBL 3TBVB 3R0NA 1RZIB 1KT2A 3ESUF 3TVMD 2W60A 3EYFA 1OL0A 3ILQC 4JKMA 4XAWL 1LE9A 5FYKH 1VEMA 1KG0B 3P0YH 3ARFC 4LCCA 4X4ZA 2AQ1A 1AQDB 3H9HB 2XXCB 4KI5E 4MCZB 3VXOA 1XIWD 3DUUB 4JQXC 4Z7NE 5FAAA 1OTUC 4HH9A 5CJ5A 3MV7A 3K81A 1K4DA 1ADQH 1FCGA 2KKQA 4LIQL 4K71C 5E8PB 4ZDHA 1ORQA 1BOGB 3F7YB 4WHYG 4HIEB 1IGCL 1T1WA 2XZCH 3TO2B 2A83A 5DQ9B 5I73C 3ARUA 4D9RD 1KLGA 2EZ0C 4PJ5B 1ZHLB 5BS0D 2E5EA 3CCHB 2XA8L 3HMWL 4GAYB 4RAVA 3RPKA 3RUGE 3VFOB 1UZ8A 2D7MA 4AEHH 1N7MH 3I85A 4U6VH 5IB1A 4JFDB 3QNYB 4H25B 2QSQA 1YN7A 4L1HA 3LS5L 2G75A 4OLUH 3L5HA 5JQ6H 2J8OA 4MHHG 3C60C 4NWUH 5EOQL 2YK1H 5CZVH 5ACLA 2D9CA 2EIZA 1RFDH 4JM2F 4Y88A 1C7TA 1HWHB 1UM4H 5EU5B 3NABL 5L2KD 1FIGL 4URTB 4U4BA 3JV4B 1DUZA 3UDWA 2E9BA 2BFVH 2LAAA 4PP2B 4HG4J 5IOPA 2DQCL 1A9EB 1SJVA 4F9PA 4OQTH 3S96B 1I8KA 3PHQA 3MRJA 5FECB 4EKXA 4LBEB 2XWBB 4U05A 4JRYE 2PF6A 4NQVA 4Z78A 4J3XA 2R0ZL 4JR9L 5J56B 3LD8B 3B2UC 2AK1L 1KENL 3LH2L 3GSQB 5IHUL 5EOCH 2FJHB 1SQ2N 4WUUA 2J8UE 1I9RH 3MCKB 4JPVH 3V6FB 2BSTA 2E9WA 3T2NL 3WO4B 3B6SA 5EOCJ 3WIHL 4L4VE 5AYUL 1TVHA 4P99A 3T0EA 3PWUA 2FGWH 3IDJB 4MX7A 2WUBL 1FIEA 1G7LA 1H3XA 3KLHC 4G9FA 2YZ8A 4J23A 4NPYA 4LFHG 1U8IA 2AEPH 3QWQB 4QRPB 3SDXB 4JN2B 1KGCE 4LHUA 3DXAB 3NA9H 2F8OA 3C60B 4XP1L 5C09E 4OF7A 1CGSH 4KVCL 2IANE 4P3CL 4GLRH 2C1PA 1PBYA 1MF2H 4G6JL 1UJ3B 4QRPD 5F21B 1H8OA 5CJXC 5HHXL 1KCRL 2DTML 1J1PL 4F7MA 4GRLD 3W11C 1OSPL 4X6BA 1MREL 5KBNC 1T2QH 5E2VH 2BC4B 3HI1B 4JPIA 4DK3A 4PR5B 1NLDL 1OAUL 4D0CA 3WXVH 4QNPE 3VXPA 5E8EA 1X7QA 1SJEB 1JRHL 1FJ1A 3DSFL 1JTOA 5FECA 4W4NA 3MO1A 1WCQA 4PRHB 1UXSB 2AERT 4BZYA 4LARL 4PJAA 4FQLL 3VRLE 4OD3H 3RDTB 1DCLA 3QXUA 2BY0A 3QEQA 4B5EA 3JV4A 4RISH 5FF6A 3BPLC 1MJJA 4JFXB 3HG1A 4XMKH 1FVDB 4MJ5B 1HXMB 4NOFA 5DSCB 3ARBB 4YDKH 2EKSB 4OLEA 1BQHG 5E1AA 3S36L 2UZIH 1VGKA 1N6UA 4NRZA 1LWRA 4XVUD 3BGFC 3ELAT 1D5XB 1DBAH 4MSWA 5BZDB 3VFOA 1SEQL 3DVIA 5T3ZE 3FB6A 2B0SH 1EZVY 3L7FB 3NFPB 3DX9A 1I1AD 2EYRB 1T3FB 5D7IA 3G6AA 3V6ZA 5ICYB 5MEQB 5KJRL 1WUNT 4Z0XA 2EDOA 4TQEH 5ESQB 4JFZH 3TT3L 1KCUL 2CDFA 5KW9L 1YC8A 4Q9CA 4KQ3L 3HUJB 3NFNA 1T7VA 1AP2A 3JTSA 4FQ2L 1A7OH 3MLZH 3FQWA 5DC0A 2XKNB 1IMHC 4YHOL 5KVEH 3CVIL 1ACYH 4OBSA 5GJSL 3L3JB 1WTGT 4ZS6D 5IROA 1XF4B 3LQAH 2NY5H 3B9KC 3ARDD 4EQ3A 2GJ6A 2GSGB 1HHHB 4GQ9L 5T33H 3B3IA 4KUZH 4MD4A 1YEJL 3BPOB 3M1BB 2OXGA 4Q0XL 1DDHB 3GMRA 3OZ9H 5GRVL 4JZOB 4HKXA 2NY4B 4G8GA 5ADPH 4LSUL 5HGDB 3MLWH 2YA2A 1BD2E 1X4ZA 4DVBA 2LVCA 2ESVE 1ZMYA 2CRIA 4DVRL 1PAMA 3ARGB 4PJBE 3V0VB 2ZNXA 3Q5YA 3IS0X 3P9LB 3L3OA 4GRLC 3T0VA 3BIBX 1QR1B 4WFED 5HYJE 4FQCH 1ZLUH 4LCWE 1KIUA 3KPQB 1S7SB 1TJGL 3IETB 4HW6A 4JM2D 1Z9OA 1LEKB 4I18B 1Z0MA 4GUPA 4OV5A 2H2PD 1HILA 2PTTB 3AAZA 4Z7VB 1ZHKB 4HS6B 3NAAH 2XI9A 2Z91A 35C8L 3KPNB 3ZDZF 1EGJL 4GFTB 4PJXF 4DN4H 2PO6B 4QRTA 4Y2OA 1X4XA 2NX5D 3FT4B 4FQPA 1FNGA 1GL4B 3EYUL 5E8DL 1I8LC 3S7GA 3WNMA 1XCQA 3REVB 3CVHH 9CGTA 1I1CA 2GJJA 1NH6A 1HEZB 2OM5A 3OKKB 5MENB 1NGWA 3MACH 1EIBA 1T1ZA 1N0XH 1H3WM 1FVCA 3HE7D 4WNQB 4OZHE 4M02A 2P42B 4HLZG 4K3EL 4P2QA 3I75B 5B39B 5ITBL 5C2BL 5DTFB 4CN4A 3D9AH 3ARRA 1S9KC 2VDML 4PRDA 4ODSL 3PWVB 5MEQA 5FCSH 1KB5A 1LO3H 3BPOC 5DJ2B 4RQQB 4WFGD 4N0CC 3DPBA 5C09D 1A7BA 1A4KA 4KXZI 5DJ0B 5HHNB 2WMPA 5D6CA 2BSRB 4Y4FD 1DEEB 4APQC 1P7KB 1XF2A 3H9SA 1R5VA 5I75B 2Z93B 4NSKA 3UTTD 3MRQB 2J6EA 1T4KB 5B4MD 3NACH 4ZUSA 3BQUB 3OX8B 1NCWL 1QRNE 2ORBH 4WENB 1I8MA 1LE5B 2L7UA 4ALAL 4NFBA 1F4YL 1SVCP 2YPLD 1K9TA 3BP5B 2B5IB 4X6CE 4OIIL 1GGIH 4XX1G 3TWCH 4ZFGH 4HKBA 4JFFB 2GT9A 4ZAKA 5D7JB 4PJIB 1MEXH 2FR4A 2DQIL 3DWTA 4FZEH 2D7OA 4JO1L 5A16A 3VGGA 3WYRA 1RHHA 3I50L 1REIA 3MRGA 2HLFD 1Q9KA 5T1LB 4CNIA 2XICA 4YHIB 1S7QA