1YNLH

Identification of key residues of the nc6.8 fab antibody fragment binding to synthetic sweeterners: crystal structure of nc6.8 co-crystalized with high potency sweetener compound sc45647
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
219
structure length
219
Chain Sequence
RVQLLESGAELMKPGASVQISCKATGYTFSFYWIEWVKERPGHGLEWIGEILPGSGRTNYREKFKGKATFTADTSSNTAYMQLSSLTSEDSAVYYCTRGYSSMDYWGQGTSVTVSAAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPSGPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig gamma light chain
publication title Cocrystal Structures of NC6.8 Fab Identify Key Interactions for High Potency Sweetener Recognition: Implications for the Design of Synthetic Sweeteners
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 42
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2005-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ynlH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ynlH02
3QCVL 1QLFB 2GSIB 3HS0A 5EORH 4Z7WE 2J7LA 2YHGA 5EZLB 2V7HB 1AXSA 3P73B 4F2MA 5I18L 1IT9L 1NBVL 1VFOA 1YEFH 2AV1B 5BV7B 4AL8L 3CLFL 4MGXA 1HINH 5ICYB 2ENSA 1ZWIB 1ZGLB 3H7BA 2D31A 4C58B 3OJ2C 4ZFGH 2EE3A 2Q76B 4RAUA 1XCQB 4JHAH 3HC3H 4GBXB 5GS0D 3JV6A 3VXNB 3WIHH 2IPTH 1FNGA 4ZNEA 4PJ8B 4Q58C 3UBXG 1C08A 2EYRA 3EJJX 2CO6B 4ZS7L 5C2UB 3VXTB 2Q3ZA 1DBJH 3RUGE 4URTB 4BH8B 5JORB 4YHLH 1BFSA 4QOKB 2BSRB 3DETD 1LD9B 4NRYB 3QH3B 5C9KA 1WT5C 5ID1B 3ROLA 3DMMC 1V7NL 2I5YL 1K8IA 1IM9D 3UZQA 4KVNL 3OKEB 4LU5L 3GSQA 4S1DC 4QNPF 4QXTA 2IADA 3QUYC 2FWOA 1V3JA 2GJZA 2XACC 3TH4T 4XBGA 2IJ0C 1CD8A 2OR9L 5HD8C 2XV6B 4IIQA 5D71L 1S7XA 3TCLA 4G8GB 3AREB 2XKSA 1DQDL 2DRUA 2KZ1B 4GMTH 2CRIA 1EVTC 3EYSL 4JFHE 2GTZA 2PNDA 3RBGA 4RDQG 4N1EA 2JIXB 4I0CC 3INUH 3MZGB 1QSEE 3D0VB 1S7QB 2J3SA 1IAKB 3TJHC 5ERWB 1Q9KB 3CH8A 1FH5H 5EIQA 1VACB 4TSCH 2A6KB 4PJEF 4H26B 2ILLA 2IPKA 4MNQB 4MXQC 1MOEA 3A0OA 4GLRH 1DN0A 2CUHA 5IMKA 3H9SB 5DD1L 2VXVH 3P9MA 1QKZL 3TBTB 3DURB 3ARDD 4LNVA 5I76B 2HN7A 1ADQA 1YNTA 4G6KH 1A64A 3EYUH 5FB8A 1U3JA 1LE9B 4RWYL 2C3GA 4MB3A 4BFGA 2YSSB 1RUAH 2Z31D 3V9FA 4XHQA 1OP3K 4APQB 2I9TB 3A67L 4PJ9B 3K46A 5JHDA 1JGLH 2CJUH 4G43B 2R4SH 1QYGL 3LZFH 5EBMB 2NQCA 1KB5H 2AK4E 4OCSL 2CIKB 4U6XB 2C4FT 5E6IB 4U1JA 5IR1B 1G7JA 4GAYB 5KVEH 4LVNB 3HUJB 4M9OA 2FIRT 3QIWD 3CUPA 3QNYB 1UYWL 2UWEF 5GJSL 2H6PA 4J8RB 3BIKB 3ZE1E 2DIBA 2PR4H 5DVKA 1EBPA 5HPMA 3MRQB 4WVRA 1FCCA 4EQ3A 4Y4KC 4C55A 2AEQH 3K74B 1IEHA 4R4BA 1MCEA 1NSNL 1KB9J 1OF2B 2X1XR 4K7FB 3WKNA 2DN7A 1RZFL 5IMOB 3TFKD 4M8VA 3DI2B 2FSEA 4GG6B 3SY0A 1JF1B 1VFBB 3TO4D 3RDTA 1CGSL 5I17A 4OCYH 5DJAA 1NBQA 1RZIB 3V7AG 2LFGA 3QEQE 1A3LL 2ZJSL 4MJID 3I84A 3RI5F 3FQRA 3NACH 4NP4H 4Z5RB 2YPLB 3BP6A 4R4FL 3M8OH 5IHUH 1DBBH 5DWUH 1OSZB 3CX2A 4HWNA 2HT4D 2JJUA 4MZ3A 1F58L 1YNKH 2G2RA 1N3NA 3ARBB 5D2NE 2F54E 1CLYH 2OX5A 2CK0H 1XIWA 2R15A 3O8XD 4JFQB 1WZMA 3TJEL 3BVNA 3RZCD 1R3LB 3HE6B 2CPCA 1YEGH 4ZSOE 3KXFE 4HKXB 5HI5D 3RUGF 1AD9A 4L8CB 1E4WL 5E2UH 3KJ6L 3Q1SH 2FLBT 4RFNC 1P7KB 3OPZH 1B9ZA 4G3YH 4YBLC 1LEIA 5C0AE 5DF0A 4WWKD 4XPAH 5F88A 3MLSL 5EC2B 1DBMH 4E42B 4DVRH 1F6AB 1BREA 3ARYA 4QRPD 3UBXA 3P4LA 1J1XH 1MLCB 4OM0L 4AIZB 4YXHH 1AR2A 4V2BA 5TE7H 1FZMB 3TNNB 1CCZA 4XNQB 3MXWL 3IFPB 3IU4H 4JB9L 4YE4H 5BRZE 5T1KB 1J1OH 1AGBA 1XGPA 1NEUA 4GRWH 1K5NB 2IQAB 2G9HA 5F9JA 4QRTA 3LRSB 4UDTB 2O5ZH 3FQNA 3OR6B 3T65B 4U1GB 2COQA 2ZP0T 1OAQL 1N26A 4HXAH 1N2RA 5D1XA 4YPGB 4PREB 2YPKA 1DUZA 3DRQB 1DCLA 3VGEA 3MLTA 5HI3D 5MEPB 4PJDA 3TIEA 3PWNA 3RNQB 3IDIA 3DX7A 2VLRB 4ZFOL 5EIIB 3ZKNC 2CKBA 3PWPB 5FOBB 5IROC 2HLFD 2FIKB 3R4DA 4WV1C 1FJ1A 5F3HB 3OR7B 1LO4L 4P23B 3KPLA 5LGJB 2JB6A 2WIIA 4PRPB 5BMFL 4GAGH 2FLRT 3NFSL 5GIRB 1W72A 5C0NC 3QQNA 1A6UL 3HPLA 2AXGB 2KDGA 5MP6H 3VRJA 5DD5H 4P3DB 4ALAL 4HUNB 5JOPE 2VDPL 1X5ZA 5TDOB 3UMTA 2O5YL 1UXSB 4NJ9H 5CJOL 2ATKA 1A2YA 8FABA 3Q5TA 3D25B 1ZHBA 3PL6B 4RFEB 1J0IA 3NA9L 4I0PB 4L9LB 4HLZH 3QRGL 2VL5A 4LVEA 3SGKA 2V2WA 1HHHA 4JFZH 4JFED 1UWXK 3STZA 3NCYS 4ZUUB 4AYFA 3O4LB 3VXRB 4LPUA 1K85A 4ONHB 5DJXA 1WF5A 5FV2A 1X5YA 3RX8A 5FF6B 3MGTA 5SWZB 2IGFH 4QHLA 3FFDB 4YGVB 3TA3A 3ALWA 1RZKL 3TT1H 2OJZL 35C8H 3HFML 4R7NB 4LRIA 4BH7A 1PFCA 4LLMB 4K3EL 2DQJH 1YMME 2AJYL 1YN6B 1MPAL 2AXFB 4IMLA 2R56L 1OCWL 5CSZA 4P2RA 4OZGE 3A6CL 4OI7A 5GS1C 5DTFB 5M7QA 4PP2A 2PW1A 3BPLC 2VSDA 1R5IB 4DN3H 5D70L 5CGMA 4YGAB 4CU6A 1Q72H 4KMLB 3U2SB 1ZVSA 1AFVL 1AQDB 1FV1B 4NQTA 4RGNB 1I85A 1B2WH 5DURD 3S35X 2NY6D 4HIXL 3BN3B 3GB7A 4M6NH 4QWWD 4YBQC 3FO0L 3AS1A 4QRQB 1E4KC 3FB5A 1Q9OA 4FNLH 1CGYA 1NCDH 2X4UB 1UB6B 4NNXA 5IVXB 4YX2L 2B2XH 3LEYH 3HG1D 4PGBA 3N1PC 2CRMA 3O9WB 1UZ8B 1OTTD 3BAEH 3BOVA 3CSBA 3UYPA 4O58L 4OLZH 4ERSL 5C0BE 4R7DA 3ZDZE 2IANA 4XAKD 2F9BT 1ES0B 2R2BB 4NNYB 5CIPA 4G7YL 4YO0B 3I6GB 1CZ8H 1RUPL 5LAXB 3SEPA 2HVJA 4EVNB 1U8OB 2I25N 3HMWL 2Q7YA 1NAML 5I8CB 3N9GH 3U82B 4PRDA 4X8XA 4ESKA 2GT9A 4Z78B 1NAKL 1CDJA 3P2TA 3FB8A 3BDBA 4WNQB 1YECH 4F7TB 3BW9A 5T3XL 4Z7OF 3NIDF 2PO6A 3OKKB 1ZT4A 3EIFA 4R4NC 5MHSE 2EDRA 3KR3L 5K9OA 5DVMA 2FBJH 4NZTL 2JTDA 4MAYC 4KK8C 4NQCA 1SY6L 3ISWA 3CFKA 2XZCL 4WFGD 2APWA 3QCTH 2Z92B 5HY9A 5CKAA 5HGAA 4LSTH 1IM3B 5FM4A 3VRLF 5DEFA 3CCHB 3CSPA 4OTXL 1CFTA 4Z7VF 2YD4A 5F7FA 4MHHI 1G1YA 4P5MB 3TZVA 4OI9A 2D7TH 3MODH 3ZYJA 1FORH 2MHAB 2HWZL 2Y06L 3NPSC 4PJGF 1BVLA 1D5ZA 2WIMA 4K9EC 3OB8A 1S9XA 5JXED 3CDYA 1MRDL 1ZTXL 4CKVX 5EORL 5C08B 3ULVH 4PTUB 4YXKL 1BQHB 1MFEL 5CBEB 5J56B 5GQBA 4MCYB 3A6OA 3L7FA 3DMMB 1T1XB 4U3HA 4ZQKA 1QRNA 2YUWA 1JK8A 1HINL 4R96B 4M02A 3UROR 4N8PA 5I8OH 3RWJA 5D1QC 4HH9A 2C3HA 4HUXB 4ZTPL 1MVUB 1LE5B 1SEQH 4ZFGL 1GIGH 5JUEH 1S78D 1U42A 3EYOA 4JHAL 2E6JA 4HWBA 1XGYH 2J4WH 1J8HB 1NMAL 4U6YB 4D0DA 1VB9A 4KUZL 3TPUB 1DUYB 3EDEA 3T1WA 1T7VA 5CJQL 1INQA 1JE6A 1EZVX 3C8HA 3CSYA 3TVMA 4OZGF 3HRZB 5K9KA 1FFNB 2PYEE 4YHLL 2NY2D 5IB5A 3PWVB 4U1LB 3OKMA 3MX0A 3PUCA 3GKWH 3H7LA 3RJDA 5TGBB 1FCGA 3GFUA 1X5FA 4M3JA 1U3HA 3FN0L 1NCUA 1MUJB 4HHAB 3QIBA 1IC7L 3BZDA 4Z77A 3CPLA 3BISA 3F7PC 4LGPB 5D4QA 1V3LA 1DE4B 5IWLA 1OT2A 3HAEH 1D9KC 2NTSP 2VLJE 5ESVB 3QFJE 1NGZB 3GKZA 1CVSC 1EXUB 5HHMD 5E99H 1MI5E 3IETB 4GMTL 2BNUB 4HH8A 5DJCB 3OKNB 3T8XB 5EFIA 1VFUA 4H88L 4JY4B 4AT6B 4PJEB 3HN3A 1VESA 3INUL 3TBSA 1GSMA 1M71B 5T3XD 3RGHA 4ENED 5JW4M 2FR4B 3ZDZF 1FVCB 3VMNA 1JPTH 1A7RH 3RWHB 3BRFA 5E6YA 1AXTH 2YMXH 1C12B 2YPVL 3BFOA 1LP9A 3LKNB 1BFVL 2GJ6B 5GSVB 3WDHA 5I66A 5JW4R 3O2DA 2HH0H 3SDCD 3KYKH 4KHTH 5DD3H 3I3BA 2ZUQC 3EYUL 1H0DA 3BGFB 4EN3D 5GSRB 3WO3B 2EDYA 5B21A 1IGFH 3QZWG 4MA3A 5HHPB 4GJTB 4CVZB 5EU4B 4IMKC 4X7SH 1XT5A 5C0FB 3IF1A 2CJUL 3WNKA 2R4SL 3BQUA 3EFFB 4JKWA 2W59A 1D3CA 3F12A 5I71C 4JREC 2UWEB 4X7DC 4F3FA 1RZJC 2WUBL 4YHKH 3RVTC 3SHSA 2JB5H 3O6FD 1YPZF 4N0UA 2EDFA 3VXPA 5IUSA 5KVEL 5MEOB 1RUQH 3QULA 4JKKA 1TITA 3IU3A 1YC7A 3SKOB 4IS6A 3PDOA 1KPUA 5C0EA 4OQTL 2H2PC 3O3BB 4A2MA 4HWBL 5EU5B 4ZO8A 3V5DB 5E5MB 3R1GL 1MCWM 4P49A 4LCUB 2EEBA 3H3PH 4LRNH 4ZO6A 4F58H 1RZ7L 3DYOA 4ODUA 3ME0A 2VXUL 3VRIB 4RFNB 1KG0B 5EZJB 4YBLB 1KJ2B 2VLLB 4O51A 4WHYH 1OGAE 5LCVH 4UIMB 3CXDH 2A9NH 1EJ6A 3ZE2E 4UTBL 1ODAA 2AJUH 1G0DA 3PABB 4G6MH 3B2UD 4HZLB 4PRIE 3MV7A 4HMCA 5HYJB 4DZBA 3JV5A 5IHUL 3RL2B 1DBBL 1C5CH 1CXKA 2DTMH 3FN3A 3MO1B 3EOTH 5E7FA 2X05A 4ZPVB 4QKXB 3CDGB 3LD8C 1YNKL 5FK9A 3BRGC 1CLYL 3MRRB 2CK0L 4HK0A 4J6RH 3KPRB 3KPQB 1UJ3C 2NY0B 3CSGA 4XP6H 4Y2DB 1YEGL 1JNHA 3U7YH 3D18B 3U4EA 3Q1SL 4P5TC 3ZE0E 3OPZL 4CVWA 4G3YL 3KWWB 3EDFA 4XPAL 4E5XB 1EUUA 2GCYA 1OVZA 1J1XL 1MQ8A 3QG6B 1RZ8B 2C3VA 1H3PL 4H8WH 5JHLH 3PP3H 2DIAA 3BP4B 4JRXB 4HIEA 3ZYIA 2EDOA 3EHBC 4WV1B 1IGMH 2NY3D 4TNVF 5HGBB 5BJTA 1F3JB 2B0SH 2DMKA 4J2XA 3BKYH 2QADC 5IQ9B 4PS4H 4WUUA 3IU4L 1UEMA 1WTGT 4YE4L 5IB2B 1HIMH 1J1OL 5IOPA 3Q5OA 2LAGB 1S5HB 2NY5H 1QSEB 2O5ZL 3ARSA 3J8F7 4D0CB 3GMQB 3L3GB 5EPMB 2E9BA 4O2FA 4PJCA 5D7KD 4P46C 1F11B 4BUHA 1MAML 4AG4L 1BZ9A 4A2LA 1FDLH 1XZ0B 3BIAX 1G9NC 5ABDE 2R0LH 1D5XB 1H15B 2ICWB 3RVUD 5FECA 4CRPA 5J1SC 3AB0C 3U36B 4BM7A 3MLUL 7FABL 3MUGA 4K3GA 3BPCA 1IL1B 3RTQC 5I30H 3CMGA 5DJ2A 4GAGL 4ZFZB 5TDNB 4OCWH 5IJKA 1JYNA 3Q3GA 4R2GD 3DECA 5MP6L 1RFDH 5DD5L 5BS0D 2DKMA 3U1SH 2A6JB 1EMTL 1WWWX 1GOFA 3F7VB 4G9DB 4OGAC 3B9KC 3E2HB 2LQRA 4G8FB 3SCMC 5C0JA 4LL9A 2YD9A 1LEKA 4E0RA 1T22B 5GS1B 3V4VH 5ID0B 1EEYB 2ADIB 2CMRH 3AU1B 3BPLB 3QZWA 1G0XA 4J3SA 4E9LA 4FQXB 2P5WA 5I0ZA 1T5XB 2FECL 4JAMB 1TQCC 5KANG 5JMOC 2SEBA 2AABH 1TZGH 3KHQA 1GL4B 2E8ZA 1NEZG 2PYFA 3DARA 3D3VA 4NQXA 4OZIE 3P4OA 4AM0A 3M1BB 3TH3T 1M7IB 2OL3B 4M6OH 3MRJA 3O3AB 5SWSB 3TBYA 3TT1L 1V7ML 5IM7B 4JJHA 4MQTB 4LHJB 1ZLVH 2DQJL 4KZEL 3AS3A 1D6VL 2R9HC 3CIQA 3UXFA 1UC6A 5EU7E 4JY5H 4HD9A 1CICC 3PWLB 1MRCH 5AZ2L 3T0DA 1PKQE 5J12C 4X80H 3ZE2F 3LDBC 1EV2E 3NCBB 5KSAD 5D2NB 4LBEA 4DN3L 4OM1L 5DJDB 1LEGA 2I24N 3GJFB 2AK1H 4P4RA 1Q72L 3HR5A 4MNGE 3RY6A 1I3RA 4ZUSA 4ZSOB 3KXFB 1W0VB 2VDRH 1E4JA 1NBYB 4M6NL 3PQYD 1FC1A 5C0AB 2YN3A 5C0CE 3D2UA 4X7FC 4FNLL 3L9RA 5IK3A 1KBGH 3ZE0F 1NCDL 3V6FB 4PYGA 4XWOC 2I60L 1AIFA 1TQBC 3O3DA 3L3KB 5ESAA 3ILQC 3UP1A 2B2XL 3BWAA 5GRXG 3D69B 4QRSA 3VFPB 3FZUC 3UYRH 2VITB 1CFNB 4J3VA 4MAYB 4DKAA 3BAEL 5D7JC 3MRKB 3WFBL 4OLZL 5E8OA 3VXMB 3FT2B 3S8WA 3D0LA 4PUBH 5ANMB 4XP5L 2VKXA 4MSWB 2IALA 4UMGA 2NPLX 4MA1B 2E6PA 4K8RC 1WBYB 1T1WA 4L3CA 1S7WA 2NCMA 4U31A 1ZLSH 3MC0A 4X0KA 1FZOA 5F9AC 5DSCB 4WTWA 1SQ2N 3W9DA 1AE6L 1BLNA 5GS3A 4J3WA 1UADC 4AY0A 4QHUA 2WBJD 3D39A 5E03A 1YECL 3G5ZB 5GGSB 2NMSA 4G9FD 1M7DA 1XF5B 3ZZ1A 5GGUA 5DEGA 2IWGA 2VYRE 2FH8A 1AHWC 2FBJL 4FQQB 4ONGL 4HMDA 3QCTL 4Z7VB 1FE8L 1C7SA 1P4BH 4XCFH 3LKQA 1NLBH 3SOBH 4P3CH 2F15A 5D1QB 4PJGB 2E27H 3KNBA 2Q8AH 1FFQA 1DANU 1MAKA 2C3WA 2D7TL 4OKDA 5IIEA 3AXLB 5HYQA 3VFVB 5EBLA 4HCRA 4FQHA 3MA9H 2OTWB 2AXJA 3VWJA 3QWOB 4MJ5B 3BZEB 32C2B 4Q0XH 4XPGH 1LDPH 3JTSA 4FXGB 5ADOH 3WLBB 4NN5B 4NQDD 3REVB 3GSRB 3IJSA 5FYLE 5HHOA 3ULVL 3T4AA 4L4VA 5TE6L 1I8IA 4Q74A 4YHML 2WWMC 2EDXA 3BN9D 1GJIA 4QT5A 2Y72A 4Y4HA 1R24B 1NCNA 5I8OL 2FD6H 3ESUF 1NGXB 3DYMA 1YMMB 4JRYD 1X4YA 2CLZB 4BFEA 3CXHK 3OXRA 1INEH 3ARGC 1Q0XH 4OZGB 4WUUD 4EBQL 1UB5A 4S2SB 1XGYL 2J4WL 2HG5A 1DBAH 4XCCL 3MA7B 4K7PX 2PETA 1NEZA 5DMGD 1CF8H 3OV6A 5DEZA 1Y18B 3PWUA 2F19H 1RSFA 4P2QB 5IHZA 4JDTH 4U6VH 3LRHA 1MCPH 1WWCA 4HUVB 4U7SA 5C70A 1J9CT 1T1YA 5EU3A 2F5AL 3GKWL 4UINL 2O26U 4PV9B 3CFJA 3DXAD 1KIPA 1I8MB 4LCIL 3F62A 3OF6D 2XN9D 1OY3B 1R0AL 3KPNA 1RVFH 2GHWB 3G6JB 4OFIA 3RHWK 1FNAA 5F1SA 2BY0A 4RMTA 4R9HA 4U3CA 1I1FA 1HHIB 1H3XA 2BX5A 3WO4B 3UTSB 1FIEA 2R1WA 1HOCB 5E99L 4KWUA 5DS8A 2EDLA 2QQLH 1AD0A 4JGUA 4ZAKA 3GSVB 3HC4L 4JG1H 3OBAA 3MJ6A 4KY1L 5I73C 4MXVE 4NKIH 5KW9H 4JREB 2NXYC 1ZE3C 4MD0B 4KJWC 5J1AB 3BRDA 1NCCL 4QHNA 4LQ1A 1N5AA 1CGVA 1CR9H 1JPTL 2BOCB 2EXYD 3D87B 5JMRA 3L95B 4Z0XA 1LWRA 5MEQA 1AXTL 2YMXL 4L3EA 5EN2A 2VZ3A 1SBBA 1NGYB 5T1LD 1J1PL 8CGTA 1P4IL 3JWDC 4WEBH 2X70B 3FJTA 2HH0L 3TBWA 5CILH 3KYKL 4PJXA 3S5LG 4NQEB 4KHTL 1MIMH 5DD3L 3WN5A 4EUPA 1DJSA 5B22A 2EZ0C 4JQIH 2NZ9D 1CGTA 4JM2A 1DQQA 1IGFL 1YEJH 2YD7A 3M17A 5D6DA 4X7SL 1U8PB 1NCWH 1YPZB 1DVFC 1AO7A 3QPQD 3SE4C 2EDHA 4RZCA 1R3IL 1XF4B 3NFPB 2GK0A 3MGOB 3ULVD 3MJ8B 1BZQK 2JB5L 5FOJA 1QG3A 2ADJB 1A6TA 4LKXA 4X98B 4B7IA 4IOIA 2DQUL 2J12B 2ZPKL 1PG7X 1L7IL 5E8NA 4ZPTB 3HMXH 4NSKA 3FCTA 2VR4A 4G42A 5A16A 2F53B 4HUWB 5DRXA 4HIJA 2OZ4L 1UJ3B 1MLBA 1FYTD 3GMMA 3H3PL 4LCWE 4LRNL 3VFNB 4F58L 3GMLB 1GRWA 4FMKA 2AEWA 1R3KB 2FEDC 2XNAA 4P5TB 1MCLA 3ABZA 4NDMB 2Z93B 4DCQA 4RNRA 3RAJH 3V6OC 1KEGH 5F7NC 5EU6A 1EHLL 5LCVL 3H8NA 5C3LD 5F1NA 4U6HA 5LKNA 2E9IA 4JO2H 1ZHLB 2FNBA 3E3QE 4TYUA 5I16B 4CDHA 4YK4C 2VDOH 3CLEL 5L2KD 3U0TB 4KROC 2CD0A 2EDEA 3QI9A 2ICWI 4J12A 2D0FA 2DTML 4UB0L 4M4PA 3SDDB 3PGCA 1K8DB 1SJEB 3C6LC 2QADB 4F8QA 3QEHA 5HGHA 3GBLA 3QAZB 5GGVY 4XP6L 1N0LA 1QSFB 4NQVB 2LU4A 5H94A 3UZVB 4XRCB 4HIHA 4D9LH 4F37F 5CCKH 5FGRA 4YDIL 5GGVH 4CNIA 4ISVA 4HFUH 2X4RB 1DANT 4P46B 1U58A 4F7PA 3C5JA 5CWSA 4LSSH 2AW2A 5TFSL 3VJ6B 1KN2H 3L3HA 3K81A 1OOAA 5FHBH 1HHJB 3BKMH 5KSVA 2LU3A 5JHLL 4C56B 4NN6C 6FABH 5AYQA 4LHUG 3AB0B 5E94A 2ZUUA 1MI5B 1RJZB 3FT4B 4PJFF 3RTQB 3T0XA 2B0SL 4YH6A 5DZNA 3SN6N 3BKYL 4PS4L 3SKNA 4UT7H 4TOYH 3PDDA 3LKRA 2DMBA 2NY5L 1FFPB 4W6WB 5BV7L 3ZMRA 1NBZB 3UJTL 4F80A 4S0SD 3DTXB 4NKMA 4PLKD 3DIFB 4PGJA 2P24A 4MXVF 3MBXH 4MS8D 3EAKA 2XZZA 3DVNB 3F7YA 1YY8A 1HI6A 4IOFC 1FBIH 3F65A 3KPSA 2YUZA 5C86A 3BMVA 1UM5H 3FQUB 3MLXH 1JHKH 1MJJB 4OD2A 5JDSB 2P7TB 1TQCB 2C7UA 3NAAH 5EIVA 5H2BA 1CBVL 3QQ9D 2VXTH 5I30L 2M2DA 1RMFH 2Z4QA 3K80A 3C8DA 4FTVB 3FB6A 3HE7D 4XNUH 1IAII 3UPAA 1T7YA 4WI2A 3U1SL 4PRAB 1A4JA 3O4OC 3RGVA 3VW3H 5BZWB 1Z3GH 4QCIB 3G04B 2RCSH 5F93C 3T0EC 1CICB 4NO0B 3G5VB 3CNKA 1Z6JT 1EEUA 3HG1E 3LDBB 1F5WA 5CJXC 1MCNA 3SDAD 1A1OA 1T4KA 5T1MA 1R5VA 3QDJA 2P5EA 3C60C 1TZGL 4XBEL 4MJ6B 4XAKE 2WMPA 3CMOH 2XTJC 1VGKA 4E41D 3W0WA 4JR9L 1EEQA 1FAIH 1DDHB 4XVTL 4GXUN 3DJ9A 4L4TD 2EC8A 1DEEA 5JLZA 3JVGA 2V17H 4ZOBA 4L1HA 5FM5O 2P8PA 4XC1L 1TQBB 4JY6A 4LSVL 4AK1A 3H42H 3BH8B 1MRCL 3CFEB 1UQSA 3D85D 4MD5A 4IRSC 4FFYH 4ODVH 5DZOA 4AEEA 1MHPH 3NVQA 4JE4B 3BXNA 1T89A 5IW1A 4HWEL 2I9LA 4WFGE 1WBXA 4N0FA 5JOFA 5DJ6B 3IAGC 3K0WA 4I9WD 2CDEA 4WW1A 3MZTA 3MCG1 1FVDA 4HX1A 2VDRL 1YEEH 2VWEC 5CGYD 2AI0H 2VAAA 2PCPA 4LAQL 4PV8A 1K2DA 4FRWA 1HWHB 4GRLA 1P4LA 4MB4A 3L6FB 5CHNB 2OCFD 1BOYA 4JFYB 5T3ZL 2XOTA 1TMCB 4BQCA 1ETZB 4NZJA 4PRHA 4V1DA 5IF0B 1I1AA 1A0QH 3IT8D 3RWEB 1T04B 1G7IA 3UYRL 1AHWB 1SHMA 2WQ8A 3PV6B 3DV4A 3QEUA 3L3OA 4GBXD 4AIOA 4HEPG 3VFUB 3DX9B 1LNUA 5FO9B 4UOW1 4PJ8D 5JO5A 4JLRA 1CE1H 1U93B 3LPFA 4K71C 3OKDA 1KJ2H 1QEWA 4UAOC 3B5GA 1Z2KA 2D2OA 2N7AA 4QOKD 4YDJA 3T1FB 4LHUA 4F7EB 2VISA 3C2AL 4PFEA 4KQ3L 1T6VN 3UTTA 2YKLL 2VTFA 3NOIA 1ZT7A 4YIQA 4S1QH 1HDMA 3T3PE 1CWVA 1HILB 1U8JB 5LG1A 5DHYA 1VHPA 5DUBA 4NKQB 3KYMB 5E8PA 5KSUB 3QJFA 1MAJA 3PGFL 2OTPA 3AFLA 3BUTA 5J89A 5F1KC 1YN7B 4PJDE 1OLLA 1NC2A 3X12B 4I3GA 4JFDA 2G75B 4G8GD 2NR6D 1H3WM 4IIQC 3ARED 4XCFL 1G7QB 3SOBL 4P3CL 3IDXH 2G60H 2E27L 1MHHB 2XICA 1GZQA 2IAMD 1JUFA 4U4BA 5CP7A 2Q8AL 5JW4Q 3EYFB 2HJLA 3ARGB 2JIXD 4XPFL 1DSFH 3LPWA 3C09C 1U8LB 5DD0L 4XPGL 5JPNB 3WFCL 1BD2A 1MJUH 1R3HA 4Q9QH 3P77B 3MBED 5HHME 4MNQD 5DJZB 1NCAH 1KB9K 1MNUH 4I3SL 3L1OL 2A9MH 4RMWA 3I02A 1V3KA 4XHJD 1EERB 2D7PA 2XWTA 1RQ5A 3QNZB 4TPRH 5DQJA 2NW2A 5DRNA 4R8WL 2GW5A 4OLVH 3AM8A 2H8PB 2P42B 3TBVA 3QHFH 3KJ4C 1QLEL 1GC1C 3WL9B 3C5ZB 2FD6L 5I75B 1T2QL 3JTTB 5FKPA 1Y6NR 4APQD 1FL5B 4PJ9D 1G9MH 1Q0XL 3MR9B 1HCFX 5E5UB 4XMKL 1PKQB 2ICWJ 4BYHA 1DBAL 3P4NA 5E6ID 3VFMA 1JWMB 1N5YH 2A74A 3KDMA 5INCB 1XR8B 1XF3A 2F19L 1BIIA 6CGTA 4U6VL 4LNRB 4X6BB 5T3ZD 1WC7B 5EBWB 2APVA 4N8CH 4BSVB 2LABA 2OS7A 4KDVA 4P2RE 1JZ3A 1XF1A 4EQ2A 4I18A 2EH8H 5ENWB 5I73B 3QFDB 1D5MB 3DYPA 3PIQB 3HI6L 4PJBB 5FUCE 1JIBA 5HYSA 2FJHA 3DOSA 3IXTB 4Z6AT 2HMID 1ULVA 2NYYD 5C0CB 3EJZC 4B0MM 1BHGA 1MJ7H 5LQBL 1K3ZA 4JFOB 2VDQH 1HH6A 3V95A 4UIKL 5DI8A 4HGWA 3HZYB 1MJ8H 1I4FA 1ZANH 5KVDH 1GYAA 2HTLC 5EWIH 5BXFB 4KKBC 3RDTC 2C1PB 3SBWC 5J6HA 5AD0A 4YHIB 4JG1L 4UQ2B 1OTUD 4JPVH 3RVXC 1DVFB 4LQFH 2YPLD 4TULH 5C6PB 5KZCB 3MRBA 5EO1A 5KW9L 2OL3H 1WISA 4XGZB 3HLAB 2WZPD 2FB4L 3ARBD 1KYOK 4U2YA 3F6IA 1A7NH 1CR9L 3FO1A 4PD4J 2W65B 1MF2L 1QPXA 2DB8A 1XIWC 2EE2A 1PSKH 3HE6D 1CE6B 3MRGA 1H3VA 3AUVA 2IANE 3ETBF 4ZDHA 2FGWL 1RZGB 4WEBL 3EGSA 3IDGA 5ACZA 5CILL 1CK0L 4PJAA 4EI5B 4DKDC 4OCLC 2X4TA 5C0DA 4JQIL 1KNOB 4OGXH 4UOW0 3HB3D 5T33H 4WY7L 3GJFH 2Y9RT 4HUKB 4WTZG 3RVVD 4GO6B 3TYGH 1WT5A 1YEJL 4XXDB 5J9PA 3OJDB 3WD5H 5AZEH 1IAIH 2ZNXA 3GRWA 4FQCH 4UILL 3W39A 2XWJA 2MKLC 4DWHA 3QUYA 1FAKT 2Q8BH 4PJDF 1EIBA 4L8BA 1U9KA 4M6MH 4I48A 3Q2CA 4JVUA 2R1YB 4JO4H 5T1KD 4YDKH 3QIUB 1Q0YH 4RMQA 4KK9D 4YK4B 3V4PH 3L5WA 4KROB 1QFOA 4Q6IA 1A9BA 3O11A 4DGYL 1U3ZA 3SQOL 5FKAB 1C5DA 3LS5H 4GS7B 2L4OA 2OSLA 1BQSA 2DWDA 1F4XH 2DI8A 4WHTA 4X7TA 2X4QB 4L9DA 5L8LB 2EE9A 5DGRA 3MYZA 2XFXB 3VCLA 2VLRD 3VGDA 3PWPD 4HS3A 1FNSH 3RAJL 1OAUH 2FEEI 3DVIA 4IDJH 4P23D 4G6AC 1KEGL 3UCRA 2VR5A 5D7KE 4R97C 3QJHB 4PRPD 3EYQC 4KI1A 4OSUH 4K55A 4P9HL 4XZUB 5GGSY 1JTTA 4IRJC 3WCYA 1G9EA 3IDJA 3BP7B 4U1NB 1ZLUH 2X89A 3BP5A 2GAZB 5E24E 2ZCHL 1BJMA 5K9QI 4Y19A 3E6HA 1EAJA 1JI1A 3PL6D 3ULSA 5LVEA 4I0PD 1OM3H 1SJXA 5E00B 4DUWA 4I3RH 5BS0E 5DUML 5EO9B 3VXOB 1F6LL 3EJYD 4FZEH 2XG4A 5IHLB 1JNLL 1CGWA 3W9EA 4BQ6A 4D9LL 5CCKL 3NZ8A 2EXWD 4N9OB 3U48A 2CDGA 5GGVL 3WFDH 5T5NF 3TC9A 5F96H 3VXRD 4HFUL 1HKFA 1UXWA 2BC4B 3DV6B 1U8MA 2HT2C 5SWZD 1DQMH 4POZC 4PJFB 3MV01 2DQGH 3S4SB 1KN2L 3FB7A 2X4NB 3I6KA 3TO2A 4Y4KA 4ZUTA 1R5WA 4ZXBB 3IJHB 2DD8H 4MMXC 4XI5D 3P9WB 1MHCA 5GGTL 4LRIC 4DTGH 2BK8A 2NTFB 5F9OL 4RBPH 3RPIB 2HLAA 4H20H 4H25B 2DYPA 1QFHA 1L9NA 2BVPA 2FO1A 1BQUA 2H3NB 4FFVC 4KK5D 3W5NA 1K4CA 3O4OB 4P2OA 4HKBA 4UV7H 3MNWB 1FVEB 3BUYA 1ITBB 2J88H 2DTSA 3MBXL 1BBJA 3SKMB 5EOTB 4Z0BH 1J05A 1FBIL 1I85C 3DLQR 1UM5L 4J4PA 1TCRA 3MLXL 1H3UA 4MA8L 3FN9A 4JKPH 2RFXA 2ITCA 1KTLB 3DGGB 2ZNWA 3BE1H 2A73B 4AH2B 3LV3B 3NAAL 4NZRH 3FFCA 3SJVB 2XTJB 3QO0A 5ISZA 4XNUL 4NN7B 4NZDA 3VFWB 3PQYE 4X4XB 1AKJB 2FJGB 3VXSA 1IKFH 2MCPH 4HDIA 4ORGA 3KLHC 3O9WD 5A2KH 3RJQB 3VW3L 4H5SB 2C4XA 3ARFA 4HQQL 3PF2A 4KUCD 1IAOA 1LO2L 1Z3GL 3VFOB 4FXLA 4OFYD 3CFCH 1FP5A 12E8H 4G7VH 1JL8A 1NDGB 1XR9B 4BQBA 1CVRA 4OUOA 2JJTC 4OBRA 1BQLL 1EGJH 1VKXB 2BNRB 3FQWA 4JHWL 4MQXC 4M1DL 4LCWB 3CDFA 3CMOL 3LIZH 4HG4J 1OAYH 43CAB 1QRKA 4LCYA 4DZ8A 2W0PA 4NBZB 5IG7A 2G5BA 1RZJH 3HS0B 3REWA 3O0RH 3IRZA 4OF8A 2V17L 3RRQA 1AXSB 4F2MB 1Q94A 2JJWA 4BK4A 3MRFA 4EOWH 4G9FE 4FFYL 4N0YL 1T0NA 4ODVL 3NPZB 1FL6A 4FQJH 1UWEL 2OTUA 3H7BB 4KI5F 2D31B 5FFLA 5DK2A 4LLAA 1Y0LA 3TZVC 5F7YC 3VGFA 4RAUB 2A83A 1FQ9C 3TF7C 3JV6B 1YEEL 1FNGB 4K71B 2AI0L 4KMTH 2O5XH 4XH2A 1C08B 2EYRB 3NTCH 5C08D 1DFBH 1KGCE 4NC2B 3TT3H 3WS6A 4UAOB 2DI7A 4JRWA 1T03H 2BDNH 3MOAH 5IJVA 5I1GH 4LSPH 3WYRA 4KI5C 1N6QH 3DMMD 5JR1H 3ECBA 3ROLB 2DQIH 1OQXA 4NQDE 4S1DD 1K8IB 3QO1A 3GSQB 5D93C 5KG9B 4QXTB 2IADB 3MRMA 1FNHA 2VSCA 2A38A 2UVFA 2GJZB 1HQRA 1IEAA 1Z9OA 1J8HD 4JKLA 3FQXA 4JZJB 4XBGB 5C2BH 4IIQB 5DT1H 1D5BA 5B39G 1S7XB 3TCLB 1CE1L 2VQUA 2HAZA 5DQ9A 1KJ2L 1J5OH 1U41A 3TVMC 2V5MA 4JRYE 1KIRA 5CD5C 3IDNA 2GTZB 4WUUE 2P8LA 3C09B 4XPBH 3MLPA 1GHFH 1I3UA 4M62H 2VXSL 4WU7A 2Z91A 3GSNA 3IDUA 1RURH 5HGGS 3QUZC 4S1QL 1U3HC 4HWUA 4MXQD 3DSFH 2IPKB 3FRUA 3QIBC 1MFAL 4PG9A 2IH1A 4HLJA 4NT6A 1DN0B 2EDQA 5IMKB 4JCMA 3P9MB 5IWLC 3DXAE 2FJFA 3VI3E 3LCYA 2ZSWA 3QWQB 4ZOCA 2X4OA 2HN7B 3OAUH 5MI0C 1YNTB 1LP9F 1G6VK 2EICA 2ESVA 5FB8B 3GIZH 5D5MA 4DEPC 5JHDB 4HS6A 1DTUA 3DVGA 2DQHH 5ICXA 3B83A 3HG1B 5FYKU 3O45A 1MJUL 1G7JB 3ULUF 5ACLA 3BGMA 4GW1A 1KENH 5HVHC 1KELL 2A9ML 5FV1L 5HHVL 2GJ6D 3CUPB 2N4IA 3QDMA 4TPRL 1B0RA 2H6PB 3QISA 5HPMB 2P5WE 4Y4KD 2X1QA 2R2EA 1WAAA 4Y0GA 4OZHA 2AEPL 4R4BB 4ZS6C 3U9PH 1TTFA 1UACH 3MUJA 4NBXB 2DYPD 2GSGA 3D3VE 4NOBA 1IILE 3ULUC 1TZHA 4U1KA 2FSEB 1OT1A 3BQUC 2AJVH 3AMKA 1HSAA 4X6DA 3SY0B 1CGUA 3RDTB 2A6DA 5I17B 5JW5A 5DJAB 2V7NA 1NANI 4XMLL 1T7ZA 1NL0L 5DC0A 2BNQA 1KT2A 4N8CL 4D9RE 2DWEA 3FQRB 1CXEA 2EH8L 3BP6B 3QCUH 1NCBL 3LMJH 5I8EA 3ULVE 3NZHL 4KU1A 3JXAA 2G2RB 2AGJL 4W68A 1N3NB 1RJLA 1PEWA 3O2WH 3K2UH 1XIWB 4NQSA 4LLDA 2VDQL 1ZEAH 3U9UA 3LN5A 4WW2A 3IFNH 3BVNB 3PP3K 3VXUA 1QA9A 1NFKA 1I7UA 5C1MB 4ELMA 1AD9B 5ISZD 1MJ8L 1ZANL 3X3GL 1MIEH 3QXTA 1LEIB 3MMEA 5F88B 4HBCL 5KS9E 3GSNL 2BOBA 4YWGL 5A40E 3GZKA 1FYTE 5DA0B 5EOCJ 3UBXB 1ZK9A 5F1IA 4JFXA 2OR7A 4LQFL 2VLKA 3ALXA 4OLWL 4TULL 5HYJD 5C7XH 3OJVC 3LSOA 3DX8A 2OL3L 1F45A 3HZMA 4TQEH 3U6RB 2QSCL 3K2MC 1MSPA 3KPRD 1YNLH 5CAYB 5CSBA 4HK3N 1AGBB 1XGPB 3AAZA 4Y5YA 2G9HB 2IFGA 5DHVA 5F9JB 5JZ7D 4QRTB 1JPFA 3FQNB 3N1GC 5D1XB 4XVSH 1N2RB 4H1LA 4PRBA 2YPKB 3VA6A 1DUZB 4M8QA 3OX8A 3MLTB 3K4ZA 5T33L 2UUDH 4Q9CA 2KL6A 2AQ3A 4JGJA 3HNSL 2HRLA 4PJDB 5I15H 1RI8A 3DHMA 5F97E 3TIEB 2WUCH 3PWNB 3QDGA 1IAIL 2BJMH 4QRRA 4KKAD 3IDIB 4JRXD 1YZZA 3DX7B 3MCLH 2CKBB 4AEIH 3HZKA 1Q9WA 1FJ1B 4JFHD 4JANA 3KPLB 3L5XL 2JE8A 4DW2H 2YS4A 2WIIB 1FNFA 4JO4L 1OTSC 4YDKL 1D9KA 1W72B 3HPLB 3V4PL 3VRJB 1QSED 3ZDXE 4GUPA 2D0HA 4CW1A 1T80A 1DR9A 5SWQA 3LS5L 5C0GA 5A3ID 2VB5A 4R90H 2ATKB 2BVEA 1A2YB 5IBUG 8FABB 4M7LH 1ZHBB 4U05A 2VL5B 4NGHH 3V6BR 2V2WB 1HHHB 5J0BA 1MREH 1WTLA 1ZLVK 2XRAL 1KCUH 4G6JH 3TV3L 1FNSL 4O4YH 3STZB 3SDXA 5L2JA 3NCYP 4IDJL 4FOMA 3UTPD 2X7LA 4KRPC 4LLYA 4M5YH 4OSUL 3JUYA 5DJXB 3CVIH 1AGDA 5KSBE 3MGTB 4PJ5A 2FZ3A 5IJKC 3GMRA 4YQXH 4QHLB 3QXUA 4DOHB 3BT2H 3F7QA 2F8VA 4K9EL 3TA3B 4F9PA 2XIDA 4B5EA 4RGOH 2R8SH 5M94B 4BH7B 1A6WL 5JIKA 2DQFA 4IMLB 3LQAC 5CSZB 4P2RB 4XNMA 4GW5A 3B6SA 4I3RL 5GISH 1RHHA 4FQXD 4FZEL 3NMEA 2PW1B 1HNFA 1HNGA 4PP2B 5DO2C 1D5IH 2QQNL 5J06A 4XP4L 3WFDL 5C0RH 5F96L 5I1CH 3FKUS 4YJZL 2EYSB 1ZVSB 4RA0C 5ALBH 5D96B 1DQML 4KVCH 5J13C 2DQGL 2AQ2A 4YBQD 3GB7B 5SWSD 3OGCA 3B5TA 2DD8L 3OSKA 4OFPA 3ZYZA 1SYVA 5IQ7L 3FB5B 1Q9OB 3IXAA 5MENA 5FEBA 1OW0A 4H20L 2AKRA 4E41E 4NNXB 1UM6H 1Z9SA 4GG8A 4PGBB 3GGWA 1GPOH 3LAFA 4UV7L 1A14H 3MFFA 1RU9H 3S35H 2FYYA 4R7DB 3KXFD 4Z0BL 5C0IA 2IANB 2EDWA 3RY6C 4CVUA 2VRAA 2ADGA 1KTRL 5CIPB 7CGTA 4PBVC 1EO7A 1KCVH 5F7LB 2HVJB 3UZEA 4HKZA 2X1PA 2Q7YB 5HDQL 4L3EE 4PRDB 2NX5A 2GT9B 2EDDA 5JTWA 3U7WH 2JF1A 3FB8B 2QV2A 5T1DH 4S1RL 4Q97A 3BW9B 4R4ND 1IKFL 2MCPL 2PO6B 4PJXE 1ZT4B 5EH1A 2R69H 4YXLH 4MAYD 4KK8D 5K9OB 2W9LA 4OFVA 1QSZA 4N90D 5JXAH 3VXMD 4NQCB 3CFKB 3H9HA 4ZG1A 5HY9B 5E08H 12E8L 4D3CL 5HGAB 4LLQA 4G7VL 1ORQA 5DEFB 3CGTA 4HT1H 1AO7E 5F3BA 1ITCA 2FX8H 1RK1A 4JPWH 3BHBA 1TETH 3CVHA 1EGJL 1H3GA 2O61A 1XGQA 2ZOKA 3ZDXF 3TZVB 3OZ9L 4PJIA 4K3JH 3Q0HA 5HXMA 4DQOL 3PNWA 1DBKL 3M07A 3LIZL 3KLDA 4LLUA 1GAFL 1D5ZB 1KF9B 5CFHA 1S9XB 1PZ5A 2ZUXA 1RZJL 3LEXA 3O0RL 1IQDA 3GSUA 3AC0A 3TWCH 1B3JA 5JOPD 3GIVA 3L7FB 2NY4B 4ZQKB 1QRNB 1JK8B 5F7WC 5D1QD 5D93B 3RWJB 4FQJL 4HH9B 3WMSA 5FM8A 1KCLA 1NANH 1MCRA 3U0WH 1RPQA 3EYOB 4D0DB 2GUOA 1ZLWK 1SM3H 4PB9L 2BMKA 1UEYA 2EO9A 3PP4H 3K8LA 3FQTA 2DLGA 2RQ8A 4M7LT 4KMTL 2O5XL 3B9KA 1INQB 3CSYB 2Z8SA 5E8EA 1TJGL 5F70A 2R0ZH 3TVMB 1LMKA 3SCMA 1P84J 4ODHL 5K9KB 3TT3L 3U7AA 4P5KA 2X42A 1AC0A 3BKJH 3V0AC 3WNMA 1UZ6E 5IB5B 3MOAL 5I1GL 3OKMB 1F13A 1N6QL 4KXZI 2QHLA 1E0OB 3OJMB 1MCOH 2DQIL 1S9YA 4Y8DC 1U3HB 3RIAK 4MNQE 3O6LH 1EZVY 1HEZA 1PX4A 1YMMD 5FYLH 3QIBB 4Z77B 2YSSA 3CPLB 3EDDA 2QSTA 5I2IA 3VGGA 1P9MA 1HZHL 2Z31C 4NRXA 5ETUA 3MRCA 4U33A 3SKJL 5I0DA 1S7UA 1RJYA 4P2QD 5I1IL 5GRUL 1A3RH 1J5OL 2GY7B 4NNPL 4DEPB 1A21A 5EFIB 1WFUA 3MLRH 3P9LA 4XPBL 3TN0A 4U0RC 4QGYA 3TBSB 4M62L 5A2LH 3HUJE 1MHEA 2RB8A 2Z8VC 3DSFL 5T3ZE 5HVHB 3V52L 2HJFA 1G6RA 2NLJA 1GOGA 1LP9B 3NIGE 2A6IA 3VE0A 5I66B 1J12A 4P0DA 3TFKC 4YBHA 3UTSD 3KPTA 3OAUL 2J2ZA 1BBDH 3I3DA 2Y5EA 5I18H 1H0DB 1E27A 1JMXA 1NBVH 1PW3A 1CLCA 1PZUB 4MA3B 4ZAKC 2IPUK 4AL8H 3CLFH 3MLYL 4GFTB 2CLRA 4PJXF 5TPWH 3FT3A 4GG6E 3BQUB 3DRTA 1G9NL 1EEZA 2DQHL 3FHQA 4JM2F 5AYUL 3F12B 3RVTD 4F3FB 5D7JA 4N0UB 3VXPB 1FO0A 2IPUG 1N59A 3QULB 3UBXI 3IU3B 1R3LA 3RWGA 3VGAB 2E5EA 2H2PD 2ORBH 1QTYT 4IS6B 3PDOB 1KPUB 5C0EB 2UVEA 5HI5C 2DM2A 4NQED 5MHSD 3O6MH 1WQVT 5E2WL 1KXQE 3QP3A 5FYKL 3ORJA 3V2AR 3U4BL 3GI8L 1M05A 1RIUH 5D6DC 3U9PL 1V7NH 1UACL 4ODUB 2X9XA 4KVNH 3WFEL 4LU5H 3W0WE 2AJVL 1PG7W 4MJ2A 5C6TL 3LKOA 4O51B 1J87A 3NH7H 1WLHA 3QWRD 4RX4A 1X5GA 3UTQA 5E7BA 1UWGH 1I3VA 2MPAL 2QSQA 1FZKA 1DQDH 2JJSA 3MV7B 3QCUL 4DZBB 3LMJL 5KN5A 3DUSB 2F53D 3H0TA 4ONFH 1IRAY 5FK9B 1EUTA 5FO7A 2VMFA 4DAGH 3O2WL 4X9IA 3K2UL 4F7MA 5HI3C 4HK0B 4BFIA 3IFNL 4X4MA 4N8VA 1JNHB 4P5TD 1JWSA 2MWCA 5KVGH 1Z0NA 1I1YA 4I8DA 3U4EB 1JF6A 4BK5A 1XGUA 1BF8A 1MIEL 1U8HA 3MJ9H 3WLWC 1XH3A 4ZUWA 3RWDA 1Q1JH 2GCYB 2IFFH 4JDZA 4KQ4L 2J6EH 4L4JA 4OGYH 1G0YR 5EOCL 1G6RL 2VLRE 5IFHL 1GVIA 2C3VB 3PWPE 5C7XL 2AS5M 3EHBD 3QI9C 2EEDA 3N06B 3SDDD 4HIEB 4RWYH 4HEME 4XWGH 4AQOA 3JWNC 5BJTB 2QADD 3A67H 4CN4A 3WIFA 4XNYH 3QNXA 1KXTB 3P4MA 1YNLL 4WUUB 5A2FA 5IOPB 1F4WH 1G7HA 1QSFD 3CDCA 1LVEA 4XVSL 1J0YA 1UJTA 1EHNA 4P46D 1UYWH 2D7OA 4O2FB 4PJCB 3VFSA 4GXUM 5I15L 1BZ9B 5GZNC 1JNNH 2DLTA 1XMWA 4MQSB 4OF7A 2WUCL 4C56D 2DLIA 2YZ1A 3L3JA 3L3DB 3OB0H 4Y2OA 5FECB 4Z18A 3NIGF 3RTQD 1NSNH 3VXRE 4AEIL 3MUGB 3TCXA 3BPCB 4K8RL 5EB9A 5CGTA 5SWZE 5DJ2B 5IVZA 3KLAA 3Q3GB 4CMHC 2XY1A 2BVQA 3VDBA 2FL5A 4HK3J 5I1LA 1KTKE 5FYKD 2F8XC 1A3LH 1KTDA 2ZJSH 4XP1H 1PJ9A 5HDBF 4M7LL 5IB1A 1TJHL 3ZKMC 4H0IA 5C0JB 3BKCH 1LEKB 4E0RB 1NGPL 4YFEA 1GXEA 1WFNA 1U92A 3QZWB 1F58H 1FG9C 4PJ7A 4M7ZC 2P5WB 2VN7A 1VCAA 3LB6C 5DMKA 4HS8H 5BQ7A 2WAHA 2CLVA 2ZKHH 1F02I 3TJEH 1JGVL 2SEBB 4KV5E 1I7ZA 1QO3A 2AJSH 4FTVD 1E4WH 2PYFB 3KJ6H 5J13B 3D3VB 4NQXB 2JCCA 3B43A 4YQXL 3P4OB 3SO3C 4AM0B 3HMXA 3NCFB 5CINL 4YLQT 4WO4A 3MRJB 3TBYB 1U8QA 4F9LA 4X5WA 2R8SL 1NUFA 3RGVC 2R9HD 3CAFA 3O2VH 3SE4A 1CN4A 5IVXE 1A6PA 3B4NA 4LHQB 1CICD 4NO0D 4I5BB 5GISL 2QHRL 1MCDA 1D5IL 1ADQH 4LBEB 2DLHA 3KLSA 1LEGB 4P57A 5F9WB 1IC4L 4P4RB 4CMMA 2DM4A 4NJAH 3HR5B 5K59E 2V2TA 1I3RB 5ALBL 4ZUSB 2IEPA 1CI5A 4KVCL 4KXZH 1PY4A 4GOSA 3WNLA 2R39A 3D2UB 4L8SC 3ARWA 3JVGC 3L9RB 4XWOD 1JMZA 5IK3B 5TQ0H 5TJWK 2ATPA 4OZFG 4X9BA 1AIFB 3O3DB 3K4DA 3ILQD 3RI5K 1FFRA 1J0HA 5ESAB 1LGVA 3BWAB 4F8TA 3FZUD 1E6JH 1EVUA 1QR1A 4QRSB 4P5MA 1A14L 1A6UH 3S35L 2E6QA 4ALAH 1LK3H 5E8OB 1KJVB 4Z9KB 3X13A 5D2LA 4KDWA 3D0LB 5CJOH 1H5BC 5C8JA 3C6LA 2IALB 1T21A 3NA9H 4OBSA 1EDQA 1KCVL 1HXMA 1T1WB 4L3CB 3QRGH 4GRLC 1X6NA 2PTTA 4X0KB 1FZOB 5L8JB 1CG9A 3W9DB 1OD9A 3U7WL 1BLNB 4QLRA 1QPPA 4RFOH 2ED9A 1I1AC 4QHUB 3D39B 4LPWA 1ZT1A 4F57L 5C08E 3S37X 3K1DA 3MJ7A 4PJAE 5D7LA 1M7DB 5GGUB 1CFBA 5DEGB 4YXLL 4WI9A 2BHUA 3V5HA 2XKUA 2OR8A 1ZHNA 5JXAL 1Q8MA 1RZKH 3K4AA 5E08L 2V2XA 3AY4A 3JWDL 3HFMH 3LKQB 4HT1L 1HCVA 3RU8L 3ZO0A 2FX8L 4U1MA 4JPWL 2WP3T 4Y1AA 4R0LC 1TETL 4LFHD 2OJEA 4HULB 2R56H 3KNBB 3B5HA 2XQBH 3A6CH 1J8HE 3EO1A 3FL7A 4K3JL 5HYQB 5IIEB 5EBLB 4FQHB 4R6UA 1FLTX 2NY2C 3VWJB 3IJYA 4GKSA 4N9GA 1ZVYA 3SE3C 4HW6A 5D70H 3JTSB 4XTRD 1HXYA 3RWIA 2R1XB 4POUB 1X3DA 3IJSB 5HHOB 3T4AB 3JUZA 2I07A 5SX5H 1QSVA 2WWMD 1I8IB 5KBNC 4HIXH 3TWCL 4GAJH 4QT5B 2FH6A 4Y4HB 3RFZC 1FN4A 4OJFL 2DAVA 4KDTA 5CS7A 2OLDA 5B38G 2MQ3A 5TQ2H 4OQ1A 2CRZA 3ARGD 2VJXA 3MREA 3OXRB 3U0WL 3OGOE 4O2EA 3MRPA 1S7VA 4IJ3B 2HG5B 2R23A 1SM3L 5CLWA 3PP4L 1NEZB 2Q7NA 4S11A 1I9JL 1W0YT 5IVXF 3PWUB 2IBGA 5FCUL 2R0ZL 4Y19E 1IGCL 5IHZB 4L8DA 3T0EA 1EHAA 4DKFL 1F00I 4PJEE 1YQVH 1QBBA 4N68A 3RP1A 3LKNA 5JQ6L 1QNZL 1W72H 2J8UA 2YD6A 4G7YH 4XX1E 4U0RB 1CD1A 1T1YB 5EU3B 5CJXA 4KJYA 1RUPH 1O0VA 1ACYH 1KIPB 1MCOL 3AM8C 4K7PY 3SDCC 3C60A 3C5ZD 5K59F 3O6LL 3WNOA 1IFHL 2P4AB 4OIIL 4LEXL 3KPNB 3WHE1 4K7PH 5GRYA 2HFFA 5EZOL 3MFGB 1WZ1H 1E4XI 1I1FB 1NFDA 1TVDA 3KR3H 1YYLH 3T2PA 5F6IC 3WE6A 1L4IA 4PB0L 4PY8I 4FP8H 2R1WB 3O41A 2C3XA 2XZCH 3FAXA 4I13B 3O6FC 1IEBA 5DS8B 1MWAA 1AD0B 4ZAKB 5SV3A 1A4KA 3HC0A 4IRSA 4NRZB 2IBBA 5KTEL 4KJWD 3CH1A 5C0CD 4OZFA 3GJFK 4O02H 3RWCA 4YEFA 4Z7WA 1JZ5A 4QHNB 1N5AB 3DUUA 4Z0XB 5MEQB 4L3EB 5EN2B 4TRPH 4IEFB 3H9YA 5C3TA 1MRDH 1ZTXH 1N8ZA 3TBWB 4QEGA 4PJXB 4YXKH 1BBDL 3WN5B 1MFEH 1WJ3A 4EUPB 4YNYA 4JM2B 1DQQB 2PXYA 5F72S 3M17B 2X1OA 1DVFD 4PJAF 5TPWL 1V8HA 5KZCD 5ISZE 4NPYA 2YBRA 2XXCB 4YEEA 1AO7B 2W0FA 5F1OB 3IKKA 3EBAA 4RZCB 4Y88A 4C83A 4ZTPH 3BWUC 1KLUA 1TPXB 3RUGA 2GK0B 3MV8A 1NMAH 1A6TB 4J1UA 4LKXB 4KUZH 4IOIB 5HYJE 5CJQH 2ORBL 1F4YH 2B4CC 5E8NB 1TTGA 3EO9H 2HT3C 4HZAA 4NSKB 5ELIA 3FCTB 3GMNA 4EI5D 3O6ML 4G42B 5A16B 1KPRB 1ZAGA 4JDVA 3KPRE 4IRZH 1ZLUK 5DRXB 5C9JA 4HIJB 4WIQA 4Y16A 1MLBB 3GMPA 3GMMB 4FFWC 1RIUL 2FEDD 1XAUA 4G8IA 2J5LC 1BVZA 3FN0H 1PQZA 2XNAB 5CIPH 2ITDA 4DCQB 2CK2A 1IC7H 4RNRB 3TYFA 2V5RA 3P0GB 4A6YA 4NCDA 2MCG1 4I4WA 4PGEA 5EU6B 1A9EA 1NC4A 2NY3C 2Z9TA 1PG7H 2P49B 3NH7L 3QIUD 4U6HB 5F1NB 3S97C 3CU1A 1T0PB 4HXBH 4KROD 1UWGL 1EH9A 2JELH 4Q6IC 4JRXE 4WTXA 3QI9B 1AQKL 4ONFL 2IAMB 3ELAT 3PGCB 5DJYA 2MOVA 5FYLD 1B88A 5K9JL 4H88H 4DAGL 3QEHB 4U2ZA 3SKUD 1IE5A 5HGHB 1RK0A 3I75A 1WVZA 4WJ5A 5DMJB 3GO1L 5B38A 1MWAL 3CD4A 4MCZA 2C1OA 5KVGL 4OLXH 3MBEB 2ARJA 5H94B 1ZSDA 4HIHB 4EIGB 4RBPK 5I1AA 1RAMA 4GMSL 1PDKA 3MJ9L 2VNCA 2YPVH 4ISVB 4CNIB 3OHXA 1BFVH 1U58B 3D9AH 1Q1JL 4F7PB 3C5JB 2IFFL 5CWSB 2J6EL 1MCJA 2DF3A 4OGYL 2AK4A 1B90A 3Q48A 4PG2C 4LF3A 5KSVB 4GKOA 3MQIA 4XWGL 4KH2A 5E94B 3UTPE 4HWZA 3DBXA 4OT1H 4BZYA 1U95A 3R8BB 4XNYL 3SKNB 2BHZA 3BYTA 2RGSA 4CMHB 1RHFA 1LO5A 3LKRB 1SBSH 1F4WL 2WUBH 5E2TL 5AAWA 3T4YA 2VOTA 2APBA 3WHE0 3VDCA 4OCXL 1TVBA 3RVWC 4PY7A 4NKMB 4QF1A 2P24B 3JBG7 3C6SA 4IOFD 3F7YB 1YY8B 1J7VR 4LP4A 1HI6B 4OQTH 3KPSB 1JNNL 4HWBH 3HKFA 4C4KO 4LVOC 5ITBH 4ZXBD 3LHPL 3R1GH 4M7ZB 4OD2B 1X4XA 4EDXA 3VDAA 3DO7A 2C7UB 2ARJQ 3IGAA 3QEQA 5H2BB 1RZ7H 2Z4QB 4LMQI 2VXUH 3PE9A 3FB6B 2IC2A 1QHPA 5SWSE 4LVHC 2E7CA 1A4JB 1HYSC 3SBWA 3IKCA 4L1DA 1S8DA 1O5DT 4P2OC 2F54A 3RGVB 2APXA 3MRLB 2ESVE 4XP1L 4KKLC 4LDOB 4UTBH 4BELD 3QUKA 2BSSA 4HG4K 5D5ME 3PGDA 1KJMA 3BKCL 4J4PC 2ICCA 4EXPX 2J1KA 1P69B 2YD3A 4HS8L 1YYMH 1A1OB 3BDYH 3T09A 5T1MB 2ZKHL 1R5VB 3QDJB 2P5EB 4GRMA 1FSKB 2AJSL 1OAZH 3SJVD 2XTJD 2OP4H 2DMCA 3DNKA 1VGKB 3BEWA 5C71A 3G5XA 3W0WB 5D6CA 5I9QC 1AKJD 5EOQL 2BCKA 3UX9B 4YDLB 1CIUA 3L3IA 1DEEB 2WBKA 5JLZB 5BRZA 3ZHLA 1WAAE 3RIFF 3ARFC 3RZWA 3O2VL 1H3PH 3MOQA 4TVPL 1XCTA 2P8PB 4I2XA 4YHNA 2K7PA 4JY6B 5K33A 1SVCP 1XF2A 1KIUA 1UQSB 1C5BH 4MD5B 2BNRD 1ADQL 1GC1L 2ZZUT 4YHOL 3BXNB 3DROA 3NABL 4N90E 3VXME 5IW1B 2I9LB 4LCWD 1WBXB 4N0FB 4NJAL 5JOFB 3EO0A 5ANME 2CDEB 1QUNA 3GSOA 4WW1B 3ULUH 1FVDB 4HX1B 1N64H 2MQCA 3U4AA 4J3XA 3G5ZA 5F7KC 2VAAB 2PCPB 4PV8B 1ZS8A 1K2DB 1MAMH 4K2UH 4KK6C 2FRGP 4AG4H 1H8SA 3RNKA 3NIDE 4Z7OE 4GRLB 3OKYA 1P4LB 5TQ0L 1FNLA 4Y5XC 3VXUE 4RAHA 1JGEA 4PRHB 4V1DB 1I1AB 3MLUH 4ELME 7FABH 2W92A 2Y6SD 3VH8G 3VRLE 1PGRB 4IM8A 1E6JL 4PY8J 1KOAA 4IRJA 1G7IB 3DV4B 2P47B 4PLJC 4Z7VE 3QEUB 3SE8H 1LK3L 3L3OB 3AS0A 5F44A 1EMTH 4CN6A 4AQ1B 1LNUB 1A1MA 2H41A 5JO5B 3WLBA 4JLRB 4PJGE 3OKDB 5E95B 2PKDA 1QEWB 4JGMA 3LEVL 5FGSA 4XCYB 3WS6C 4YDJB 4LHUB 2AJXL 4ODSH 2VISB 5KANI 4GXVH 3QBTB 3STLA 4FG6C 1HHKA 4RFOL 1ZT7B 2ICEA 5GRWA 4YIQB 2ZUWA 2BXYA 1HDMB 5E0QA 3IAQA 4NKDA 4JN2A 5DHYB 1I8LA 4TNVK 5DUBB 5E8PB 3QJFB 1U6AH 1NC2B 3V6ZA 4JFDB 3QDGE 1V7MH 2XI9A 2Y5TA 4KZEH 1P2CA 3IFOA 1D6VH 1GZQB 1JUFB 5CP7B 2XQBL 2FHFA 2VQ1A 1AXIB 1WZKA 5AZ2H 2HJLB 2YXMA 5IB3A 4NFDA 1QFUL 4OM1H 5KJRL 1DQTA 3KPOA 3CX5J 4P2QE 1BD2B 3VD5A 1R3HB 5D5MF 1K3IA 1CFSA 2H26A 3I02B 1JRHI 3MPCA 1FLRH 5DQJB 2XWTB 4GAJL 2NW2B 4LPCA 4OCMC 4P4KA 4WI7A 1HHIA 5DRNB 1CFQA 5I1DA 3E1F1 3TBVB 4BKLA 1I7TA 1HOCA 1HH9A 1X7QA 3RKPA 4Z76A 4NFCA 5FKPB 1JCKA 2I60H 4TSAL 5TQ2L 3G6JE 5C0BA 1KXVC 1X5XA 4DJMA 5JHDD 15C8H 2PTUA 4HUUA 2W1NA 1WAAF 3UTSE 3P4NB 4OZHF 4XPHL 2XA8L 3VFMB 4D94A 2B39A 2A74B 3KDMB 5I74C 5FYJU 2CKBL 5F6IB 1XF3B 3S96A 3CJJA 3WFBH 1BIIB 5KAQF 1BPVA 4OIBA 1JYWA 3BZ4A 1NGYA 4X6DF 1YQVL 4U1IA 4XP5H 1W72L 2BZDA 1MY7A 2JJTA 3MCKA 3QXWA 4I18B 2ERJC 4WI3A 5IGXH 2WLZA 4RQQB 1YEIH 1ACYL 1K9TA 2FJHB 3EJZD 5HYSB 1OAXL 4MWFA 3UPCA 2FHCA 1L0XA 1ZA6A 1AE6H 1BEYH 1EO8H 1J10A 1HH6B 3LQAH 3OXSA 4K7PL 5DI8B 4HGWB 2VZSA 4OAWA 1WCQA 2VN4A 3QUXA 1WZ1L 1I4FB 2HTLD 4NQEE 5GHWL 2BHYA 1MCCA 1QLRA 1A22B 4KKBD 3RDTD 3MLVL 4NKOA 1YYLL 4KJPC 4WW2F 5DMIL 4ONGH 4FP8L 4UI2A 1OWRM 2IQ9L 2ADJA 1FE8H 4ELMF 5MENE 5J6HB 5AD0B 4LCCA 4Y4FA 1YPZE 4Q9BA 4JJ5A 4ZUVA 5DQDH 1TFHA 2ZUSA 3MRBB 2R2HA 5EO1B 1A47A 2UUDK 1IAMA 4O02L 1S7TA 3FO1B 1XIWD 3VH8A 2X09A 1MCQA 4TRPL 4WW2C 2FHBA 1BJ8A 3HZVA 3MRGB 3MV9A 4ZDHB 3HPJA 1EA9C 2F53E 3EGSB 5ACZB 1QP1A 4RWHA 2D3VA 3DHJA 4PJAB 4Z7NE 1KLGA 3BD4A 5TE6H 2X4TB 5C0DB 4YHMH 5FHAH 4XVJH 3S36X 4UNTA 4PBWD 4D9QD 2XT1B 2DJSA 1N7MH 1A02N 5J9PB 4HSQA 3W39B 4MX7A 2XWJB 3QUYB 1FG2A 3THMH 1X6LA 1NMCC 4L8BB 4NO3A 4I48B 4EBQH 2PYEA 4MMZC 3P0VL 2EKSA 3DSNA 3CK0H 4XCCH 1FGVL 3L5WB 2EDKA 4Q6IB 4Y5YC 1F4YL 4NQVA 5D1XD 1A9BB 3EO9L 3RKDC 3O11B 1C5DB 1VEPA 3KYOB 1JFQL 2OSLB 4IRZL 4M43H 2F5AH 3PDGA 5DC9B 5I1HL 4PJIE 1WBZA 2DWDB 4UINH 4WHTB 3V0WH 4X7TB 4PLOB 3QUZA 1QSFE 3UO1H 3BJLA 1M4KA 4LCIH 5CEXA 2DBLL 3VCLB 5CJ8A 2VLJA 2X9WA 2PN5A 3QFJA 1FFOA 4G6AD 4HS3B 1R0AH 4LASH 1MI5A 1XEDA 3EYQD 2W60A 4XCEA 4P99A 1IGIH 1PG7L 1OP5H 4OD3H 1N6VA 4HXBL 4PRNA 4C56E 3IDJB 3PG2A 1A7OH 2XKNA 3SDXF 1T6WA 2OQJA 4X99A 2JELL 3BP5B 4IOSD 1S7SA 3G6JF 1B0GA 2D03H 4LKCA 4JFFA 1X9QA 3HC4H 4Y19B 5J7CC 3E6HB 1UA6H 5L8KB 1URLA 4I1NB 3ULSB 4PLKC 3E6FA 4MS8C 4KY1H 5EC1A 4HC1A 5E4EC 4DGVH 1II4E 4YC2C 3QXAA 3RWFA 5BW7A 1NCCH 4OLXL 3W9EB 4I77L 5FYKE 1S9WA 3NZ8B 3FO2A 4TTDC 2CDGB 5EO0A 2HT2D 1UXWB 1KCKA 1KUMA 1J1PH 1U8MB 3D9AL 1P4IH 4POZD 2E7HA 5DUPL 2YC1A 1OAKL 3FB7B 3I6KB 3UTZA 3TO2B 2E7LC 3B8SA 3TA3D 4Y4KB 4ZUTB 5I6XC 1R5WB 2Q86A 3PXHA 1N0XH 4PP1C 3ES6A 2WK2A 4F9PC 1MHCB 3C87A 4FTVE 4OT1L 3GMOA 1IKNC 2HLAB 1AR1C 1CDHA 4P2RD 2DYPB 2DL2A 1D6EA 2BVPB 4HFWA 1CDCA 1R3IH 3QUMA 4FFVD 4LVHB 1SBSL 1LK2A 1K4CB 1CU4H 4P2OB 3DUHA 4KJQC 1I8KA 4HKBB 2C9AA 3SDAC 3BUYB 2DQUH 3UJJH 2BFVH 2ZPKH 1BBJB 1L7IH 4Z95H 2HA1A 2PUQT 1J05B 4MQ7A 3P40A 4AIXA 4NZUH 2DLEA 3CC5A 4MDJA 5ITBL 1UENA 5CUSL 2QQKL 2RFXB 2ITCB 4PLNC 1OGAA 1X5HA 2OZ4H 2AJZA 2QTEA 3C2SA 1ORSA 1NGWA 4V2CB 1OHQA 3EYVA 3O3UN 3FFCB 1OW0C 3DPBA 4KRMB 4Z7NF 3QO0B 1XGTA 5ISZB 4PRIA 2MNUA 1BZ7A 2B8OT 4PTTA 3QQ4A 1OPGH 4K3DH 1EHLH 3VXSB 5GRJH 4HDIB 5L6YH 4ORGB 5FDWA 3GJEA 3ARFB 3CLEH 3E0GA 1IAOB 4XPTH 1VENA 2HFEA 3TGXA 2IAND 4ZODA 3MSPA 1P7QA 3IB4A 1IGTA 4H8WC 4UB0H 1NGQL 5JIHA 1I9IH 1ZA3A 3MRNA 4LPTA 1QBMH 3KPPB 3CZJA 3VFTA 4U7MA 1YYML 3BDYL 3WEXA 4MQXD 3FQWB 3WUWG 5J8OA 4PIRF 4WFFD 1OAZL 2OP4L 5DFVC 3BD3A 3EW3B 3NCJL 2XZQH 1JRHH 2XTLA 2BSTA 1WCBA 4FQ2H 4YDIH 4LCYB 3JV4A 4DZ8B 2KQNA 1IGYA 2PO6D 5IG7B 4PJIF 3X11A 2G5BB 2GQHA 4DFIA 1GH7A 3REWB 1NQBA 3OKLA 4NQCD 5TFSH 5L7XH 1RUML 2VIRA 1K4DA 4GW4A 1Q94B 1MEXH 3MRFB 4LIQL 5IMLA 3SGEI 2OK0H 5D1ZA 1HWGB 1C5BL 3O2DL 4PJ8C 5JOEA 1T0NB 1GGIL 3GM0A 1FL6B 4EUPH 2OTUB 3TZVD 3FO9A 5DK2B 1Y0LB 3K7UA 2EIEA 4NWUL 5BV7H 3QHZH 1QQDA 2A83B 3UJTH 4PGCA 2Y07H 3ULUL 1N64L 1AY1H 1RIHH 3HI5L 5FAAA 5EZIL 1PBYA 2GFBA 5IV2A 4XH2B 5E2VH 4K2UL 2JKXA 4CADA 1CL7I 2BVTA 4KI5D 5IJVB 4XNXH 4X4ME 3WDJA 3GDBA 2H1PH 1M6OA 2NY4D 1QRND 3ECBB 3KPMA 4LGRB 4NO5A 1EK3A 1E4XL 1CBVH 3OTTA 3QO1B 2VZOA 5F71A 5IKCA 4BQ8A 3MRMB 2XPGA 3SE8L 1HQRB 1IEAB 3FQXB 4M5ZL 1EFXA 1D5BB 5I19L 4KKCC 5DQ9B 3TVMD 5IBLD 1L0YA 4ETYA 4F37K 1KIRB 1R3JA 3IDNB 3T2NH 4OZIA 2P8LB 4ODSL 4GXVL 4XHJC 4JZOA 4WU7B 2Z91B 3GSNB 2BVOA 1U3HD 5EA0L 4XBEH 2DQEL 3QIBD 3ZHKA 3FRUB 4PG9B 2IH1B 4G5ZL 5B8CA 1U6AL 4JR9H 1P9MC 4NT6B 4PJ9C 4Z7UA 2NY7H 4XVTH 2IG2H 3I2CH 2FJFB 1L7TH 2R4RL 1CTOA 2ZSWB 5C07A 1MVFA 2X4OB 5E6IC 3S4SG 2ESVB 4XC1H 3HNVL 4LSVH 4MNGA 3LQZA 4MZ2A 5D5MB 2HTKC 4HS6B 4OZ4A 3DVGB 3TN0C 5I8KL 3BEVA 5ICXB 5CEZH 3EOBA 3WJLA 3O45B 4XC3L 5I74B 3UAJC 4HWEH 2GYSA 2ZCLL 4W4OA 4AEFA 3BGMB 4GW1B 3Q6GL 5J11C 5HPOA 4TN9A 3VWKA 1EJOL 4CBPA 1HHGA 4Y89A 3QDMB 1FLRL 4PJBE 1B0RB 4LAQH 2VC2H 2EKJA 4PJ7E 4XMPL 1GGUA 2KH2B 3RY4A 4L29A 4OF3A 1JZ7A 2R2EB 2D0GA 5T3ZH 3P11L 4OZHB 5JW3H 4YAQA 3BJ91 1S7RA 5D7SL 1BP3B 15C8L 4G6FB 4H0GA 3TIDA 3ULUD 2XXMB 3BQUD 2GSGB 1CTNA 1JYVA 1TZHB 4U1KB 3WUWA 1JPSH 1HSAB 4X6DB 3QA3A 4ZOEA 1WGOA 2A6DB 5JW5B 1DQJA 2QSVA 5C09A 1CE6A 2BNQB 1KT2B 2DWEB 3B9AA 4X83A 5IGXL 4QRUA 4K07A 1BFOA 4PJHA 4DGIL 1QBLL 1YEHL 1R6VA 1T5WA 1YEIL 5I8EB 1RJLB 4LDLB 4P59H 5FYJL 3NPSB 3C2AH 4KQ3H 4LLDB 4NQSB 1BEYL 1EO8L 2YKLH 4G8EA 3LN5B 4WW2B 3LQAL 4MXWL 5FA3A 3U9UB 2FX7H 3RVVC 3VXUB 1QA9B 5IBTL 1I7UB 1KIQA 4LGSB 4ELMB 3N85H 1IM9A 4TTGA 2X4SA 3MMEB 3PGFH 3PWJB 5CP3A 5KVFH 2VH5H 4ZD3L 2BOBB 3UJIL 2ARWA 4NO2A 3SGDI 4NYLA 5F1IB 4JFXB 5DQDL 2L0DA 2VLKB 1C1EH 3MV7D 2DKUA 1MRFL 4HIIA 3QG7L 3V6OE 3LSOB 4U1GC 2JJSC 3ZTJG 3DX8B 4M6AA 5F7EL 1KGCD 3W81A 3HZMB 4NM8L 4FQLH 1NMCB 4XPFH 2CUMA 1PY9A 2EIZA 5DD0H 1T2JA 3PJSA 1N6UA 2RIKA 3AAZB 4Y5YB 1MFBL 1FPTH 3OB0K 3WFCH 2B1AL 5DHVB 1KFAH 3F5WA 2HFGH 5D2LE 1JPFB 5E2JA 1U8KA 2XWBA 4OD1L 1Q38A 2R0WH 4H1LB 4I3SH 3L1OH 4PRBB 2WNGA 4UBDD 4M8QB 2A1WL 5FHAL 4XVJL 4XZUA 1X5KA 3G5YB 2YD1A 4R8WH 4M61A 1N7ML 5F21B 3ARDA 3QDGB 1F3DJ 4QHMA 4QRRB 1QLEH 1F3DH 4KTEH 1T2QH 2E7MA 4ZOAA 4OCRH 3O6KH 3THML 3HZKB 1SEBA 2Z31A 4JANB 1OTSD 3BDXA 1C8PA 4XMKH 4L9LC 1L9MA 3CK0L 1D9KB 2D7MA 2ZOLA 4UQ3A 2WINA 3MLWL 5GGRA 4GUPB 3S6CA 4CDGC 4CW1B 3BZFA 1N4XH 4ZFFA 1JGUH 5SWQB 3OWEA 5C0GB 4CVXA 5DD6A 1NLDH 4JFPA 2W9DH 3QIWA 1J8KA 4PR5A 4M43L 4TVSa 4ZYKA 1DN2A 4YC2B 4K3HA 3HI6H 3V0WL 3ZKXC 1G7MA 3UO1L 4B41A 1NUNB 2C4FU 5LQBH 4WHCA 3ZKQD 4LASL 5L2JB 3SDXB 5ALCH 1RUKL 4PJBF 4QXUH 3MYJA 4UIKH 2X7LB 1IGIL 3FONA 4LLYB 3PHOA 4PJFE 4WHDA 4PJ7F 2Z35A 4QXWA 1AGDB 4OD3L 2UZIL 1X5IA 4OGZA 2FZ3B 4NCC2 3CFIC 4PJ5B 1IARB 3GMRB 1A7OL 2J8OA 3TO4A 1TCMA 3F7RA 5I6XB 2ZUQB 3SGEH 1EFXD 2D03L 1UKQA 4W4NA 1UA6L 4MJIA 2JCCF 1A6VH 1L6ZA 5ICZA 4N0CD 5L88H 5ITFA 4X5XA 1WIPA 4RGNC 4XNMB 2CQVA 4DGVL 5I71B 4GW5B 3B6SB 2VZVA 2FB4H 3A6BL 5DO2D 3X14A 1RHHB 2P5WD 1T0MA 1MF2H 4HJGA 3MNVA 3O8XA 2KUTA 3T0EE 3RZCA 2UYLA 1QFPA 1CD0A 2LTQC 2FGWH 5EUOA 2VL4A 2Y4SA 3D3VD 1XGRA 4POYA 4UV4H 4HCRL 1CK0H 4WEUD 2BY3A 2KQMA 1H3TA 2PF6A 4WWKA 3OGCB 1N0XL 4WO4C 4HGMA 4WY7H 4F9LC 1SYVB 4Q2ZB 4RGMC 3V8OA 3IXAB 4QRPA 3PHQA 4XBPA 3SJVE 5MENB 2XTJE 4D9RD 1AGEA 1I1RA 5AAMA 2AKRB 2LU7A 4UILH 1JPST 5EG6C 1ND0A 2APFA 4KRLB 4N5EC 1W0WA 5IEHA 1CU4L 4GG8B 3GGWB 4F15C 5CJBA 2H9GA 2IMNA 1UG9A 3FOLA 3MFFB 4BSJA 3UJJL 2BFVL 2FYYB 4Z95L 4JG0H 5C0IB 4DGYH 3OMZA 4JQVA 3SQOH 4WUKH 4NZUL 2ADGB 3LD8B 3NCEB 2BNRE 5TDPA 3D2UD 2P43B 2CRYA 5D2LF 1GGCH 4HKZB 3L7EA 2NX5B 2VWEE 1JGDA 3HI1A 3MRHA 5BVJA 4X7EC 1PYWA 4WU5A 1OPGL 2VXQH 4K3DL 1HYRC 5GRJL 5L6YL 4P9HH 4AENA 9CGTA 3C08H 1F2XK 3P0YH 4XVUD 2BY1A 1PLGL 4S0TD 4XPTL 4CUCA 3EUUA 3CFDA 3H9HB 1EAPA 2MSPA 5C09D 4X8JA 1CLOH 1OARH 4LLQB 2ZCHH 2D7QA 1ORQB 4X7CC 5HSFA 3QDAA 1I9IL 4D8PA 5F3BB 2GITA 1RK1B 4K94C 3BHBB 1QBML 4BZ1H 3MLZL 4ELKA 3CVHB 5SX5K 3V5KA 1KLFA 2O61B 1XGQB 2DM7A 2ZOKB 4XAWH 1OD7A 3NGBC 5DUMH 1JV5A 3MV8E 1ONQA 4PJIB 2VDMH 4NUJA 1JNLH 2PW2A 2V5YA 5IP4A 3PNWB 4LARH 1H8OA 2FBOJ 4UDUA 4JFEA 2XZQL 4ZNEE 1JRHL 4LLWA 3D39D 4LLUB 1C16A 3MRDA 4FQ2L 2UV3A 4JM4H 1PZ5B 2YUVA 4MNHA 2EDBA 3LEXB 2XY2A 5KG9A 4NC1C 1FC2D 1IQDB 4K23L 4WCYH 3GSUB 3JSSA 2NXZC 3NCCB 2ZSVA 5L7XL 4JZJA 5GGQL 1MEXL 5IBUB 1YDPA 3GIVB 2B4CH 3AY4C 2HJKA 2OK0L 3V79C 5GGTH 5F9OH 5CMAB 4KGLA 1KJ3H 1HSBA 4TNWF 1B0WA 3ARZA 4PPTA 1U2CA 1CYGA 2Q3AA 5DJ8A 3VWJD 4FZ8L 3QHZL 5IHBA 2GUOB 2Y07L 4FQ1H 3GRWH 2BMKB 1A3QA 1AY1L 1RIHL 3FQTB 4ZO9A 3ZYOA 1CGXA 4KZDL 3B9KB 5E8EB 2K9UA 5E2VL 3SCMB 5HHOD 4L4VD 4P5KB 2AP2A 1S9VA 2X10A 4YHPA 4MA8H 4XNXL 3KVQA 2H1PL 4Y4HD 1KEMH 2P8MA 3MNZA 1OB1A 1S9YB 1RJCA 3GBNH 1HEZB 2J8UF 4KDTC 2CDFA 1IQWH 4TVPE 1Z5LA 5I2IB 1DL7L 5I1EH 1YJDC 5MERA 1OGTA 3SGDH 5JDJA 3QQ3A 4NRXB 1JF5A 2EECA 2K3TA 1HQ4A 3MRCB 5ETUB 1JPGA 3HG1A 4OLYH 3FOMA 4HQQH 1S7UB 1RJYB 1LO2H 1I9RH 3S5LA 5JHDE 3ZLQC 5BO1H 1NFDF 3T2NL 4ZFOA 5J12B 3P9LB 3TN0B 5HJ3A 1BQLH 1I9EA 1KCRH 3GUTA 1YA5A 4JHWH 1MHEB 1X5AA 5T5NG 4M1DH 2KZWA 3BGFC 2F8OA 4LLVA 4J23A 2VUOA 5J11B 2HJFB 3BH9A 3F58H 1G6RB 1T83A 1IGJB 2NLJB 4HV8A 3U0PA 3SDYH 2A6IB 2NY7L 4Z7WF 4UTAL 2NZIA 2P45B 3IDYC 4P3WA 3VE0B 2CIIA 4ZTOL 2R29H 3KGRA 1CXHA 2IG2L 3I2CL 1L7TL 4L8SA 1DLHA 3IVKA 2A2QT 2F5BH 1E27B 4QY8A 4ZAKD 3T04D 3H3BC 3T77A 1FZJA 4QTHA 3BO8B 1QFWI 1MCFA 2CLRB 3FT3B 4N0YH 2A77H 3DRTB 3GSWA 1EEZB 1UWEH 1SJVA 5CEZL 4HGKC 4UNVA 5TH2A 3T2QA 1UKSA 5D7JB 4DVBA 2Z0BA 2BRQA 4L3ED 1FO0B 4IDLA 5GZOC 1N59B 3BD5A 3WXVL 1EPFA 1H5BA 2YA0A 3RWGB 1P1ZA 5AUMA 5CBAA 4F33A 3HHRB 3WJJC 5JXEA 1RD6A 2VC2L 1IC5L 2EYTA 2HP4A 4U1SA 3FTGA 4JM2D 5EBGA 4PYHA 2H32A 5JW3L 5JPMA 2FGZA 2PXYC 1M05B 5BVPH 5F9DC 4GKNA 1AO7D 4ETQA 1OSPH 1JPSL 1F3RB 2E7BA 3U6RA 3LKOB 4JHBA 1FL3A 4D9QE 3MUY1 1AC6A 3UTQB 2NY0C 4I2XE 3X3FL 4Y2DC 5L9DL 4R0LA 1FZKB 5JZ7C 1DP0A 5JNYA 5KN5B 3H0TB 3D1MC 1KYOJ 3LQMA 5FO7B 4P59L 2ED7A 4F7MB 1JN6A 4BFIB 1JP5A 3SE3A 5HHNA 2VDKL 2VXSH 4Y16C 5IESH 3G6AA 2FX7L 1LDSA 3VFGH 4N8VB 1JZ4A 1JWSB 3N85L 1I1YB 4KKAC 4OIAA 2CXGA 1MFAH 1XGUB 4LEOA 3WLWD 2WW8A 1U8HB 5EU6D 5KVFL 4O2CA 1TJIH 1XH3B 2VH5L 4X6CA 4ZUWB 3RWDB 5D72L 4JDZB 1CLZH 5FUOH 25C8H 3VXQA 3G9VA 4UT6L 3QI9D 1C1EL 2XQYK 5ILTL 3WBDA 1F8TH 1NAMA 4TUOA 1V5JA 4FQLL 5A3IC 3V4UH 4R3SA 3WIFB 3QNXB 3P4MB 1G9MC 2XQYG 1Q9LA 1ZGLM 4L5FL 1FPTL 2XZAH 1G7HB 1KFAL 2QJDA 2HFGL 3B9DA 1S5IH 2WBWB 4P2CG 2R0WL 4MD4A 1SY6A 5T5FH 5CEYA 1KELH 5HHVH 3ZE1F 3UPRA 3VFSB 2NNAA 5GZND 2BVYA 3ZKXB 2L7JA 1ZHKB 5HGDB 3ZSTA 3SDCA 5CEZD 3EOAA 1T1ZA 3I9GH 3BI9X 4KTEL 2F74A 2ZG2A 3L3JB 1DEDA 3RQ3A 4EN3A 2AEPH 5F7UA 1Y6KR 4OCRL 3O6KL 3S9DB 2VZ1A 3E2HC 1A7PL 4DOHE 5IVZB 5IVNA 3KLAB 2BVQB 2FL5B 4OKVA 2R0KH 4FQXC 1N4XL 5I1LB 3O6FA 1JGUL 4NM4H 5DFWH 2LE9A 4XMLH 2WSKA 1KTDB 1NL0H 2X1WL 1NLDL 2W9DL 2EYSA 4WWID 3ZKMD 5IB1B 1S9KC 3KPSD 3SE9H 1NCBH 1UM4H 2NXYB 2QQQA 4TSBH 1JNJA 1U92B 3NZHH 1YY9C 3LB6D 2AGJH 1J18A 4PJ7B 1A1NA 1FIGH 5BQ7B 5DMKB 1CDIA 3H6JA 2H2SD 3ZTNH 2CLVB 5ALCL 4QXUL 1UCBL 1I7ZB 1QO3B 2LTQB 5DJ0A 5GPRA 4C59B 1NKRA 3WIHA 4M00A 5IW6A 3LKPA 2YRPA 3V7AE 1MCKA 1G7LA 2JCCB 4EDWH 3X3GH 1KACB 5M95B 4HBCH 4WDIA 4WO4B 3GSNH 4YWGH 1EO5A 1J88A 1AGFA 1T3FA 1U8QB 4RGMB 4X5WB 3RGVD 5I1KH 5D2NC 1BX2A 1GZPA 1A6VL 3VG0H 5L88L 4OLWH 2DICA 1RULL 5D9SB 5H37H 4RAVA 4YZFE 2QSCH 4JN1H 5DRZA 4F15B 5JA8B 3QDJD 2P5ED 4P57B 5E6ZA 2NW3A 3VMPA 4JPIA 5D7IA 4CMMB 4YDVA 1CL7L 1NFIA 2V2TB 4UV4L 3W0WD 1G7PA 4IHOA 3SO5A 1UKTA 4TUJA 4YFLF 3HNSH 1I7RA 4WFFE 2FATL