1YNLH

Identification of key residues of the nc6.8 fab antibody fragment binding to synthetic sweeterners: crystal structure of nc6.8 co-crystalized with high potency sweetener compound sc45647
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
219
structure length
219
Chain Sequence
b'RVQLLESGAELMKPGASVQISCKATGYTFSFYWIEWVKERPGHGLEWIGEILPGSGRTNYREKFKGKATFTADTSSNTAYMQLSSLTSEDSAVYYCTRGYSSMDYWGQGTSVTVSAAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPSGPI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig gamma light chain
publication title Cocrystal Structures of NC6.8 Fab Identify Key Interactions for High Potency Sweetener Recognition: Implications for the Design of Synthetic Sweeteners
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 42
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2005-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ynlH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ynlH02
3GMOB 1TVHA 5I73B 1ORQB 5FA4A 3GSVB 4G8GD 1OAQL 4XMPH 3SGKC 2A83B 5BRZB 2C7UA 2CDEB 1OQXA 5C86A 4OCWH 4G5ZL 4HBQA 2BDNL 1OWRM 2VQTA 4I3GA 5B4MD 5I1EH 2AEQH 3F12A 5ICXA 1NBZA 1QVOA 4JM4L 1PG7H 5DZLA 1KCUH 4HS6B 4QXUH 4G6AC 2E7BA 4OF0A 4IBLT 3QIBD 4JGUA 2YC1A 1VCAA 2VITA 5ILTH 4HH9A 1EEYB 5HDQH 3B9KD 3V5DB 1LO0H 5J8OA 1FLTX 2RGSA 5I30L 3IFNH 4QRRE 2IANA 2FEEL 5C09A 3CVHA 1XGYL 5HI4C 1SJEA 1QACA 1ZVSA 4HT1L 2CR6A 1U3HB 5HSFA 2F54A 1NGPH 4DEPB 2QQLL 1LK2B 2PR4H 4TSCL 3VFMB 4RWHA 4A6YL 2HJFB 5GS2D 1NAMB 1YJDH 4JZJB 4XX1G 4LLUB 5CBAB 3I2CL 3MCKB 3SDDA 3I3EA 4OF3A 2YD9A 4PGBA 4P5TD 3NABL 2I60L 2X89A 2B4CC 4PYHA 4G6ML 5D70L 2YK1L 3CDFA 5T3ZD 2V2XA 3OB0H 1QSED 1W72A 4IJ3C 1MVUB 3QCVL 4ONFL 5HYEA 4YHNA 2J3SA 5GZOC 2EDDA 1IQDB 5CP7A 2DQIL 5F7KC 2ZSWB 2PXYB 2P24B 3RWJB 2VL5B 2OK0L 5B39G 3AMLA 5GRJH 2WP3O 1FCCA 2VZ3A 1UH3A 4WFEE 5C8JB 1A4KA 5CD5D 1AQKH 3KS0H 5KVFL 4U1HA 4K7PY 5F6IC 4DGVL 1DN0A 4L4VB 5E6IB 5E2JA 4JLRA 5I1IH 2VDQH 4WIQA 2W38A 5DVMA 4NQDA 1IEBB 3BMWA 4PRAA 2DN7A 2VLKB 3SKMA 4A2MA 1T0NA 5IEHB 3U30B 2XWJA 3VW3L 4NRXB 1I7UB 3V5HA 4AQOA 2VLRD 1AGBB 4F7CA 4HGWA 5MEND 3IFLL 2Z35B 3QDJD 3JV4B 3M1BB 1ND0B 3HC0B 2X4NA 1I9IH 3LAFA 5I1GL 1DVFB 2D03H 3N85L 3BZ4A 2ZSVB 5D1XB 1TLKA 3V4UL 2MPAH 1KCSH 1AKJD 4PJCB 5FIEA 5JORB 5K9QI 3MV9D 1FL5A 5HHPB 4WV1C 1OTUD 2A6KA 3UTQA 3RWFA 4FQJH 1T4KB 1W0WB 1EJ6A 2JTDA 3CXDH 2RQ8A 3GHBH 1H3VA 4ZXBC 5HGAA 1IAKB 1T5WB 5MP6L 1MI5A 2NY4C 4EOWL 1XIWA 3FRPA 1KC5H 3CCHB 3KPOB 1UJ3B 1UWXK 4W70A 2SEBA 4PY8J 3UJJL 5EO9A 1MFEH 3ARZA 1CIUA 3LQZA 4TUKL 2BK8A 3GSRB 3MLSL 5ICYA 5C0FB 4QO1A 4WHCA 1P4IL 4X4MA 4Z7OF 3UDWA 3G9VA 1WEJH 2P44B 3Q3GB 1KT2B 1CXEA 1G0YR 1GGUA 3R1GL 4HK0A 3FFDB 4S1RH 4HUUA 3QUYA 1P5UA 1S7RB 2UZXB 2DQEH 3TO4C 2R23A 3P30H 3OX8B 1J8HA 1FCGA 3I02A 5CILH 3FN0L 1N26A 2FIRT 2JIXB 2HLFC 3PGDB 3W39B 4OD3H 1T3FA 2JJVA 3GBMH 3PWPA 5A2FA 5HYJA 5MENE 4HIEA 5CUSH 3T4AB 1BWWA 1ZTXL 3QIWB 1NCAH 4M3JA 3QDJE 1FN4A 3OHXA 2APWA 4M93B 5IBLC 4OLEA 1A1OA 2IEPA 1C08A 3DARA 3VG9B 1J0HA 5J56B 5GGVH 3C5SA 5GGQH 1S3KH 4JY4B 1W0YT 2J4WL 3ARDA 1S9VA 2FX9H 3KYOA 2D9CA 4G8IB 3E1F1 1XF1A 4HMEA 4X7CC 2BXYA 4OD1H 4MNHB 2APVA 4JQXC 4OUUB 4W4OC 3BMVA 2EYTA 3FO0L 3V6FA 4CVXB 2HG5A 4U3HA 4EI5A 3JWOL 5INDB 5KW9H 1N2RB 1XGRA 4YHPA 1JTTA 1ZKAA 2X4OA 2Y5TB 2XWBB 5DJYA 1DUYB 4PRHA 3VFSB 4QRQA 1FH5L 1KCVH 1A6WL 4XBGB 1BVKB 1R3JB 1FBIH 4O4YL 4QHNA 5IKCB 5C07A 3ULVD 1WQVT 2J6EA 1G9MH 4JFYA 5B38G 5I1LA 4NKDB 3H8NA 3FQRA 4MQXD 1AD9A 3HG1D 4MDJB 1MHCB 5IB4B 2WANA 1BPVA 2DQDH 2R8SH 1S8DB 3DRTB 3RI5F 4LCWB 1ACYL 3MBED 1E27B 3E6FA 4UOW1 4GW4B 5FYLL 2R39A 1TZIA 3SKUD 4HIJB 4CNIA 5CGMA 3WJJC 4DUVA 4P2OA 3O8XA 3Q6GL 3RNKA 3HZKB 3BE1H 3L5IA 1KJMA 2BSRB 2VO5A 4OZHB 1EGJH 1OAXH 4NGHL 1TMCB 4GRMA 4O2FA 4PJAE 1RZKC 5TJWK 1UACL 1VACA 1BQHB 3QFJD 1DSFH 3QR2A 3O11A 1RZJC 2F19H 3DHMA 4XMKL 4CGTA 4FQIH 5AWNL 1YNKL 4ETQB 4YGVA 3VXNA 5INCB 1DBBL 2AJUL 3V8OA 2VISB 2ERJB 3GMRA 1KSRA 2OR7A 5F7NC 1B2WH 2VLJA 3ARFD 3T1FB 5C0DB 4TVPL 2R2HA 4HKBB 4XWOC 1T0PB 2V6HA 2OQJB 4LNRB 1J88A 2J8UA 3TWCH 4M7ZB 4U4BA 3VXQA 1MCHA 1JHTA 4PJFE 2NY3C 3D9AH 4XPHL 5I1KL 1T20A 3RBGA 5C0AD 25C8L 3WSQH 9CGTA 4G6KL 1H8OA 1J1XH 1MCEA 1TETL 3JXAA 3RJDA 3QEQE 4OUOA 2BVOA 4P48A 5C2UB 1JGDA 4X0KA 4FFYH 2ADGB 1IGML 5T5NF 1ZLUK 4GRLC 5E8NA 3TO2B 5HI5C 4H25A 4LU5H 4RMSA 1RZ8A 4TUJB 1OAUL 4NWUH 1F90H 2OMNA 2AKRB 1KJ2H 2XICA 1EMTH 5ESAB 2CLRA 3PHSA 1YNTB 4KVCL 4YR6B 4LSUH 3IXTB 4Y2DA 3R8BB 1EHLH 3ULVE 3AFLA 2B4CH 4AYFA 3OR6A 1WT5A 5GGSY 4WI8A 5EZLB 1ZK9A 3E2HC 4MXVE 4DFIA 4DUXA 3O6FD 3D85B 2PYFB 5E5MA 4S0TD 2OR8A 4I13B 3QQ3A 4O2CB 4QYOA 1EDQA 2LFGA 1T7VA 3EJYC 4GLRH 4JANB 3G04A 3HI6H 1XH3A 3BHBB 3FQUB 2H32H 4FXGB 5I1DA 4OLWH 1A6AB 2VQUA 3QFJE 5DJ0A 3RVWC 4P2RB 4PRIA 2DI7A 4HWNA 2X41A 5FO8B 4LCUB 4OLZL 1LE9B 1YEIL 4HPYL 3MO1B 5E7BA 1HI6B 2F5AL 4PJ8C 5D7SH 1XR8A 1YY9C 5DHYB 3L95B 3RQ3A 3WIIL 1UVQB 1QSFA 2AP2A 2OXGA 4IOFD 4CW1B 1IGIH 1T1XA 2VABB 4XAWH 2E9BA 1R3HB 1K6QH 5FUOL 5ICZB 4IRSD 3AS0A 4AIZB 4OQTH 1PDKA 4QHLA 4R0LB 5B39B 4JJ5A 4BQBA 5C0AE 3QEGH 3KWWA 3TIDA 2OCFD 3L9RA 1K8IB 2CJUL 3B9DA 2VXSH 2DLFH 4NC1C 5IB1B 5SWSD 5C0RL 1C1EL 2C3GA 2EXYD 3WEXA 1N6VA 4LVOC 3PXJA 1MRDL 2QSQA 3WO4B 1H5BC 4L8DB 1KYOJ 4JQIL 3WNPA 1YPZF 4M7JH 2O5XH 4H0GA 3AVEA 5EOCJ 1IGCH 4JZOB 3ARED 2J8UF 1TPXB 4P5KA 1INQB 5IP4A 4F37F 3LKNB 1QNZL 1CVRA 4DN4L 5HD8C 3EYUH 4YHLH 1HYSD 3UPCA 5KSBB 5T5FH 3PP3H 1ES0A 1DL7H 3DROA 3WHE1 5FUCC 5EO0B 4XVTL 5CJQL 2NY0C 2AV7A 4M1GH 1NC4D 3BEVA 3RTQB 4FZEL 3CC5B 1RUMH 1UB6B 5KSVB 1H15A 3F5WB 1JTPA 3D18A 4MJ5A 1CL7L 3VFWB 1FFOB 2GIYA 1AI1H 4EI6A 3WLBB 4J3SA 4HUXA 3MLYH 3SE4C 1ZVHA 3BPCB 1FNHA 1WBYB 4Y4HB 2XKNB 3ULSB 3NFPA 2A77H 3D2UB 3P11H 1VFBA 1FC2D 4M3KB 4Y4KD 2EO9A 4P46C 1G7PA 3S36L 2FR4B 4DVBB 3DUUA 4ZAKB 1UKTA 2COQA 1ZT1A 1SEBB 1C8PA 1GJIA 3TLRA 5LCVL 3KHQA 5ECJE 1JWMB 1NFDB 3L3OB 4WI9A 2DD8L 2GJZB 2AAVA 4XZUA 4WUUD 4JFEB 2H26B 2CXKA 3MRRB 1IC4H 4GAGL 1YUHB 4JAMB 2JELL 3W0WA 5DJCA 1AXTH 5DJ8B 4NQCA 4N0YL 4YZFE 3NFSH 4JDVA 4KDTC 3FT2A 4FRWA 1INEH 1ZSDA 1BQLL 2FX7H 3SDCA 2D7QA 1RUPL 1UXWB 2NX5E 2Y6SC 4MCZA 5FKAB 4ZFFB 4MD0B 2I9TA 1Q9OB 5C0CD 5SWSE 5L2KD 3UJIL 2D9QB 1YMMD 4P4RB 3IFOB 1CR9L 5IVZB 4NBYB 4HW6A 2JK5B 3MV8B 5HGBB 1C5BL 2AXHA 2W65A 3TN0A 2DF3A 4TPRH 1HINL 4LVHB 2VL4A 5BOPA 1KIPA 2XKUA 1OTTD 1TTGA 4XVUC 1RZFH 3EYVB 1RULH 4ELMB 4Z76B 5ADOL 1SYVA 4H1LA 3GMQB 4AK1A 5M95B 4LAJH 4X7EC 2OXHA 5GIRB 3MA9L 3U7YL 5C0IB 2EDWA 3IAPA 5GRWA 4P59L 5J3HD 1QLEL 1I1YB 5CSGA 4IHOB 3X3FH 4KHTL 3MRMB 5JHDB 5E56A 3X13A 3OMZA 5HYSA 5JQ6L 1IM3A 1F4WL 3DV4B 4LSRL 5IMOB 1S5HA 4AG4L 2D0GA 2W9DH 2HT4D 3QXAB 4JPVL 3WKMH 4C59B 2UWEA 5IEKA 3W11D 4EN3C 1GSMA 1IEAA 1RZKH 2GAZA 2OM5A 3T0ED 4Y4FA 4WWKC 2OTWB 5IESH 2NXYC 2NYYC 1NLDL 1DFBL 4JVUA 1KEML 4LPXA 1QA9A 4DGYL 5E70A 4Q6IB 1CT8B 5IVXE 5EBLA 3MLVH 4WUUE 5GRUL 5L88H 1BFVH 1IZJA 1WTLA 1W8NA 4X6EA 3SE8L 5I1AB 4DN3L 3QEUA 4GXVL 4RWYH 3WE6B 2EE9A 5ITFB 4FXKA 1R5VA 3CIQA 3AAZB 2ZCLH 3U4EA 2X5PA 2XZQL 4RFOL 2ZP0T 1NJ9B 1FNSH 5C0CE 5C71A 5L2KE 4PREA 3WFBH 3STZA 3RZWA 4MHHI 4PLOB 5I18L 1YMME 3BN9D 5C0GB 4IIQA 3MLXH 3S3JA 2MQ3A 5DQDH 4AEHL 1WC7B 4RMVA 3NIGE 3DX7B 5C6PB 1I3GL 4GMTH 1A6TB 1IC7L 2R2BB 4OGAC 4QOKE 5ENWB 3RVUC 35C8H 3EZ8A 1ZT7B 3QDGD 4FQLH 2H8PA 3HNVH 1JPFA 4YXLH 1J0JA 4PJ5D 1P2CA 4OD2A 4WWID 4EDWH 2FSEA 2ICWB 4PP2B 4XBEL 3VXRD 3BPOC 2Z92B 5ALBH 2QSCL 3RZCA 4HC1H 4ORGA 3MA7B 4PV9B 3DMMD 3NTCL 4G43B 3FONA 4JHWL 4IOIB 3QDHA 3GEWB 1V3JA 1CGYA 4Y5XB 2UUDK 3OF6A 2DDQL 1DN2A 1HNFA 1WAAE 2DBLH 4BJLA 4LHUD 4DAGL 3HAEH 3HAEG 3CZFA 4JDZA 3T4YA 3QA3A 1J1OH 2B1AH 4KKLC 5J12B 1U9KA 3T0EE 5JXEC 2ITDA 1IQWL 3VXSA 3SE3A 4YH6A 4G6FD 4F9PC 4JFDB 1DTUA 4N0UA 3VH8A 1J1PH 3IRPX 4OGXH 4WEBL 5DTFB 2XWTB 2FECL 4PP1D 3QUKB 5F97E 4O51B 2E8YA 3OXRB 4XNYL 4Y5VA 1R5WB 3GHEL 4QHKJ 4JPWH 5JW4N 4NRZA 2Y25A 3M17B 4YDKH 1QRND 3I84A 3MRHB 2ZJSH 4YQXH 5DMGC 3F7YA 2UWEF 1QPXA 2IBZY 2VXVH 3LV3B 4LSPH 1FLRH 3FMGH 1EEZA 2YPLB 2X05A 5DD5L 3UO1L 4XI5D 3D0LA 3IJYA 4N8VA 2YD8A 3KJ4C 4NQVB 4TSAL 1J0KA 3NN8A 1ORSA 4MQ7A 1FL6A 1XGQB 3C6SA 4Z7UA 4HZAA 2VXQL 3TV3L 2ED9A 5J6GA 5GGRA 3B6SA 2YUXA 5E8OB 5HPMB 2FO4A 1I3UA 4PJ5E 1OSZB 4JKKA 3G5VB 3GZKA 2CGRH 3BSZH 4M8VA 1U92B 1Q9KB 5KSAB 1U93A 1S9WB 2X70B 4K7PL 5EU6D 5TPWL 5AYUL 3RWCB 5A16B 1KB5B 2NPLX 3DHJA 4OLUH 1CGSH 4NN5B 1F3JB 4WV1B 4G7YL 3SN6N 1MUJB 5F7MC 3GSUA 3W5MA 4OCXL 3TBSB 3MRCB 1BAFH 5F1NB 5F89B 3DXAA 2ZOLB 1FGVH 3RL1A 1LEIA 4KI5F 1MFAL 1ITCA 4LF3B 4PJDB 2NY4B 2A9NL 1YY8A 4KMLB 5EUOB 1JPGA 4X7DC 4JFQB 1KNOA 2VN7A 3LN5A 4NZTH 1YN7B 5I8KL 5GRVL 1FRGH 4JRXD 1J12A 4PYGA 3RWHB 2F8OA 2H6PB 1JK8B 3MRNA 1GAFL 1FSKB 4QRSB 3GSQA 1LO3H 3P4LA 5IB2A 3QNYA 5I66A 3DUHA 4FQ1L 4M1DL 4OSUL 1Q9WA 1CU4H 4JFFA 3B5HA 5HI3D 1YYLL 2P49B 3JWDL 1YEKL 1BD2A 3MRGA 4N68A 3CH1B 2OTUB 5CSBA 1AC0A 1T1WB 3SGDH 4XMLH 5IHZA 3KXFA 1AP2B 3JWOC 5DMIH 1I1AB 4XHJC 4S2SA 1CLYH 5I8CA 5E2VH 3ARGB 1KLGA 4JKWA 5TDNA 4JO3L 3H9SD 1DQML 4WO4C 5B38A 5F7UA 5EZJA 5GSVA 1QO3A 4L4TB 2IPTL 4LGPB 4NNXA 3REWA 4I3SH 1C7TA 1BGXL 4ZFOA 4P0DA 3RPIA 3SGDI 2Y1VA 5CEYA 3K8LA 3LKRA 1A4JA 2W0KA 2X4UA 5D7IB 1JUFA 1QFUH 5JW3H 4LLWB 3BH8B 1G6RL 3A67H 1LD9A 3KPQB 3ZYIA 3FT4A 1EGJA 4UTAL 3EYQD 3FB7A 5BV7H 2AVGA 3S3PA 4I2XE 1JGLL 2R69H 3IDMB 5HHOD 1MREL 3D39A 3FB8A 4RBPH 5E8DL 5J1AA 1IM9D 1BM3H 1TZGH 4NZUL 4EUPH 4EUPG 4BSWB 5CEZD 4U6YB 1OAQH 1BZQK 1U8OA 2DI8A 4HIHA 4Z7UF 3ULUD 3GKWH 4L4JA 3HUJE 3VCLA 3CSYB 1FNGB 1KXTB 3D3VD 1OARH 2BDNH 4PGZA 3AC0A 3M07A 4NQEA 4Z7NF 5DVLA 5MI0C 3NPZB 5BXFB 2FGWL 4JM4H 4Y8AA 3FRUB 4PPTA 2R0ZH 1R3LB 4K7FB 1JGEA 3HPJA 4UV4L 3UBXI 2HVJA 1T5XB 2F8XC 3H9HA 1ZHLB 4PJGA 4NC2B 5IK3A 4NNYA 5I30H 1CXKA 4OF8A 1CDJA 4KJQC 1IAIM 3RU8H 5KG9B 2OP4L 1T7XA 1XGYH 1O0VA 2AXFB 3D1MC 3KNBA 5IR1B 2HJLA 2YZ1A 5ANMB 3OBAA 1KJ2A 3DI2B 1Y0LB 3PDGA 3MGOB 3BP4A 1DQQB 4APQC 2GY5A 3L3HA 3O4LA 3MXWL 4POYA 3FZUD 3L5HA 3I2CH 3ZDYE 3BQUB 5F1IA 3H0TB 3H9SE 4G9FA 4QCIA 3WS3A 3UTSE 1PFCA 1R3KB 3W9EB 2EKJA 3NABH 2VR9A 2I60H 3OKKB 2A6JB 4G6MH 5D70H 5D1QD 2YK1H 4R4FL 5L0QC 4NT6A 1Q94A 3QI9C 1RJLB 2QKIA 1TNNA 1FL3A 5HHNA 1UWEL 1CQYA 4ZTOL 1H8NA 2DQIH 3LY6A 3O9WB 4FG6D 4XBPA 2OK0H 1PKQE 2GITA 5E99L 5D2LE 1CXIA 4AM0A 5HHOE 2B20A 3VGFA 4KKAD 3CPLA 1YZZA 2FHFA 3QPXL 3KDMA 4WW2B 5C92A 5T1KA 3TCLA 4LSDA 5CEZE 3QWRA 5EULV 1LVEA 1GGCH 1HXMB 4UDUB 1X6NA 3ULUE 2WIMA 4L3EA 1JFQH 1CCZA 4OJFL 4WJ5B 4FZ8L 3QUMB 3VW3H 4DTGL 4XPFL 1CFQA 2CKBL 4YPJA 4XH2A 2BC4B 1K3ZA 1EO5A 5D5MA 4OQTA 4G7VH 3KLHD 3GMLB 4HV8B 4NO3A 1BJ1H 4H8WC 3N1PC 3S4SA 5I1GH 4ZDHB 3BESR 3N85H 4XCCH 1FYTE 3QNXB 4E42A 4G9DB 4JG0H 5T3XE 3K4DA 3TNMB 3OSKA 1ADQA 1S7WB 3PWNA 4RGNE 3V0VB 1RAMA 3RY6A 5M7QA 4YBQC 4MGXA 5DUPL 1C7SA 3GUTA 4X5XB 2LE9A 5EOTB 4FQ2L 5T3ZL 4QRRB 1WZ1H 3LEXB 4LSQH 1ZLSL 3BT2H 3ZL4H 3O3AB 1ODAA 4D8PA 4PRPB 1WBXA 1B0RB 3SQOH 1RHHA 3CMOL 3NA4A 4ZXBA 3ZE2F 3VG0L 1CVSC 1Z9MA 2IQ9H 3F7VB 4P57B 5MP6H 5BS0A 4EOWH 2P8MA 5DD6A 4QXGH 2FHCA 3U82B 1WBZA 2R1WA 1V7NL 3TBVA 1HH9B 1U8JB 3SQBA 3KYMB 1MCPH 5HBBA 1FG9C 2Z4QA 4PJGF 5CWSA 3VWJD 5DJDB 4Q58C 5DJZB 1P4IH 1I1RA 1I8KA 3QT2A 4Z77A 4YIQB 3SDAC 2BX5A 1JP5A 5I8OL 3R1GH 4NO2A 2FJGA 4JKPL 2WBJC 2H2SD 3ZT7A 5DFVD 1MCWM 4N0FA 2AJVL 2XXCB 1SY6L 2DTML 2FBJL 1DBML 5EIIB 4MQSB 3QO1A 1M71B 1HHGB 4LVOB 3VDAA 3GSXA 3CXHK 4I0PC 1RJZB 1YEJH 3FN0H 1RMFL 2XYCA 2PW1B 4KC3B 1I3VA 4OZGE 5EOCL 1FV1B 4X7TB 3MC0A 5JW5A 1DUZB 3DECA 5LAXA 1ZTXH 4C55A 5HYIA 4J1UA 1L4IA 1VB9A 3L3DA 2PW2B 2AEWA 4MNQA 5C0JA 3QIBB 5HHQB 4GAFB 4MAYC 4MDIB 2W60A 1WISA 5ID1B 4U1NB 4L29B 3CSPA 3CSBA 4FP8L 5K9KB 3B9KB 2RBLA 1MJ7L 2WV3A 2J4WH 3X12B 1EFXA 7CGTA 2R9HD 4HHAA 3BOVA 5HPOA 3MMEA 1EAPA 3C2SA 5DEFB 1UB5B 4UQ3B 5EBMB 1SJHB 1FZMA 5DFWH 2CKBB 2MFNA 4JQXA 4DWHA 4W4OA 4X98A 4Y8DC 4M5YL 1MHEA 4L3AA 4JO4L 4U2YA 5IROA 4WI3A 3FO0H 4TNVF 1T7ZA 3JWOH 5E00A 2ITCA 5EU7E 5FGRA 5D5MF 1LO4L 1N6UA 3EYFA 4PGJA 1AY1L 2IC2A 4X99B 1FH5H 1A6WH 1KJ3H 4XB8A 4F57L 4U1GB 5IMLA 3VD9A 2IWGA 1C5DA 3R0MA 3H7BA 3D69B 4X80H 3P4NB 2YEZA 3U1SL 2QR0B 1AIFB 3IETA 2XA3A 3WJJA 1B0WA 3IDJB 5FYLH 3AY4C 3QNZA 1MSPA 4TTGA 3PWVB 2H41A 3VFOA 3EDFA 3Q6GH 3BP6B 1MEXH 4JO2L 2G5BB 1EPFA 3K3QA 4NGHH 2HH0L 3MUZ1 1UACH 3U79A 1RJYB 4XMKH 3T0AA 3HE6C 4X4XB 2VQ1A 1D6EA 3VJ6B 3KR3H 2AJUH 4BK4A 2XN9D 3IDIA 5D9SA 3QG6A 3DJ9A 3PV6A 1UENA 4TVPH 4Y19D 1NSNL 4BFIB 1IGJB 4Z5RB 3LKPA 2QADD 1X4XA 3KPSA 4BH8B 1NGWB 4DZBB 3QDJB 5ISZD 1F00I 2B39A 5IOPA 3G6JB 4XPHH 5I1KH 4NUJA 3UPRA 4P23A 4K23L 25C8H 3ZHDA 1AKJB 3GMNA 4EDXA 1CBVL 2FJFB 2JCCA 3BI9X 4J7RA 4G6KH 1ZS8B 3FCTA 4ODVH 1DP0A 3ULVL 2FL5B 4NUGH 4KI1A 2LVCA 4I4WA 4XPTL 4QHMA 1AO7A 1DQLH 32C2B 3QUZD 4GRLA 5I1JL 4ZUWB 1IGMH 5GJTL 3P4MB 3NH7L 1TVDA 2V2WB 2NXYB 3Q2CA 1KTDA 1C16B 3DX6B 4KVCH 1FGNH 4PTUB 1FVDA 4YHKH 4HC1A 4GUPB 3T65A 2GCYB 2AXGB 1ERNA 4ZOEA 1YQ2A 3NA9L 4JZNB 3BIKA 3CVIL 4ODWA 3RUGE 2BSSB 1MQKL 1HHIB 2CRIA 4J3XA 4UILL 3REVB 4ERSH 2UZIL 2HFEB 5AG9A 4ODUB 1DANT 4CJ0A 4YDJA 4QLRA 3HAEA 3LH2L 3EFDL 4O2EB 1G7MB 4JKMA 3ZLQC 1KPUB 1GC1C 1Y6MR 5ADPL 3KPPA 1R3IH 4PJAB 3J7HA 4P9HL 4LMQE 4MVBC 4CJ1A 1HHHB 2PNDA 4OLZH 1YEIH 1A8JH 4PJ8A 2DWDB 3MLUL 4BQCA 2DM3A 2F5AH 3WIIH 3GBNL 4KROC 4MNGE 1U8MA 3STLB 4Y19E 4BK5A 1X5AA 2FLBT 3LDBC 5HGDA 4KKCC 1M7DB 1A7BA 5JZ7D 5FUOH 4UTBL 5AZEH 3VFNB 3G5XA 5JPNA 1CFTB 3U0PB 4H8WH 4X9FA 3HI1A 3P0YL 3RVXD 1I8IA 2PTTB 5CEXA 4PJFB 1T2XA 5IBUB 5JA9A 2WINA 4FQXD 4P3DB 2CJUH 3H7LA 2Z93B 5EORL 4XWGL 5C0RH 1C1EH 3OJ2C 2KZ1B 4PLJC 4NN7B 5E7FA 1H5BA 4RMRA 3QEQB 1MRDH 4HS8L 4WEUD 3RVVD 3GGWA 5D2NE 4JM2B 5E03A 4POUB 5MEOB 5HHXL 3TVMC 2OJEB 1JTOA 1A1MA 2OTPA 4WI6A 3VMPA 3NZ8B 3VFTB 3MRIA 3SCMC 4ZYKA 5DSCB 2X4QB 1YEFL 3GJFB 4HWBL 1MLBB 4FNLH 4NO5A 4U1MB 1QNZH 4PJBA 4DN4H 2P8PA 1V8HA 4D94A 3BKML 3I3DA 2JCCF 5HJ3A 4ZUVB 4XVTH 5CJQH 1MRCH 3VXME 3NIDE 2FH6A 3DETC 3MBEB 5DYOA 3W5NA 1RQ5A 1S5IL 3EO0A 3BKJL 5FEBA 3CFJA 3IDUA 2ADIB 4E0RA 2AJZB 1U8HB 3EDEA 4RFNB 3BD4A 2LU4A 4KKBC 3PDOA 3RDTC 4R6UA 2B5IC 2HYMA 3BIAX 5F7EL 3S36H 4LLAA 1LNUB 1OP9A 3PHQA 2X4TA 5FHAH 4BKLA 5HTSA 1N0LA 4U0QB 3TIEA 1FZOA 3GSOA 3MCKA 3X17A 5EU5B 4U1KA 4H88L 1CL7I 4EBQH 5DHVH 4K3GA 1OGAE 4GKOA 5IHBA 5KSUA 4XCEB 1UWGL 4GAGH 5ETUB 2JELH 1RUKL 4N0YH 2X1QA 3JWDC 1MCLA 3VRJA 3HR6A 1BQLH 2C4FT 2VRAA 3A6CL 5C0AB 3I85A 2ZSWA 2A9ML 4KRPC 2VL5A 5D7LE 2NW2A 3B83A 3EO9L 1F4HA 4E9LA 1NGZA 3BVNB 2JJTA 4GAJL 3WXVL 4J3VA 1C5BH 1HINH 3OQ3B 1KEGL 2VLKA 4IMLA 5KN5B 1GOHA 1NBYB 4WY7H 5IEHA 3SKNB 3TA3C 3T09A 3PHOA 2OZ4H 2AEIT 1FZJB 4NRXA 2C3VA 2PETA 5GGTH 1RZIA 2EIBA 5DQ9B 1Z0MA 2C5DC 3QUXA 5J4MA 4WHDA 1WVZA 4I0KA 1ND0A 3MA9H 4M8QB 1MCJA 1CICD 1DVFA 4P59H 4ISVB 4V1DD 1QLEH 5HVGB 5CBEB 5L7XL 5E2WL 4RFEB 5CSZA 4P9ML 4KHTH 4PJCA 2XQBL 1AQDB 5JQ6H 1OLLA 3UBXA 1F4WH 1XCQA 1E6OL 4LSRH 2BY0A 5CKGA 5FA3A 1N5YL 1QEWB 1X4ZA 2DL2A 2GEEA 5GRZA 4AG4H 1IEHA 4JPVH 1DBJL 4YNYB 1MCKA 1MVFA 1UM4H 2A6DA 4WNQB 1D9KB 4QWWC 3QDME 4WVRA 1I7ZA 3BW9A 3KG5A 4JREB 3QQ4A 2VXUH 4PR5A 3NIFF 5BJTB 1DFBH 1KEMH 2H45A 4M61B 4WO4B 3C60D 4DGYH 4PJBF 5ESVA 3LEVL 3UYRH 3MLRL 5GZND 1NPUA 5FM5O 5IM7B 4XXDA 3U6RB 1ZGLP 2W9EH 4PS4L 2MCPL 1ZGLM 2RB8A 4AQ1B 4DN3H 1BVZA 2GYSA 5IW6B 3PJSA 3BH9A 4EIZC 2Z31C 2W0FA 4HJGA 2V2TA 5JW4Q 3TFKD 2BNQA 2XZQH 5CIPH 1MCDA 5GSRB 1DQJA 5J9PB 4A6YA 2NX5B 1JYXA 5I18H 3X11A 4G6JL 5TQ0L 4KTDL 4LSVL 1XF2B 2J8HA 5E9DA 5SWSB 4YEEA 3P77B 4FFWC 5KZCD 1IC7H 4OCRL 3EDJA 4ZSOE 5F1KC 3CLFL 1U41A 2IH3A 4GXUN 1I7TB 1F4YL 3L3IA 1QBAA 2JIXA 2FO1A 4TYUA 3IF1B 1JGUL 1MH5A 1CK0H 4GKZB 4OM1L 5DO2D 4G3YL 3MUGB 2R2CA 3C09C 3AREB 3GRWL 3Q5TA 1CS6A 4XBEH 4X5WA 3QIWA 5BVJA 4FQHA 4W6XB 4V1DE 1CFSB 1OTSC 3BX7C 4JHWH 3OR7A 1MNUL 2ADJB 4LIQL 2ZUQB 1GGIL 1HQ4A 1RZGB 5FM4A 2DDQH 3SKOA 5BZDA 1GPOL 2BVPA 4QXTB 5DK3A 4DAGH 1GC1H 3WFEL 5FYJU 5D1ZC 4APQB 1O5DT 4F9PA 1UCBH 1WJ3A 4KRLB 1XGTA 4Z7OE 5INDA 1A22B 5SV4A 5KTEL 4Y4KB 1JYVA 3EJJX 5EZOH 3MUHL 3L3JB 2GJ6A 1F6LL 4WEBH 5TE7H 3VFGH 1A7PL 5D96B 4RZCB 4UBDC 5DC4B 3IKCB 4MA7L 1PLGL 2K9UA 1CTNA 4XNYH 5IVXB 1M05A 4WUUB 3GHEH 4NKDA 4P5TC 4JGJA 4JFOA 4NHUB 2ICEB 1DDHA 4ZPTB 3O45B 4PG2A 4UAOB 1E27A 3V4PL 4HIJA 3TZVC 1Z9LA 3MJ8A 1NEZG 1A6VH 2FECI 1HOCA 3UO1H 3BGFB 4F3FB 2F58H 5C0CB 3WIFB 4K71B 2IJ0C 5L2KB 4WI4A 1BBJB 1B6UA 1YMMB 4M62L 1GL4B 5DS8A 2NTFB 5K9OA 2F53A 2M8XA 2KL6A 4FABH 1P1ZA 1CF8L 4XVSH 2VXQH 3TV3H 4ETQA 5INCA 5E1AB 2DMBA 3IDNB 4QOKB 3S96A 3DX9A 3KYKH 1FFNB 3MFGB 2AV1A 1BOYA 1S9XB 2HVKB 5JOPE 4G80A 1XFPA 2XQYG 4HKBA 1RJCA 2VIRB 2WSKA 2R29L 4K7PH 5TPWH 5AYUH 2EC9T 3U48A 5F9JA 3QIUA 4OV5A 4YUEL 3FB6A 1AGCA 4FN0A 1TJIL 1G7HB 4G7YH 4R7DB 4LKCB 5FYJD 1SBSL 2XG5A 3SDXA 3GSWA 2EKSA 1T66C 5FUZL 3MTRA 3B8YA 4LVNB 3LD8C 4KQ4H 1OTUC 3DIFA 1OW0C 1U58A 1MFAH 4LRIA 2R0KL 1A7RH 2VWEC 4G8FA 1NCCL 2A9NH 2I26N 4M9PA 1PAMA 2PO6D 3CLEL 4X6DF 3HRZB 1D5BB 1UG9A 3QWQB 5EBWB 4Z0XA 4BQ8A 5ESAA 1YNTA 5AUMB 1BJ8A 2DL9A 3BKYL 3MRJB 3PWLB 3RWDA 5IJVB 2BVYA 5TQ2L 1LEKA 3AROA 4XP5H 1LE5B 4HUMB 1UJTA 3EOTH 1VERA 4MZ2A 2PYFA 4I77H 4GRWB 1T2JA 1YYLH 4PRHD 3JWDH 3SDAB 4ZTPL 1YEKH 1T80A 5I17B 5JXAL 4PY8I 1NL0L 5C07D 3MOBL 4ODXA 5IQ9B 1ONQA 3CH8A 1XGPB 4M5ZL 3CDCA 4LBEA 1N3NB 4XAKD 3ARRA 1MWAB 3C9NB 4K3DH 1OT1A 2VDNL 4JO3H 3O8XD 4WGVB 2EDHA 3FFCA 3O3DB 1DQMH 4YLQT 1A9BB 1JE6A 4YHYB 1U3HD 1EXUB 5E5RB 3Q0HA 1HYRC 4HKJB 2JJWA 4L9LB 1BGXH 3K80A 1FO0H 5T1MB 4B50A 2BY3A 4PJ5B 5M94B 1J8HE 3MROB 5HVHB 3BPNC 4AT6A 2G75B 5CZXC 1OL0A 1FG2B 1U8NB 1A9EA 4MAYB 4UTAH 3RWEB 2H9GA 3MFFA 2VLJD 4MB4A 4EJ1C 4YFEA 1JGLH 4NRYB 4NCC2 1V3MA 3FO2B 5SWQB 1JL8A 4L3CB 3DMMB 4RRPG 2VN4A 1QHPA 3QFDB 4NZUH 3WFDH 4Q2ZA 1MCCA 2WUBL 5IGXH 2E6JA 4LQFH 1OGTA 2RHEA 5FGCE 1HQRB 2OL3L 2I5YL 2XZAL 3BO8A 4Z0BL 1NFIB 3BEWB 3G9AB 3HE7A 4OFYD 4L4VD 4YGAB 3PIQA 4GBXC 2C4XA 3HB3D 3S9DB 4YDLC 5SX5H 2FGWH 4G6FB 3T2PA 3HC3L 1JV5B 1HXYA 4HWEL 5EIVA 3UZQA 4HS3B 2DOCA 4HBCL 3CNKA 3T0BA 5TH2B 4NM4L 3UP1A 1IKFL 2OI9C 2YWYA 4PRHE 1VFUA 5EO0A 3SDXF 2YMXL 2RR3A 1BX2B 3O2VH 4U1JB 4DUWA 4WCYL 5C07E 5D1XD 1P6AB 3CC5A 3WUWA 1UB6A 3GSNB 4ODHH 1TFHA 2BY1A 3C5ZC 3HKFA 1VGKB 1OT2A 1KB9J 4Y4HA 3ULSA 3MXWH 3HE6B 3D2UA 5FDWA 4FFVC 1ZXQA 1DR9A 2E8ZA 3C6LC 3BP5A 3PGCB 4UT7L 4ZPVA 1CE6A 3WNOA 4YDVB 3FQTA 5CEZL 4OBRA 1P4BH 3OKDB 5A3ID 2MWCA 3ULUL 1JWMA 4PRID 3S98A 2Q76A 2HFGL 5GS1A 3QRGL 3ARFC 4JFHD 4ZTOH 3DRQB 4PV8A 4O58H 3L5XL 5F3HA 3T3PF 1TJHH 2VLJE 5E99H 1ZHNB 5EOQH 4PRNA 1YPZE 4JHAL 5EA0L 4JY5L 1CDCA 3QPXH 1QSFD 4I2XB 1TCMA 5I15L 3JTSA 1C12B 5E94B 5F3BB 2J8UE 3L3GB 3OG6B 4ZFFA 1E0OB 4N5EC 4P9HC 3NGBC 4R9HA 1YECH 4O9HL 2YBRB 3S35H 3BP7B 4KK6D 4OJFH 4L1HA 5IQ7L 1L6ZA 3HUJB 3TYGH 4DTGH 4ONHB 4L4VE 1H8SA 1IAOA 1NAKL 4EQ2A 4K55A 3HNTL 1XZ0B 4N0CD 1GXEA 4X6FA 3IDYC 1HE7A 3DUSA 4OF6A 3KVQA 1WLHA 5GIRA 3IDGA 4OTXL 1ZLVK 4YBLC 3DO7B 1QBML 3WHXB 4NSKB 2NY1D 2BXZA 3IDXH 4I8DA 3WN5B 1I1YA 1TCRB 5DUPH 2NXZC 5DLMH 4FQ2H 5T3ZH 3S5LG 5JHDA 3O6FC 4YBHA 1ZLSH 3RFZC 1VEPA 1QRKA 2XA8L 3SO3B 3CMOH 3QXAA 1IGYA 4MWFA 3V6OA 3QJFA 4KJPC 2FB4H 2YS4A 4LP5A 5C6TL 3BXNA 5K59F 4QRUA 2VXTL 3ET9F 3N1MC 4OCNC 2OTWA 1V7NH 3MRLA 4X9GA 2GFBA 3G5ZB 3H9SB 1L7TH 3UTSB 4PJHA 3L7FB 5DA4A 5D93B 3RIFK 2XFXB 4PRIE 1NDMB 2Y07H 2XNAB 1GCFA 4UUJA 4Z6AT 2GI7A 5D4QA 5I1AA 2LU7A 2X42A 3WE6A 3MACL 3JV6B 3ZTNH 3SDDC 2WBJA 5IFJA 4F7EB 4IRSC 1QSFE 2XXMB 2LAGB 5D2LB 5HHOB 3VE0B 1SY6H 2DTMH 1UEYA 4IS6A 4LCWD 1L7IL 1IM9B 2O5YL 4KV5F 4I0PA 3A6BL 3F7RA 3W0WD 5ACLA 3AGVA 2Q86B 3C8KA 5C0GA 1RMFH 1PJ9A 5DHVA 1IGFH 5EOCH 1GVIA 2R2BA 3V7AE 1FFQA 2BNUA 3QZWG 5ENWA 5C08B 2ICCA 4R4BB 3UTZA 5BOZG 3SCMB 4OLYH 2VDRL 4D0CB 2ARWA 4PY7B 5DA0B 5HYQA 1PQZB 4NC0B 1JF1A 3GK8H 1SJXA 5FO9A 4Z18A 4OFKA 3EBAA 4Q0XL 3TN0D 2DQTL 4HWZB 1UA6L 4KAQL 1FYTB 1PG7X 4D9RD 1MJ7H 2DS4A 2WAHA 2AEPL 1HYSC 4RGNB 2IQAA 3PABB 3AS2A 3PNWB 1B0GA 1NANH 3ZT5A 3LB6C 2CK0L 2VR4A 4M5YH 1MJJB 3Q6FB 3RDTB 4JO4H 4QT5B 1AHWB 3TJHD 2CDGB 5D72H 5F9AC 2E9JA 4WTZA 4ZO9A 1VKXA 1LO4H 1F58L 4X8XA 1AY1H 5JIKA 1IGTA 4UU9B 4EEEA 4POZD 3AS3A 3BUYB 4F57H 1A0QL 1P4LB 3DYOA 2JJUA 2XWTA 3FO9A 4MX7A 5AAMA 2C3HA 3W9DB 5DD3L 3U1SH 2C3XA 3JV0A 2CLZA 4L5FL 4Y16C 4MCYA 2J8OA 2DI9A 2AK1L 2AJ3B 5HGHB 1XIWC 2AABL 1EHAA 1BBDL 5CJ8A 2RIKA 3MRHA 4PLKC 3D85D 1MCWW 2ZUSA 2HH0H 4F58L 3PL6C 3W0WE 1YQVH 4NQCE 1I8MB 4RGOL 5BZWB 5TE6L 3K1KC 3CU7A 4PJHF 3GM8A 1D5XA 4F7TB 5AZ2H 3U2SA 5I16A 4OZGB 4X6CA 4GKSA 2DJUA 1NSNH 3ROOB 2ESVA 4IRJD 4P2RD 5E8OA 5I75C 2KH2B 4DQOL 4M6ML 3G5VA 4KGLA 1XCTA 5A40E 3HZMA 4KI5D 4K23H 5CIPA 3DVGB 4IMKC 4PGDA 4P99A 2ARJA 1CBVH 4HFWA 1B3JA 1NC2D 1Y18B 1F3JA 1A3LL 3AUVA 3HR5B 4XPTH 1MUJA 2YWZA 3OGCA 3S6CA 2C4FU 5I1JH 1RIVL 2NY2C 3P3YA 5GJTH 4HMDA 3NH7H 4PJIA 2GY7B 4GW1B 4PJXA 4QF1B 5KVEL 1Q1JH 2HFFA 2HT4C 2ICES 4PJDA 4XP9H 4K8RC 4LLQA 3RX8A 3W11C 1FNEA 1XF4B 4JFQA 5ACMA 2UWEE 1O7VA 4JVWA 2ZOKA 3RWHA 2OSLA 3VFVA 4Y5YB 3CVIH 3TBWA 5T1LB 3VWJB 1MCNA 3KPRA 4EI5C 1MQKH 3OAZH 2F74B 1MAKA 1I9EA 3FO1B 1YDPA 2UZIH 1U8KB 2V17H 1I3RA 4R4ND 5F7FA 3EFDH 5MEQA 1FORL 1WCBB 2VH5H 3QQ9C 4LLDB 5ADPH 3OAUL 5AD0B 4HKZA 4WEMB 3ROLA 3RTQD 5I2IA 4P9HH 1KLFA 1UM5H 1WIOA 1HK6A 4YXKL 3MLUH 1JMXA 2N56A 4P2OC 1HDMB 1RV6X 3GBNH 4CMMA 4I18B 1X7QB 2D7TH 1P7KB 1U6AL 2ATKA 3CZJA 4P2RE 4HZLA 1JMZA 1B4JL 4R3SA 4UTBH 4PJ9B 4X4YB 2WWKT 5FCUH 1TTUA 3VXTA 3KPNB 3MNWB 3MV7D 3TBYB 3P0YH 4KI5E 5J11C 2ADFL 4DK3A 4NKOB 3QQNA 4Z8FH 2FLRT 5EC1A 3T2NL 8CGTA 3MJ6A 3K81A 4XP4H 5IB5A 4JFED 1EO8L 3IGAA 4XNUL 5L9DL 2DYPB 5CKAA 5EORH 4XWGH 3FB5A 4C83B 2EXWD 4H0IA 4QHUB 2DMKA 1RURL 4HS8H 3PWUB 1M7IB 3B9EA 4H20H 2IAMD 3HZVA 1K4CB 3MRKB 3EZJB 1PYWB 4X6CF 2IPKA 2AGJH 5F88B 2YPKA 1ZANL 3GIVA 1N7ML 1MIEL 3HCVB 1YEFH 4NQXB 1FP5A 4HWBH 4YE4L 3EGSB 3MZGB 4LGRB 3MYJB 1WZKA 1T0MA 3MV8D 5IMKB 3O3BB 3OPZL 3PXHA 4YHIB 4OZ4B 5JUEL 1YNLL 1KXVC 4NM8L 2R0LH 5TFSL 4B7LA 4BZ1L 3LMJH 1NGYA 4PGEB 1ZHLA 4J6RL 4TUOB 4ZUUB 5FYKU 4N0UE 1JNJA 3RUGB 2XZCH 4MZ3A 2VC2L 1INDL 2BERA 3LS4L 4Y2DC 4WENB 4PJIF 4UDTA 2X6MA 2EYSA 3OKYA 1WT5C 3AU1B 4PJXF 4J4PA 1JNLL 4BZ2L 4IDJL 4WHTA 4QHKI 5FGSA 2GSGB 5ANMA 3ORJA 1L6XA 5H37H 5H37G 4KUCF 2CUHA 2LVEA 5EB9A 1KIQB 3DV6B 1S9KC 3I6LD 4Y1AA 2W0PA 3BQUA 1BZ7B 3OJDA 5I74B 4H88H 3KXFD 4HAFA 4NJAL 1U91A 5DMJB 4MNGB 3E6HA 4Y19B 5DUBA 3MV7E 1JWUB 2FEDD 1BVLB 1RUKH 2PKDA 1RJLA 3K8MA 5IVOA 4YEFA 1RVFH 4Z7UE 2EH7H 1T22A 4HQQL 3CFDA 3BDBA 5MEPB 3ZHKA 5GRVK 3A6CH 4JN2B 1NCTA 1JGVH 4X6BB 4Z7NE 3D0VB 3K2MC 1YEDA 1P7QA 3ARTA 2AK4A 2A38A 3BKCL 3MNZA 4HH8A 4NZRL 1MIMH 3WXVH 5F9WC 1HXMA 1FAKT 1XR9A 1FNLA 4W68A 5D2NB 2YXMA 4OI8A 5T1DL 3TA3A 5I6XC 3QZWB 4TNWF 1FO0A 3F7PC 1AXIB 2VLLA 3ILPA 5ACZB 4KK5C 3O6ML 1UWXH 3K2UL 2J88L 3MGTA 3DXAE 3MRPB 1G6RA 1KG0A 5FYKD 3PQYA 1TITA 1I85C 2CIKA 2FYYB 4MD5B 2GW5A 5L7XH 4RRPA 3MODL 4HUWA 1GGBL 2NY6C 2P8LB 1OLZA 2ZUUA 1IMHC 2CO7B 3F62A 4P9MH 4P4KA 5HY9B 4AENA 2XQBH 1VHPA 1G84A 2EC9U 4G6AD 3VXMB 3L3KA 1E6OH 2MKWA 3UZVB 3OWEA 1N5YH 4LNVA 1J05B 4KZDL 4DKDC 1DBJH 4R8WH 3B2UC 2RFXA 1HSBB 4LLYA 3T2QA 1X44A 2MNUA 3IU3A 5HI3C 1KLUA 5JHLL 1CFBA 3MR9B 4AIXA 4BSVA 2XTJE 4JFFE 2YD5A 3MREA 2F9BT 3I6LE 3V2AR 3S3SA 5H2BB 1BD2E 1I8LC 1MFCH 2Q6WB 2B1HL 1RU9L 2AQ2A 4FFZL 1FJ1B 5J6HB 3LEVH 1Y6NR 5DK0A 5SX4H 3KXFE 1T04B 3MLRH 2HN7B 1HH9A 2HFTA 4RAUA 3VWKB 2LU3A 2MCPH 2R4RH 1OGAB 1F6FB 3JWNC 4EXPX 5KVMC 4KXZI 2XG4A 2Z31A 4LPUA 3VXUA 1IT9H 3WIHL 4UI2A 1KPVA 1JZ7A 4LASL 1AE6H 2QQNL 5LXGL 2GHWB 4R97B 4FQXB 4GW5B 3NACL 5GZOD 3CK0L 5D7LB 5TQ0H 4KTDH 4LSVH 1MCOH 5K9JL 4X4ZA 1VADA 4HPOH 4ZD3L 1HKLL 4HIIA 4KJYB 4OCRH 1CXLA 4G8GA 3CLFH 3IFPB 3AB0B 7FABL 3D39E 3GB7B 1TNMA 1F4YH 4YO0B 2YPLD 3SDCC 5DURD 2OYPA 4OM1H 3BD3A 1VFOA 4G3YH 4XHQA 1G7QB 3AXLA 4U3CA 3GRWH 5J89A 1UYWH 2VDKH 4K3JL 4OLXH 2Y7QB 3KS0J 1BIIA 4YPGA 5IT2L 1QYGH 3ZE2E 3CVHL 2G2RA 1EZVY 4AMKH 1K3IA 1UEMA 2A74B 4JY6A 5I1CH 3VXOB 2CUIA 5C0NC 3RKDC 2OX5A 4LIQH 3X12A 1GGIH 1HIML 1N59B 1MFBL 1UB5A 4NDMA 5D1ZA 2CKBA 4MJ4A 4PJGE 4Z78B 4J23A 3SO5A 1X5FA 4TTDC 3WFEH 3WFHA 2QJDA 2H3NA 4LFHD 1UM6H 4BUGA 3QDMB 1OSPL 4QTHB 3EYOA 5C3LD 1AD0B 2WUCH 4MA7H 1QR1A 4ZXBD 4OBSA 3WS6C 2NY4D 4P5TA 3SJVD 2AI0H 3S5LA 4CN1A 1QSEA 4G9FE 5GGUA 3M45A 5D1QC 5DVOA 4XC3L 3TZVA 4RQQA 4LSTH 4BFBD 1Z3GL 1NMAL 3UTOA 1RY7B 4LCCB 1U95B 5E4EC 5JR1L 2P4AB 2R0WL 2IGFL 3BP6A 3QEHB 1G0DA 5EN2A 6FABL 5LVEA 3ARBC 4TULL 5GGSA 1N8ZB 3VDBA 4AIOA 4FG6C 5DJAA 4PTTB 4LSSL 1ZLUH 5JTWA 2B2XL 5IV2A 3Q48A 1CF8H 1RFDL 2CMRL 2FWOB 3ALWA 4P3CL 4X4XA 3VJ6A 1GZPB 3SPVA 1DCLA 4ZSOB 3TBTA 3MPCA 2UY7A 2MJWA 3TO4D 3BPLB 4PB9L 4QRTB 2B7DT 5BMFL 1TVHB 4HXAH 4L3EE 5FA4B 2VLRA 1OP3K 1R5IA 4KY1H 5DVNA 1FDLL 2R29H 4IIQC 5MENA 3QRFM 2C7UB 2CR3A 3O41A 4L4TD 43C9A 3QYCA 4L9DA 1SY6A 3BIBX 4V1DB 5D5ME 3LKOA 3C08L 1AKJA 3MRBA 2A1WL 2EECA 3BAEL 1SBSH 3F12B 4ZNCD 3MV9A 1NBZB 1QVOB 1UZ8A 5FUZH 1OW0A 2ENYA 4JHZA 4OT1L 4JFPA 3SEPA 4MNQD 2C1PA 5DWUL 2R0KH 2YC1B 3MXVL 4RX4D 2GTZA 4HH9B 3P4MA 2VDLL 2YN3A 1OHQA 5FB8A 1II4E 1WFOA 5FK9A 1SJVA 4M6NL 2EDYA 2IANB 2ARJQ 3CVHB 1C16A 5B3NA 1D7FA 1KIUA 3BKYH 1SJEB 1ZVSB 5FKPA 4UQ2A 2F54B 3SJVE 5TQ2H 3NZHL 3RX7A 4OZIF 5EWIL 3B3IA 1U8PB 1E28A 4HDIA 5E08L 1KCLA 3SE3C 1W8OA 1VSCA 4ZTPH 3REVA 1NL0H 2NY7H 1ZHBA 2P5EA 4UT6L 4J8RA 4M5ZH 2V2XB 1W72B 1KPUA 2J5LC 2P1YA 4Y7MA 1FFRA 1YYML 4Y5VC 1QFOA 3H3BC 5J57B 4PG9B 5DFVC 2VDNH 4PJAA 1ZAGA 4LRNL 5F8RC 5GRYA 1T1YA 1HHHA 2AW2A 4PB0L 5FYJL 5KZCB 1R0AL 1TQCC 2GT9A 3B5TA 5I8EA 3BUTA 1A4KB 2VAAA 1IAIH 3QCUL 1F45A 3SGEH 4U1HB 3RIAF 3HI5L 3STLA 1DN0B 4JLRB 3V7AG 1HNGA 3B5GA 4NN6B 4PRAB 1RIHL 3U0PA 4XPAH 4NYLA 1T0NB 3BN3B 2WWMC 4XWOD 4Q9QH 2GSIA 4PJFA 2XWJB 5TE4L 1CZ8H 1MRFL 3VGAC 3UJTL 3V5HB 4MAUL 4F7CB 5F7DA 4HGWB 3SGEI 2NY3D 1RSFA 4R26L 1J18A 1RD6A 2WUBH 1TJGH 2ZCKL 2X4NB 4HMCA 4J3TA 5CJXC 4MNQE 2OL3H 2I5YH 2FDBP 3BZ4B 4Z0BH 5GS0L 4GAYA 4V2BA 4GBXA 4RISH 1FL5B 2Q3AA 4I3RL 5I19L 1Q38A 2J6EL 4AL8L 1MPAL 1EVUA 1AO7D 3UTQB 3V79C 2DMCA 3DLQR 4U49A 5FM8A 5HI5D 1NMCC 2V5TA 2CXGA 4XNZC 1G7IA 1N0XH 4TVSa 3V4VH 1MLBA 2ZWLT 3GKZA 4MA1B 2DKUA 4QXWA 4NM4H 1EK3A 1IKFH 1QBBA 2C3WA 3HG1A 4M6OL 2YMXH 2D7MA 4MXWH 4L8SC 2ORBL 2MKLC 3CGTA 3JTTA 1NAML 2BY2A 5DUML 2MSPA 2SEBB 3C5ZA 5FOBA 5EO9B 1LEGA 2VDML 3LQZB 4HK3N 1CLCA 3GJFK 5ICYB 2IALB 2DICA 4HKXA 3CDYA 4KKNA 1CDGA 3QFJA 2EYRA 2XTJC 4ODTL 1SM3L 4PRPD 4ZODA 1BECA 2BP3A 3TP4A 3RVWD 4DW2H 4HK0B 1D5IL 3QUYB 3ARFA 3VXPA 2JF1A 2HFGH 2R23B 1J8HB 4PJ8D 4Z7VF 3I02B 3L5XH 5ERWB 3G08A 4F7PA 1KTLB 4WU7A 2QADC 4JHAH 2I07A 4EKXA 4JY5H 3R8QA 1U3ZA 1QFWM 4WDIB 1CFNA 3K74B 2N1KA 4HIEB 3L7EB 5JOFA 1FN4B 3OHXB 5A2KH 5DXWA 4MLIA 4PJAF 1T83C 1IBGL 2NY2B 4O9HH 4YHML 2X1OA 3BVNA 1UADC 4HG4K 1C08B 3H2WA 4RMTA 3L5JA 3C5SB 2BFVL 4WFED 2UYLA 2ATPA 3VFRB 1L9MA 3IVKB 2PO6B 1NAKH 1AO7E 3ARDB 1QKZL 3SKNA 1S9VB 3HFML 3HNTH 3KYOB 2JKXA 5BO1L 5HYSG 1FZJA 5DJ2A 2OBGA 4NWTL 3UTPE 2V5YA 4KK8C 4OTXH 3F65A 2EYTB 3H42L 3V6FB 5ESQA 2HG5B 4EI5B 1SEQL 1KF9B 1XGRB 4YHPB 4IM8A 5DJYB 4AEIL 3O6FA 2XRAL 3MRFA 3SKJL 5DDHA 5HD8D 4PRHB 1AQDA 4NNPH 4QRQB 1DBAL 4QHNB 1ZHKA 5C07B 4JFYB 4QTIH 2NY0D 5I1LB 3FQRB 3I9GL 1JHLL 4YNYA 4XNQA 3ARVA 3WNMA 4HWBA 3CFEA 2VXTH 3E6FB 1TZIB 3ZKNC 4PRPE 4P2OB 3O8XB 1S7TA 1A6UH 4L1DA 3RNKB 5ABDE 2BHYA 5IB3B 4Z7WA 2NCMA 1KJMB 4M61A 1HCVA 2MMXA 4OFDA 2X4RA 4JFXA 5DGRA 4FQPA 4P46D 4GRMB 3RGVC 4O2FB 4X9HA 1OAYL 1VACB 5L2JA 2R1XA 4WW1A 1LDSA 4JN1L 3O11B 2HLAA 3EW3B 4BELD 4YGVB 3VXNB 2P5WA 4IRSA 3GMRB 5JZ7C 3QULA 3PWJA 4GG6A 2VLJB 2EO1A 4XP1L 1YPZB 2R2HB 3L5WB 2UUDH 1L7IH 2O5YH 3A6BH 5EZIL 3O6LH 1EA9C 3L6FB 3TNNA 2J8UB 3O2DH 3PGFL 1JHTB 15C8L 1XF2A 1CFVL 1T20B 2XACC 4NC1E 1Z9OA 2L4OA 3ES6A 1N6QL 3SDYL 5HDBF 1FYHB 2VDRH 3BWAB 5JIHA 2VLME 4LCIH 4P5MA 4OIIL 2BVOB 1IVLA 4E5XA 3AREA 5A1AA 1JGDB 4X0KB 3IS1X 2DQTH 5K9QG 1UA6H 5E8NB 1X5GA 4KAQH 3UX9B 4H25B 4XVUD 4CMHB 5J13C 2G9HB 1A1NA 3THMH 1E4KA 1RZ8B 5F96L 2MQ0A 4PRBA 2YD7A 3HS0B 4YC2C 3D25A 3LQAC 3NIFE 5EFIA 1X5ZA 2CLRB 4LHJB 4PJBE 5DJXB 4Y2DB 1A7NH 1NC4A 3VH8G 2CK0H 2ADJA 5FUCE 5EC2A 2BNRD 2FGZA 2YPVH 3OTTA 1CGXA 4D2NA 3VMOA 5E5MB 1PGRB 1ZWIB 2BVQA 1F58H 3RY6C 3T8XA 3QQ3B 4CVZB 3WMSA 3V52L 4X5LA 5EDXA 5EBGA 4EN3D 3G04B 4U0RC 1XH3B 4KPHL 2Z91A 1UXSA 5I1DB 4WWKD 5FHBL 2NXYD 4RZCA 4Y16A 3V0WH 3K4AA 4QNPF 2A73A 5DJ0B 4L5FH 4PRIB 4MA8L 4N8VG 4WUUA 2AK1H 1QLFB 2IADA 2KQMA 2ICEA 3QXUA 1U8QA 1XR8B 1J0IA 2IPUK 5BVPL 1EV2E 3PL6A 1QSFB 1P53A 3ZDZF 2A0LC 2Q1EA 1T1XB 4R2GB 5EU3B 2ED7A 4F58H 4GKNA 1VFMA 2CD0A 2FD6L 3MZTA 3LZFL 5FV1L 5C0CA 2NW3A 5TE6H 3RHWK 3IU4L 4QHLB 4JJ5B 4Z7WF 5SWZA 2GUOA 3TIDB 1RUQL 1NMBL 2AQ1A 3L9RB 2HMID 3IDNA 3N1FC 1I9RL 4LLVA 1B9ZA 3QAZC 1H0DA 4DQOH 2HVKA 3TH4T 4OGAD 3EO1A 1AGFA 4OAWB 4IMKA 3G6DH 4K94L 4D0BA 4GG6F 2NY6B 4HCRH 5L8JB 5DRWA 2P43B 2FATL 2HTKC 2G5RA 2NY1B 3T3MF 1M7XA 3MJ9L 1A3LH 4O02H 3G6JE 2FNBA 2VDOL 2DQJL 4R96A 3QDAA 1RIVH 1FZKA 2AEQL 2BNRE 2HAZA 1L9NA 1KN4H 1BWMA 4LKXB 1VA9A 4ZS6C 4QXUL 1ES0B 3DROB 5HHME 1WAAA 3P9MA 5ALCL 3GRWA 3LKSA 1VENA 5ILTL 2AV7B 1F6AA 3BEVB 3QEQD 3TH2T 3T0EA 4JM2D 3IFNL 5ITBL 1KJVA 3HRZA 1D5BA 4MJ5B 4KKLD 4OCYL 5JMOC 5DC9B 1UQSB 4EI6B 5JXED 4HUXB 5H94A 5AUMA 4E41A 3NFPB 2ZG2A 1X9QA 5IROC 3C60C 4NP4H 4ZMAT 5C3TA 3NCFB 1VFBB 1G7PB 3DUUB 2CLVA 3BDYL 1X6LA 5D7JC 1ZT1B 5DRZA 2GJ6D 2VZSA 3PDDA 4LPWA 3RVTC 1U8LA 3LRSA 4HX1A 5D71L 1I4FA 2JE8A 1EHXA 4XZUB 3NMEA 4LMQI 2E6PA 4ALAH 3TFKC 3W0WB 5DJCB 4I48A 5DR5H 4NQCB 3N1QC 4JDVB 2V7NA 1U36A 1ZSDB 3SDCB 4ZO7A 5TDPA 2J2ZA 1IFHH 4RGMC 3ZKMD 5CHNB 4MCZB 2E9IA 2I9TB 5DJ6A 1B4JH 5E9DE 3QDGA 1A7OL 2BHUA 3WYRA 4PJ5A 3NCCB 4N0RA 3MROA 2NLJA 4KQ3L 2ADFH 4QRPA 2VZTA 4LEOA 3TN0B 3VXRA 2IH1A 2R4SL 3MCLH 3VFUB 1ZVYA 1EO8H 1K9TA 1KIPB 4JDTH 5F9OH 4X6DE 5JLZB 4EIGB 3FO2A 5SWQA 2DLIA 3R0NA 1SYVB 4H1LB 5GRXG 1HEZA 1CDYA 3S7GA 1RURH 4NOFA 3GNML 2KZWA 4U6XA 3WXWH 4JB9L 4P23C 4LHUA 1KCSL 1N7MH 1T21A 1WGOA 1UKQA 4GG8A 1MIEH 3X13B 5HYSB 4WU5A 4JRYA 3RNQA 4IOSD 5L6YL 3OB8A 3OPZH 4G42A 1K5NA 4JEGB 2UWEB 5IEKB 4FQJL 1B4RA 4NKMA 1F4XH 1GOGA 1IEAB 4NM8H 3NCEB 4Y4FB 3VGEA 1MHHA 1A14L 1LDPL 2GJ6E 4ODSL 4Z7QF 4ELKA 4NIKB 3HMXL 4G8EA 5F71A 3INUL 1QA9B 4UNVA 2O61A 2NR6C 4EZMA 2QQKL 5DC0A 1QRNA 3OKLA 5EBLB 1V7MH 1WAAF 4GS7B 4X6EB 4ZFZA 4B5EA 3ZYJA 4I9WD 3DX8B 3HNSL 3QEUB 3MLTA 3O4OC 1A02N 1DE4A 4OZFH 1R5VB 4OZFG 1EHNA 4CADA 5I76B 3B2VH 1WEJL 4LPCA 2VR5A 3BZFA 4U1LA 1D9KD 3NPSC 4XHJD 4ETYA 4NJAH 2VE6A 2NZ9C 4PJ7A 3MJ7A 4PREB 3G5YA 4IRZL 4OI9A 4IRJB 3STZB 2E27H 2F53E 4IIQB 1FC1A 4WO4D 3FFCD 4I5BA 1J8KA 2DQEL 3DRQA 12E8H 4KMQA 1CGTA 5EU6A 3I75A 1NUFA 2H8PB 1NC2B 5D7KD 1JPFB 2ZZUT 3LQAH 3U9UA 4OD2B 4I2XA 4NZRH 5F44A 2YRZA 4DKFH 2FSEB 5CUSL 1K8DA 5E94A 3RAJL 1NCAL 2X9YA 1BLNA 4M43H 3S4SG 1F13A 4NO0A 3RZCB 5T1DH 1Q72L 2YBRA 5EH1A 4ORGB 1VFAA 2NX5D 5I1HH 4XCYA 1ADQH 3FONB 5GGVL 1ULVA 3O6MH 3SDXE 1S3KL 4PJEA 3S37H 1I85A 1FAIH 3MRDA 1JRHI 4MJ6B 1H9VA 1OY3B 3I6GB 5IFAH 1RK0B 4JRXA 3DNKA 4JDZB 5GJSH 3QA3B 3T4YB 4KTYA 1GGBH 5LGJA 2BSTA 2AJXL 2ITDB 3H3PL 1SQ2N 3VXSB 5KW9L 3E3QC 3QXTA 2HKHH 4N0UB 2C1OA 4XNMA 2OL3A 4CU7A 2R2EA 2X4PB 1K4DA 1Q9LA 5GS0C 1JNNL 3QP3A 1FBIL 3FQNA 5LGHH 3RBSA 5JHLH 2QHRL 4I9WE 5C0BA 4Y5VB 1ACZA 1HKFA 4QKXB 3DTXA 1I8LA 2FZ3A 4NRZB 4K2UL 3I3BA 4FTVA 4FFZH 1RU9H 1G7LA 2G60L 3F7YB 2Q20A 4XP6L 5I9QB 3BE1L 2AJYH 1EEZB 4APQD 3X14B 3FT3B 1S7VA 5CGTA 1OAXL 3D0LB 3DSFL 3IJYB 4N8VB 2Q7YA 5TF0A 1U3HC 5E8EA 1P5VA 2ZKHL 4AZ8A 4DEPC 3NN8B 3FFCE 3MV7B 1ORSB 2Z9TA 1DSFL 1FL6B 3WIHH 1CD1A 2P45B 5C9KA 4Z7UB 4X7SL 1J0YA 2F19L 5EPMA 5EU4A 3QI9D 5J6GB 5GGRB 2QQNH 3B6SB 5LXGH 1G7JA 2CRZA 5FYKL 5D7KE 3V6BR 3QCTH 3NACH 5FYLE 2FO4B 1PKQA 5K9JH 3IXAA 4JR9L 3VI4F 1G1CA 2L7JA 4P2QA 4ZD3H 1HKLH 1IL1A 2MHAA 3TWCL 5H35A 2IAMB 2BMKA 4ZUSB 3SOBL 7FABH 1CN4A 4CU8A 3D9AL 2Z8VC 1Z5LA 4PJ7F 2PXYC 3D3VA 4KVNL 2YD2A 4IEFB 3GSUB 3WSQL 4N8CL 3P9LB 3WNNA 1BEYL 4D0CA 1J1XL 3DXAB 5E6IC 2JJTC 1RIUH 3RL1B 4C4KO 4TVPE 5IT2H 2OR9L 3RRQA 1P84K 4QOKD 5MERA 1F11A 1HHKA 1OD7A 3HPLA 2FX8L 3AM8A 1W0VA 5EUKA 5K59E 1YY8B 1JPGB 2Z8RA 3BWUC 4NWUL 1KNOB 5ID0A 1HIMH 3KLSA 3OKOA 2JLLA 4K3EL 1FFPA 1D5ZA 3QUXC 3LKQA 3L1OH 1PY4A 1WIPA 3BGAA 3MRNB 5BV7C 4RAVA 4UV7L 5IHLB 1BJ1J 1DVFC 3GSQB 4YBQD 4LPVA 5IB2B 3QNYB 5D1XC 3JUZA 5I66B 4PJEF 1Q9WB 2XTJB 4JFFB 3ARSA 1JVKA 1BD2B 2BOBB 3EUUA 4F9LC 3WS6A 4Q9RL 3S36X 1WFTA 3QSKB 3Q5YA 5IHZB 3KXFB 1I9JL 1XF5A 1S7QA 4U1IA 4KV5E 5D1QA 4S2SB 1DLFL 4OLWL 5I8CB 3U4BL 3DVNA 5KAQG 1KLGB 3LS5H 4XC3H 3TPKA 1BFSA 5TDNB 3Q1SH 3ZKQD 1LHZA 3RL2B 3DGGA 5JR1H 5B38B 5EZJB 5GSVB 1QO3B 2R0WH 3ARBA 2IGFH 4NNXB 3REWB 1J0ZA 4MHHG 1UJ3C 2QSVA 1WK0A 4ZFOB 3QO0A 1U3JA 3ESVF 4JG1L 3LKRB 4MSWA 5DRXA 3SDAD 1A4JB 5BQ7A 2X4UB 4XAWL 1OF2A 2B2XH 4PFEA 1JUFB 1JNHA 4MS8C 1K6QL 1JZ4A 1RFDH 3UYOD 1LD9B 4HG4J 3ZZ1A 4P3CH 5EO1A 5IIEA 5I0DA 5IG7B 5E1HB 3EHBC 3D39B 1KB5L 3DVIA 3FB8B 5J1AB 4HUKB 4OZGA 4I0PD 1T1ZA 4PB9H 4Z95L 5BMFH 4F7MA 3ROOA 3VRLF 3FQXA 1CGUA 1FDLH 3ILQD 3MBXL 5DD1L 1U8OB 2EIZB 3P73A 2V7HB 1RZ7H 4UIKL 3C5JB 2ENSA 4N0CC 3ZTJH 3ZTJG 3RP1A 4M7JL 3BAEH 3O2DA 2DTSA 1IGCL 4C56D 5L8LB 3ZYZA 2NQCA 4MAYD 4OT1H 1JGEB 3QIWC 2X40A 4P2YA 3HPJB 5GHWL 4EVNA 4HUVA 1A3QA 4M93C 5DWUH 5I71C 2DQFA 1EERB 1RK1A 2HVJB 5E6YA 3IJHA 3H9HB 3T0XA 4PJGB 5T5FL 1MLCA 4RDQG 5IK3B 1QG3A 2YSSA 4YDIH 4NNYB 4GW1A 4M6NH 4WHYH 4QF1A 4WHYG 5C0EA 4P49A 3FTGA 3HC4L 3JV5A 3I6KA 5CMAA 2VOTA 3KNBB 4KH2A 1RUML 2HJLB 1QSZA 3QHZL 3NZHH 1QD0A 3T08A 1TXKA 1KJ2B 2P7TA 3MLYL 4GO6B 5EWIH 2XOTA 3BP4B 4HLZH 4KJWC 3L3HB 4LLMB 4WTWA 3O4LB 4N9GA 4CN4A 2QQQA 3VWJA 3P11L 5F1IB 2EE2A 3T2OA 2F74A 4G9FB 4QCIB 1KGCD 3WS3B 4PJHE 5CZKA 1U8KA 2GQHA 1OP5K 4UT6H 3QH3A 3UROR 2YD1A 1KPRA 4IJ3B 2D4DA 4DCQA 4O5LH 4NT6B 1Q94B 4GRWE 5BW7C 3ALPA 2QTEA 5IHUH 4OFPA 4LCYA 3NCYP 2QKIB 1FL3B 5HHNB 2V5SA 4PG2C 1WWBX 4XBPB 5FYJH 4M48L 2DIJA 2GITB 2H32B 4AM0B 3LSOA 3CPLB 4BFEA 5F6IB 3U4AA 5DURB 5T1KB 2FX7L 3TCLB 4RA0C 3HI5H 3HE6D 3CDGA 5E2TL 3FAXA 5SV3A 4L3EB 3U7WL 3U0TA 5KANG 3MNWA 3TBYA 4AH2B 2P48B 3SBWA 1OD9A 3MGAA 1I7RA 5KS9A 3MLPA 1CFQB 4TPRL 4ACPA 4MAUH 4XH2B 1F5WA 4RCAA 5CS7A 5D5MB 1SYSA 3U46A 4R26H 4C56E 5CJXA 4NO3B 1DEEA 1N5AA 2ZCKH 1J5OL 4CRPA 1RULL 1EJOH 3DURB 2M1KA 4KTEH 5DT1H 5GS0H 5KANI 1M7IA 3BGMA 3QIUC 4M7ZC 4E42B 1U3YA 4LOUC 3TJEL 4I3RH 2AJSH 1PYWA 4AL8H 1MPAH 4B41A 1CD8A 1QFWL 1GIGH 4HJJH 4NQXA 1H3PH 4M7LH 1IKNC 5FM5M 2HTLD 4K94C 4HCRA 1WBXB 4N8PA 4OB5H 5E6ZA 5IMMA 1RHHB 4UNUA 4ZXBB 5FECA 4LRIC 4K9EL 3WKML 2E9WA 3SJVB 1CWVA 4L8BA 4L8SA 4ZQKA 2P8MB 5DD6B 2I9LA 4KUCD 2WIIB 3GJEA 1KGCE 2ORBH 2R1WB 1RZJL 1EX0A 4ZUUA 5JOEA 3TBVB 1NAMH 3RUGA 5DUMH 3DBXA 4KZEH 2DKMA 2VDMH 1C5CH 4BA8A 2Q8AL 5CWSB 1F3DH 5FFLA 3HN3A 1M6OA 2E7HA 2UY6A 3P0GB 2KUTA 3OKMA 4KGJA 2ZUYA 3KGRA 4ODTH 4RWYL 1I8KB 4Z77B 3ARYA 1IE5A 2HKFH 3DV6A 4NO2B 6CGTA 3OAYK 4N0FB 2XN9A 5IJKC 4MVBD 3SHSA 1D5IH 5T33H 3TO4B 3QAZB 1R24A 2XTLA 3QO1B 4MNGA 3GSXB 5DEGA 3WFBL 2Q87A 4KROD 3UTSD 5F7YC 4JFZL 5DQDL 5ISZA 3VI3E 1K2DA 4X6CE 1E4XL 2FCBA 5FO7A 3R06A 5JW5B 4OGZA 2DJ4A 4K7PX 4JN2A 4F2MA 1L0QA 4X6BA 3QUML 1JPTH 1T83A 5IBTH 4U6VL 3JVGC 4J1UB 4YXLL 2BRRL 5E2UL 1IBGH 3RWGA 2FIKB 4OCSL 1WITA 3L3DB 4MNQB 5C0JB 3QUZA 2W60B 1HCFX 2BFVH 5D2NA 4YWGL 4R0LC 3E8UL 1LO2H 4N5UA 4OM0H 1TVBA 4PLJD 1EFXB 1QKZH 4JPIB 5JPMA 3HFMH 4HHAB 1ZV5A 4J2XA 3KPLA 2AXJA 5BO1H 1E4JA 2D0HA 3UBXG 4OKVA 1FZMB 4NWTH 3TVMD 4M1CD 5E0QA 1MHEB 4PJIE 4G5ZH 3UCRA 3FQWA 1ZT4A 4PJXE 5KS9F 5C08D 4W6WB 5IW1A 3SCMD 1NKRA 5E00B 4MD5A 1SEQH 4ZS7L 3T0VA 3WO4C 1NDGA 3HE7C 1J1OL 2B1AL 4N1CA 2XRAH 3EYFB 4MMZC 5DI8A 3RA7L 1ED3B 3SKJH 5HY9A 3H6JA 3MRQA 3QWOA 1VDGA 1DBAH 1TPXC 3TESA 4S1DC 3V6ZB 1J1PL 5JDSA 1FYTD 2ILLA 2DLHA 3EFFA 5T3XD 1JHLH 3KPRE 1C5DB 3H7BB 3DETD 2I27N 1HSBA 4RGND 2YEZB 4JPKL 4AEFA 3MR9A 4WUKL 3QNZB 5JA8B 3VFOB 4KKBD 1NGXA 4JPWL 2JJSC 3RDTD 1PD6A 4HT1H 1I1FA 4RGMB 3RGVA 1HHJB 2HT2C 3RTQC 2Z8WC 1NCDL 2QQLH 2ZJSL 4TSCH 5J6HA 5CD3A 3OKEA 1OAYH 4LSPL 4A6YH 5MHSE 4JN1H 4P2CG 1PEWA 4Y4HC 4D0DA 1CXFA 1D6EB 2D31A 1SHMA 2VTFA 4WFGD 4MD4A 3WLWC 4ZAKC 5D9SB 1OCWL 2E7LC 4GQPH 3PV6B 3V9FA 4XP1H 5C9JB 2VUYA 3QCVH 4ONFH 1U2CA 2PCPA 3LKPB 3OXSA 4LPYA 4OZFA 2NY3B 3KPSB 2V9RA 3PGFH 5IOPB 2EE3A 5GS1C 2CGRL 2GK0B 3MYZA 4NPYA 4KRPD 4NUJB 3UPRB 4P23B 1IILE 5ELIA 3N1GC 1N6QH 2WBWB 5KVFH 4EDXB 3W2DL 1UH4A 2JCCB 4H26A 4DGVH 3VD4A 2PN5A 3FCTB 3KHOA 3OJMB 1KCKA 3ZKSD 4I4WB 4QHMB 1AO7B 1GRWA 1G7QA 4GRLB 3MSPA 1BAFL 1MCSA 4ZUTA 1Q0YL 2KDGA 5C08E 3RWIB 1FIGL 1FGVL 5A2LH 4OI7A 5F96H 3LCYA 3IFLH 2DQGL 4LVHC 1KTDB 4FXLA 3D87B 2A74A 2VKXA 4Y2OA 1LK3L 3MLZL 3K0WA 4BH7A 1ZGLA 4PGCA 1FVDB 3E2HB 3VFPA 3V4UH 4UNTA 3T65B 4U1SA 3GMPB 2HP4A 3GMMA 3BIKB 43CAA 4NKQB 1P6FA 1LO3L 3DO3A 2X9WA 1S7UA 4RIRA 1CU4L 3V52H 3WV0A 1E4WL 3HAEB 4KPHH 1AD0A 4D3CL 5FHBH 3B43A 3KPPB 3V6OC 3IJSA 4MA8H 4CKVX 4Y1AE 3A6OA 1CLYL 2WWKO 4WFGE 4PJ8B 3ELAT 5JO5A 3UJJH 2FEDC 1OPGL 4TUKH 5BVPH 1U8MB 1U95A 2DM7A 3MLSH 4YAQB 5T1LD 5HGDB 3KYNA 4OKDA 1XGUA 3AMKA 2JB6A 4M02A 3LZFH 3G5XB 5JPNB 1BZ9A 2Z31D 3VXUD 4M00A 4OCMC 2X44D 3HI1B 1I8IB 5CEXB 1D5MA 1XF3A 5JW3L 8FABA 3A67L 1NMBH 2AK4E 1LQSR 1FQ9C 3S35X 1I9RH 2D7OA 1CG9A 4J12A 3WIHA 2D7PA 4C57C 1H5BB 3GGWB 2IFFL 4K94H 3UAJC 1A1MB 3BD5A 3OG4B 3GKWL 2PYED 2FATH 4CBPA 1CICA 4Q6YA 1PZ5A 1OARL 2Y4SA 3MRIB 4PJ9D 3MJ9H 4UOJA 3S8WA 4V1DA 4RNRB 1S7SA 4ZYKB 1X5KA 3MLWL 2VDOH 1TENA 2DQJH 3PQYE 4Q74A 5GQBA 1AR1C 4NO5B 1PEZA 4PJBB 4MJIA 2P8PB 1FVEA 2NY5L 2R0ZL 4QY8A 1LWRA 2CIIA 1OTSD 1ZLWK 2NY0B 5CJ5A 4LEXL 5GXBB 5HJ3B 5B8CA 2DYPD 5ALCH 4WI2A 5DYOB 4X8JA 3EO0B 5TGBB 3CFJB 5ITBH 3KAAA 4E0RB 1CXHA 4OCYH 4S1SL 3RU8L 3H3KA 3BZEA 5D1ZD 1JN6A 3C60A 3PDOB 4Y5XC 2QLVB 4U6HA 3PP4L 4P46B 5D7JA 3BDYH 1CLOL 5J12C 1Q0XL 1WTGT 3PHQB 4HAGA 1U8PA 2D0FA 2X4TB 4O4YH 4UBDD 4BKLB 1NCNA 3S34L 5JMRA 3TIEB 3LN4A 1FZOB 3GSOB 4U1KB 5D71H 1UT9A 2O5ZL 1WICA 3MNVA 4OF5A 4L8CA 5KSUB 1DZBA 3UTTA 1ACYH 3AS1A 2GJJA 3F7QA 3CJJA 3RKPA 3VXUE 2V5RA 3TZVD 2DAVA 2DWEA 3VRJB 1O7SA 4PG9A 3FOMA 3HLAA 1LP9A 5C7XL 4XGZA 2X7LA 1ZA6A 1WF5A 5DK2B 5E24E 1JPSL 1UKSA 2NW2B 3EOAA 5LWYL 1KB9K 1A7OH 1AGEA 1NGZB 5AWNH 1YNKH 2ZUTA 1DBBH 3GBLA 4KQ3H 4G8GE 1GGCL 3NFNA 1P84J 1JFQL 2R4SH 4IMLB 5DRNB 2PYEE 1Z6JT 3PHOB 3UEZA 1Y6KR 2C3VB 1RZIB 5FF6A 3QUXB 4G7VL 3GNMH 4JJHA 5BV7B 4HGMA 4JB9H 5KSAC 2BNRB 2X4SA 3IKKA 4XPBL 2F8VA 4XCCL 1X4YA 4OZIE 3CUPA 5CSZB 4EUPB 4JG0L 4ZNEE 1NGQL 1TETH 2XIDA 5HHMB 1T03L 1T66D 4NN5C 2FJHA 3UBXB 1XCQB 3VA2C 5L6YH 5FA3B 3G6AA 4CDHA 3O2WL 3U36A 4EN3B 1WZ1L 2BHZA 1GOFA 4LSQL 2X10A 3BT2L 2VYRE 3ZL4L 3WUWG 2W1NA 2A6DB 4WWKB 1OAUH 5FCSH 3SQOL 1I7ZB 3BW9B 1A14H 3QQ4B 4DJMA 1LDPH 2IQ9L 4PR5B 4ODSH 5HVWA 3HMXH 3OZ9L 3INUH 1X5YA 2LABA 4QXGL 2QQKH 5ESVB 3C2AL 3RI5K 4XXDB 5T3ZE 3KLAA 1MCPL 3HNSH 1QSEE 3OKNA 4HJ0C 1ZMYA 1S9YA 4XRCA 5B22A 3VXMD 1JIBA 3PJSB 1FSKC 3BH9B 3LIZL 5JNYB 1YMHA 2IALA 1HH6A 5B3JF 2WW8A 4H5SA 2P5ED 2W0FB 4HJGB 2V2TB 2BNQB 1DQJB 3GO1L 3LQMA 1GZQA 4A6YB 2QV2A 4IRZH 3X11B 4GSDL 4C58B 5E9DB 1AGDA 2VKWA 4HPYH 1ZLVH 1I1AC 3VGDA 3BYYA 4FQQA 1DLHB 1MCIA 3ARGC 2EDTA 3RY5A 2IH3B 5ERWA 1FNAA 1YEJL 3VWKD 3L3IB 1KTLA 3P9WB 1OGAD 2EDFA 1MH5B 1A5FL 1WUNT 4LAQL 4WDIA 2VLRE 3BPOB 5CZXD 3NOIA 2WBKA 3QJHA 4X6DB 3RAJH 4X5WB 3L7EA 5I71B 5JIPA 1WWCA 5BVJB 1LP9F 3CFKA 4FQHB 4HSQA 1Q72H 4OFIA 1ETZA 5D7LD 1SVZA 1BHGA 2BOCA 5KAQF 3MV9E 2CDFA 4GMSL 5CGYC 2BCKA 4ZOAA 3VFRA 3OR7B 3IVKA 2PO6A 3EOBA 1HQ4B 1M4KA 1MHPL 3GMOA 1ORQA 3CSGA 3GSVA 4NZJA 3SKOB 5BZDB 4CL7A 2VWEE 2BVPB 1P7HL 2A83A 5BRZA 5FAAA 2CDEA 3B4NA 1M1SA 4JQIH 4GBXD 3T0DA 2AJXH 3H3PH 5F1OB 1XGTB 1UFUA 2HA1A 2GJ6B 4HS6A 4M9OA 1JNNH 1KJ3L 3EJZC 2QHRH 5CP3A 5C2BL 1M05B 1EEYA 1HSAB 3V5DA 1IC1A 1UC6A 1NCWL 4JFOB 4FZEH 4X80L 1DDHB 4K2UH 4Z7VE 1CL7H 4JRWA 2P5EE 1HWGB 2G60H 3C5ZD 4XP6H 3MJ8B 5IB3A 1MEXL 1HOCB 4ODBD 1CDIA 1U3HA 3KJ4B 4K9EC 3RJQB 4FFVD 3DSFH 4J4PC 2LAAA 3C6LD 1LK2A 3LEYL 3QDMD 3VFMA 2ZKHH 4AJ0A 2HJFA 5K9OB 5DS8B 1FVCB 1NAMA 2F53B 4JZJA 4LLUA 5CBAA 5LCVH 1P1ZB 3RX5A 4X7SH 3KR3L 3BQUC 2DD8H 2HWZL 4RDQF 5FYKH 3OL2A 3DX9B 3S96B 2AV1B 1YPZA 1MVUA 4JR9H 4G80B 1HILB 3L5WA 1P9MC 3L6FA 1IQDA 5F9JB 3QIUB 3WBDA 4OV5B 4BQ6A 2EDXA 3FB6B 3SOBH 4QEGA 1AGCB 2PXYA 1RUPH 2P24A 3B8SA 3RWJA 3O9WC 4KVNH 4N5ED 5C8JA 5F6HI 3UJIH 4LGSB 1EUTA 4N8CH 1EUUA 1BEYH 4OFYA 4L4VA 4WW2C 1CR9H 3GSWB 3BWAA 5E6IA 3SDXB 4ODVL 2EKSB 3ZMRA 4NUGL 4YHOL 1G9EA 3V8CA 2Q7NA 1DQLL 1IEBA 3DYMA 2OR9H 3DIFB 1U58B 1U8IB 1JZ5A 2ICWI 2FX8H 4G8FB 3FKUS 5H8DA 4WTZG 5ADOH 2G9HA 1D3CA 1I7UA 1AGBA 4F37K 3HS0A 4PUBL 1AJ7L 1RUAL 2Z35A 2K1MA 3JV4A 3M1BA 4K3EH 3HC0A 4Z0XB 1QQDB 3U7YH 5DJXA 2WM0A 3RWDB 1FGNL 4I1NB 4NCDA 4UV7H 3PE9A 2ZSVA 4YJZL 4YHKL 5D1XA 1LEKB 2NXZD 1GYAA 5JORA 3HG1E 2D2OA 4P4KC 5HHPA 1ZWIA 1AFVL 1YN6B 4F9LA 2YUZA 1PSKL 4ERSL 1IARB 4CVZA 4Q9RH 4KJPD 4ODXB 1T4KA 1ONQB 1I9JH 3QB7C 1W0WA 5FXCH 1DLFH 4LBEB 2K7PA 2IAND 3U4BH 1NLDH 5C09D 1IAKA 1T5WA 1R3IL 4XCFL 3FFCB 3CCHA 1QLFA 3P0VL 3KPOA 1OM3L 1QFHA 1UJ3A 2IBZX 2F54D 5GRUH 5HDBE 3ZDXF 2GTWB 1G0XA 3R4DA 3SE8H 4GXVH 4GLRI 3GSRA 3SY0B 1AXSB 4JG1H 3SDDD 5EU3A 4AT6B 5C0FA 3FOLB 1EEUA 2P5WD 5AZEL 2YKLL 1JJUA 3NCMA 1A9EB 5J1TC 3Q3GA 2X89D 1KT2A 1G9NL 4H8WL 4RFOH 1QLRB 2H9GB 3MFFB 5EG6C 5C1MB 1KB5H 3BRFA 3RPKA 3HRPA 1IJ9A 3FFDA 4Z95H 1CDBA 4AEHH 4Q2ZB 3WO3B 1S7RA 3MBXH 5DD1H 1KUMA 1I3GH 1OGTB 1NCBL 1MFDL 4AEEA 3OX8A 4LFHG 3BO8B 1RI8A 5A2JH 4OAWA 1LO5B 4UIKH 1KIRB 3PGDA 5MI0B 1QUNA 3HE7B 3W39A 2EZ0D 5CLWA 3PIQB 3E0GA 3T4AA 1T89C 5JOPD 4NQDD 3MUY1 5B4MC 3I50L 5GHWH 2QSCH 3TEUA 1KCRL 1HXYB 1MAJA 4KWUA 3WD5L 4FNLL 5J06A 3NTCH 4LKXA 1NBVL 4QNPE 1VESA 4TSBL 3QIBC 4JY4A 3LB6D 1MRCL 3HC4H 3B9KC 4M4RA 3ALXA 4G8IA