1YNLH

Identification of key residues of the nc6.8 fab antibody fragment binding to synthetic sweeterners: crystal structure of nc6.8 co-crystalized with high potency sweetener compound sc45647
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
219
structure length
219
Chain Sequence
RVQLLESGAELMKPGASVQISCKATGYTFSFYWIEWVKERPGHGLEWIGEILPGSGRTNYREKFKGKATFTADTSSNTAYMQLSSLTSEDSAVYYCTRGYSSMDYWGQGTSVTVSAAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPSGPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cocrystal Structures of NC6.8 Fab Identify Key Interactions for High Potency Sweetener Recognition: Implications for the Design of Synthetic Sweeteners
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Ig gamma light chain
total genus 42
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2005-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ynlH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ynlH02
3BXNB 2NY1B 4JY5L 5FKAA 3GK8L 4P4RA 4G7YH 4PV9B 4U0RB 3ARGC 5IHBA 1JMXA 5DDHB 1GGYA 1MFEH 2VZSA 3ET9F 4PJXE 4QRPA 5D7IE 4M7KH 1BJ1J 3KPOB 4BH8B 5JHDA 2ITDA 3IB4A 4CVZB 5GRJH 3ARED 4XRCA 4IOIB 4ZDHB 3UDWA 1YMME 3BE1H 4Y19B 5T3XH 2J5LC 5IMKA 3L6FB 1LILA 1ZS8B 1BBJB 3D85D 5HPMB 4N5UA 3LQMA 1EIBA 1W8OA 5DQ9A 5KJRL 3KGRA 2CRMA 4ZNCD 1WBXB 5E6YA 2ATPB 5EIIA 2VDLL 1Y6KR 1VEOA 4P46C 1JUFA 3FRUA 3ZL4H 4P2OD 4PTTB 1H9VA 1I9EA 4BZ1H 3BN3B 3VD4A 1WWCA 3HS0B 3MLVL 2OTUB 3IS1X 4TUKL 1KELL 1XF3A 4N68A 4UIMA 1F00I 1C16B 4WCYH 2AJSL 2GIYA 1OARL 4EI5D 2CRZA 2V2WB 3IRPX 5D93B 1XCTB 5E8PA 4RFOH 1VFMA 1QFUH 2DIAA 3IVKA 1JRHL 2ARJB 1ZE3C 3G6DH 4R26L 4LIQE 3REVB 3FONA 1A6UL 4YR6B 3GM8A 5IBLC 2D7MA 4OAWB 3W9EB 5IVXF 1PW3A 5BRZB 2OQJB 4OF8A 4LHUG 2EXWD 3G5VB 3C6LB 4PRNB 1T83C 1WT5C 1UXSA 2CLVB 2HTKD 4FG6D 2CXKA 4U1NA 4UAOC 3S37H 5DRZB 2NMSA 4OD3L 2EYTB 1CL7I 4IIQB 2AXGB 1Z9OA 4JQIL 5D93C 2F74A 1NEZB 2Q20A 3DX7A 4G8GE 4KRPD 1INEH 4Y5YA 1RK0A 4LVOB 2V17L 2F54B 1SJEA 2DL2A 1MI5D 3JV4B 4FQLL 3MJ6A 3QWOA 5EORL 2B7DT 4HX1B 3B9VA 3WIIH 1MCWW 2K9UA 2VNCA 3M1BB 5DQJA 1WEJL 3NABL 5DRNA 2K1MA 4OLZL 4WW1B 2IALA 3T65A 1RZKC 3QJHB 5T1DL 2FECL 3SDCD 4Z7UF 4KK8D 3AB0B 3JTSB 2D4DA 4PJBA 4KJPD 2DQCH 3M45A 1KLGB 3G6JF 4Y7MA 4DKEH 1V05A 5BO1H 5DZNA 2YZ1A 1I7TA 5ALBL 1TTUA 4QRRE 3TO4D 1FL3B 4MX7B 2AJUL 2VDNL 3MR9B 1HXYB 2DQTH 1S78D 5HD8C 3ARTA 1JN6B 4F7PB 5KS9E 4IS6A 4M00A 1A1MB 2A74A 3ROLA 3QRGH 4Z77B 1A7PH 5DEFA 1UWEH 1MFAH 4DVRH 1G9NC 3JV6B 2VZOA 3RVXC 4JFZL 5GJSL 1J8HB 3FB5A 1MFCL 2N56A 3QUYA 1CLYL 2A9NH 4U2ZA 3OKOB 3EDEA 1JFQH 4J3WA 4MCZB 1IC5H 1A4JA 2W9EL 4S1SL 5ADOH 3H3KA 4GRLA 3HUJB 3EOBB 4UI2A 4MVBC 2DQHH 1CS6A 5KVGH 3TESA 1FVEB 1BM3H 4JHAH 1NAMA 4PG9A 2R0WL 3HE7A 5IVNA 1TJIL 4DUVA 2VLKA 3CIQA 5C0DA 5C9KA 3O9WA 3ZKMD 3HAEA 2W9DH 2D03H 2P46B 3O6LL 3RJDA 3QIUA 2FJFA 2YRZA 2Z35A 4L8CB 1EJOL 1K8DB 3BDYH 2JJSC 1YYML 5JR1H 3U2SA 3G6AA 3P0VH 2CJUL 3QXTA 4PLJC 3O6KL 1CICB 4JHZA 4EIGB 1CFSB 3AS1A 1HI6A 4Z7WA 1BD2D 2B1AH 3GMPA 5HGBA 5IWLC 5EZIL 5FM8A 5IVXB 5T1LB 2RGSA 1QSFA 2P45B 4J6RL 5B8CC 3BFOA 3ZE1F 4RMUA 3U46B 2A6DA 1MWAA 3BUYA 4R4NC 5EZJA 3RWJB 5E6IB 3ESUF 2VDML 2E7LA 4I13B 4JPKL 2VZVA 4GRLB 4XZUB 4JGMA 1NCCH 1NAMB 1JMZA 5KSVB 3P0GB 1NMBL 2CLZB 1H5BB 1HNGA 2QQLL 3L5XH 1ZLWH 3DV6A 5C0CE 3SDXA 4PJAF 3MLRH 4PRIE 4Y8AA 1TETL 5SX5K 1MUJB 1U95A 3V2AR 3L5IA 5DUPL 3SGJA 4PB9H 3CFBA 4ACPA 3RIAK 8CGTA 3VFRA 5L2KE 1AGEA 2R39A 5A2JH 1TJIH 3BAEH 2R0KH 5BQ7B 1R5IA 1T1ZA 2HRPL 4UILH 2E6PA 4F7PA 4OCMC 1ZLUH 1CLOL 4XNYL 5DJ2A 4TUJB 5J1AA 3RGVA 3FHAA 1CFNB 1OB1B 1FYTE 2HLFC 3RX7A 4NQTA 2XOTA 5F21B 3DLQR 1I3RB 1UQSB 1Z3GL 5CBEB 3LZFH 4UV4L 4NGHH 2VDOL 3UJJH 3MBEC 4BSWB 2FECI 1D5BA 4HKXA 2PN5A 2ITCB 4FQQB 4BZ2H 3L3JA 4QY8A 5GGSB 3O8XB 1VEPA 1GOFA 1CE6B 3FO1B 3OR7A 3AREC 4BFEA 1KJ3L 1WUNT 3WHE1 4HFUL 5F7NC 2R0ZL 5AAWA 3EYVB 3IETB 1OGAE 5D71L 3S7GA 1F2XK 2YUXA 4LVNB 4APQB 1UWGH 2MKWA 1G0XA 1XF1A 3WO4B 2Q6WA 2AXGA 2CMRL 4UOW0 4LPYA 4H8WH 4LDLB 5I1EL 4Y5VA 1NMBH 4XPBL 1PX3A 2CDFB 3V7AG 3TN0D 3OGOE 3C5ZB 5IW1A 2EEDA 3SKMA 5DWUL 1JYWA 3FFCD 5DGQA 3F5WB 1UCBL 1BECA 1D9KB 2N7AA 4NZUL 1F13A 3C60D 4WFEE 3QIWA 1ZA3B 1E6OL 2CLVA 5BVJB 5I73B 4YDVB 3W39B 5L6YL 5DJXB 3JWOH 2IQAA 3OKLB 4JFHE 1U3HC 4YFDB 3UO1H 4M7JL 3W0WB 3QZWA 5I1KL 3I3BA 3O2DL 3KPRE 1J7VR 4OZHA 2LU3A 2X4NA 4WVRA 3UYOD 4YDLC 5H94A 3U6RB 1VSCA 1BAFL 15C8L 3CH1B 3H9SD 3QIWC 4UNUA 1JIBA 5FGCB 1OAZH 4OI9A 5LWYH 1ADQA 4PJBE 1Z0NA 3BIAX 1ZHBA 1LGVA 2DBLH 2E27L 4ZD3L 1AXTH 1CICD 3TN0B 3E0GA 3PUCA 2UZXB 4LU5H 3VRJA 1IGMH 3T0EC 1CFVH 3RVVC 3BOVA 4PJFE 4PRBA 4MJ6A 4IDLA 3MLSH 4G8GB 4W4NA 4TRPL 4OKDA 4U31A 1EVUA 2CGRH 1QNZH 1FE8H 3ARGD 1X4ZA 3BIKA 1N59B 4KI5C 1A7QL 4NNYA 1CGYA 2Y36H 2EIBA 4UUJA 4CVZA 4O9HL 5J4MA 1CTNA 3RKDD 2VAAB 1JZ6A 2EO1A 4NM8H 4ZNEE 3VFSB 4HWZB 1MIEH 3BEVB 5I6XB 5J12B 3SCMB 1M71A 4KROC 1MRFL 4NO0D 1L7IL 4NKDA 4PJEF 3GEWB 5ENWB 4PY8J 3GSUB 3BGMB 3FAWA 4Y0GA 3X12B 3MRMA 2XICA 4F58L 5T1KB 3ZT7A 3VJ6B 1KG0A 1WICA 4JG0H 3V4PL 2NNAB 5TE6L 1J1OH 2P47B 4MX7A 1UKQA 2DQFA 4HIHA 1ZLWK 1I1AB 3FB8B 4JM4H 1GZPB 5GRVK 2OK0H 2VLJD 3D39A 4GMSL 4X7FC 4OCWL 3WIHA 3FT3B 4ETYA 2F15A 4Y19E 3GRWL 1BJ8A 2CIKA 3SDXF 5D5ME 1CD8A 1CWVA 4JDTL 5CIPH 2J4WH 1JZ2A 3GSVB 1IRAY 4MQTB 5HHOA 3QUMH 2V7NB 3SE4A 4LDEB 3VI4F 1CGVA 2A9ML 3BKMH 4YAQB 2W0FB 5TFSL 3GSRB 4Y1AB 4L3EB 1XZ0B 5IWLA 4Z7UB 3HE7C 5BV7L 5M95B 1MIML 3M07A 2QSQA 4L5FL 4DZBA 3BQUC 1B4RA 5FF6A 3O3DA 2BVQA 4MA8H 4RGMB 1RK0B 3MXWL 5B21A 5CZVH 5DJCA 1EGJH 3MNZB 5T1MA 4R7NA 3F12A 4HKBA 3TWCH 4I3SH 1YPZF 3EDFA 5E2VH 1YEEL 4GAYA 2JJSA 3QIUC 3CMOL 4PJGF 1VGEH 1JGLL 1JYNA 5BCAA 1QRKA 5FDWB 3X13B 5FUOL 3O81A 4HH8A 1CXEA 3HZYA 2ID5A 4PJCF 3FT4A 5JIKA 1FPTH 5MEQB 1N6QH 1S7UB 3EO1B 1BD2A 3GSWA 4PR5B 2BHUA 3QI9A 4NQVB 2XTJC 5E8PB 4WUKL 4YHZL 3TYFA 2BNQA 3VG0L 3BZFA 3SDCB 3DYMA 5F8RC 1CFQB 3WD5L 4B53A 2CO7B 4PRAB 2WM0A 1XGQB 4JFFB 4GMSH 4J3TA 5DJ2B 4F9LC 5J1AB 4AIXA 2EXYD 3DBXA 3VFVA 4XAKE 4O02H 1NKOA 3WUWA 2OM5A 1MFEL 3TH4T 1YUHA 5KVGL 2MQ0A 1V5JA 4JKWA 3BKML 4P57A 4XBGA 4XVTH 4YHYB 4IRJB 4BK4A 4OFDA 1IQDB 4OTXL 1FORH 1RK1B 3UTQB 4GQPH 1HEZB 2UWEF 5IB5B 1FV1A 5KJRH 2ZUVA 4ZS6D 4NN7C 5E2TH 1B88A 5FB8A 4BUGA 9CGTA 2DDQH 5JZ7D 1SY6L 4LLAA 4Q6IA 4YNYA 5I9QB 3FO2B 2HWZH 2EDWA 4JHBA 2VQTA 3P73B 3TBWA 4DWHA 1RZKH 5F7UA 1T83A 3MACH 1S3KL 3PWPD 4TUKH 2C1OB 4UTAL 2J88L 2ADJB 3U0PA 5ANMA 2AJSH 5FHBL 1XGTA 3EAKA 3A67L 2PW2A 3B6SA 4ZO9A 1IC4H 4EQ3A 1MSPA 1G7JA 3HZVA 4KJYB 1JPGA 4LP4A 3DGCR 5HDBE 1Q9LA 2QSTA 1JGEA 1UB6B 1WWWX 5I18L 4MZ3A 2DQEH 1OGAB 2V5YA 2HP4A 1QYGH 1JNJA 4RFNC 3SDCA 5FO8A 3WD5H 4PRDA 1LE5B 1A6TB 5EUOA 5GQBA 4YZFF 3KHQA 4OQTA 3L5XL 5EU6E 5FCUH 4G9FB 3LKSB 4PJ5E 5D72H 3MOQA 4LHJB 4QRSB 1DE4A 3GMQA 3NACH 4YQXL 1KPVA 5IM7A 1T1XA 1FYTB 1T1WA 4GKNA 5DD0H 3S35H 2XFXB 1ACYH 5C0CD 1S9WA 4PRID 4X7DC 3VMPA 4O5LH 2DJ4A 1P7HL 1S9YA 5FM4A 1ED3B 1LP9F 2E9IA 2JB5L 1QSED 4G6JL 4WV1C 4OD2B 1BFOB 5L2KD 3HAEB 1LNUB 2VH5L 3ZDXF 4TOYH 4U1KA 4OZHE 3KPPA 2EEBA 4PJDA 3H42L 1FRGL 4N8VB 4KKBC 4LLVA 1H3PL 4P5TB 1LMKA 3LZFL 1FAKT 4UV4H 1MH5A 4FHBD 5F1IA 2Q7NA 4F9PC 3MUGB 3V4VH 3CSYA 5ID1B 1HSBA 5MP6L 4HS8H 4MQ7A 5LGJA 1OQOA 4NQDB 4UQ3B 3T8XA 2C1PA 1GAFL 2Y06H 4WO4A 1RZFL 3MCG1 1DBAL 1RIHH 4PJ7F 3RZCC 2MHAB 4LHUA 2QR0A 5FO8B 3CVHA 1OTTC 4JFQB 1WJ3A 4FQIL 1IGIH 3ILQD 1C08B 1M7IB 3ARGA 3QDJB 1HIMH 1QEWA 3OB8A 3SE4C 4KU1A 3VFUB 2IGFL 4HIHB 1FIEA 4UIKL 4JFYA 3WN5B 4JFZH 3L5JA 2Z91B 3ARQA 1U0QA 2W60A 3V5HB 1CK0L 5L2KB 1PX4A 1DANU 1RUQL 2HVJB 2ZCLL 5ESVB 5FB8B 4KGJA 1Q0YL 3MBED 1X5GA 3P30L 2EH8H 4CW1A 4BH7A 4XNQB 1KUMA 3MRDB 1SMAA 1A6VL 3RY6A 4KRNA 5JW3H 3N85L 3SGDH 1INDH 1DVFB 4JFEA 5D2LE 4XX1G 1ORSA 2BVPA 3VRLE 2BVUA 5J11B 2O5XH 3J7HA 1P5UA 1RULL 3GBNL 3JV6A 4GKSA 4NIKB 3L95A 4MQSB 4D2NA 1DUYB 4EVNB 4KRMB 4NWUH 3NIDF 1G7QB 1RZ8A 5I8KH 1BWMA 3VGGA 3T4AB 1KIPB 5ALCL 4X5WB 5FYJL 3IU3B 3K4DA 3OTTA 4X7EC 1TZGL 3O4LD 4MAYD 4P57B 2DWDB 3C60B 1NL0H 3BH8B 3ROOB 5F88B 2DYPA 1VADB 4X5XA 1OD9A 3RWJA 1UENA 3MRFA 5JIPA 3DSFH 4YHNB 1HCVA 4NQUA 5MI0B 3ESVF 5K9QG 2UZYB 7FABH 1IEAB 2NY4D 1X5LA 2J8UA 5GISH 5IROA 4R8WH 1RD6A 2CLRA 1QR4A 1XZ0A 3GHBH 1X5XA 4LKXA 2XWBB 5ILTL 3U4EA 5DI8B 3ULUF 3BKJL 1P84K 2KZ1B 3OG6B 1JZ4A 3NN8B 4MXQC 4PJIF 2HT2D 3HPJB 5C07E 1YMHA 1CGUA 4OQTL 2IGFH 1ZT7A 5JOFA 4HPYL 5D2NE 3ULVE 2X1OA 2CQVA 4I9WE 4RDQF 1I9JL 5GGQH 1NDMA 3O3EA 4XVUD 2AP2A 1KCVL 3P40A 3MA7B 2V2WA 3INUL 3WHXA 1MVFA 2H3NA 2VLKB 3EOAB 5ICZB 5DYOB 1VB9A 4DOHE 5F9AC 4DZ8A 1U8NA 1ZVYA 3T77B 1T4KB 3QCTL 1T1YB 4IOIA 2IBGA 4WHTA 5D9SB 4KQ4L 2FX8L 3NZ8A 2LABA 3FRUB 1GIGL 5E6IC 3O8XD 4OM0H 3L3KB 3WCYA 3MRLB 2X1WL 3EYQC 1NCBH 3PP3H 5T3ZL 3QIBA 4X9HA 1X5FA 3VFMA 2X42A 4JR9H 4FFZL 1DTUA 3DSNA 2J7LA 4Z7UA 3R4DA 3IAGC 3CXHJ 4X6FA 5A2KH 1AP2B 3FN0H 2BC4A 2QL1A 3PL6C 2HVJA 5ESVA 1R0AH 4M6NL 1QSEE 3IDXL 2HTKC 2L4OA 4XNMA 3VI3E 2FH8A 1NCAL 2AXFA 5JORA 1MLBA 1G7MA 1RJCA 5HYSB 3I3EA 5SWSE 5I1HH 4H88H 3SO3C 5E9DD 3GO1L 2Z8WC 5T3XE 3LHPH 4G42B 3ZKSD 4B0MM 2H2PD 2QQNL 3CFJB 1KLGA 4HFUH 4G6KH 43C9B 4HXAH 4CVUA 4Z76A 1TVBA 3IFLH 1IMHC 5E9DA 4IRZL 3NA4A 4Y4KB 4AIZA 4TVSa 1L7TL 1CE1L 4HCRH 4PRPD 5MENB 2DOCA 5LGJB 4LPVA 4EN3A 3H9YA 3VGHA 2UZIL 3C2AH 4X9BA 3RNQA 1EEYA 2YD9A 1DUYA 4YPJA 3N9GH 1M7DA 3FQRB 5FYLL 3MBEB 4DGVL 3MBXH 4NHCH 4W4OC 4X6BB 3ZHDA 1CDCA 2F54A 3JV5A 5FUOH 4KVNH 4HWZA 4E0RA 4DKAA 1AJ7L 3DV4A 1FC2D 4WUUB 4XNQA 3A6BH 5L6YH 5LXGL 3T0XA 1E4XH 3SKUD 3GDBA 4E41B 4MCYB 4M6ML 2XT1B 4HSQA 3BJ91 1IC7L 1AFVH 2VLJA 4JKMA 3B5TA 1FDLL 1B9ZA 3ZDXE 4D9LH 15C8H 4X9IA 1KCUL 5F9WB 3PWPA 3SKJL 4MAYA 4ONFL 2OQJA 1HWHB 4XZUA 3QFJD 4XVJH 2FBJL 2YS4A 5HHOE 4ODXB 3V5DB 4I1NB 3IXTA 4R3SB 5CLWA 1IT9L 3DYOA 4OCNC 1KB5B 4U1SB 3CDYA 4E9LA 3O4OC 3FJTA 4Z78A 3VXOB 3VXNB 3WUZA 3QFDB 5SV4A 3IDIB 4UTBL 3RWHB 2ICCA 3KYAA 2CK2A 3DNKA 5FXCH 4P49A 2JELH 4OGYL 4H88L 4H26B 1NGWB 1UG9A 3I6KA 5CIPA 3RX5A 3CFIC 5LCVH 4I48A 1JGVH 3C5JA 4HH9B 4MJID 4NO3B 4NQCB 3TO4A 5TF1L 1S7TA 1YNKH 3GMOA 4V1DA 4N9OB 4LASH 4Z95L 1A7QH 2YPVH 4ONHA 3MOBL 2FO4B 4MA7L 2OJEB 4GRWE 5I1GH 4QTHB 3TT1L 3ROOA 4Y5VB 5E8NA 4KKBD 1YQVH 4ZG1A 1CGWA 5JOPD 1KN2L 3OKDB 1S3KH 3KXFE 3TYGL 4E5XA 1FVEA 4OCSL 3CLFL 4M4RA 4U1IB 3E2HB 4F15B 3DARA 2PKDA 3QUZD 5IB3B 1HQ4A 4U1MA 2NX5A 3A6BL 2NXZC 1JTOA 3KYOB 4MA3B 3L95B 4QRSA 4L4TD 3BZ4A 3UTOA 1MFNA 5HGGS 4WU5A 3WV0A 2P5EA 5AWNL 1B6DA 1RMFH 3IDYC 5D2NC 5EDXA 3ULVC 3MLXL 2CRIA 4ZO6A 1NMAL 1K4CB 4D9LL 1DN0B 1F6FB 3QUXA 4XNUH 4JO3H 5ITFB 2Y7QA 3HAEH 3PNWB 5C3LD 4YHYC 1N26A 2C7UB 3NCFB 4XCEB 3D3VA 1J0KA 2BMKB 3DBXB 2VZ1A 1UB6A 2BXZA 3VXQB 3K4AA 3L3GB 2ESVD 3PQYB 1WFUA 5DK3A 1CD1B 3MREB 4KJYA 3F6IA 2WUBL 4M7LH 2NTFB 4OLXH 1PZUB 5H37H 3UJIL 5ESQA 4MB3A 1FVCB 2H2SC 1VFAA 1RJYA 1FSKC 2G9HB 2R1XA 3GSOB 1NDGA 2ICWI 5HYJA 1XF4B 3GSNA 2P4AB 1T7XA 5I8OL 2ERJB 4CDHA 2Z93B 3C9NB 4A6YH 3D69B 4Z0BL 4D9RD 1U92A 3OJDA 2XZCH 4BK5A 4MQXD 4MGXA 3HFML 4LLQA 3BEWA 1EGJA 4PJ7A 4P2QB 4XPAH 4HS8L 4PLNC 5D7JA 3GMMA 3R06A 1WTGT 3CUPA 4MNQE 4RAVA 4PJDB 5GS0D 3VFTA 1S7SB 4GUPA 2X41A 4FQ2H 4TSBL 5DRZA 3DURA 4ZQKA 4KHTH 2NY2D 1NBZA 1D5ZB 4G9FE 2IPUK 2YD7A 1MAML 3G5VA 3HC3H 1A6AB 3JV0A 3MRBA 1TNMA 4WY7L 4HF5L 4D0BB 1HZHH 2G75B 1J12A 3AMLA 4M8QB 4KK6C 2Z4QA 3TEUA 5IVZA 4QEGA 3JZ7A 4G9FA 4NSKB 4LNVA 5J06A 3S6CA 4U49A 1T2QL 3AS3A 3OKEA 5TQ2L 1U2HA 3BX7C 3G6JB 4YWGH 4PGZA 4DUWA 5C7XH 3S37L 4M61B 4LSVL 2B0SH 1CL7L 4M4PA 4P46A 3U0WH 4R3SA 1U8OB 5J8OA 1MRCH 4YDKL 2H41A 1K6QH 5EBLA 3VXUB 1ND0A 3RVWD 2A0LC 4AH2B 5JHDE 3PWPB 1Q9OA 2AEIT 3F58H 1KG0B 5TH2A 2O5XL 4BFIB 1P2CB 4ZAKC 1I85A 3HS0A 2AV1B 1T22A 1RZJL 3ZDZE 3V52H 1WTLA 4OTXH 4HUUA 2ZG3A 1ZT4A 3SDCC 4YX2L 3W11D 4DKFH 1U8JA 2ADJA 2ZNXA 1SMOA 3KPNB 2BVQB 5LVEA 5JPMB 4JE4B 1OGAD 1S7SA 3DX9B 3DX8B 2FHBA 1F3JB 1OGTA 3HRZA 4Z0BH 5C8JB 2QLVB 2VL5A 5DLML 5C0AE 3DRQA 5KW9L 3NIGF 5J6GB 3QI9D 1PEWA 2DLIA 4X6BA 3WS3B 1SM3L 2NR6D 2I9TA 1SEQH 2UVEA 4EI5B 1JHKH 1QO3A 1UZ6E 3B9DA 1EX0A 3FB5B 4HFWA 2DI9A 3KDMA 3VXMB 3MZTA 4LSPH 2XACC 4ZO8A 5I18H 2R23A 1D5IL 4OKVB 3CVIH 3GFUA 5C0CB 2HJKA 4O2EB 3LDBC 3ULVH 3GB7A 1MCJA 2Z0BA 4YC2C 1RJYB 4MA1C 1S7XA 4WGVB 1S7RB 4MXWH 2QTEA 3K2UL 4AT6A 4F37F 4URTB 3G6JE 3VH8B 1HINH 1N5AA 1E4KC 1Q38A 3TN0A 1A9EB 2AEPL 3QPQD 3W81A 1A6WL 1R3KA 4Z7UE 4WWKB 5C7XL 5I16B 3TA3B 4JZOB 2HKFL 2ILLA 3I6LD 4X4YA 1DBJL 1AKJA 1W0WA 4NO3A 1IC5L 1OSPL 4XTRC 2VDKH 1IGTB 1MRDL 1BVLA 4OB5H 3ECBA 3KWWA 2IH1B 4KUZL 4PS4L 2IMNA 4KY1H 5E95B 1OSZA 4N9GA 3MRPB 2D0GA 3KYKL 5DQDL 3DX7B 3WDJA 3BD5A 4XMPL 5T1LD 5CINH 3GSNL 4L8DA 4D0CB 4QXTB 2HT4C 1T1YA 5F6HJ 5CJXC 3UZVB 2NY7H 1XCQA 3WNMA 5D7SL 4LHQB 2NY3C 2DIBA 3UAJD 4L4JA 1EAJA 2DM3A 5EIIB 4E5XB 2EDXA 4OZIA 3EO0A 1F4WH 1QFWI 1R5WB 3QEGL 5K59E 5DD6B 1UXWB 3QRFM 3FN9A 4XHJC 3QCUH 2BZDA 4KPHL 4RWYL 5IEKA 2NY2C 2HJFB 1DL7L 4I3RL 4KVCH 5DI8A 1TCMA 4TNWK 4OQ1A 3NAAL 5BZWB 3T2NH 1J05B 1S7TB 4M1CD 5B39A 3FONB 2BVYA 3VGAB 5IP4A 2P5WB 5TGBA 5I71C 2DBJA 2UWEE 4M6OH 4PGEA 4OZIF 2VLJE 2AJZA 4UAOB 3AM8A 4X6DF 5IQ7L 1RJZB 2GK2A 5H37G 1YY9D 1F58H 5E1HB 4HKZA 1X6NA 1K4DB 2XXCB 3N9GL 3BESR 2Y07L 2LV4A 3RWEA 1EFXB 2PXYD 1H5BC 1F97A 2VLRA 3GMLB 3B3IA 1Q72L 4JAMA 2IFGA 4NQXA 5E5MB 4Z8FH 1LEIA 5I1LB 5E6ZA 3K1KC 5EUKB 3RIFF 5IIEA 3T0DA 3HMWH 3P4OA 4LGRB 2FX7H 5TE4H 2SEBA 4GSDL 2NX5E 4XCNA 1AC6A 4MAYC 1NCWL 4H20H 4XVJL 1IGJA 5JMRA 7CGTA 5I66A 3C5SA 2AJYH 4OFPA 1M6OB 5E00B 5IFAH 2X4SA 5CSZB 1FGVH 4LHUD 3DX8A 1QLEL 4KKAC 2B4CL 3KYNA 1CT8B 2C3VA 5IMMB 4LPUA 4NZRH 4X99B 3DTXA 3QEGH 3PWUA 1XAUA 2R2EB 4HG4J 1E6JL 2V2XB 4XAWL 4LQFL 1R24B 2BOBA 4EBQL 3VFOA 3VXMD 3RA7H 1FFOB 5AD0A 5EBWA 3D3VD 3MUZ1 4M48H 2R0ZH 4CU6A 1K3ZA 4GRLD 5CS7A 1CFNA 2CK0H 1S5IH 2GK0A 3QIBC 5EO9A 3EDDA 3B9KB 2FEEI 3HE6C 1U8OA 1MAJA 3V8OA 1PKOA 2R23B 4LARH 4OKVA 1GPOL 3QIWD 3MROB 4MSWB 4ODTL 3Q6GL 3U36B 3EZJB 3WO4C 5IF0A 4HFWB 2PW1B 4Q9RL 4BKLA 3IDJA 2QSCH 1WIUA 1UCBH 4LK4A 2NW3A 2BRQA 2LVEA 3CH1A 1J0ZA 3WE6B 4AH2A 1HXMA 1YEIH 1DEEB 2KKQA 4MNGE 4Q9CA 2GKIA 1T2JA 1OTSD 2P43B 2BNUA 5KSBB 3RHWK 3VDCA 5AWNH 1OAUL 4IM8A 4IDJH 1S9WB 2XNAA 2YA0A 1P6AB 4P59H 3EOTL 5T3ZH 3RBSA 1ZAGA 1WCBB 1CFTA 3KNBB 4CNIB 4F57L 4N1HB 4JFOB 1I3VA 5MEOA 1XGPB 1I7RA 1TCRA 3MLYL 5EU6B 3QIWB 1AO7D 3SJVD 3FKUS 1AXTL 3MGOA 1WWAX 3AAZA 4J3UA 3QDAA 3GKWL 3O4LE 3U7AA 3HNSH 4G80B 3QNYA 4PD4K 2X1QA 4OCXL 2ZPKL 2G5BA 3MRPA 3SDDD 1MHPH 3PWPE 5GIRB 1ORSB 5JOFB 3LH2H 1IM9A 3DHJA 3CFDB 4OZGB 2X4QB 4KJQD 3PWVB 5GSVB 5K93A 1V7ML 2DQUH 3PV7A 3DO7B 1CU4H 5CD5C 2WK2A 4IRZH 4WJ5B 1H8SA 2XRAH 1RZJC 4JZOA 4D94A 4JKPH 2P44B 4A2MA 1FNSL 3Q3GB 5B39G 2GJZB 4ZQKB 2KDGA 3HI1B 4M9PA 4UZGA 3E3QE 5I76B 1MREL 3IDYB 5D2NB 4DAGH 4PY8I 5GRZA 2NLJB 4CMMB 2WIMA 5F6IC 5GRUL 2Q1EA 1JL8A 4Q0XL 1B3JA 1BJ1H 3FO0L 3REWA 3UO1L 4CN1A 3B9AA 5JZ7C 4YBQC 1HOCA 1G6RH 3OX8B 3TNNA 4LSUL 4ODUB 2IC2A 2GITB 1IL1B 4JQXC 3QXDA 3CXHK 2D7NA 3WXWL 1EUTA 5D1XC 4OGXL 1L9MA 5CILH 1QVOA 5HHMD 4ORGB 2BNQD 2G5RA 3BGFB 3C08L 4PP1D 3ARPA 4RGNE 4AG4H 4G8IA 1W8NA 2APTA 2G5BB 2YZ8A 4X80L 1G9NL 4QOKD 3VE0A 4L8BB 2VZUA 1ZHKB 2CD0A 5ITBL 3FMGH 4QTIL 4CMHB 3VU2A 3MOAH 3R0MA 1JHTA 3BYTA 1P1ZB 4YWGL 3PGFH 3ZYOA 3K3QA 3RVXD 3TCXA 1GVIA 2NTFA 5FIEA 3GNML 2D7TL 3MO1A 1WZ1L 4J4PA 2W92A 2GFBB 2HMIC 4JFEE 5D2LA 4F3FA 1MFBL 3VXRB 3ZYZA 2CKBL 2HT3C 5L2JB 3P9LB 2CUIA 5F89A 3DX6A 2P1YA 3D18A 2X4TB 4NYLB 1QBLH 4N8CH 1PDKA 2AKRA 4PLJD 5ELIA 1DE4B 1XR9B 4DUXA 5HHMB 1CF8H 2QBWA 3HZYB 3IDIA 3MXWH 2I9LA 4UOJA 2X89D 4YEFA 3OPZH 1ZA6A 5CGYD 4ALAH 2JK5B 5CZXC 4ZXBA 4P2RD 2E9WA 1BLNA 1VACA 4BQ6A 2H2SD 4Q0XH 5MEOB 4HXBH 4YDJA 2YA2A 1D6EA 2NY3D 1JPFB 1SM3H 1BZ7A 3H3PL 1NFDB 1ZVSB 1NGQH 4HJJH 4OCRL 3H7BA 3PDOA 5DQ9B 3WXWH 5KSBE 4PJ5A 1U41A 2DLHA 5CILL 5EU6A 3D25A 2XN9A 3ULSA 1AR1C 4FXGB 1CIDA 2YA1A 3BW9A 1WWBX 1KIRB 4POZC 3G6DL 5FEBA 4BH8A 3RZCD 2XV6B 3NGBB 5HHOB 1T03H 4JO3L 2X4OB 3HRPA 1I8LA 3QAZB 4AEHL 4YFLI 4IOSD 2OJZL 2R1WB 3QEQD 2AEQL 3U9PL 3D39E 3WJJA 3CCHB 3O2WL 4L3EA 4NM4H 1TJHH 2OCFD 3BQUD 1EEYB 5GRJL 2AJ3B 3QXAB 1U3ZA 1EA9C 1IGFL 2Z9TA 1HEZA 3ULUL 2I25N 3NFSH 3ULUC 3GMQB 4PTUB 5HGAB 4DN3H 4L5FH 3IKCB 2NXYB 4U1GC 3RI5F 3S96A 5SWSA 2VITA 5LQBL 4P3DB 1CR9H 1NUNB 4P2QD 5DEGB 2OTUA 5FYLD 3IDGA 2JJTC 1DR9A 1MF2L 5IF0B 3U36A 5I1JL 4EI5C 1N5YL 1FORL 3Q2CA 4RIRA 4P9ML 4XCCH 1YEEH 1LD9B 4B41A 1TZHB 1MLBB 2VLLA 4MS8D 4BQ9A 1A9EA 3VRIA 3WLBA 2EH7L 2YEZA 4W68A 2BC4B 4P2OB 3VI4E 4XPGL 3CVHL 3QWRA 3RWFA 1WFOA 4Y5XA 1JV5B 3E6HB 2WNGA 4AMKL 1L6XA 5FYKD 4RFOL 5DSCA 5GS3A 3D0LA 5AZ2L 2HJLA 1NCDH 1TNNA 1I8LC 2J88H 2F5BH 1CQKA 4LRNH 3MSPA 3PP3K 5DDHA 5DC9B 3BSZH 4QCIA 1U8PB 3QCUL 1I85C 1T20B 2OZ4H 4XGZA 2NXYD 3NFNB 4JFHD 1F3DJ 1B4JL 3CK0L 3QWQB 1EAPB 2Q7YA 1B2WL 1MAMH 4FXGA 4KXZH 2ICWB 1NEUA 2E7CA 3RBGA 4K3JL 3BP4B 3OKKA 4PYHA 5GS1C 3AFLA 2XZQL 4H1LH 4RGOL 4TUOA 2MJWA 3UPAA 1RZ7L 1P6FA 3BT2L 3TVMA 3MODL 3PJSB 4I18B 5HI4C 5SWQB 1SBBA 1OF2B 1UWXK 3ULUH 2EYTA 4YQXH 4K8RL 1FZJB 3IDGB 5CCKH 1U42A 4ORZC 5F7LB 3WNLA 5HDQH 1ZLUK 3MRNA 5IT2H 2VITB 5IB1B 3QYCA 1NGWA 4L8DB 4D0CA 1SY6H 4AZ8A 2WP3T 1BFVL 2J5LB 4TN9A 2DQCL 4HEPG 3NFPA 3HHRB 4HT1H 4UDUB 3L9RB 5LGHH 1QRNE 1V7NL 4QNPF 4KJWC 1I1FA 2YWYA 5D1ZA 1JNHA 1S7VA 2EIDA 3PXHA 2LAGB 2J12B 5KS9F 2JCCF 1U8HB 3CVHH 4HHAB 4HK3J 1TJGH 5A3ID 1W2KT 3K8LA 4KV5F 1RY7B 5KAQF 1IFHL 3K74B 1AIFA 1PYWA 1HHHA 3DUSA 1N5AB 1GHFL 1QBMH 2OR9L 2YD8A 4NKMA 3F12B 4HKBB 1L0QA 4IMKC 3QQNA 4E41A 3SKNA 5F93C 3LRSB 3KPLB 3G5ZA 4RBPK 5CJQH 2GTZB 3SOBH 3P4NB 3RVWC 4Y4HC 3LKPA 3RZCB 2HG5B 3HPJA 4GLRH 4LL9A 1G0YR 3GSRA 1KLUA 5DK2B 2FJHB 3GSNB 3GIZL 1CGXA 4U7MA 5TDOB 4O2CB 3D3VE 3CX5K 2JIXD 2HJLB 2QQLH 1GZQA 2JJWA 3U1SH 2W60B 2YPLA 3V5HA 4NKOB 1ACYL 3IJHB 2FLRT 1I7UA 5E9DB 2I5YH 4KUCF 4G6JH 5D2NA 3WJLA 3WIFB 4DEPB 3MUJA 1F90H 1BOYA 4ZNEA 2NQCA 1BZ9A 1XGRB 3K2MC 2YK1H 2GT9A 4A2LA 4H25A 2AK4D 3DVNA 4XMPH 5I8CA 3EHBD 3SDYL 1TIUA 3GUTA 2AJXL 5DZLA 32C2B 1JF1B 3OSKA 4JQXA 1JZ5A 2YRPA 5D7IB 5KSUA 3S96B 2VOTA 4KV5E 1QEWB 1NKRA 4ELMF 4GW1B 2BDNH 1KGCE 2QHRL 4G8IB 2R9HC 4XX1E 5HY9A 2B5IC 1KOAA 5F7DA 2M1KA 4LIQL 4JPKH 1ZWIA 1U3HB 1MWAL 5IV2A 4LAQH 1ZOXA 4NBZB 4U1IA 1CDIA 6FABH 1A7RL 4HEME 1UA6H 5IJKA 5KSVA 2VUOA 4RAUA 1QR1A 4EDXA 5DYOA 1K5NB 1J1PH 3EJJX 1F8TL 1Q0YH 5KVMC 2IG2L 3BIKB 4U1KB 1KJ2A 2AV7B 4FQXB 2WQ8A 3GMMB 3R06B 4EOWH 5EOTB 1JNLH 5J3HD 5F7WC 5IFHH 1A14H 1LK3L 5DMGD 1DSFH 1NCUA 1JZ7A 1MHCB 5FUZH 3ZKNC 4WUUE 4RRPA 4KKAD 4PV8A 1WAAF 2HRPH 5E99H 5I8KL 2G75A 1HHGB 2I5YL 3U48A 4LSUH 2VAJA 4OZFH 4PGJA 5ISZB 2Q86B 2RBLA 4CAGA 2FX9H 3QO1B 1C5CH 2HN7A 3ARSA 3FFDB 5JIHA 1GIGH 2X89A 3DUUA 2VE6B 3QJFB 1C5DB 5MEPB 2MSPA 3V4UL 3CFCL 4OD2A 4M3JA 4L9LC 5BOZG 2HT4D 2RIKA 5KVDL 4LCWE 1Y18B 4Y4KD 4G6FD 2R2EA 3N1PC 2BSTA 5ITBH 5HHVL 5BS0D 2ZJSH 1QR1B 1YA5A 1OL0A 3CFEB 1KJ3H 1S7QA 3ULUD 4NNPH 4HS3A 4Z6AT 5SWZA 4Y1AE 4RAVB 5DR5H 3WFBH 4U6HA 3KPSB 2F53D 4GKSB 3JTTA 5FO7B 4QGTA 1X5HA 5EO0A 4XPFL 2D9QB 2GHWB 3NPZB 1KENH 3DIFB 4XPBH 3HB3C 3STLA 3T3MF 2R1YA 4RISH 1U91B 2AABH 3D0VA 1FN4B 2GT9B 5D8JH 2VLME 2LU7A 4I77L 1A1MA 2PO6D 1YMMA 1U93A 4ZFFB 4OI7A 3R8BB 3PQYD 2R2BB 2IF7A 3BGFC 2Y72A 4YPGA 3MXVH 2FGZA 1FVCA 4WI2A 5FUZL 4LCIH 2W0KA 2GITA 3W9DB 4HUXA 5E99L 3TH2T 5IR1A 5CZXD 3OKMB 4GQ9L 3UTZA 4G42A 3LS5H 4BFBD 3BRGC 4KTEH 3IU4H 4WW1A 1G6RA 1I7UB 4HWBL 1I3UA 5A40E 1E4XL 1UACL 4WGWB 3NCMA 3GSQB 5EA0H 2IWGA 3ARZA 1J05A 2HTLC 3C5SB 3EOTH 3BRDA 4H26A 3PGCB 4K23H 1IGML 4HK3N 5EWIH 4RMQA 2EC9U 5DD3L 1J88A 1F6AB 1KXVC 1YEFL 5D1QC 1SHMA 3SDDA 4YXLH 5DMJB 6CGTA 2OTPA 5JIIA 1B6UA 4YO0A 4N0UA 3STBA 5IHUH 5FA4B 4HZLA 3SQOH 3GZKA 4CGTA 1BQHA 2BCKA 5SWZB 5HI5C 1DLFL 3K4ZA 4R96A 2D7QA 2YUWA 5AUMB 1CGSH 1UEMA 4XC1H 4PG9B 4M7KL 1N2RA 5E5MA 5I2IA 3A6OA 2Y5TB 1BF2A 1NH6A 1I3GL 1FL6A 3O3AB 1QA9B 5IROC 1TDQA 2DN7A 12E8L 4ZTOL 5CP7A 1S5HA 4ZO7A 4NUJB 5HHOD 4BQ8A 3MBXL 5ID0A 3H9SA 3QEQB 3B9KD 4LOUC 5EZJB 4FMKA 4LFHG 2X9XA 4TTGA 1HHJB 2EH7H 2VR9A 5EIQA 5IBLD 5JHDD 1IBGL 3WE6A 3VXNA 4R4BA 2FZ3B 4X6CE 3HMXL 1E27B 4QOKB 3HC4H 3EHBC 3AROA 4GKZA 1W0WB 4D3CL 4I3SL 2VQ1B 5I1IH 4JRYA 3RKPA 1D9KC 3ZT6A 4GW4B 4M7ZC 3CMOH 1DUZB 2DD8H 5JOPE 1BVKB 3EYFA 4KAQH 3EYQD 2VXSL 3LQZB 32C2A 3EYSH 3KPTA 4JRYD 2M2DA 4BUHA 3FRPG 3L3OA 2OZ4L 4X6DA 2VC2L 3R8QA 1XGRA 4E41D 1J9CT 3GSUA 1HILB 4YDIL 4N8PA 4R26H 2Z31A 4PPTA 1LDPH 1M4KA 3MC0A 2EIZA 3PWJA 4JPIB 3ZKQD 3V6ZB 3BP6B 3EGSA 4Z7QE 4QGYA 2VLJB 5AD0B 1M7DB 5DURB 4U6VL 1AP2A 1KIPA 4ODWB 3GSXA 4JRXA 3ARBC 3BE1L 5F3HB 2DTSA 1LEGA 5CJBA 5GGVH 2EO9A 5CJ8A 5FECA 2D7TH 4P5KA 4RQQA 3DV4B 2ICWJ 1IVLA 3NA9H 2C9AA 2G2RA 4ZUUB 4HUVB 1BBDH 2OXHA 3SE9H 3P9MB 3VI3F 1ZGLM 5EFIB 4WO4C 5E7FA 1YQVL 1TZHA 1P4IL 2FATL 1RU9H 2GCYB 2UUDK 2VLLB 2K3TA 3EO9L 4HV8A 2BOCA 4P23D 4NFCA 1UXSB 1OTSC 3OAZH 3UTTD 4NNYB 4HQQH 1A7NL 3MLTA 1NSNH 1JZ8A 3ULVD 4JFDA 5D7IF 4AM0B 4AYFA 3G9AB 2X05A 5GGVY 2XZCL 4OF0A 1I8IB 5D70H 1A3QA 4R2GB 3WFCH 5J12C 4HWBA 2AERT 1ADQL 2V6HA 3QXVA 1OP5K 2PTVA 4Y4FC 2FGWL 3L3DB 3A67H 4KZDH 4OFVA 4NKOA 3D9AH 3VXUD 4FQ2L 4TSBH 5AG8A 1X6LA 1JGUL 3HZKB 5HI4D 1FYTD 4KHTL 4U6YB 3PXJA 1YECL 3KJ4B 5C09E 1FL6B 3EJYD 1YNLH 5TGBB 3HC3L 3SKOB 5DS8A 4DOHB 4HC1A 2VO5A 5H2BB 3FQWB 3I85A 1MCDA 5ACZA 1IEAA 1QYGL 4M1GH 4OF3A 1T0NB 4M43H 4D9QE 4CU7A 4PJBF 5J13C 4I18A 2AEQH 3BZEB 1QFWL 1KC5L 5E2WL 5A43C 2HH0H 4QHUB 2HVKA 4KGLA 4P2QA 3HR6A 3X3FL 3ZKND 3QHTC 1AY1L 1GC1C 3NFSL 2PXYA 5AYUH 3KLAB 4RMSA 2XQBL 4X4ME 1BWWA 5BVJA 1MQKH 4FXKB 1FJ1A 3SDAB 5E2TL 1FG9C 2FYYA 2Z93A 5T3XD 3ZKMC 3S35L 3L1OL 3T3ME 1RZ8B 4N0RA 4NQDD 2J8OA 1MCQA 1UKTA 1X4XA 1SJHB 2HWZL 1IZKA 5DD5H 5GS2D 2VXVL 4GLRI 3RVTC 5C0RH 1GGTA 5CD3A 2P8PA 2V9QA 5CJOH 5FKPA 1F6AA 1SYSB 2DICA 1NEZG 5DD1H 3OKMA 3WKNA 4NWTL 1R3IH 3U79A 4EKXA 3VW3L 1A21A 1VCAA 4GXUM 4P5MB 2VLKD 4KI5D 4PJ5D 4JFDB 4AM0A 3BMWA 3DUHA 4MMXC 5KW9H 5AZ2H 1XF3B 1QPPA 1BGXL 4EN3D 1TQCC 2O5ZL 3E1F1 5IW6B 3OGCB 5GS0H 2ZNWA 3CZJA 3S34L 3WNOA 2PETA 4CN6A 3B8SA 4RIRB 2R9HD 3BSZL 1PG7L 3GRWA 4S2SA 1P5VA 4NOBA 1GAFH 2Y06L 4L3CB 3RU8L 1UM6L 4YH6A 2Y7QB 2BX5A 1A7RH 2WP3O 1T2QH 1UJTA 5EOCJ 4JFEB 3OG4B 3I9GL 1B2WH 5HI5D 2R29H 3KS0J 4Y2OA 3BKYL 3K8MA 1Z5LA 3OR6A 4PTUA 4U1JA 4EXKA 4J4PC 1OPGH 3CSYB 5ID1A 1RZ7H 4Y16C 2GJJA 3T4AA 4LCWA 2WINB 5K9OB 1R5IB 4PRHE 2CLZA 2R0WH 5FYKE 2HFEA 3MV01 4LFHD 4HUNB 3KPPB 5FGSA 3LMJH 1CIUA 3ARGB 3QI9C 4HLJA 1AI1L 3T0VA 4QT5B 1KTRL 5F44A 4ZPVB 4D8PB 2VH5H 3Q3GA 3WXVL 3HRZB 1QBAA 1OY3B 1HDMA 1OLLA 4HG4K 5IVXA 4FQXD 1T2XA 5DHVH 4ZS7L 5KSAB 4PBVC 5F96L 5IW6A 3UYRL 4UB0H 3H9SE 4Y4HD 4B7LA 4GAJH 1LD9A 4M3KB 4N0YL 4NO2B 2Q8AH 1DUZA 4JPWH 5F1IB 3VXUA 5MP6H 4Z7VB 4QOKA 4P46B 3BUYB 2V9RA 3EDKA 1P9MC 2JE8A 3I50L 3QI9B 4NQVA 3KLHD 2OTWB 2EIEA 4XNZC 5CD5D 2O5ZH 3BQUA 1LE5A 3QZWB 1P7QA 1BD2B 4R0LB 4PJFF 2AJ3A 3QXAA 3SY0B 1U8IA 3O3AA 2DQTL 5GGUA 2FYYB 4NSKA 1KTLB 4QXUH 3QDJD 4JHWL 4UT9L 2BSTB 5E7BA 3MFFA 4OSUL 4Z5RA 2AK4B 2ATKB 2PW2B 4GXVH 1FFRA 2H2PC 1RVFL 4QHNB 4OLEA 1A02N 4KUZH 2C1OA 3DMMD 2R69H 2KQMA 3QPXL 4ENED 4PP1C 2F58L 4UQ2B 5ACMA 4Z7OE 2MQ3A 1A64A 5KVFL 4MDJB 1QFOA 3IFOA 1LO2H 2IQ9H 2QJDA 4YJZL 2LVCA 1J0JA 4MNQA 4YHIB 1N7MH 3QCTH 4K2UL 5E5UB 3HZKA 1YEGL 4WEBH 4PGDB 3RIFK 2RR3A 4PJIB 1QUNA 4YBQD 2M26A 5I30L 1Z9LA 1DQMH 4KK9C 1T7WA 4K7PL 1HDMB 5C71A 4F7CA 4HKXB 3RVTD 5EUOB 1FP5A 2XN9D 3QIUB 4IOFD 3VD3A 3ARYA 1PLGH 1EEZA 4GAJL 4PJGE 5D7KE 4JQVA 3IXTB 1EH9A 3ZYJA 1Q94B 1L0XA 5JW5A 4YHML 4L3CA 2DF3A 3BHBA 1VFAB 4G7VL 1HHKB 3B2VL 4MAYB 5DMGC 1YEJL 4V2CB 4KJQC 4EIZC 2PCPA 2AW2A 3V6OC 1E4WH 3E6FB 5C9JB 2YC1B 3U7WH 2GFBA 1FVDB 2MPAH 3BKJH 1FYHB 4OLUH 2EYRB 1AGEB 3QUYB 2CO6B 2D0FA 3GO1H 4WI5A 2Y6SC 1LQSR 5IESL 2PR4H 2Z8SA 3DGGA 4APQD 3KXFB 1L7TH 1JTPA 1UEYA 5GSRA 5E2JA 2H8PA 2QADC 1GPOH 5IFHL 4X4XB 1Z9SA 1EMTH 3CZFA 3PIQB 4PUBH 3MRCA 5MERB 1A7OL 2QSCL 2PXYB 4NN5B 4NFBA 2DTMH 5EN2A 3WHXB 4GMTH 3RTQA 1WCBA 2CRYA 3KPRA 1JNHB 1S7VB 4G6MH 4DTGH 2CKNA 1YN7B 5FKPB 1QSFB 1PAMA 3BGAA 3RTQD 3S35X 3MRRB 1G7HA 1JF5A 4C55A 1VGKB 3ILPA 4PIRF 1BQLL 4S1RH 2HKHL 3QJHA 1MJUH 4IDJL 2X40A 1FGVL 3U4EB 1BVKA 3QQ9D 5BRZA 3DROA 4QWWC 3CD4A 3KPQA 5K9JL 2CLRB 3LEXB 3C5JB 1YJDL 2VKWA 3JVGA 4G7VH 1SJXA 4XMLH 1J86A 3ABZA 1VFBA 4NN5C 5DD6A 5DHYA 4JZNB 2VXTL 4XAWH 1R3JB 1EFQA 3VG9C 4UMGA 1BF8A 3NFPB 1LO0L 3EO0B 3OKYA 3RDTC 4HXAL 4X5XB 4XBEL 5JDSA 2ICES 4JM2F 3OXSB 3X14B 1MPAH 4IIQA 1NBVL 1QA9A 3RPKA 2VXQH 1MHPL 3PIQA 3SE9L 3AREA 1ZGLA 1X5JA 1EAPA 4XXCC 4ZPTB 2Q7YB 1J0IA 4AQOA 1SVZA 3CJJA 5JHLL 1RU9L 1I9IL 1OF2A 4XPTH 4DGYL 3OKOA 1MELA 2PYEE 1FBIH 4WUUA 4JG1H 4O51A 3RY6C 5FYKU 5LBSL 1IAIH 2X2YA 3THMH 3MNWA 1NSNL 1M6OA 5E00A 1A5FL 5KSBA 3QG7L 1UJ3A 3FFCE 3FB7B 1FNGB 4G8EB 4HPOH 4GW1A 2IADB 4PBWD 3D0LB 4X83A 3SKOA 3MJ8B 1KELH 5FV1L 1VGEL 5HVFB 4DGIL 4GQ9H 2ZUQB 3GJEA 2R8SH 4FTVB 1A0QL 4K94L 2OYPA 1HK6A 1FPTL 1NCTA 4LVHC 4Y4KA 5DT1H 1P9MA 2YD5A 5FKAB 1FO0H 1CXLA 1B0GA 3IFNL 3NIDE 5EA0L 5L88L 5CMAB 5DFVC 3OAUL 1EZVX 4PJEA 3V6BR 3VXUE 5EU4B 5MERA 5F7KC 1OCWL 1CDJA 5DHVB 1JNNH 4Q9BA 5FGRA 3B2UD 1A1NB 4G8FA 1WVZA 3MJ7A 3VXSE 3S98A 2UVFA 3MOAL 2H26B 2IALB 3T65B 5JHDB 4NBXB 4PRHB 4ZD3H 2UUDH 2H6PB 2DQIL 2O5YH 3W2DH 1AGFB 4LVHB 5EOQH 3W0WE 1X44A 3GIVB 1KXTB 5DJDB 4F33A 4P3DA 3FZUC 2VXQL 5AYQA 1AGDB 3SGEH 3L1OH 5I1GL 3RWIA 1RUPH 4JLRB 4GH7B 4O51B 3W5MA 4GFTB 4N8CL 3LRSA 3UAJC 4BZ1L 1JCKA 4MJ6B 4L9DA 3QNXB 4G5ZH 2AV1A 3GKZA 2XYCA 5I8EB 5KOMC 4I0CC 3VRIB 2CR6A 3Q0HA 5DD1L 2LE9A 4PY7A 5JDJA 4UV7H 3P2TA 3LEYH 4NO0A 5EU7C 1O7VA 4OZHF 1ZHBB 1T1XB 2NY5C 3NZ8B 5L0QC 1A7BA 3TO2B 1KIRA 4FXLA 1FG2A 1T4KA 3V9FA 3BQUB 3DVGB 4WV1A 1GGUA 3R1GH 3HUJE 1JPTH 3EW3B 4DGIH 5EC2B 3O9WC 1AE6L 4JREC 3VA6A 5JDSB 4UQ3A 3T8XB 3H7BB 3PDOB 3QQ4A 3F7VB 4HJ0D 3Q6FB 3I02A 1NLBH 4I2XA 4LGSB 4I4WB 5CKAA 4LSQH 5DRXB 1UZ8A 3QPQC 4NCC1 1BJMA 5C08E 1GRWA 2FR4B 5D5MB 2YXMA 3NMEA 3U0TB 3OJVC 4POUB 3KPMB 1U6AL 5GGSA 1FQ9C 3PHQB 3K46A 1W72H 1H3UA 3M8OH 4JFDD 2F5AL 2X44D 1INEL 4WWKA 1ZANL 5KS9B 2ITCA 2AGJL 1ZKAA 4JFFD 1TJHL 2XTLA 2VIRB 3UTZB 1KSRA 1YY8B 1FZMA 4FQPA 3U0PB 3D39D 3QAZC 2BFVL 1ED3A 3UJTH 2XPGB 43CAB 5EOCH 3GHEH 1YN7A 3LMJL 3NIFF 1IILE 3GBMH 4LSRH 2EC8A 4N1EA 3NH7L 4R2GD 1PKQE 3BPLB 5IBTH 3RUGA 1N8ZB 1BM3L 4JHAL 1F4AA 1S9VA 4NCC2 5T1DH 2XA3A 4U1GB 1T5XA 4EUPG 1P4LA 2AXHA 2DM4A 5FYLE 3FHQA 5IBUB 1P7QB 5MHSD 1EHXA 4XP1L 2JLLA 5D7LD 4WHDA 3MV8D 5INDB 4HK0B 5F72S 3DGGB 2IANB 3P77B 5DRWB 4XWGL 4U6HB 4P2OA 3D18B 3QO0B 3FAXA 4K71C 2GI7A 4HD9A 3QEHB 2ZCKH 5I76A 2DRUA 4XCYA 3WIHL 1AE6H 4HUUB 4YEEA 4WI3A 1C1EL 4FQQA 2FL5A 2VABB 2DI8A 3CNKA 2ZCHL 3MREA 4Y5XC 4NQCE 3U9PH 1JGUH 4Z0XA 2HT2C 3PWVA 5I0DA 1RUKH 1BIHA 4JFYB 5BVPL 2VDMH 5GGSY 1T3FA 2J8UE 2HMID 1QTYT 2Y5EA 3HI6H 3GSWB 5DK0A 3UBXA 2OI9C 4OLVH 1K4CA 4AJ0A 3MV8B 1T5XB 1S8DB 1XGUB 1K8IA 3O6FB 4O2CA 4S1DC 4J3XA 2OP4L 4M93B 3QG6B 4HCRA 5KSBF 5B22A 3CMGA 5HDBF 4OT1H 4NQDA 4LLVB 4P5TA 4M1DH 2YSSA 2NX5B 4JM2A 1K8DA 4WEUD 3QUXC 1MRDH 3EFDL 3QNZA 1VERA 2DIJA 4RAHA 3EYUL 1G9MC 4ODVL 4QF1A 2AK4A 2QHLA 1C5DA 2MCPL 2A6IA 3U4BL 2IFFL 5ETUA 2J1KA 2DLTA 3CPLA 4JO2L 1WEJH 3NABH 5EZOL 2VWEE 5DRXA 5T33H 3SE8H 5B4MD 2AK1L 4W81A 4HUWA 2CXGA 1DQJB 3Q6FA 3PHQA 3U2SB 3JWDL 1NL0L 3VXRE 1XF5B 4TVPL 2FJGB 3I6LE 1UZ8B 3WNPA 2JIXB 4GS7C 1B4JH 3FQTA 4V1DD 5HJ3A 4FRWA 4BZ2L 5SWSD 4HULB 4FABH 4KH2A 4MJIA 1AH1A 5IB4B 1YPZB 1F45A 1ULVA 5GISL 2BSRB 2UYLA 2W65B 5I74B 2EDJA 3QFJE 2D31A 5FUCC 4ZSOA 3O4OB 4MNGA 1XGPA 2MOVA 3I9GH 1JPGB 2VB5A 3D48R 1LO4H 2XTJB 4LRIC 1QSZA 1RI8A 3HPLA 4QNPE 1AO7B 3SJVB 4Y4HB 3PQYA 3MV9B 1INDL 3QEHA 5CAYB 2CDEB 1A7OH 3TA3D 5D72L 5A16A 1TQCB 2OL3L 1CXIA 5FM5M 1AGFA 3KLSA 1NGYB 4U6YA 4NT6A 5LGHL 4ELKB 1AD0B 3CDFA 3JWOL 1JF1A 5EH1A 3OR6B 4U1JB 2FRGP 4QXGL 5MENA 3VFWA 2HG5A 3VDAA 2WIIB 3QA3B 5IW3A 3WS6A 3C2SA 2BXYA 2DKMA 4U6XB 3QCVL 1F4HA 2D03L 4PJ8A 4XT1C 3MV7A 2G9HA 4NQDE 2VDPL 1QFWM 3LQAL 1DVFC 3SE8L 5D7IA 4P4KC 5KSUB 2VDQH 3MCLL 2ARJQ 1MFDH 2AXFB 3BISA 3WNNA 1XR8B 3JBG7 5CJQL 4EUPB 3I50H 4ZFZA 4MXVE 2PTUA 4YGAB 4MWFB 3LQZA 3O6KH 1PEZA 1ZV5A 3TPUB 2A77L 4ZXBD 2EDBA 3ZSSA 5JORB 1AHWC 2R4SH 2CGRL 3CFDA 5JTWA 3QUXD 1I9JH 4L3AA 5HYJD 2NZ9D 4XCEA 4DVBA 4WI9A 4JKLA 5GIRA 2JCCE 4H5SB 1AGCA 4U3HA 1D5XA 4OZFA 1WF5A 3INUH 3WFZA 1HIML 1CE1H 4HCRL 3H6JA 1IGYB 1UC6A 4Q2ZB 2R2HA 1E6OH 4PBXA 5D96B 1AR1D 4LCYB 5HYEA 1GCFA 5GZOC 3QWOB 4DGVH 4XNZB 5EUKA 3MNZA 1MIEL 2UY6A 3O2DH 1S9KC 3NCCB 1JPSH 3TVMB 4PJIE 5T5NF 4CVXB 4N90D 2FX9L 3ZMRA 1AXSA 1UXWA 3EOAA 4QO1A 1MQ8A 5HYQB 5C86A 3SBWC 1AQKL 2H9GB 2QHRH 3IF1A 2G60H 4S1QH 3IETA 2A6KA 5IB1A 1CN4A 3V4PH 1WK0A 4NQEB 4KKNA 4NC2B 3IDXH 4QRPB 5KVDH 1VFBB 5DHYB 3NFNA 3QDME 4ODSH 3LQAH 1TPXB 4MJ5A 3UTSA 3MBEA 1LP9B 3BDXA 5IJKC 4RZCB 5E8DL 1UH4A 1ZSDB 4HIJB 3TPUA 3PG2A 1KYOK 1FE8L 1JI2A 1XCTA 1E4WL 4ZFZB 1I1RA 1J1PL 3LN9A 2DWDA 4OBSA 4GAGH 3E8UH 3DX6B 3L6FA 4YPGB 1BZQK 3V7AE 2VSDA 1A14L 4DK3A 3VFOB 1GZPA 4U2YA 1DSFL 3P4MB 2BOCB 2GJ6A 3OF6D 3TA3A 1YC7A 3KS0H 5HPOA 2W0LA 4U05A 4LCYA 4OQTH 3IU3A 3TLRA 3WL9A 2J6EA 5C2UB 5E08H 1CZ8H 2DYPD 4UV7L 4W6WB 1M71B 4Q6YA 2P24A 3I6GB 4Q2ZA 3TT1H 4NQED 5TE7H 1MLCB 1EMTL 1NFDE 4PUBL 4TSAL 2F53E 2FSEA 1CD0A 3FB7A 1AGDA 4G3YH 4IMLB 2CDEA 4K8RC 2Y1VA 3WLBB 5JLZB 1MJ7H 3MGTB 5IMLA 1AKJB 3GI9H 4RFEA 4JM4L 2DAVA 1NLBL 4OGXH 4PJCA 4PJ7E 4KK5D 4UUJB 3AM8C 4LSQL 2Z31D 3GI8L 4NJ9L 4JFXA 4YHZH 5DEZA 2P5WE 5F6HI 1ONQB 1TENA 3BJLA 4GG6B 2BVOB 1WBYB 3SGJC 5HVHC 4FNLH 3KAAA 2NY5H 3QUML 1UFUA 4X4ZA 1U93B 1QFPA 4ZFFA 3QUMB 3DXAD 2EDNA 2B8OT 5FO9A 2YN5A 2BJML 1JGVL 3ZLQC 4M6NH 3WJLC 3LDBB 4RBPH 4ZXBB 3DO7A 2XRAL 1A4KB 1MPAL 3LKRA 1KNOA 4OJFH 1ZLSL 2BNRE 2FH6A 4LGPB 2H32A 2X4NB 5LAXA 3VMNA 4JRYB 4ETQA 4MJIB 4NQCD 1NGXB 5ACLA 4XPTL 3O9WB 3KXFD 5CP7B 3QIBB 4HS3B 4JG1L 1JGDB 3CUPB 4Y2DA 5B38G 4JDVA 5BXFB 1S9XA 4RAUB 4Y4HA 3THML 1G7LB 4JPVL 3KPRB 3H7LA 1MHEB 1YDPB 2IQAB 3WLWD 2C5DC 2C4FU 1RZKL 1U8KB 4Q97A 1N4XL 1ZGLB 4HXBL 4BFIA 4NHCL 1CLZH 3U9UA 5IMOB 3HLAB 5FDYA 1N2RB 5I2IB 3RL1A 1P69B 1ETZB 2XWTA 3OZ9H 4PJFB 4GBXD 4PRHD 2ZOKB 4YHKL 5KG9A 1OWWA 3OAYH 5D96C 1C1EH 2BSRA 4LEXL 1BQHB 2BCKB 2FCBA 5F6IB 5D7JB 1DDHA 5EU3B 1DBKH 2F19L 2APVA 4PJ9C 2HFFB 5T5NG 3LEVH 1FO0L 4XP4L 3TN0C 4M61A 2YPLD 3VXTB 2Q86A 4JZNA 4GRLC 1SBSH 3K80A 4NCDA 1A4KA 3VDBA 3HE6D 4WY7H 2DWEA 3MV7E 5KSAA 1WZ1H 3MV9E 3TV3L 3IDJB 4D0BA 1H0DB 2KZWA 1I1CA 1FHGA 3WMSA 1MFBH 5BW7C 1XF4A 5JUEL 5C0BB 5I1AA 4M6AA 1I4FA 4XVTL 1KGCD 4OT1L 4UT7H 4X7SL 12E8H 3MRRA 2DQIH 4ZTOH 3REWB 2X4TA 4NYLA 4Y19D 5J56B 3PL6B 2W9EH 4S1SH 2NY6B 2HJKB 4OGYH 1FL5B 3RWDA 3IJSA 3VXRA 5CHNB 1JHLH 4K8RD 4NN6C 4K71B 4XP9L 3MRHA 5HGHB 2WIIA 3QA3A 5I6XC 1XF2A 2J6EL 2L7JA 1QVOB 2C1PB 2VDRL 4Q6IB 4YNYB 2EDKA 5DVNA 2W9DL 1RUMH 4J3OC 4H1LB 4BZYA 5CGTA 4OZGA 4DKEL 2HA1A 3EJYC 4PJAB 4CADB 1WCQA 1JHTB 4ELKA 3QXDB 3DIFA 1BQHG 4FQCH 2GSGA 1VPOL 4FFYH 4FQ1L 1EJOH 3I3DA 4OCRH 3ARRA 3D0VB 2QQKH 4UOW1 1EGJL 4MDJA 3WUWB 3FQXA 4MYWB 1WT5A 5DLMH 1UKSA 1FFNB 3I6GA 5BW7A 1NCDL 1O5DT 4LSSL 4BFGA 3U30C 3V4VL 4U6TA 3OZ9L 4YZFE 2DI7A 2QV2A 4HBCH 1DANT 4FOMA 4LEXH 4M5ZH 1CG9A 4ZYKB 1J1XL 3N1QC 3W9EA 1DBAH 3P4MA 1RUAL 1YPZE 3WJJC 4Z9KB 1JRHH 1N0XH 1YY9C 1NAKH 4JDVB 3CK0H 3MLXH 4HDIA 3ZDZF 3ULVL 3LRGA 3NZHH 5C0AA 1JFQL 1YPZA 4MXWL 1A6UH 1I4FB 2W07A 4WO4D 1AC0A 1M1SA 4CMHC 3FQTB 1CICA 1L4IA 2FJHA 5FDWA 3ALXA 4V1DB 1FJ1B 3SDAA 4HX1A 1TETH 4RGND 1V8HA 4JREB 3BMVA 4K7PY 1RAMA 3NH7H 5I73C 5SV3A 2NY0B 1WC7B 1N6UA 3QNYB 5E4EB 4JB9L 4FQXA 1MHCA 3QT2A 5DUMH 4UQ2A 4NRXB 4JY4A 4GBXA 5E8OB 4F2MB 4P23B 5CZKA 2EYSA 3BPOC 2P5EE 2JB6A 3O6MH 2IANE 4JFED 4DQOH 5JQ6L 3HUJA 2GTWA 1HXMB 2VLMD 3QULA 4BJLA 5FA3A 4TPRH 1U92B 1YJDC 5GXBB 4QYOA 1G0DA 5F7DB 4QHMA 4GRMB 3AS0A 2C3WA 5CSBA 5FHAH 4XNXL 3MACL 5TPWH 1NJ9B 5DF0A 3EOBA 4MVBD 1QPXA 3T09A 5E2UH 1KEGL 1F4WL 4RX4A 1QBML 2EDFA 3RIAF 1NLDH 2P8MB 2APFA 4WNQB 2FSEB 4NC1C 3IFPA 4IRJA 4O4YH 1JRHI 1J1XH 4IJ3B 2XXMB 4O2FB 1LE9B 3PHSA 4NFDA 5C0GA 4ELMB 1CK0H 3WFEH 3GMNA 4WFGD 4ODHL 3ZYIA 3QHZL 4U0RC 4Z77A 1UWGL 3FQNB 1F4YL 3NIGE 5DMIH 4JN1H 1BZ9B 3NZHL 4EXPX 1EHLH 4JZJA 2W0PA 2XQYK 4JY6B 2VYRE 35C8L 2VN7A 4IS6B 5HHQB 4OB5L 4PY7B 3GIZH 3WKMH 2VXUH 4KY1L 3V7MA 3GMLA 1U3JA 5FCSH 4AT6B 4FA8A 4NBYB 3B6SB 1BFVH 2F53B 4NP4L 4P46D 3CX2A 3JWNC 2A9NL 1FFOA 4O2EA 4IJ3C 1U58B 4XRCB 1K6QL 1IGJB 1RSFA 2R4RL 1PQZB 1V7NH 3ORJA 4LEOB 5DD0L 3GIVA 3EJZD 3ILQC 1FFPB 2MKLC 4GW5B 2K7PA 3TA3C 4GSDH 1HSAB 4YXKL 2FIKA 1IFHH 1MCOH 4UBDC 2KL6A 1A1OB 2A2QT 3MRQB 3HNVH 5DJ8A 2Q3ZA 3O45B 2IADA 4WIQA 4S0SD 3RVUC 3S3JA 4JANB 1PG7H 2YMXH 5ERWB 4PJ5B 2BDNL 5GZOD 3T3PF 3VXSB 5MENE 3T2OA 4K07A 5E94A 5C08B 4RFNB 1IAKB 4F8QA 1QLRB 3QQ3A 4GOSA 1AQDB 1HQRB 4OAWA 5GRWA 5C0BE 2GW5A 5JPNB 3S3SA 1LP9A 2WWKT 1E6JH 5ACZB 1YMHB 4O4YL 1GOGA 1QNZL 2ESVE 1RURL 4JAMB 3ZT5A 3BH9A 4Y1AA 4PG2C 1F58L 5ICZA 1H3WM 3SGKA 5CIPB 2W1NA 1IQWL 4I2XB 4PJDF 3EOYG 2I24N 3EFFB 4OFIA 2CK0L 2IG2H 2P5WD 3ARFC 4CL7A 2Y36L 2YD3A 5GS1B 1D5XB 1X5YA 4J1UB 1BREA 3RTQC 1MCPL 3Q6GH 3KWWB 2XKUA 2P5WA 2CUHA 4M62L 5D1QA 5L2JA 3H9HA 5KVFH 2ORBL 4M8VA 4ODXA 1OM3H 2OL3H 5IUSA 5BZWA 1LO3L 5BS0B 5BJTA 5GZND 2DQFB 1NQBA 1HH6B 4LKXB 5F96H 4I0KA 2JB6B 1A6VH 5FYJU 4DKDC 1AJ7H 3NOIA 3CPLB 4EUPA 2EECA 3MRMB 3RAJH 4DN4H 2BNRD 3H8NA 5TDNA 1AXSB 4WI6A 3W0WD 4YHNA 4APQA 2R0KL 1YEHL 2XY2A 3O45A 5DJ0A 5E94B 4EN3C 1PBYA 1CXHA 3HCVA 5TQ0H 5IKCB 3NTCL 3O3EB 4PJ7B 2RAMA 1T66D 1I1YB 3FOMB 4O58L 1D6EB 4LNRB 2FIKB 1TZIB 4X98A 4XNYH 5FYJH 1V3MA 1ZT7B 2FD6H 3MLZL 3TJEL 5EB9A 3L3JB 4QY8B 2D2OA 1QQDB 1HH9B 1IC1A 4HC1H 4OFYA 5KVEL 1GGIH 3OAYK 2V7NA 4BSWA 1JYXA 1HYSD 4ZSOE 3HMXA 4OZFB 1U8PA 1JV5A 5F7FA 3O8XC 3FTGB 1H3TA 3AMKA 3BXNA 3FT2A 5BMFH 1BX2B 5AEAA 1NFDF 2Z31B 1RURH 3I2CL 4AEFA 4KVCL 1KJ2L 5EPMA 1FZKA 1AO7A 3SJVA 5F70A 5C07A 2F53A 2NY4C 4YE4L 2OZ4A 3T2NL 5JW4N 4DCQB 2AVGA 5KTEH 4F7EA 1XIWA 2DLFH 4TSCH 4WHCA 3CZFB 4OCYL 3RGVB 5C07D 4M6OL 5JNYA 4TULH 4KVNL 1FNSH 4PGDA 3X3GL 5GSRB 3LIZH 4WU7B 3BGMA 3LS4H 2KBGA 5EBLB 5C2BH 2GCYA 3TWCL 2X10A 5EG6C 3IXAA 4I5BA 3KLDA 5CEYB 5C6TL 3MJ9H 2P8MA 1ORQA 4JDZA 4NNXA 2R56H 3SCMD 4HAGA 4OLWL 5FYKH 5ISZD 3U7YH 5JPMA 1H5BA 2FEDC 1TVDA 1BFOA 1AR2A 4NRYB 4P0DA 4QRQA 2FX8H 3O2DA 1C5BH 4LKCB 3HPLB 4NKIH 3ZE1E 2HKHH 5J6GA 1YEJH 1ACZA 3BW9B 4QHMB 3A0OA 3GRWH 3IFOB 3IJYA 5C8JA 4YIQA 1KXQE 3P4LA 5GJTL 1NCWH 4H20L 3X17A 2J4WL 4HIEA 2NLJA 4B7IA 4WFFE 1Y18A 2AAVA 4QF1B 1WFTA 3MYJA 1H3GA 5ESAB 2EYSB 5E6IA 4S0TD 2ESVA 5TFSH 5LCVL 2DBLL 3GJFK 3QO1A 2JF1A 3IYLW 5BV7H 2ZSWA 4ZAKD 2E9BA 1XF5A 2CDGA 4HUKB 5C0IB 2AABL 2DWEB 3VG9B 2WMPA 4KQ3H 2IAMC 1DFBH 3BD4A 3M17A 1JHLL 1ND0B 5DJAB 3RPIA 1SJVA 3NIFE 1K8IB 3AVEA 1KJVB 4MSWA 2QQNH 5HGDB 3ZL4L 3RWCA 4PV8B 3SQBA 5J9PB 5GRUH 1MI5A 3QH3B 2EDRA 2QEJA 1Z6JT 4GT7A 5GS2H 4FQXC 1G6RB 4X6EA 3QBTB 1JGLH 1WITA 2A38A 5C0BD 3VXOA 1IE5A 4QHNA 5C09A 1VPOH 3W0WA 3DVFA 4P5TC 3LIZL 3LB6D 2BNRA 3MFFB 1KB5H 5J6HA 1YDPA 1J0YA 3SCMC 1GSMA 1RFDH 4UTAH 4PB0L 1CICC 1KT2A 4LCWB 4NZJA 3F7YB 3MO1B 3LN5A 1GGBL 3PABB 4KWUA 3BYYA 5ITFA 3S5LB 3V95A 1I1AD 3LSOA 4QHKI 4UINH 5D7LB 5CGMA 4XVSH 2I60L 1DEEA 1UYWH 3OJMB 1J11A 5CJXA 25C8L 3EUUA 4JZJC 3UXFA 5DMKA 3TGXA 5EC1A 2A1WH 3CSBA 5GJTH 3PGCA 4OUUB 5F9OH 3QG6A 2YD4A 3ROLB 3SEPA 2V17H 3LKNB 5F7EL 2UY7A 3MJ7B 1O0VA 3L7EA 1IQDA 4LSVH 5DVLA 5E1AB 5HSFA 3S4SA 5CEZL 3T0EE 1MRCL 4G7YL 1T3FB 3T1FA 2X70B 3QZWG 1JVKA 3JXAA 3VXRD 5LQBH 3LV3B 3PHOA 5IG7A 4UT6H 3QXUA 1QRNB 3OPZL 5BS0E 3VD7A 4I9WD 1HCFX 5GGRY 4WDIA 5TF0A 2P8PB 1DJSA 5FGBA 3JTSA 3M1BA 4C59B 4XMKH 1YNKL 4X4MA 3PV6B 1SJHA 2WWKO 2C3GA 5K9OA 3GJEB 2WBWB 5JQ6H 5F1NB 5ISZA 3I6KB 1V3LA 4TYUA 1MH5B 2R8SL 3FO9A 4FZEH 1A0QH 3ETBF 2K7QA 4FFWC 1X9QA 3STLB 1G9EA 1MLCA 2P42B 4U1HB 4KZEL 5EBMA 1FNHA 1JJUA 2VUYA 4Z7NE 3S5LA 2HVKB 1NUFA 3QRGL 3U83A 1I7RB 1NEZA 4XHQA 3SDXB 4KZDL 1N6QL 3D5OF 5KSAD 3GMOB 3LEVL 4XP4H 1IM3B 4ONGL 1AGBB 4FXKA 3TZVB 1VENA 2YPKA 4JFFA 4J3SA 2HFGL 2JCCA 1GGCH 2YD2A 3CAFA 4U0QB 1YNTA 5GGRB 1CGTA 4K3JH 4Y5YC 1CFQA 4UIKH 1F2QA 1W72L 3TV3H 3REVA 1K4DA 1UVQB 1KBGL 2DQHL 4AL8L 5D1QB 5E9DE 3TYFB 3HG1D 1NDMB 3WSQH 4WI8A 4AK1A 5JO5A 4AY0A 1A47A 4HWUA 5L7XL 1MI5B 3BPOB 1FH5H 4HW6A 4HH9A 3MRIA 3P30H 4NQCA 1P4IH 1PY9A 2FATH 3OB0H 5GS1A 5ADPL 1H8NA 2VQUA 3FB8A 2Q3AA 4U7SA 5IK3B 4Z7VF 5GGTA 2F8VA 3IF1B 3MLWL 4NQSA 1OT1A 4R97B 1A1NA 3V5KA 4XPGH 5HPMA 1QBLL 4NKQB 2IEPA 5J7CC 4DCQA 1VESA 1AQDA 1HQRA 4J8RB 1ADQH 4FQCL 1VADA 4QRTA 3L3HB 2FGWH 2R2CA 4F33B 4K3DH 3VW3H 5DVKA 3I84A 5IMMA 5FGBC 1FNLA 4HIIA 5T1KA 2D0HA 5C0FA 4H0IA 2V2XA 4N1CA 3EIFA 2EZ0C 4XC3L 2V2TA 1KLUB 4L9LB 5DK2A 2CR3A 3ARVA 2GY7B 3RDTD 3SO3B 4GW5A 7FABL 4X6CF 1U6AH 2V5TA 5D7JD 4MD5A 2PYEB 5DTFB 1XEDA 5EU4A 3RHWF 1MEXH 3VFMB 3IGAA 4HKJB 2ZCLH 4GG8A 3NAAH 5E70A 1A6WH 4MXQD 1F4XH 1OAQH 1YUHB 2AJVH 4WW2B 1NPUA 4G9FD 4RMWA 1ZT4B 1B0GB 2NY1C 4DFIA 2HRLA 5J89A 1XIWD 1KTKE 3E6FA 5JW3L 5IQ7H 4XNMB 5FUCE 4ZUVB 2O61B 1HHHB 3VFNB 1W0VA 3EGSB 3DVNB 5I8CB 2ZUUA 5HHQA 3CC5B 2GJ6B 1A6ZA 2UWEB 2YD1A 3MA7A 2OR8A 2VXVH 3CFJA 1JE6A 3O2VL 1C08A 1M7IA 3QDJA 3NBNA 4Z7QF 3ZKXB 2EE6A 5CJOL 2IAMA 5HYFA 1HILA 3F7RA 5ALCH 3WNKA 3SCMA 2MHAA 1D3CA 1RPQA 3MQIA 4PGEB 5HGAA 1Q1JH 1K3IA 5ID0B 1P7QD 4PJIA 5I1JH 2I9TB 5IQ9A 5KZCD 3UYRH 4DKFL 4YX2H 3O0RH 3DSFL 1IZJA 2OR9H 3MLZH 3FCTB 2OS7A 4J7RA 5CWSA 3WIHH 4UU9B 4V2BA 5KOVC 4N8VA 3ILPB 1T89C 4M1CC 2H3NB 4R8WL 3U6RA 3DX9A 1MHHA 3TO4C 1J8HE 4AMKH 5FHAL 5FA4A 1R0AL 4YUEH 1U8JB 4IHOA 5EBMB 5A2FA 3P11H 3IDNB 1RZGB 4KJPC 2XFXA 1U8NB 3T77A 4K94C 2RFXA 3GJFA 4KROD 3HC0B 2D31B 1CVRA 2GAZA 3ZE2E 2Q76B 1F4XL 1UM5H 2DLFL 1TVHB 4PJGB 5E5RB 5DMIL 4POYA 4XXDA 4FFVD 3C8HA 4GXVL 5C0AB 1OSZB 4N9GB 2FZ3A 3G6JA 1YEDB 1R3LB 1IAMA 4IRSC 3HG1B 3EDJA 2UZIH 4ZODA 5EBGA 3EYUH 1II4E 4HS6A 1LEKA 5C2BL 2EDEA 3MODH 3V0VB 1EFXD 4F3FB 2Q8BL 1DQJA 4CW1B 5GGTL 5C6TH 3BPLC 4U33A 5E4IA 1CI5A 5TJWK 3MLRL 2IFFH 3O2VH 4CBPA 4OLWH 1QHOA 3PDDA 1NCBL 1YEIL 2WZPD 3PV6A 1R5VA 1CQYA 3L7EB 4N0YH 1BMGA 1IM3A 2MFNA 3O8XA 3UTSE 3CXDL 3VXPB 4QXGH 3F7PC 4X7TB 3BDYL 5I16A 2WBJD 1DQML 3TBVA 1D5BB 4XCFH 5DRWA 2AJYL 3LV3A 3P9MA 3PHOB 2DYPB 2E27H 2YKLL 4PJXF 4OZGE 3VH8A 5DMKB 4GG8B 5GZNC 4OIIL 4Y16D 3SKJH 3VD9A 2Q6WB 1MCLA 4PGCA 4P48A 4CADA 4UDTB 4YHMH 3WBDA 4K3EH 2YMXL 5C0AD 3EYVA 1MFDL 4JRXB 2WINA 5IB3A 1KCRL 4R4FL 1H15B 5F9JA 3DMMC 4KI5F 4P4KB 2I07A 5CBAA 1S7QB 1XH3B 2VL5B 1U3HD 5A2IH 2CPCA 2MNUA 2MWCA 2X5PA 1RZIA 3ARBD 5TDPA 4HWEH 1NGYA 1Q94A 4HAFA 5EO0B 3BKCL 1AHWB 1OAYH 3W9DA 1ITCA 4OZ4B 4N0FA 5IHZB 1F6LL 2YRLA 5TF1H 2XTJD 3HA0A 4HGWA 5DXWA 3MFGB 2IQ9L 1CD1A 3S3PA 1T1WB 1L7IH 3DXAB 3GBLA 3HNTL 4GKNB 4OLYL 4H8WL 4QRUA 5DVOA 4C4KO 4N0CC 3DMMB 5GGQL 5IVOA 1PSKH 2LAAA 2W65A 4JJ5A 3F7QA 4PJEE 3RVUD 4WW2C 1W0YT 1EO7A 2D3VA 4GKZB 5I1CL 3NCBB 1OM3L 2BSSA 2JK5A 4F58H 4Z7VE 3NCJL 5JO5B 1J1OL 2FJFB 4P3CH 1QSVA 3H9SB 4Z8FL 1QKZL 3KPSA 4XH2A 4U1MB 1TVHA 4PJGA 3TO2A 3B2VH 1IT9H 2ZUXA 5DJXA 4M7JH 1A3LH 2G60L 4OCWH 5D7LE 4JY5H 4GAYB 5AUMA 2HYMA 5J6HB 1U8IB 2CH8A 2LTQB 4JFOA 4ENEC 3F5WA 2JELL 4CNIA 4OCXH 3I75A 4HZLB 5EZLB 1J8KA 4G8GD 4QTHA 3S97C 1JWMB 2V7HA 1MWAB 3MYJB 4GBXB 1GGIL 5HY9B 5B8CB 4Z5RB 3SGKC 1VEMA 2V5SA 2Z92A 1H3VA 2NW2A 1K5NA 3RX8A 4R0LC 4M7LL 4DK6A 4NZTL 2PW1A 4YXHL 2CKBH 1U8LB 2APBA 4UT6L 4WU7A 1G7PB 2VISA 4D9QD 2ZG2A 3M17B 4R7DA 4JM2B 1A6PA 1AKJD 5IV2B 3FO1A 2XWJA 1GH7A 3LN4B 3D69A 4P2CG 3RWHA 3DHMA 3AS2A 1CF8L 4PJ8C 5E08L 1JNLL 43C9A 3KG5A 3GMRA 2BSSB 4OLYH 1G9ML 5SX4I 1JI1A 3E3QC 1KJ2B 1B90A 1ZT1B 3TBVB 3CC5A 2A74B 4CMMA 1LWRA 3PWUB 3OXRB 1AQKH 2Y6SD 3OGCA 3TC9A 4R4ND 2CIIA 1W72B 1HYSC 1ZHNB 1NBYA 4IMLA 4ZYKA 3UP1A 4GAFB 2C7UA 2XKNA 4YGVB 1FV1B 4CVWA 4L4VB 1I7TB 3GGWA 2ENSA 4RFEB 5ANMB 2R1YB 2VR4A 5LWYL 3F6LA 2PUQT 4X9FA 2A83A 3QDGE 1TITA 3P73A 3TBWB 4JG0L 4RGNC 1FDLH 1U8QA 5L0QB 4LRIA 3RJQB 2BHYA 1UB5B 4DJMA 2CUMA 5F3HA 2NY5L 3RNQB 1K2DA 3QUKB 4RNRA 4NKMB 4BA8A 1HH9A 5HVHB 3JSSA 4ZFGL 3AREB 2BJMH 3S9DB 3EYOA 3KVQA 5CP3H 3RZCA 4BQCA 1MCRA 1FL3A 4I8DA 5SWZD 3C8KB 3QUZC 3OXSA 3X14A 4ODUA 1MHEA 3HCVB 5IKCA 3BZFB 1YMMD 3BPNB 4DW2H 2GY5A 2ADFH 4O9HH 1JGDA 4PRBB 4HPOL 1MF2H 5EUOE 2KUTA 1L9NA 3QB7C 4RISL 1LVEA 4K7FB 4Z7WB 3MRGB 2NYYD 1GZQB 1IAIM 3O11B 2EKSB 2P49B 3W82A 4I0PA 4HIJA 4JPVH 1QHPA 5DQJB 3T2QA 4BSJA 1MREH 3DI2B 2X4QA 1FNGA 3QFDA 2IPTH 3C60C 4R4BB 4R7NB 3TYGH 2NR6C 2XTJE 2BVTA 5L88H 2DQEL 4OZHB 3SE3C 4J1UA 1MCSA 2VTFA 2P5ED 1NC4B 3RKDC 3FN3A 5AZEL 3F65A 1DBKL 2F19H 4NQEE 3RWGA 4DZBB 3RY5A 3TBSB 4JVUA 4LSPL 4ZPTA 5IMKB 2NNAA 4XVSL 2ZZUT 3EYOB 4L3EE 4XPHH 5TQ2H 4LMQE 4Q9QL 1HH6A 4X4XA 4U4BA 2B0SL 2BRRH 1OW0C 1IGYA 2O5YL 2XY1A 4OF5A 4XI5C 3UZEA 5HHNB 3M8OL 4MD4B 3AU1A 4UNVA 4RGOH 5F9OL 3SN6N 2AGJH 5BXFA 1YEFH 3T0BA 1MCBA 3ZTJH 3VXME 1IEBB 3BEVA 2YUVA 2V9TA 3RDTB 1MVUA 5IHUL 3FCTA 1NAML 4X4YB 3GBML 2W0FA 4I0PB 1LO5A 3QXWA 3S37X 1IKFH 3O3BA 5EIVA 1W72A 4KRLB 5CZVL 3JWOC 3GSQA 4PRIB 5FOBA 2Z91A 1QSEA 3L7FA 4FMFA 4LPTA 1DBBL 5CINL 2DQDL 1CD9B 2VDRH 3TP4A 4MJIE 5DA4A 2XG5A 5D6DA 4ZUWB 5E03A 5HI3C 4J8RA 2B1AL 4AEIL 1S7RA 1ZLVK 1ZS8A 2KH2B 2XA8L 3IKCA 3FTGA 4WO4B 4G6AC 3HC4L 4CDGC 4X8XA 2ADIB 1EJ6A 4PJ8B 3MUGA 3TFKD 4QRRD 5F9WC 1LDSA 4LCWD 4I3GA 4X99A 1OW0A 1UB5A 3CCHA 2VQ1A 5B38A 4YBLC 4OV6F 4ONOA 2QSVA 4RSVA 1RUAH 2ZKHL 1UH2A 3VFRB 5DTFA 1AO7E 4L8SC 3SJVE 3MLUH 4Q9QH 2EDTA 3QEQA 4QHLA 2ICEB 3HE6B 4NC1E 1UJ3B 1P4BL 4G8EA 1DEDA 1IAII 2ATKA 5KANG 4KUCD 4Y4KC 1KCKA 5CCKL 1NBYB 2YEZB 3QFJA 4OZIB 3TM6A 1R6VA 1ZA3A 3OXRA 5C92A 3UPRA 3KYKH 2EIZB 3PWJB 4JPIA 1EV2E 4HJGB 5BJTB 4GW4A 3Q5YA 4XP5H 1ZTXH 2PYFA 3DECA 4AEEA 2F8OA 2A6DB 2JJUA 5SWSB 4KMTL 3N06B 3U4AA 5CEZD 2VLKE 3HKFA 2IMMA 2XWJB 4ZS7H 2DQDH