1YNTB

Structure of the monomeric form of t. gondii sag1 surface antigen bound to a human fab
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
218
structure length
218
Chain Sequence
QVQLQQSGAELVRPGVSVKISCKGSGYTFTDYGMHWVKQSHAKSLEWIGIISTYSGDASYNQKFKGKATMTVDKSSSTAYMELARLTSEDSAIYYCARSSTWYYFDYWGQGTTLTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the complex between the monomeric form of Toxoplasma gondii surface antigen 1 (SAG1) and a monoclonal antibody that mimics the human immune response
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Immune system
molecule keywords 4F11E12 Fab variable light chain region
total genus 40
structure length 218
sequence length 218
chains with identical sequence D
ec nomenclature
pdb deposition date 2005-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yntB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yntB02
5GHWH 4ORGB 3PHQB 1K3IA 2QQNL 5IBTH 1DBBH 3RVXD 1A1OB 4N5ED 4XZUB 3H7BB 4RWYH 1OOAA 1K4CA 35C8L 1AD9A 3WL9B 5GIRA 3FO1A 3VH8B 5EU6E 2EXWD 3KPSD 2E7LC 2C4FU 5GGTL 3X13B 2YHGA 4ZOCA 4EI5D 1T22B 4XPFH 1AXSA 1T1XA 1U95B 3OB0H 1YEFH 4KAQH 5AYQA 3BWUC 4RX4A 4DEPC 5F7UA 4HWNA 4Y2DD 4E0RA 1WITA 4M1DL 2OTUB 1MAJA 5EZOL 3CFEA 3P4NA 2E7BA 1A6AA 3GIVA 4P59L 4XNZB 4UQ3A 5J12C 5CP3A 1YN7A 3DRQB 3QISA 3CX2A 5J6GA 1GC1L 1KLGA 5IR1A 2X1WL 3E1F1 3LSOB 1KCUL 2YXFA 4EI5B 4KRPD 5DTFB 1EMTH 4NQXA 1BWMA 4G9FD 3ZE0E 5DR5H 3DX6A 4WRLA 3BP6B 1JWMA 1EO8H 2AQ1A 3LY6A 3QCVL 5LGJA 1VPOH 3KPPB 4RA0C 2JIXD 5IESH 4NRXB 5AWNH 4HFWA 3VXUE 4P9MH 1YEIH 2X4OB 3BQUC 1RUPH 2RIKA 3CDYA 4LPVA 1GGIL 5A2JH 2CDFB 4GW5B 5CP3H 2VXTH 1EUUA 4OJFL 3TPUA 5C0RL 3MV8A 2RAMA 5L2KD 4LHQB 4EQ2A 5KANI 1E28B 4DUWA 3N0PB 4I0CC 1ORQA 1CK0L 3LV3A 4YDJA 4EBQH 3C5ZA 1MPAL 1RMFH 1PVHA 1CFVH 2W9EH 4HS6A 2OP4L 4XVJH 3V5KB 2ZOLB 1ND0A 4JPIA 3D0LB 3WDIA 2IFFL 1EZVX 1PX4A 1UVQB 2VL4A 4LNRA 3BHBA 3O11B 4GLRH 1TFHA 3T0ED 4TNVF 1KEGL 2WLYA 5SWZB 3CLFH 4Y5XB 1I8KB 5SX4H 3RVTC 3VFPB 4D9RE 1HXMA 4UTBH 2AK4B 5CHNB 2AI0L 4H1LG 3NCYS 4YPJA 5HHVL 1I7ZA 8FABB 4DGVH 3MACH 2YN3A 4C83B 1CICD 5IW6A 4KWUA 4WHTB 4JVPA 4DUXA 1JYXA 3MRCB 5JXEC 1CDBA 3G5VB 5F9OL 3WFBH 5I15H 4KZDL 2YPVH 5KSBF 5IF0B 3P9MB 1FVEB 3BGFB 5JO5A 1YEJL 5C0EA 2ZG3A 2I5YL 3KYNB 3CD4A 3RY6C 2C1PA 3VFNA 4WI3A 1RIVL 3G6AA 3W11C 3P0VL 3DO7B 1G1YA 4FQ1L 4UV4L 5C0GA 1F4XH 3GBMH 3QQ3A 2AK1H 3QJFB 4KDWA 4ODSH 4JKWA 4PRPA 1RUQH 3MJ7A 1JNJA 2D0GA 4DQOH 3OXRA 1F4YL 1U8IA 4OI9A 3D85B 3C08H 1TNNA 2UVEA 3LHPL 3GMNA 4M5ZL 4CMHB 1YN6A 5T33L 2YPLB 3D3VA 5B4MD 2FGWL 3O6ML 2VN7A 4F7MA 4JRYB 1OAXL 5ALCH 1DEEA 4KGJA 5IB5B 2XA8H 1I85A 3MBEC 3U30C 4AIXA 2FATH 1A5FL 4C56B 5F72S 5A2FA 2BHZA 3VFMA 5T3XH 4URTB 1BLNB 2WINB 5IMMA 3T1FA 3RKPA 1BQHB 1MRCL 3L7EB 1ZT1B 5DHVH 4D9LL 4Y5YC 3VFNB 5HJ3B 1S8DA 2VDPH 4WWKC 5ID0A 3NIDE 4JDTL 4UU9B 5ACMA 1EA9C 1FYTA 5FV2A 5A40E 3WUWB 1NFDA 1R5IB 2NX5E 1IGML 4CKVX 1WV7T 2KQMA 1KJVB 4LVNC 1S7VA 4Y19A 1JPSH 2CSPA 3NIFF 1UZ6F 3MREA 3QXWA 1GVIA 3C60D 3TN0B 4Q6IB 2VDQH 4FQXB 4LPYA 2WZPD 1HWHB 4L8SA 4NRYA 3FT2A 3KYOB 2OS7A 2YBRA 1FL5A 3T3PE 1VGEL 1WBZA 3SKNB 3QIUB 1S7SA 5JOFB 4IRZH 1JCKA 4FQHA 1FJ1A 4M6ML 4UILL 1Z6JT 4JM2F 1GCFA 1X9QA 4UQ2B 4PBVC 3CFJB 5IBLD 5IIEA 2CXGA 5J13C 1D5IL 2R69L 1A7QL 1IEAB 4LGSB 3MV7A 3O9WA 5B3NA 4Z7UA 2GI7A 3CAFA 2C3WA 1T7VA 4DVRH 2Z8RA 4KY1L 4PJCE 5DI8B 4FFVD 4PYGA 1WAAA 1MNUL 3GZKA 3MJ8B 1QFWI 2APWA 2BOBB 3T0XA 1JZ3A 4N0YL 4MJ4A 4J3SA 4KVCH 1EXUA 4HEPG 4ONGL 3LKPB 3OAZH 5IFAH 4DGIL 2P5WB 5EUKB 3OF6D 3CH1B 4ZUWA 3VDAA 3SGEH 4KGLA 3C6SA 5DJ6B 1DDHB 1ORSA 5JW4R 5DK2A 4YFEA 2C7UB 1T1YB 2R4RL 1H3PH 4RMWA 4I8DA 5LG1A 1TVDA 1F5WA 2HT4D 2HAZA 5ENWB 4GKSA 5IHUL 3DXAE 4NO0B 2HG5B 3MLSL 4JO4H 4MQSB 3W0WA 4NQCB 5IROC 4AENB 1NGPL 2EKJA 3TGXA 3U36B 3ARGB 4LCWD 5L2KA 4G5ZH 2KZ1B 1U91B 1HOCB 1XF5A 5TFSL 3C9NA 4HAFA 2QHRH 3SCMC 3RVWD 3JV0A 4ZUUB 5F3BA 5C3TA 5D2LF 1UB5B 2PKDA 1IJ9A 4P2RE 1CIUA 4PJ8C 3IGAA 5BS0B 1E4XI 3QUZA 4MCYA 1YPZA 2AV1A 2QBWA 1UCBL 4MDJA 4MX7B 4Y89A 1DQLH 2IADA 5ADPH 3K4DA 4LSQH 4GAFB 5AUMA 4GRWB 3T77B 3CFBA 2LAGB 3AU1B 3CIQA 1OCWL 4UINL 1NFIB 4BH8B 5JPNA 1EAPA 3PGDA 4NQSA 4QOKD 5JOPE 1TQBC 4K8RH 3ABZA 1WSST 2G5BA 3ZKQD 2XZQH 3VWJD 2Z8WC 3GI8L 1VKXA 2XV6B 4G6AC 4DGVL 3QUYD 4Y5XC 3NZHH 2COQA 4W81A 3U7WL 3ZDZE 3S8WA 1U0QA 1PQZB 5DS8B 3CXDL 3CLEH 4WV1B 5KS9E 4EUPG 3T0EA 4WFFD 4PR5A 4PRNB 3AMKA 2LFGA 2CDEB 5TE6L 4YX2H 2WSKA 1U8MB 2NCMA 2BOCB 1NAKH 4UDTA 1GHFH 2HFEB 4EKXA 3L5HA 5HD8C 5F44A 3QO0B 2DDQH 2HRPL 4FQQA 5D72L 4JQXA 3X3GH 1C12A 3GJFA 1PX3A 4PJBA 3B9KA 4L4TD 4QRRB 5CJ8A 1NFKA 2FX9L 3MRGA 2YBRB 5EOQH 3UTTB 2W0KA 1IKFL 5DO2C 1F4AA 5TDNA 3LEVH 5TE7L 2UUDH 5DS8A 1AO7D 1ZKAA 4HT1H 2DI8A 4IHOB 2E9JA 4WI4A 1GAFL 2PYEB 4AG4H 3EYSH 1RUKH 3B3IA 4ZDHB 3MUHL 2HT4C 1SJVA 3ESUF 3NMEA 4M7ZB 3S36L 3V79C 4F3FA 4S2SB 1YYLH 1HNFA 1G1CA 5I1AA 4HKXB 4UNVA 1JPFB 1I9RL 4LDLB 3KXFD 2XQYK 1WK0A 2BVUA 2F8OA 1YY9D 4XCFL 4Q9RL 5CGYD 3TESA 2PXYD 3STZA 4EIGB 3KLDA 2FL5A 4D0DB 3EIFA 5MEQA 1DE4B 5FKPA 1F2QA 1Q1JH 4QRTB 4JKKA 2CRMA 4HS3A 5TF0A 1BIIA 5J12B 4GG8B 5CLWA 4U6HA 3RBGA 1A7BA 3MLRL 2VABB 2VXUL 3HCVA 4JFEA 4O2CA 5F7NC 3RTQA 4NM8L 5HGBA 4X5XA 1IM3A 5FM5M 3WFDH 1NCTA 4OZFB 4OLVL 4BK4A 4BSJA 1A3RL 4X99A 1WEJH 5DMJB 1BECA 3NAAL 1N59B 1X5HA 2JB5L 2AK4E 4LLDB 3KPRD 2B5IC 2OR9H 3E6FA 5E4IA 3U46A 3ZDXF 5IJKC 2MMXA 4DGIH 3V2AR 4WFHE 5F3BB 5DJ6A 1BQLH 3HB3D 1GOHA 2VDRL 3L9RB 3KPSE 3CSGA 5GGTH 1OGAD 4I0PC 1YN7B 3ARWA 2LQRA 3CVIL 5C09E 4ZUSA 4UDTB 3HB3C 5JMOC 4QTHB 1IKNA 4P3DB 3CC5A 4G8GD 4OGAD 1A7OH 4P5TC 3V8OA 4NO0A 2N7BA 4M8VA 4IM8A 4RMQA 4NCC1 3T08A 4WW1B 1AIFA 5DUML 3LCYA 1KIUA 3SJVA 1DN0B 1NPUA 2YRZA 2CR3A 4L4VE 4M02A 4X8JB 5IEKB 5E6IB 2EDRA 3UYRH 4L9DA 1FNEB 4M9OA 3Q5TA 1UWEL 4JPIB 5AUMB 3W39B 1NCAL 2FD6L 4L9LA 2A74B 5FGCE 3UC0L 3AB0C 3CSBA 2ZKHL 3GSXB 3ZYJA 4I2XA 3V6FA 3SKMB 1TQCB 2CIKA 3HE6D 3S36X 4L4VA 1CFNA 4FXLA 3IXTB 5JW5B 4MQXD 1KXVC 2ADGB 4HKBB 2V9RA 1MJ8L 3TPUB 1KEML 4P4RB 3D18B 1OAKL 1QLEH 5JIKA 1JF5A 4H26B 1XIWA 1GGYA 4U7MA 1NKOA 5DD0L 4M3JA 1HSAA 3HI6H 1UB6A 3W5MA 3SKOA 1F90L 4UAOC 4XMLH 2RQ8A 3QIWA 1KEMH 1G9NC 2W38A 2Z31D 3ZE2F 5L2KE 4OKVB 1XIWD 4X6EA 3BKYL 3HLAA 1NGPH 4OZGF 4W4OC 5JLZA 4OZFA 4YFLI 4OI7A 3BXNA 2DQTH 5AZEL 3KPLA 5K59F 2OK0H 3C08L 2GHWB 2PNDA 4N8PA 2H26A 5K9QI 1ADQL 1CLOH 5E4EB 3RQ3A 4BZ2H 3MXVL 1T80A 2NNAA 4NQVA 2MCPH 1XGYH 2PTTB 3EOBB 1SBSL 4HH8A 4QHLB 4ALAH 4G9DB 4I18A 1A7NH 2V7NB 2CIIB 3KPOA 7FABH 4NYLB 5CBEB 1N4XL 5KZCB 1OQXA 3GB7A 5CSBA 2V2WB 3IFOA 2ADIA 3G6AB 5BW7A 2OTWA 5DD5H 5FXCH 5I1CH 4GJTB 1ERNA 4FP8L 5EUOB 1JPTH 1ZTXH 5FOBB 4S1RH 4UTAL 1T1ZA 4CJ0A 4PLKD 4R4NC 4ZFGL 3WIHA 2A9MH 2MKLC 3CFCH 1T20B 1WF5A 5E9DA 1JNLL 2XRAL 3U0TB 4X6DE 4KQ3H 3VE0A 3NIGF 2J88L 2Z31C 3FRUA 2DYPB 4LK4A 5CSGA 5HI5D 3SO3C 1ONQA 2Z91B 1FFPB 3MMEB 3PJSA 4IJ3B 4JB9H 1MI5D 5JW4M 3GJFB 5IOPA 4LNRB 3FO9A 3DMMC 5HHOD 3DIFB 2RR3A 3DPBA 2EE9A 4UU9A 5C0DB 5F7LB 4K2UL 5MHSD 4S0TD 4S1SH 4S11A 1BQHA 2AEPH 3SDAC 1XGTA 3L7FB 5I1IH 1RURH 4UUJA 3SEPA 1AQDA 4X0KA 1FV1A 2X4UA 3BH8B 4Z7VA 1XF2B 4JN1H 1CE6B 4GW1A 3WBDA 1E28A 2EE6A 4ZAKD 4F15C 5EBMA 5EZIH 1PKQB 4F7PB 3V4PH 4OLUH 4RMTA 2FEEI 3FO0H 1J88A 2KDGA 2VLJD 3C2AH 5F9JA 5DMYA 4XVSL 2Y6SD 3G08B 3BKCH 1MCEA 4P57B 1XAUA 2PXYC 5CGYC 3NA4A 3T77A 3D39B 1I7TB 3QYCA 4CVZA 2NY0B 1KXTB 1EMTL 3MCLH 5D2NC 2F5AH 5HHXH 4I3SH 4JFFA 5DF0A 1CQKA 3ZDZF 1A6WL 3DO7A 5IEKA 4Y1AE 4LEOB 1CZ8L 2XXCB 5FA3A 3B83A 4LPUA 3L6FB 1RD6A 4MAYA 2AEIT 3KNBA 2HVKA 4OKDA 1ZLVK 2IEPA 1H3TA 3S3JA 4HIEA 3IJSB 3CUPB 4X0KB 1FZOA 5FDWA 2EIDA 2DQJH 3KDMA 4MD5A 1L0YA 3AREC 4NDMA 3S35X 1MQKH 2FO4B 3PWVB 3W0WB 2A77L 3JV6A 5HHMB 3LS5H 4JO1L 1WT5C 3JXAA 4JFXB 1JGEA 2A6KB 5F7FA 5I15L 3WFBL 1JF1A 4QGYA 4TYUA 5DVOA 4U2YA 2BRRL 4Q6IC 5SWZD 1FYHB 3BPLB 1NC4D 4XRCB 1VESA 1S7QB 1MCWM 4QXGL 4I4WA 2FEDD 3CSYB 4XBGA 3CSPA 3DOSA 4G8FA 4HK3N 5EZLA 4GAJH 5IMKA 1BFOB 3F12A 3K74B 2W59A 3RVVC 5J6HB 3CJJA 2F53B 4ELMB 1FL3A 3RGVC 4JZJC 3QI9C 1JNHA 1U8HB 5JHLH 4KRMB 4HUVA 4HIJA 1RULL 3TJEL 4EOWL 5CEZL 3OR6B 5AYUL 4YUEH 3U48A 2I9TB 3UTOA 4Z77A 4C57C 3VXSD 1CE1H 1IAOB 5FO9B 1OWWA 1TJIH 3GEWB 4Y2DA 4IDJL 5FDYA 2Y9RT 1FV1B 2Q76A 4LARH 4ZODA 4FQHB 2KPNA 4KKBC 4TSAH 2Q20A 5D9SA 5DVMA 1JGUL 1QFWL 3D9AL 1XF4B 3V6OE 5E99L 2H2PD 1H5BC 1EPFA 5JR1L 1RZ7H 2ZCHH 1I9EA 3N9GH 4KK9C 3BKJL 2DQIH 1A3LL 5DD1H 4HUMB 3DMMA 4RMUA 1KTRL 1RUPL 1MFCH 1CXLA 1OPGH 1KOAA 4JO2L 3SDAD 5F9JB 4D0CA 4ORGA 1F11A 3QG7L 5GGRA 2C4FT 3AM8C 4V1DE 3GSNB 4KC3B 2YPKA 5JQHC 3DNKA 4BFIB 1LO2H 2GT9A 4LSUL 3B3IB 4ZDHA 3V6OA 1UFUA 4I3GA 3QUXC 3EDJA 5CEYA 4U1JB 4KROC 1RZKC 1JNNL 5CEXB 3WYRA 4MAYD 4HUKB 3WIIH 5B8CB 4XPAL 1XGUA 2AJUL 2YMXL 4NM4H 2AKRA 2J8UA 3ILQC 5KANG 3HHRB 3V9FA 1KNOB 3BZ4A 2V9TA 2RGSA 1U8OB 2BVPB 1ZK9A 1LVEA 4R90H 4DZBB 5BV7L 1INQB 2C1OA 4WEBL 5T1MA 1R5WA 1OL0A 2J8UF 3MSPA 2NZ9C 5I71C 1MCJA 2VKWA 3KS0H 4HX1B 4F7MB 1TVHA 1E4XL 4WU7A 3TC9A 1U3YA 1EFQA 3B5TA 2PUQT 2YC1A 2D0FA 1I3RB 1SYVA 4TQEH 3ME0A 5FECB 2BVQB 3NIGE 2X9YA 1XH3A 4M00A 2Y72A 3RTQC 1HKLL 1G6RA 1MHCB 2Q86A 2ED9A 3VDCA 4AEHH 2CQVA 1LO3H 5E6IA 5ICZA 5J3HD 3HKFA 4HMEA 3IDJB 4L8SC 4K3DL 4LIQE 1F3DJ 3Q6FB 4PFEA 4KHXL 5F1NB 5SWSA 3B5GA 1T21A 1S7XA 3IDNB 3FQXB 1FSKC 2DQUL 1CCZA 5CJQH 2YEZB 4ERSL 4NT6A 1UZ8B 1FQ9C 5JXAH 4PJ9C 4R26H 2GAZB 2AV1B 1HILB 1KFAH 1KNOA 2JLLA 5HD8D 5DUBA 2VC2L 4GXVL 1QG3A 2ORBL 3QUMB 1N0XH 3UP1A 4WHTA 3O3BB 5F7EL 4I18B 3MUY1 1EGJL 1AKJD 4MCZA 1KTLA 4J3VA 1ZOXA 2XN9A 5JORA 2DTML 3T09A 3P4LA 1N0XL 4LDOB 4GXVH 1Q9LA 1TPXB 5D7LE 4MA3A 2X1QA 3GKWH 3MLVL 5DVKA 4CL7A 3GRWL 5T3XL 4L4VB 5IB2A 4YDVA 2DM3A 4JANB 4KRPC 3KVQA 2A0LC 3RDTB 5EU3A 1HILA 3VFWB 2XQYG 3MLUL 2H1PL 5I1DB 1P4LB 4FFVC 4U1LA 4DK3A 2CUHA 4XB7A 1QR1B 4OCYL 1FNHA 3RWHB 3DBXB 1BIHA 1T21B 5IGXH 2IQ9L 4KMTL 1G7PA 3HMXL 1FN4A 3QDGD 4WWID 4FQ2L 4ZYKB 4LHUA 4AL8H 1UYWL 1DQTA 2BSRA 3WO3B 4U1SA 3FJTA 3AC0A 1CU4H 4GUPA 4YZFF 1YEEL 2O93L 1IAKA 3NN8B 2AJSL 5ADOH 3WCYA 4P4KB 4CVUA 3SCMA 5I1GL 4JQVA 5CMAB 3B8YA 3SDXE 4MYWB 3TH3T 2AJ3B 4LSUH 1MFAL 1KB9K 1J1OH 2FH8A 4RGMC 4WEBH 4MA7H 4WTWA 4D3CL 3UBXI 2D7PA 4PY7B 4HD9A 3NH7H 4HWZB 2B1HL 5IWLC 1PAMA 2P48B 4S2SA 1DBML 2ZSWB 3CZFA 3DX6B 4QRPB 1CICB 4G8IB 4PJHA 3EYVA 3QFDA 4I3RH 2EIBA 1T2JA 1RZ7L 1DEDA 4IHOA 2VAAA 1BAFH 4JFOB 3IFLH 1A6TA 4DAGH 1BEYH 3HC4L 3LEYL 3DSFH 3RDTD 3LN5B 3NPSB 5B39G 2R2EB 2WIIB 1R3KB 1RZGB 1ZHKB 3TT1L 3DTXA 5DFTA 3RPKA 5DJZB 4QRRA 5B39A 3UJIL 3O8XB 1BBJB 4OLXL 1HZHL 4DVBB 1RZKH 4BFIA 3GSNL 5FB8A 2VXVL 1NLDH 2IFFH 3SOBH 3IVKB 5CAYB 1KPVA 2HFGH 4IOFD 4XGZA 2VDNL 1MEXL 4PP2B 3IDXH 4QRSA 3L7EA 3U46B 3LN4B 4PR5B 5C7XH 3S7GA 4HZLB 1OT2A 3S34H 2NY7H 2CLVB 2HFGL 1IT9H 4UIMA 1YEDA 3WNLA 2KBGA 2V2XA 4FZEL 3WNPA 1JWUA 1U8KB 1DEEB 4ONHA 1U93B 5HYSG 1HXYA 2ICWB 2BY0A 3K2UL 3RBSA 4YHPB 1E4JA 1NAMH 2P8LB 3ALXA 3DYMA 1NGYA 2QEJA 3MJGX 1I4FA 1A7RH 1BD2B 4N0CD 3FKUS 5EBWA 2V5TA 4NC0B 4GAJL 1CE6A 4IOIA 3T4AA 2M26A 2X09A 2PW2B 4N68A 3ULVC 4QT5A 3FT4A 3JV4A 5MEOB 2W9DH 3KWWB 3EYFB 1Y0LA 3O41B 5I6XC 2IALB 4LLWB 4XGZB 3KYMA 5DLML 1PG7X 3MLYH 5DEZA 1KT2B 4WTZG 4KJYB 4PGCB 3UJTL 4NQEE 1CFNB 3MRPA 5DHYB 1YPZE 3VMNA 4E5XA 4OQTA 3ULVF 3OBAA 1QBMH 4Z0XB 2H8PA 3RU8H 5FYLL 3QUYA 4DFIA 5HGAB 4ZUTA 4OSUH 5EFIA 5DA4A 4JPKL 4KAQL 4HWBL 4P5TB 5CJXC 5D5MB 4JO3L 3ULVL 4IS6A 3SDAB 3JBG7 2O5ZH 5GGRB 1JPGA 3PXJA 2QLVB 3ZDXE 3MLUH 2X4SB 2E7HA 2DWEB 4RWYL 4P2QE 4YHYB 4EUPH 5K33A 3O4LE 5HYEA 3MFFA 3C2AL 2ATKA 2HLAB 3T3ME 4LRIA 4NBZB 4A2MA 1D5ZB 1V7NL 1FZKA 4Y5YA 2FB4L 3C8KA 3VXMD 3I9GL 5LVEA 1M05A 2A9NL 4G43B 4PJDA 5T3XE 2LE9A 3U1SH 1NGQL 1T66C 5JXED 3V7AG 2DQGH 3ZZ1A 1AGBA 1ACZA 1OD9A 2R9HD 1CD0A 3KGRA 4YHKL 5K59E 4LRNH 3IKCA 5JW3H 4U1SB 4GW5A 5I2IB 3OMZA 4M8QB 3Q48A 5F9WB 4U1NB 1S7SB 3VH8G 5JOFA 3JTTB 4BFEA 1ZV5A 2X89A 4KKNA 4X9IA 2EH7L 2OXHA 4CVWA 5GRUH 3AU1A 4ZTOH 2EDEA 3FT2B 5JXAL 3I3DA 1MFNA 1A4KB 4Z76B 2OL3H 3CDGA 4DCQA 2FIRT 1H15A 1NUGA 5C08B 3QNYA 6FABH 5HBBA 1L6XA 1HSAB 1MCWW 1Z9MA 4KXZI 3B6SB 3EJYC 3ZKMC 3QPXH 1AH1A 1RUAL 5HYJB 5I2IA 1QD0A 4DAGL 5DJXB 3BMVA 3FT3A 4L9LC 3NOIA 4QHKJ 1WC7B 2DIBA 3ZHLA 1H8NA 1IGTA 1CFQB 1JF1B 1OTSC 1VDGA 4PB9H 1F13A 2PO6C 1CGUA 3NCJH 2HN7A 3BDBA 4F57H 3A0OA 3F7VA 4NC1C 5F93C 4HPOL 3TIEA 1X3DA 1WTLA 3ULVD 1EEYA 1EERB 4ZTPH 3BP5A 4JFEE 1WWBX 3ZE1F 2ESVE 4U1GB 2D31A 3LN9A 4AY0A 5H37H 4W4OA 4RGNC 2HJLA 2JTDA 4I77H 3UO1H 4GW1B 3BKMH 3VXRD 5HGHB 2ICWI 2CD0A 1IAIH 4PRPB 1BP3B 4PJ9D 5DA0B 1DBAL 4KK6D 4GAYA 3QHTC 2FHBA 4DN3L 1IEBA 4DKDC 1MCPL 5GS1B 1MCDA 1QFUL 2YC1B 4O51A 3MUGA 3QAZC 2BSTB 1KT2A 1MFCL 1PEWA 1IRAY 4XNYL 4HLJA 5HXMA 3STLB 2DMKA 1INQA 4MJ6B 5ID0B 5E99H 1QO3B 5GSVA 2BNQA 1F6FB 1MHPH 4K3EL 3RWGA 4ETQB 4OM0L 5DRXB 2QTEA 3EOTH 3JV4B 4KQ4H 2J3SA 1FNGA 3QEUA 5GGVY 5LAXB 5E6ZA 4LSVL 3RWFB 1W0VB 4ONFH 3D69B 4XP6L 3ZLQC 2DF3A 2YD3A 4AJ0A 2VC2H 5SV3A 3JVGC 4MJIE 4P23C 1Z0NA 2BNQD 5JHLL 1JYWA 1KUMA 4QXUL 4MNHA 3FONA 1UWEH 4OZHF 4Y1AD 2FBJH 4ISVA 5CJQL 2AJZA 2ICES 1BVZA 4WI2A 5DJ2B 2X40A 4XCEA 1KB5A 1U8PB 3DUSA 4HZLA 1IGCH 3FQNB 4U49A 2R1YA 4WJ5B 5HHME 2OM5A 1QFHA 2ZCLL 4WY7L 3RWIA 1QLFB 2X42A 3BP4B 1FGVH 2PETA 2OR9L 5E94B 1IGCL 2VWEE 5HI3C 1KF9B 5CD3B 5GGSB 4HC1L 1I3GH 5TPWH 3P9MA 3NAAH 4NKOB 4JKPH 1AJ7L 3FRPG 4Y8AA 2DBLL 4Y5VB 3KPPA 2QSQA 2W0FB 2IG2H 3EBAA 5IJVA 1ZLWK 1F58L 3VXTB 3HAEA 2Z8VC 2PO6A 4NZTL 5IB4A 1N6QH 2NYYC 4NQDD 4PJEF 3OKOB 2HFTA 3C6SB 4NM4L 2XZCL 4ZUWB 4OQ1A 1FH5L 3GSQA 3MCLL 1XGYL 1CTNA 4MSWB 3VI4F 2CLRB 1MHPL 2NX5B 3C6LB 2P5WA 2PR4H 3BGAA 4J1UA 5KSBE 4KTEH 3G5VA 5FO7A 2OYPA 1V7NH 4U7KA 2CJUL 3VG9C 4KKLD 4YK4C 1GL4B 3BKCL 5I9QC 4NM8H 4Y5VA 1RJZA 4FXGA 5IVZA 4ODVH 4OGYH 4NWUL 1Z9OA 4GSDH 1QLRA 3QG7H 4R3SA 2PCPA 5GS2H 5T3ZH 2YWYA 4NQCD 4KUZL 4FABL 4LHJB 4R97C 3UJJL 1OAYH 4I9WE 5HPOA 4ZXBD 2DI7A 1MAKA 2J8HA 2XIDA 4J23A 2EYRB 4LARL 4ELKA 4PTUA 5E1AA 4NQEA 4NKIL 4OCXL 3VD5A 3RWHA 1I7UA 3GO1L 2GJ6B 3SDDD 2VZSA 1I7TA 3LPWA 3G5XB 2MQCA 1FZJB 3MGTA 4Q6IA 1FLRL 2VDML 3ZTJG 3U2SB 1NGXA 4O58L 1K5NA 2WP3O 1JRHI 1NC2A 2IH3B 3DX9A 3IGAB 5BS0A 5FO7B 3B2UC 4RAUA 1D7FA 3VXSA 32C2A 3G5YA 1BM3H 4ZSOE 1NCAH 1FC2D 1YA5A 3O4LB 5CBAA 4Z95H 3HNSL 2Q87A 3UAJC 2AJYL 2AGJH 3CLEL 4JZJA 2DD8H 5AG9A 1ZGLM 4PP1D 1Z3GH 4TUKL 5HHVH 4L5FL 3VXTA 2ZUUA 1OT1A 3ZTJH 4F80A 2BNRA 4CGTA 4OLYL 1CT8A 3RPIB 2RCSH 3C5SA 2R0WL 1T04B 4P5KA 4E5XB 4NP4L 3DJ9A 4O2FB 5BO1L 4NSKB 1EFXB 3E3QC 4K8RL 3PGCB 2OMNA 2ICWJ 4ZPTB 4G6JL 5CUSL 3TO4D 5A3ID 3FQXA 5B3JE 3FQRB 2HFEA 2W60B 4EI6A 5E08H 2OQJB 3NZHL 1MCSA 3R8QA 1LEGA 3WE6B 3F7QA 2Q7NA 3P9LA 1G6RB 1T5XB 4OF3A 3QJHA 5IVXB 4XPGH 4H20L 4IJ3C 4PJBE 3DLQR 3RX7A 1WVZA 4MAUH 4N1HB 2D7QA 3TNMA 4L4TE 1OCWH 2P8LA 5EN2B 1CFBA 5FO8B 1T1ZB 5FUZL 4P9ML 4O00A 3I9GH 4OFYD 5DXWA 5F8RC 4U1KA 3BP4A 3L3IA 5IESL 1EDQA 4FMKA 4NKIH 2BDNH 2GEEA 4JG1H 5DYOA 4G9FA 4K8RC 5H2BA 2B0SH 5EO1A 3T1WA 4YLQT 2BP3A 1T7WA 1U8OA 1BJ1J 3A6BL 3MLRH 4XNMB 4I3RL 5E9DD 1RQ5A 3LS4H 1FC1A 4MS8D 3H7BA 1NBZB 3QFJD 4JFDE 3KG5A 3SQOL 3VXPB 3D25B 4F37K 5I16B 3QI9D 4ZNEA 3V52L 4HXAL 4JPKH 2H32H 3PDOA 5IFHL 5ISZB 5FGBC 3FQRA 4H88L 5GISH 4EI6B 3CZJA 4L29B 4Z6AT 5F1KC 3UC0H 3EW3B 2NY5C 3QXVA 3EO0A 1SYSB 4DVRL 3TBTA 4PRBA 4G8EA 5HYFA 5JIIA 1ZT7A 2I24N 2VITA 4LSSH 3SE3C 5IV2A 2LABA 2Q3ZA 3UPAA 2J7LA 4L4TB 3OHXB 5EG6C 1PQZA 3SPVA 1X4ZA 3H9YA 4WY7H 4M6MH 4UILH 1JN6B 3ARFD 4YGAB 4YHOL 4O9HL 3K8LA 4POYA 3OZ9H 1NL0H 4WI7A 5HHPA 2IH1A 4MNGE 5I17B 3EZJB 2W92A 1YNKH 5A2IH 1K4DA 5IMOB 1TPXC 1IM9D 3UTTE 3ZT7A 2BCKA 4R3SB 4FQIL 1MI5E 5FV1L 1S9YA 1U8JA 3ULSB 3OZ9L 1YY8B 3WFEH 2O26U 5HGHA 2DWEA 2GK2A 4Q2ZB 1OP5K 5IB3A 4XP6H 4AT6B 2ZPKL 5C09D 5F88A 2P5ED 2ZUXA 4IRSC 4G8FB 5B38B 4LSVH 2C1PB 5T1LB 4L3EA 2WAHA 4I13B 4HH9B 3MBED 4XMKH 3S4SB 3Q3GB 2FBJL 1EEYB 1WEJL 5EIIB 3ARGA 5L2KB 4JFXA 4O2FA 2P8PB 3BH9B 1NLDL 3TZVB 4UINH 3VXOA 2XG5A 5D2NE 3MGAA 1RZKL 4OLXH 2BVOB 5A1AA 2FX7L 3O2DH 4ZUSB 3OL2A 5E0QA 4HJJH 5HVFB 2D9QB 3LH2L 4KQ4L 4TULL 4HIXH 5HY9A 1R3JA 3VFRA 3IFLL 5DHVB 2WWMC 3KWWA 1T03L 3KPMA 4TQEL 3ULUE 1QSED 1BZ7A 4XXDA 5MERB 5D2NA 4I77L 1YZZA 1MFEL 2VZOA 1I8MA 3CU1A 2EKSA 2DN7A 2NX5D 3C6LD 2GTZA 4K3JL 3OPZH 2VZ3A 1HN1A 4JFHE 5FYJU 1R3HA 3TZVD 4NC1E 3CPLB 1MCPH 1I4FB 4JO4L 4XHJC 3MLSH 3FFCD 4AYFA 3MRIB 1JZ8A 4R90L 1TCMA 1DDHA 2OJZL 1S7TB 5B22A 3Q6FA 1M6OA 2VN4A 2H6PA 3MXWL 4JRWA 4QO1A 4XC3H 2BSSB 3Q6GL 5GRZA 5B8CC 2VL5B 1DBJH 2XY1A 4KHTL 5DD3H 5T1DL 3TV3L 4IRJC 4KI5F 4R96A 4GG8A 1KYOJ 2R2CA 1C5BL 1JMXA 4ZUTB 3T4YA 3TT3H 1BVKA 3TVMD 1Y18A 1QBBA 2H2SD 3HRPA 3CK0H 3CXHJ 3KHOA 1JK8A 3ZSTA 4KK5D 4NIKB 1M7IB 5I66B 1CXKA 3VXRE 3LIZL 1H5BB 4QRPE 3T65B 4FQIH 4B0MM 2MPAH 4M4RA 5FB8B 4DZBA 5I74B 2HT2D 5DVLA 3BDXA 2R69H 1YUHB 5SWQA 1QHOA 3QCTH 4HIHB 3MLVH 3GKWL 3MMEA 1CF8L 5IVNA 1TJIL 3KJ6H 1BQLL 4P0DA 4KKCC 2WINA 2BNUA 2YKLH 5MEND 1H3XA 3TJEH 1UKQA 2BFVL 1H5BA 4OZIF 4LSQL 5ADPL 4M1CD 4HV8A 5E8DL 1V05A 5GS0L 5L7XH 2W9EL 1UVQA 4LPCA 3UYPA 2KL6A 5LCVH 5IQ7L 3BD4A 4LKCB 1JZ7A 3BPLC 3F7PC 3NACL 1FFRA 2FJHB 3ARVA 2X41A 5CMAA 1RZJL 5FM5O 3BO8B 2NW3A 1UH3A 1LK2B 4YHKH 4NNXA 3U4EB 3PE9A 1YEIL 3OAUH 4NUJA 5CIPB 4YBQC 1NMAH 1KYOK 2EDLA 5IB5A 5DJXA 3J8F7 5CJOH 2QADC 4FFYH 1ACYL 3DBXA 4WU5A 3LS5L 4JO1H 2VLKE 1XF3B 1KPRB 3EGSA 5HHMD 5AEAA 3QXAB 4ZPTA 1ETZA 3GMMB 3QCVH 2CO7B 3I3BA 4PJ9B 4UZGA 1GXEA 1P4LA 3QUKA 4TUOA 1I1YA 2R4RH 4YZFE 5INCB 3HE7D 5D7KE 4JANA 4NFBA 4DN4H 4Y4FB 1IE5A 2ZSVB 4H5SA 3PP4L 1R3JB 3VFRB 1UB6B 5DHVA 2CUMA 5CEZE 4U31A 3HE7B 4PGDB 2EIEA 1UWXK 1MNUH 4ZOBA 3JUZA 2O5YH 2IANA 4LIQH 5SWZA 3ECBB 1X7QA 5C08A 2UWEB 1RHHA 3NCBB 3G5YB 1FZMA 3EJZC 4TNVK 3MQIA 2XPGA 3HMWL 1ND0B 5CJOL 1FZKB 5D8JL 3VW3L 5ENWA 3RZCD 1CD1A 1YEGL 9CGTA 5JUEH 1IAIM 3V4PL 1KULA 4F8QA 1H0DB 1KBGH 5GGVL 4FZEH 4JN1L 1MJ7L 2RCSL 2BSRB 3HZVB 5D71L 4YXHL 2ZCHL 3LKNA 5KN5B 2EYRA 4CN4A 1AC6A 1GIGL 1BZ9A 2AV7A 1CN4A 3K1KC 4LNVA 4LLVB 1TJGH 1FO0H 1Z5LB 1CXEA 3BHBB 3O11A 2OX5A 3BP5B 3N1MC 2A6IB 4AIZA 1CGXA 4WW1A 2VE6A 3U7YL 3KLHC 2WWKO 2BVQA 3QUXB 4M4PA 3MRKB 2MWCA 4JFFD 2VDLH 1UJTA 5AYUH 3REVA 3FB7A 1F4HA 3HE7C 1BQHG 2IGFL 4R7NB 5EWIL 4JB9L 3L5JA 1VADA 5GRVL 1CIDA 1GH7A 4G3YH 5EUOE 1T2XA 3MA9L 4HAGA 2L7UA 2VXQL 4M9PA 4EEEA 2XNAB 1N26A 4PJCA 5T3ZE 2GY7B 4WHYG 1JNLH 4WI9A 4NQCE 4Z7UE 3T0VA 5EC1A 4ZAKA 2DKUA 3V4VL 5LGKA 3SE8H 1MJ7H 3OJDA 1KBGL 1BFVL 4Z76A 1NSNH 1YEGH 1TTUA 2QKIB 1FO0B 5ECJE 1MJJA 5T33H 1IMHC 1T7ZA 3FQTA 1OAUL 1GZQB 1JMZA 2D7OA 2CKBA 1NBVL 3N50A 5K9OB 2VLLA 3F58L 3H9SE 4F7TA 1R5IA 4OUUA 2IALA 1QEWB 4OFIA 1FYTB 4JRXD 3MRNA 1C08B 2FEEL 3D87B 3UO1L 1Q0XH 5KSAC 1P5VA 4ALAL 4ZUVB 1LK2A 2BHUA 2R0KH 4UQ3B 4EN3B 5JQ6L 3MYJA 5I6XB 1ZSDA 1U41A 2FL5B 3OG4B 4PRIA 2Y5TA 3PWPA 5FKPB 5JDJA 5I1JL 5AAMA 3CFEB 5DMGD 4Y2DB 4X4XB 5DJCB 1KTKE 2VNCA 1TZIA 1O0VA 3BEVA 1G9NL 3SE8L 1G7JA 3LZFH 4PB9L 2K7PA 2OR8A 2NZ9D 3MRDB 3LEXA 3OKLA 1EUTA 3BD3A 4ZFOL 4LQFL 5IVXA 1NCNA 2ZCLH 2O5XH 4P23A 1BZQK 1FHGA 3MRNB 2GTWB 2C4XA 5GJTH 2XFXB 3TLRA 2VLLB 4GQPH 3AY4C 3PDGA 1OTTC 1F2XK 4HKJB 4NZRH 3RIFK 5KTEH 2B39A 2H1PH 1C12B 3B9KB 4OIIL 4O5LH 4JQIL 2KKQA 3MUZ1 3KLSA 5TF1H 5LCVL 3SY0A 1KFAL 4Y1AB 5J11B 1L7TL 4ZG1A 3BPCB 4X6CB 4G80A 1ZHBA 5LBSH 5GRUL 1PYWB 3G6JE 3MRCA 5CSZB 5C0FA 1CK0H 5J57B 4WUKH 5HGGS 4GRMB 5F96L 4OIIH 3ISWA 3QDMA 5ESVB 2DTMH 1QFOA 3F62A 5DT1L 4L8CA 1DQMH 2J6EH 4CMHC 4CU8A 1KJMB 3LEXB 3QPQC 4OGXH 4P4RA 4HWBA 1NANH 3D48R 2J88H 5FGCB 1KSRA 1MRCH 1AY1H 4R4FH 2X7LB 1BD2A 4AMKL 4PJAE 5IT2H 1B6UA 4K7FB 2WBWB 5LKNA 4XVUD 4LCCB 5IEHB 1A5FH 4FFZH 5I76A 1VFAB 3REVB 1CICC 1G7LB 3EOYG 3PP3K 4MNQD 4R8WL 4CNIB 1J5OH 3W39A 1SEQL 2XN9E 5I1DA 2XWBA 3MGOB 4XC1H 4H8WL 4AIZB 4YWGH 3L3GB 3RHWK 3HPLB 2ZUVA 5T3ZD 2B5IB 1AHWB 3BVNA 1NH6A 3C09C 5E1AB 5BV7H 3ZTNL 5DGRA 3U79A 4P99A 4LF3A 1DQDH 1IGTB 1T2QL 3M8OL 5ACZA 5J56B 4QXTB 4L8DB 3IRZA 2Z9TA 3BUTA 4BA8A 4L8CB 1EHAA 5J0BA 1N7MH 1N3NB 3MOBH 3PWLB 2GITA 4P4KD 1KXQE 2P5EE 5C2UB 4K71B 3V5HA 1ZGLP 1GGTA 2ZUQB 5IQ9A 1A6ZB 4P3WA 4J6RL 3MCKA 5E2VL 3TBSA 5CJXA 3VFVB 5L8KB 4XNQA 2VAJA 2NY6B 4K3JH 3SY0B 4PJ7E 4UOJA 1U92A 3SDYH 1A3LH 3RZWA 3EYVB 3QFDB 4FZ8L 2X4NB 4G6FD 4GXUM 3K8KA 5BZWB 2LTQC 3RUGF 1EXUB 5C70A 5EU4B 4IDJH 1F42A 4ZFOB 1OAUH 1VCAA 2EZ0C 3WFZA 4PRHA 3MR9B 4WWKD 5FOJA 4FS0A 3K46A 3OKEA 4X6CF 5T1KD 2EDNA 1OGTA 3EYUL 1IEAA 1YNTA 2WBJD 1TETH 2P4AB 1DANT 2NY6C 3RUGE 4CN6A 4YDLC 5D6DC 5BOPA 1OLLA 1J11A 5GGSA 4NN6C 3PXHA 1M7XA 1AO7B 2C3XA 5CD5C 2R0ZH 3TYFB 2NW3B 3BO8A 5BVJA 1TENA 4NZJA 1B0GA 3HRZB 4UDUA 2DICA 4H1LA 3IJYB 4FQXA 2IGFH 4OF6A 5JUEL 3MV8D 3ULUD 4ISVB 1VACA 1KIRB 3FONB 5DJ0B 1RFDH 1AGCB 3O6FA 4LLUA 5FM8A 3UTSD 1ZGLB 4FQPA 2BNUB 4KZEL 2PYEA 1QSFD 5TGBB 2NQCA 3GMPB 3SGKC 1JYNA 1HINL 4HQQH 2ESVD 3L3JB 4HMDA 5IWLA 3UTSA 4CADB 1NCDH 1DBJL 1QR4A 3MV7E 2YD8A 3B9AA 1BM3L 5EC2B 4AEEA 2ARJB 2AXJA 1JL8A 4U1MB 4CU6A 1LILA 1PG7H 1F8TH 3QO0A 4FQQB 1M7DB 1QBML 4K07A 4P2CG 1CS6A 3OPZL 4O51B 3A67H 2YK1H 2DB8A 1QVOB 4ONHB 3HPJB 4A6YA 4XCCH 1FFNB 5GISL 1NLBL 3LKRA 1T0MA 5IM7B 5EOTA 4HBCH 1XF4A 5FECA 4TULH 4W6YB 5LWYH 3QJFA 4DN4L 3I6KA 4Y4FC 1L0QA 4LKCA 5E24E 1CDYA 5C6PB 4G7YL 4Z7WA 4NOBA 1OF2B 4KI5C 2EICA 3D0VA 1CBVH 1LO5B 4JFQB 2IPKA 1R3HB 1CD1B 4UAOB 1OGTB 2EKSB 2ZWLT 3LQAC 3NVQA 5MENE 4V1DB 1T7YA 5E6YA 4UT9L 1PSKH 3N1FC 4JZNA 1U58B 3N1PC 2FO4A 3PWVA 4XPTH 1RHHB 3L95A 4M7JH 1DQML 5F97E 3L5WA 3DUHA 4Y4HA 5BS0E 2DRUA 4H1LH 5E56A 1OTUC 4Z0BH 3GMPA 3PHOA 5EO0A 4LLMB 3CX5K 5KSUB 5IMLA 5CZXD 1ZVSA 2W0PA 3QIBD 4EQ3A 3IU3A 3IXTA 3KPQB 3QDMD 1BMGA 5E08L 2E6QA 3FZUC 4MMXC 4LLAA 3AAZB 1L7TH 3DX9B 3PL6D 3PWJA 2V5SA 3GSNH 1KCRH 1V5JA 3O3DB 5HDBF 4NDMB 1WWCA 3P4MB 1KG0B 3PGFL 2X44D 4P4KA 4GQ9H 3HZYA 4KKAC 4R2GC 4R96B 1GPOL 1VGEH 2ARJQ 4TTDC 2DL9A 2I07A 4HHAA 1EIBA 1C5BH 4FQCH 2XA3A 1BQSA 2QQQA 4LVNB 3EYQD 3HFMH 2F74B 1MSPA 4QXUH 2XZQL 1LE5A 4N8VB 4NUGH 3U9UA 2XWBB 3MGOA 2D3VA 3B8SA 3O3DA 1INEL 3SGKA 4P57A 5HYIA 1IFHH 3THML 4C4KT 1OB1A 4S1DC 4BFGA 5I1AB 1TZHA 12E8L 1QACA 3KPMB 1TTFA 1MFBL 4PV9A 3QIWC 4RGMB 1UCBH 1DN0A 3EZ8A 1RUML 5JHDD 2YMXH 4XP5L 3MV7D 1LNUB 3TYGL 2NY0D 4HLZH 1G7HB 2F54B 4OLEA 1KELL 2X4UB 3BH8A 1UYWH 4X5WB 4Z7VB 1KC5L 1ADQH 4BELD 2YD5A 3L5WB 5GXBB 1EVTC 2A6KA 4XNYH 1QLEL 3L3KA 1M71A 3QHZL 1JZ5A 3S97C 5E9DB 4JRYD 2HFFA 3C5JA 1FFOB 3D2UA 5DYOB 2QV2A 1WAAF 4Y1AA 2IANE 4ZQKA 4DKEH 3QHZH 2ZKHH 2VQ1A 1INDL 1YNLH 4YBLC 3N9GL 1CDHA 3LPGA 3X14B 4XHQA 2DLFH 5ACZB 1TZIB 4Z7VF 3P3YA 4FG6D 1N59A 3BGFC 1FRGH 1SHMA 3T4AB 1T22A 2VXQH 4HG4J 3N1QC 12E8H 2AJVH 4EDXA 3ESVF 4NHUA 1G7MA 5DURB 3OKLB 2UV3A 4M7ZC 1U42A 2KQNA 4F7EA 1JUFB 4U1KB 5C6WH 2DBLH 1M6OB 5K9OA 1KJ2L 5F1OB 1U93A 4BH8A 5JPNB 3HFML 2R0WH 1G7IB 4UIMB 2P8MA 2V2XB 1QKZH 5CGMA 2P44B 2UZIH 1A4JB 1MHEB 1SJEB 4UTBL 2FSEA 3VGAB 5IKCA 3ARBD 4UBDD 4JQXC 1JV5A 1KCLA 3WFEL 4HCRH 2JJWA 4H26A 4YDIH 1ED3B 3B5HA 3FMGH 1XF5B 2QSVA 2D03H 3GK8H 4F3FB 4KRNA 3ULUF 4KJPC 4DJMA 3BZEA 1NL0L 1YJDH 3VI3F 4EJ1C 1CFVL 1MPAH 1RMFL 3SJVE 1DTUA 3NCEB 4M61A 3FB7B 4GBXD 4O9HH 3RPIA 5HVHB 3JWDH 5KG9B 5D2LE 4Z0BL 3ZYOA 1I7UB 1DUZB 4PY8J 4JDTH 5CHNA 4L8BB 4GG6E 3OAZK 5I1LA 1MFDH 1CICA 1KCVL 4G8IA 5JPMA 4D0BA 2XTJC 4LSSL 2BERA 2DIAA 3BWAA 3WIIL 3HC3L 4JFDD 4RAUB 1G0YR 4MQ7A 3PGDB 4GSDL 4OGYL 4ODVL 4Y4KA 3WN5C 4D94A 2VZUA 1J12A 4JJ5B 2BDNL 3D0LA 4JG1L 5C07A 4M62L 4CVXA 1FVDB 3WXVH 1NGWA 4WFGD 1DQJB 4LCWB 1NMAL 3JVGA 3MBXL 3U4AA 2F53A 4LPTA 4ELMA 1Q38A 5M7QA 1LEIA 1A0QH 1W2KT 2I07B 2B1AH 4HHAB 5EOCH 3T2OA 1JGDB 2IBZY 1RURL 2FNBA 3SE3A 3F7YB 4ZPVB 5HYJA 4XPGL 4ODTH 3OKKA 2AEWA 4LCCC 4YBHA 3AVEA 4PJ5A 4XBEL 4RMSA 5IHLB 4XAWH 2EZ0D 3UJTH 2X5PA 2OJEB 5EIQA 1IGYB 5IJKA 2IAND 3MBEB 4NPYB 4U6XB 4G6JH 5CUSH 1FG2B 1T1WB 2NXYC 2BNRE 5KOMC 4JG0H 4TVSa 3F5WB 2B7DT 4HPOH 3DV4A 2NY1B 4WFED 3JTTA 2CK2A 1QSFA 3BN9D 1HWGB 4FMFA 3V0WH 4LLMA 3HE7A 5F6IB 4Q9BA 1YMMA 3O4LA 5CBAB 1OSZA 2A6DB 4W6XB 4XI5C 1MIEL 3QRGL 4ZFGH 2W91A 5JOPD 2JE8A 1VADB 3T1FB 5CWSB 1DE4A 4PLJC 3FQNA 1KJ2H 3GMLB 4IMKC 2GJJA 2A74A 1I9IH 3UX9B 2XKUA 1UZ8A 2WQRA 1DSFH 2GUOB 1ZHNB 1NGZA 3AS3A 2FO1A 1K8IB 2E6PA 1RJYB 1O5DT 4J3XA 4GKZA 3C60B 3TN0D 2OP4H 1S5IH 7FABL 1MCOH 4P46A 3WJJC 2VERN 1CTOA 2NTSP 5GZND 4XB8A 4GBXA 1E27A 1ADQA 1GYAA 3VFSA 4HEME 1B9ZA 3FTGB 1U8JB 1PG7W 3MTRA 3ULSA 3BIKB 2ZG1A 1I3RA 3QWQB 1JHLL 2FIKB 2EECA 4IRSB 2AS5M 2WUBL 1IC5H 4JJ5A 3WUWG 4XT1C 5T1KB 4ODUB 4WWKB 1W72L 3QFJB 3WXVL 4HGMA 2E9BA 5HDBE 2DOCA 1KTDA 3O45B 4WI5A 3SGJA 2EDBA 5KSAB 4LHUG 3LD8B 4OZHB 4Z7VE 5CKAA 2PXYB 3D3VE 3ZKXB 1DUZA 1QNZH 5KSAD 4OLUL 5EZJB 4M7LL 1J1XH 2K1MA 3NFSH 1A7PH 1MRDH 4XPBL 5ERWA 5I0DA 5FUCE 1RJLA 5GJSL 1RPQA 4ONGH 3TBVA 4OT1H 4WGWB 4L29A 4PRAB 5CKGA 1JI1A 2MHAB 3P73A 5KW9H 4NQUA 3MLYL 1AJ7H 1EZVY 4OD1L 2C3HA 3TM6A 2CLVA 4GLRI 4WV1A 3B9EA 3WS3A 1T2QH 3M8OH 4E41A 2A38A 1L0XA 3ZTNH 1CFTA 3T2NH 3MRRA 1KACB 2V7NA 3KPOB 4QRQA 4CRPA 5GRJH 4Y19E 1UKTA 4MNGB 5C0JA 1RZFH 2CK0L 1T83A 2IMNA 2VL5A 4DOHE 3BP7A 2R2BA 4G42B 4JKPL 5DMGC 3NPSC 1BBJA 3KLHD 4X7SH 3F7VB 4M7LT 4P9HC 4D8PB 4NO5A 3W9EA 4HUVB 1IGIH 4KROD 4MJ2A 3OJ2C 4LKXB 1U8NA 1OD7A 4MDJB 4MX7A 3DRTB 3OR7B 5DK0B 3O6KL 1U3HB 3VG0H 1IGMH 5KJRL 1OGAE 1DCLA 1BVLA 2HWZL 5E2TL 2X05A 5IFJB 1R5VB 2XQBH 3GM0A 3QIBB 4LCYB 2R2HB 1ZVSB 4KI1A 2XY2A 1IZKA 3OWEA 4JM2C 5F7EH 1S5HA 1RY7B 5C7XL 1NGQH 1UM6H 3QZWG 4Q58C 3MNVB 1MCFA 4HXBH 5F88B 4R26L 3VFVA 3HAEB 1QA9B 5IJVB 3FFCB 1JGEB 1E4WH 4DKEL 1HHHB 5EOCJ 3ZL4L 4JE4B 1B6DA 3RWCB 3B4NA 2FGWH 5DC4B 2L0DA 2P7TB 4QHMA 1LQSR 1MWAB 5E2UL 1XCQB 1F00I 2ILLA 3ARGD 1Z0MA 2FYYB 4LLVA 5D7KD 1JRHH 3UROR 3BWAB 1LMKA 3HI6L 5DD0H 4XPHH 2HJKA 3M07A 3BKML 2UY7A 4QNPE 3ARYA 3F6LA 5FCUH 3TYGH 3LZFL 2BHYA 4XP5H 5ILTL 3NFNA 1NEZB 4KRPB 1XGPB 4PGJA 5KVGH 1E4XH 4G8GA 4LVOC 1W72H 4JZOB 2GTZB 3G08A 4Z7NE 2JK5A 1I1AB 2VZ1A 3DWTA 1INEH 2YPVL 5DHYA 4N8VG 4PTUB 4QTHA 1OM3H 1J9CT 3VGAC 1XGQA 5D7IB 1YMHB 4YFLF 3MA7A 4KDTA 4MA1B 4EN3D 1XGRB 3OJVC 4OZHE 1W0YT 1F02I 3MLWH 3P0VH 1J7VR 3MRQA 1WT5A 3H8NA 3QEHB 1MWAA 2FX9H 4KPHL 5E6ID 2BMKB 1NMCB 2VLMD 3SDXB 3QDJB 5LXGL 5C09B 5GS2D 1NBVH 1LO2L 3N85H 5C0IB 1U3HD 1D9KC 1CVRA 2CPCA 4IOIB 1KEGH 5HHNB 1TNMA 3SGEI 3UPCA 3F6IA 5J1AB 3O45A 4J7RA 1A7OL 5TE6H 1BFVH 3D0VB 4F9LC 3FAWA 3QFJA 3WJLC 4YHPA 3RTQB 5JR1H 4HZAA 4JJHA 4XVJL 3GRWH 1JGUH 1QFWH 2KH2B 5J6GB 1JWUB 1U8KA 3TFKD 3RKDC 4H1LB 1UM5L 2VDRH 3VG9B 4H25A 1ZE3C 4WIQA 2VDNH 4XNMA 1YY8A 1PW3A 3FCTB 1R24A 3PWUA 4LRNL 4YUEL 5EBWB 2JB5H 1JTPA 1GGIH 5H2BB 1CL7L 1OARL 4LSRH 4O58H 5DQDL 4PJDE 3REWB 2OQJA 2D31B 2YOCA 4H8WC 3BYTA 3NCYP 4Y4KB 1WQVT 3EKCA 1H3GA 3AROA 4RCAA 4KK8D 4EBQL 2AQ3A 3FB8B 2OTPA 2GSGA 4X83A 1UACH 3AS2A 3TNMB 3SKNA 1BAFL 4YHLL 3DMMD 5D5MF 3WS3B 3O6LL 1CG9B 1OAYL 4I9WD 3WXWL 1JGLH 5GGVH 4XCEB 1ZLWH 4YJZL 1H8SA 3O3UN 5DRZB 2WBKA 2F8VA 4NRZA 1U8QA 5ALBH 3HMWH 3VWKD 3UBXA 5CD5D 4OAWA 3ZDYE 2A77H 4LFHD 4NNYB 1KTDB 1F11B 2YA0A 5D1XC 1Z2KA 5IF0A 5D1ZB 4NO3A 3MOAH 3DTXB 2FZ3B 5D7IF 4QRRE 1WIUA 5JZ7D 1WCBA 3V5KA 5KOVC 3RWGB 2EO1A 2FLBT 3DROA 4PJ5B 4B7IA 5IFAL 4NCDA 2VJXA 1YEFL 1QBLL 5BMFL 1Q9KB 5FYLH 3S5LA 4HKBA 3VFPA 4PJXE 4H8WH 3LKQB 4FQLL 4WHCA 4S10A 3QI9B 4ODUA 2BSED 5FA4A 1CR9L 4X4ZA 1RJYA 3GSXA 1LDSA 5E8NA 3GK8L 3V6FB 5IBTL 1B90A 5D72H 3CFBB 4GAGH 4APQD 1GHFL 3V7MA 4U6YB 4OZ4A 5K9QG 4YDJB 3DX8B 4F9PC 2NY2B 1JE6A 3VGHA 5KN5A 2UZYB 2HTLC 3D1MC 4MXQC 4PJDF 1V7MH 2KZWA 2OZ4A 3IYLW 2C9AA 4S1SL 1H0DA 2Z8SA 1KJMA 4X4MA 3HMXA 4LU5H 1MI5A 4TPRH 1FVEA 1QHPA 2DL2A 1HOCA 2Q8AL 2GUOA 2E9WA 2ARWA 4P5MB 1D6EA 5LBSL 3VJ6B 4TOYH 2F58H 5FHBH 4PB0L 1CQYA 2NR6D 3E3QE 4NQCA 4ZFFA 3F5WA 1Y6KR 1AKJB 4P5KB 4LSRL 3RY4A 4TTGA 3BX7C 4HDIB 3KHQA 2IANB 2PYFB 4GW4A 4KJYA 4PGCA 3MO1A 1I7ZB 8FABA 3DARA 1HQRA 3R06A 4N0FB 1CFSB 4PREA 4YHIB 1W72A 1Q94B 3ARQA 5F89A 3DSFL 4M43L 2CRYA 2Z93A 3BN3B 3QNXB 1UQSA 1IQWL 1T0NB 1KPUB 1EHNA 2EDQA 1A22B 4HJGB 2FSEB 3EDKA 3EYQC 1P2CA 3KPTA 3SDYL 3GUTB 1MHEA 5T5NG 5DFWH 4OF0A 4B7LA 1N2RA 3VDBA 4N8VA 2R4SL 1X6NA 1U3HC 3MZGB 5FA4B 1HHKB 3LEYH 2ED8A 2NY1D 2Z92A 4U6HB 3X3FL 3ZHDA 4AIOA 2WIMA 2VABA 5HI4D 1DQQB 3U4EA 1G7PB 1I1FB 3HZMB 1FJ1B 1Q9KA 1AGBB 3MXVH 4FFWC 4GRLD 4DEPB 2NTFA 5J89A 1LDPL 3DXAA 3SBWA 4G6MH 1ZSDB 4KV5E 1EX0A 2UZXB 4OD2B 5F9WC 4EDWL 5CSZA 5C0FB 3L3JA 3WDHA 3H9HA 4WU7B 2JB6A 3LQAL 1JPFA 5E1HB 4YWGL 2ERJB 3V0VA 1LEKB 4YC2B 2AXGB 4I5BB 1FYTD 3BD5A 4HUNB 3CNKA 2H3NA 1J5OL 1HHIA 2XKNB 2J5LC 3JZ7A 4P5TA 2YD1A 5FCUL 1AGEB 3D9AH 1ED3A 5KVGL 4XP1L 4HIXL 4OZIA 4P9HH 1A6UH 1KJ3L 3QP3A 2Q76B 3BZEB 3CVHL 3O2VL 2AEPL 2OL3L 1HQ4A 1YMME 5MEPA 1RULH 1IBGH 2NXZB 4I5BA 2AXGA 3FOLB 3UTZA 5E9DE 5C0AA 1L7IL 1S78C 2BXYA 3F8UB 2VR5A 4KRLB 4YGVB 4MHHG 1JPSL 4L4JA 4BFBD 5EU7E 2E5EA 1YY9C 2JJTC 3WNKA 5C6TH 4PJEB 3BJ91 1HH9B 1ZLSL 43C9A 5KVDH 4HXBL 4OJFH 1ZWIA 1VEPA 4JKLA 1MY5A 1SYVB 3L1OH 4JM2D 5KJRH 5EZLB 5IMKB 5GS3A 2ATPA 3MRMB 4KFZC 4KQ3L 4G6KH 4OCSH 4XRCA 4KK8C 4C56D 1I9JL 5CP7B 5BVPL 2BVTA 4OD3H 5E5MB 4U1MA 5F1IA 4HKZB 3VXMA 3P4MA 4AM0B 3CDCA 2OR7A 4X6EB 3T8XB 2VMFA 1WISA 1E0OB 1C7TA 3IJHA 5J6HA 4FP8H 4Y4HD 5I1CL 3OJDB 4WTZA 2DQDH 4MGXA 4OZFG 3QDJA 4Y8DC 1N8ZA 2RHEA 3PP4H 5GSVB 1WWWX 5FK9B 1DVFC 4N0UA 3IVKA 2EC8A 4AEIH 3I84A 1ZGLA 1SBSH 3AB0B 4HUXB 3VCLA 4Y5XA 1JFQH 3MV01 2FX8H 4AENA 1HIML 1MJJB 2E27L 3DV4B 2CIKB 2NR6C 4Y4FA 1XGQB 4HFUL 2FECI 1OB1B 1IAII 1ZT4A 5DLMH 5DC0A 4H88H 3C5ZD 3LOWA 3MGTB 3FHQA 1SJHA 3QDGB 1XGPA 4HXAH 2I9LB 1LE5B 3TPKA 3WIFA 1WUNT 2IPTH 3GHEL 1NCDL 3QG6B 4WU5B 1ORSB 3HNVH 5BRZD 3E8UH 1HINH 3V8CA 4MNQB 5ESAA 3RI5F 5C9JA 1I7RA 3NFPB 2APFA 4QHMB 3QRFM 4MXWH 3VFTA 1YC7A 3JSSA 3TF7C 5SV4A 2J5LB 3MR9A 1IC5L 1FAIH 1GC1C 4EXPX 1OPGL 3MV7B 4OCLC 5FYKH 3U83A 2DQIL 1HH6A 3L5XL 4LCIL 5HHOE 3HI5L 4LLYA 4AG4L 5SX4I 4N9GB 2HTLD 1SY6L 3BE1H 4HUXA 2NY3C 2K7QA 4PD4K 4F7PA 1BWWA 3E6HB 5LGHH 3VXNA 4JFHD 4QTIH 2F5BL 3DVFA 1AE6H 3PQYD 3FFCE 1X5FA 2QADD 3OKNA 3NABL 4P4KC 4PJGE 3MC0A 3IDYB 1J8HA 3V6BR 1KIPA 1AQKH 3S9DB 2YA2A 1VB9A 2BRRH 3LIZH 5DRWB 1ZTXL 4Z0XA 4CBPA 3S5LG 5EU5A 2VLKD 4HKZA 4LCUA 1NAKL 1VFBA 3VXMB 4HWUA 1XF3A 3PQYA 1VPOL 4ELMF 4NWTH 1VFMA 3WUWA 1LGVA 4LQ1A 1T6WA 2R2BB 3EJJX 4TRPL 1F4WL 1S7UB 3CVIH 3M45A 5C07E 4U1IA 4Z7WB 4DW2L 4ODWA 1S8DB 3LKSA 2R56L 5DWUH 3DHMA 1AXSB 1T1XB 4FQJH 5CCKL 4I48A 3L3GA 4FXKB 1QP1A 4I0KA 3G6DL 4PJEA 1CZ8H 4EN3A 1D5MB 5L6YL 4QOKB 4CDHA 4NCC2 3WO4C 2ZCKL 1L4IA 3QZWA 4GRLB 3TA3D 1A2YB 1AP2A 5EU6B 4WO4B 4ODTL 4XVSH 3I6KB 4LCUB 1EBAA 4R6UA 4D9QE 4E42A 4GRLC 5ERWB 4JFZH 3TIDA 1F3DH 3QULA 3TFKC 5IM7A 4OLWL 3VFGH 4ZXBB 3RNKA 3CXHK 3VXSE 2V2TA 2J2ZA 3QEUB 1L6ZA 1QUNA 4TVPL 3MBXH 4ODWB 5ICXA 1QRNA 2FX7H 2B1AL 5D7LB 5F9DC 5DZNA 4P48A 4NWUH 4TN9A 5HGDA 2VLRA 3HZKA 1EAJA 5C0BD 5IVXE 4LLWA 3QBTB 4NQDA 4OCWH 3V5DA 2D7NA 2WBJA 1P69B 1FH5H 1MRFH 3OKMA 3L3OA 2Q6WA 4X9HA 5EIIA 3DXAB 3DVIA 3QWOB 3IJSA 4GUPB 5TE4H 4KUCF 1ZAGA 4J3UA 3VD9A 1BOGB 3LEVL 5TE7H 1ZA3B 3GSRB 4YBQD 1CF8H 1PZ5A 4QRPA 1NGYB 3QUXD 3U6RB 4UV7H 1AGCA 1XR8B 1ZHLB 2YN5A 5FYLE 2ZOLA 2FWOB 4KROB 4WUUE 3X3GL 1N2RB 2NY3B 1HHJA 5E8OB 5ACLA 4MZ2A 4K3DH 1F3RB 5B38G 3MNZA 4XAKD 1T6VN 4QWWD 2HT3D 1CGYA 1IM9B 1J18A 1G6RL 2BJML 5FO9A 3HR6A 5C9JB 1OSZB 2A6DA 4ZO8A 3MV8B 3K1DA 1S7TA 4H0HB 5E8PB 5L0QC 3RUGB 3ARFB 2ADJA 5EB9A 3LRSA 3K2MC 1G9NH 2NY6D 3PIQA 2Y07L 4NZUL 3WFDL 5B39B 2QADB 5EU5B 5INCA 1XR9B 3R0NA 4X99B 3S88L 1A6PA 3UPRA 5JA9A 1J0YA 3AAZA 4XPBH 2C3VA 4WFGE 1GGCH 2J6EA 3BAEH 3SQOH 2UWEE 4I4WB 2Z93B 5C9KA 2R0KL 1A6VH 1DFBL 3I02A 1MFEH 3EHBD 1B4JL 2HMIC 43CAA 4Q2ZA 2NLJA 2CR6A 4OBSA 3GIVB 1ZVYA 2V9QA 3VMPA 4LSTH 1NDGB 1ZA6A 4I2XB 2P1YA 1MJ8H 3MNZB 4D0DA 5MEQB 3CH8A 2DLFL 4QHUB 5EO1B 1G9EA 1P84K 1Q9OB 4NT6B 1JHTB 3BRGC 1CLZH 3DX7B 4LPWA 1BZ9B 1AC0A 4H20H 5FHAL 4MD0B 3ZYIA 2EXYD 1U95A 3IFOB 3K80A 3UYRL 4NYLA 3PG2A 5I8EB 4YAQB 1EGJA 4N0CC 3Q5OA 5C0BE 1A6VL 1DFBH 1ZT7B 4JRXE 4BQ8A 2V7HA 2LU3A 1MFBH 1KLFA 2AJXL 1FZMB 5CILL 1OTSD 1NCBL 2VH5H 3R0MA 2YSSB 2DYPD 3NCJL 4U1HA 3O81A 1FO0L 1JN6A 3S4SG 4FQCL 3HTLX 2Y07H 4NZUH 3U7WH 2XWTA 1N5AB 4I2XE 3O2WH 2VSCA 2KUTA 3DROB 5C0BA 4BZYA 2DD8L 2XG4A 5IKCB 1RU9H 2J4WL 4JHWH 4HS8L 1BGXH 1JV5B 1TZGL 1RIHL 4N1EA 3U30B 4Z8FL 4TUOB 2CKBH 3FO9B 4NO3B 3MOQA 2VQTA 4K9EH 1S7WA 3GI9H 4L1HA 5F3HB 3RZCA 4FHBD 2CMRH 4LLQA 1B2WL 2B4CH 3VRLF 4LIQL 3OR6A 3OKYA 1FCCA 2XI9A 1NCUA 3QWRA 3HC0A 5HDQL 2VDKL 3SE9H 3VA6A 1DVFB 4APQA 3V52H 1ZS8A 4UB0H 1WBYB 2WUCL 5GPRA 1AGFB 1WZLA 5F7YC 5TFSH 3G6JF 4GO6B 5TE4L 1I85C 2DQGL 3GIZL 4JPWH 5D2LA 4MLIA 4PP1C 2Z31B 5DMKA 2APTA 2GSIA 2B0SL 2IWGA 5EN2A 5FO8A 3VXUD 4Z5RA 3UZVB 2I27N 4X7EC 1H3WM 1WFUA 4XI5D 1YMMD 3O6MH 1JNHB 1U8HA 8CGTA 2HT2C 2X4PA 4RZCB 1MFDL 1P7QB 4TSCL 2C3GA 2SEBA 4JVWA 3LN5A 3TP4A 4TTDD 4X5WA 3FT3B 1A1NA 4DQOL 3TH2T 3RJQB 1YUHA 5SWQB 3H3PL 2DAVA 2RFXA 4Q9RH 2VDKH 1NC2D 4L3EB 1TTGA 1GOFA 5EOQL 3ROLA 5E5RB 5EUKA 3P4OB 3WN5B 1U8LA 1UADC 2DMBA 2F53E 4D0CB 4ELME 1EJOL 4BKLB 3VI4E 1QZ1A 5LJYH 1J10A 1F8TL 2F54E 4U6XA 1K9TA 3AFLA 3JV6B 5E4EC 2VXSH 3A67L 4PJ5E 2EDFA 3O3AB 3LV3B 1T0PB 4HCRL 2XT1B 4WDIB 3MRQB 4PJBF 3ARDD 1SQ2N 4RISL 3KPNB 5L6YH 1H8OA 4QF1A 4L5FH 1CDUA 3UBXG 4W6WB 1B3JA 2LVEA 1HSBB 3HUJE 3LQZB 1XF2A 1FSKB 2EH8L 3EHBC 3D5OF 1A7RL 3QG6A 1NDMB 5HPMB 5MENA 2MPAL 4UTAH 1DJSA 1SMOA 2JK5B 1TJHL 1NCBH 1Q8MA 2VH5L 3CLFL 2FHCA 3HPLA 4WFHD 4JLRB 3OGCB 4RBPH 4Q9QH 2VLKB 3QDHA 1KLUB 3UMTA 3QUZB 1PLGL 3ET9F 4FQXD 3TT3L 2CH8A 4XBGB 5FYJL 1BD2E 3UBXB 1MOEA 5BQ7A 4XNZC 2K9UA 2B4CC 4K7PX 1ZA3A 3GSRA 4YHIA 2N56A 1RK0A 5DSCA 4TNWK 1W0VA 1VGKA 3ETBF 1CLOL 4K9EC 3DUUB 4KTDL 4PV8A 3B2VL 4DZ8A 2ZNWA 1AE6L 4MCZB 3UJJH 2VXVH 4IRJB 1NAMB 4U3HA 3SOBL 2GCYA 5AZEH 5E6IC 2WBJB 4MVBD 1EHLL 4JY6A 3IFPB 5GSRA 3DIFA 4MXQD 3ECBA 5FGSA 1LO5A 4JFQA 4HK0B 2FDBP 2X1OA 4WCYL 1CDIA 2C7UA 2XTJD 5C08E 1S5HB 4JRYA 4DN3H 2JJSA 1EO8L 4LGPB 2FECL 5BV7C 4HKJA 3MRHB 3BZFB 4OZGA 3TCLB 25C8L 2G60H 3BUYB 4Y16A 3LH2H 3MJ9L 4E9LA 5IMMB 2NW2B 3OAYH 5I0ZA 3T4YB 3QO1A 2MQ3A 5C1MB 1F58H 2NNAB 4UT6L 2WW8A 1BF8A 1HCVA 4NUGL 5HHOB 4R0LA 1LO4L 1N7ML 4HV8B 3VFOA 1TIUA 1KIQB 2AJSH 5ADOL 1U8IB 1RZ8B 4YNYB 1A7QH 3JWOC 1I3GL 2ADIB 2LVCA 2DQCH 1GGBH 5TPWL 5C0AD 3SO5A 1EHXA 2NW2A 3MCG1 3QQ3B 1UCTA 1T04A 2Z35A 3GSWA 5EBGA 1MUJB 3SKOB 4XPFL 2P5EA 4WEMB 4IMLA 4I1NB 4P46C 3WJJA 3S6CA 4IIQC 4J2XA 3HNTH 4WUUB 1HEZA 4FFWD 3DV6B 1I8LC 2EYSA 2YS4A 1DBBL 2QQNH 3FQUA 3IXAB 4XC1L 5ISZA 3T65A 2NY3D 1RJLB 4ZTOL 4R8WH 4MQTB 1ONQB 3TZVA 3Q5YA 4X4YA 1T3FB 4K8RD 4MA8L 3G5XA 1FNGB 5EDXA 3VWJB 5T5FH 3DVGA 5FYKD 3BPOC 5DQJB 4NZDA 3Q3GA 1RK0B 5DSCB 2DM2A 3FOMA 3TYFA 2HJLB 5BVJB 1WFOA 5F96H 1HSBA 5D70L 2VDQL 2ZSWA 3CZFB 4K7PL 4OUOA 4OM0H 2X4RA 4GKZB 3E6HA 3FL7A 3DXAD 15C8L 3T2PA 4ACPA 4MVBC 3BQUA 1VHPA 5EUOA 5D1QB 4MZ3A 4MA8H 4U4BA 5TF1L 3IDIB 1XCQA 4WUKL 3ZYZA 4HSQA 5C0CE 1RAMA 1OW0A 4HS6B 1YYML 3H9SD 3GSUA 4JO3H 3EOAA 3FCTA 3C87A 3RTQD 1YDPB 1TLKA 4M5ZH 3QNZB 2NLJB 1HKLH 1WC7A 2VZVA 3P9LB 5D2NB 3BT2L 4ZNCD 3GMQB 2DQHL 5F7DA 3WKMH 1P4BL 4LVOB 1NLBH 2DLEA 4HMCA 3FB5A 4BQCA 1MJUL 2X4NA 4NO0D 5HYSA 4WV1C 2VUYA 1CFSA 4OGAC 4P5TD 3HN3A 3CFKB 4Q74A 5EIVA 3RGVD 3DVGB 5IV2B 1HI6B 3WD5H 5EH1A 1GOGA 4NFCA 1LO4H 4DTGL 4MAUL 1MH5B 3GMOA 1F4YH 4PRDA 5FKAB 5I1JH 4Y16C 1QA9A 2VLJE 3OKKB 5K9KA 3KDMB 1CD9B 4PJFF 4BK5A 1FCGA 2AJUH 3RX5A 3L9RA 4QXTA 4Z7WE 2HKHL 4Z7QF 5I19H 5CD3A 4Y16D 5JXEA 1N5YH 2E7LA 4M5YH 3VXPA 1G84A 2P5EB 2AI0H 5DUPH 1A47A 4GFTB 1LK3H 4XMPH 4NQDE 2A73A 4KJWC 4QHNA 3QPXL 3KPRA 4OZ4B 1L9MA 4KZDH 3WLBA 1D5XA 2ICEB 3CFDB 2R0LH 1J0JA 2P45B 1P7KB 3KPSB 3I2CH 1DR9A 1OP3H 1Y6NR 2OI9C 1NEZA 4NHCH 3T2QA 3VFOB 3ARGC 3OQ3B 4JEGB 4PGEB 3VXQA 1VFAA 4OLYH 4XWGH 4HC1A 4IBLT 5SWSB 4P46D 3MRJB 5KVEH 3WKNA 3V7AE 3WS6A 4LEXH 3IKCB 2EH7H 2AEQL 4U33A 1RZIB 3CCHA 2JJUA 3G6JA 3B2VH 1TMCB 4YEEA 5E8EB 5KBNC 1DVFD 4MB5A 3L3OB 2Q6WB 1ZANH 3HI5H 4RIRB 2AW2A 4G3YL 1T5XA 4N5UA 4ETQA 4P3DA 4P2RD 1TVHB 3KLAA 4WW2F 5DURD 1HZHH 2PXYA 3IDIA 4M3KB 5T1LD 3A6CL 4HWEL 2NMSA 1KPVB 3HUJB 3LMJL 1SYSA 3U9PL 3CMOH 4NQXB 1HYSD 5EWIH 5JNYA 4WWKA 4JFPB 1HQ4B 4FA8A 5IG7A 3ROOA 1A02N 2E9IA 1T4KB 4PGBB 5DK3A 4L4TA 4KMLB 3L3KB 2SEBB 1CT8B 4XXCA 2PW2A 4RIRA 1ROWA 4JFOA 4MDIB 1T3FA 4JHAH 2EEBA 4JPVH 3ES6A 4O02H 5KVEL 3OB0K 1AFVH 2DJ4A 2QSCH 3MRPB 3CCHB 4JVUA 2FHFA 1PBYA 3CVHA 5E2VH 2R1WB 2OL3A 3RKDD 4N0UE 3W0WD 3MROB 1CVSC 5DEGB 4OLZH 2FX8L 4ODXB 5D2LB 3PWNA 4WHYH 3ZSSA 4YK4B 4YHML 2EEAA 4HFUH 2XZCH 3WDJA 5E5UB 4HG4K 5E2WH 4HBQA 2HVJB 1Y18B 1HIMH 1N6QL 2A6JB 5ANME 6CGTA 1D5BB 5HPMA 2W9DL 1A6WH 1ULVA 1Q72L 5GIRB 3MYJB 2ITDB 3G5ZA 4P59H 4KDVA 1HYSC 1X44A 1ES0A 3LRHA 1N64H 2R15A 1QEWA 5GZOD 2DIJA 4MLSA 1SM3L 2AXHA 2MHAA 2ZUQC 3BPNB 2CRZA 3P73B 1C08A 4PJ7F 3OV6A 3MROA 3VD7A 5IUSA 1U91A 1YN6B 2QL1A 3B6SA 3RFZC 3CPLA 5TQ0L 4EVNB 1MHHB 3QH3A 4CJ1A 2VUOA 1QSZA 4JY5L 5DJ8B 1BF2A 1D3CA 3LRGA 1HK6A 5EC1B 4ZAKB 4KTYA 5ALBL 5DJDA 1P4BH 2G2RA 3SDDC 4OI8A 2ADJB 1AI1H 1LEGB 3WE6A 1S7QA 3BT2H 5KVDL 3GSQB 5TH2B 4PLNC 5C0EB 4ETYA 4YR6A 3C9NB 3PHSA 1BJMA 1BBDL 2VISB 1JYVA 3IDUA 4YHYC 5IW1B 2Y06H 5JTWA 3MO1B 4QY8A 2WM0A 4OCRL 4ZFFB 4O5LL 2V7HB 3ARBA 3U9UB 3P11L 3U9PH 5L8LB 1IEBB 1Q9WA 2RJMA 4HPYL 5GS0H 5L7XL 5E95B 1F3JB 3CVHH 4KKCD 1D6VL 2ZUTA 2CMRL 1FNLA 4K7PH 5E8PA 4P9HL 4YXKL 3ALWA 1PKOA 1JTTA 1S7XB 3IDNA 3KJ6L 4PLJD 4QLRA 2BY1A 5DK2B 4BSWB 2F9BT 4XP1H 2DQFA 3CGTA 3KAAA 3O0RL 1FNFA 2Y5EA 4B50A 2X4TA 2LU7A 4D0BB 4X9FA 4WFEE 3DX8A 3SDXF 2PO6D 3EO9L 3NPZB 3NTCL 1CWVA 2P7TA 3B2UD 2DQEH 3BPNC 2XKSA 4POZD 4P2OA 1D5XB 1F3JA 4XWGL 3OX8A 4X4YB 1IGJB 4UIKL 4NJ9L 3S37H 3ILPB 3QAZB 4L3EE 4U6VH 4BUGA 1UWGL 3VCLB 4PGDA 1P4IH 3AREA 5HGDB 2GKIA 2D0HA 5FF6B 1U6AL 5EU6D 3RA7H 1YEEH 3FQWB 3PWPD 1LK3L 4IOSD 3B43A 2X4OA 5T1DH 3IRPX 3TV3H 1OLZA 1IAMA 3EO1A 3LKOA 4KHTH 4F33A 5DHXB 3C60C 4GRMA 5FUCC 5BOZG 2IQ9H 1HE7A 4NRYB 5IGXL 3W0WE 1FBIL 4XHJD 3RI5K 1EVUA 4S1QH 2WK2A 4KVNL 1LD9B 4PJ9A 3GJEB 1JWMB 2X9WA 3KPQA 4PJCF 5EU6A 1JGVH 4HF5H 5T3XD 3O6FB 1I8IB 5JDSA 4NKOA 2R8SH 1IQWH 1QSEB 2GTWA 5F9AC 5E94A 4IEFB 2PO6B 4POZC 3D25A 1HDMB 2H32B 4NNXB 4RZCA 2ITDA 4AK1A 4HJJL 2ADFH 3SE4C 4XPHL 1B0GB 1JPST 1UENA 2DI9A 2HVJA 4TNWF 1SMAA 3FB8A 3D3VD 4WO4D 2P8MB 4LOUC 2ZP0T 2ATKB 4ZO9A 3IDGB 2JKXA 3KYKH 5I1KH 4Y2OA 5AD0A 2J8OA 5CJ5A 3P30H 2YUXA 5MHSE 1UZ6E 4WI6A 3OGOE 2JF1A 3E0GA 1VEMA 3C5JB 3NA9L 3PWUB 4BZ1H 2XWJA 5JW3L 1T0MB 3MFGB 3SHSA 4QWWC 5GGQH 1EEZB 1YC8A 2NY5H 3VXRA 1UM4L 1BFTA 4XWOC 1G6RH 2BJMH 2VWEC 3I3EA 1C1EL 1K6QL 4TVPD 5CINL 2A83B 3SBWC 5HI5C 5J9PA 5KSAA 2QQKH 5J1AA 1NC4B 3RZCB 3ULUH 2EDXA 1LP9A 4PGZA 1QQDB 4GRWH 3IFNH 4X6DA 3MV9E 3IU4H 2V5YA 1OGAB 4YIQB 2O5YL 3ZMRA 5EPMB 5DO2D 2K3TA 4XX1G 3MV8E 4ZFZA 2AKRB 4JCMA 3S35H 1K8DB 4S0SD 3WUZA 4NN6B 3MRFB 2BNQB 4WVRA 4RISH 3VFMB 3VFSB 3QQ9D 4MNQE 5CFHA 2HH0L 4XPAH 2VLME 3L6FA 5HVGB 1AP2B 1KN4H 4K94L 3ARSA 1QSVA 2Y1VA 2DLGA 2ZZUT 1A21A 4PJXF 3OX8B 1BHGA 3DSNA 2MTPA 3CDFA 1SJHB 2VLRD 3HRZA 4YAQA 4MHHI 3AGVA 1P6FA 4RX4D 1I7RB 1YPZB 3WJLA 5F6HI 4X7FC 5EA0L 4NQEB 4IDLA 5EO9A 4PBWD 1OSPL 1IEHA 2X6MA 5D7IE 3P0YL 3RIAK 5IVXF 1NUNB 5CS7A 2P24A 4PJGB 4EI5A 35C8H 1H9VA 3DX7A 4GMTH 1A9BB 5D1QC 4B53A 1N8ZB 2XTJE 5C08D 5HGAA 4Y4HC 2PCPB 5KSVA 4XBPB 1FL3B 4X7DC 4NRXA 1ITCA 5DZLA 1R3KA 1KENH 4WI8A 3IETA 5DJYA 4JDZB 4LASL 2EIZB 2FJGA 4NBYB 1LP9B 1VGKB 5ITBL 1MI5B 3TH4T 4XX1E 3IDMA 3MNVA 4RRPG 1RV6X 2C5DC 5HYSB 2VQUA 3G6DH 1PY9A 4KTDH 4OV6F 1NJ9B 4WNQA 3QCTL 5I8CB 4Z7WF 2M2DA 4DCQB 5LQBL 3TO4B 3RNQB 3OB8A 3QUKB 5EOTB 3QEGL 4Z7OE 1DVFA 1WBXA 3QH3B 1A6AB 4JAMA 4IIQB 2BCKB 1KN2H 3PIQB 3C8KB 3QXAA 1N3NA 4POUB 2FR4B 4YX2L 3WMSA 3VFTB 1LP9F 2P47B 4W70A 4X6DF 4QYOB 1I9IL 2ICWA 3IDGA 5EU7C 3U4BH 2NXYB 1UWXH 2C1OB 4OFDA 4QOKA 5F7MC 3EDEA 1EK3A 3QDJD 2JELL 2JJVA 4UUJB 4NBXB 2B20A 4L8BA 3QDMB 3MXWH 4XC3L 5DQJA 3RL1A 3E2HB 3MLWL 2HKHH 4ZUVA 3LKSB 2V6HA 3TA3C 3I6LD 2VITB 1FLRH 2VDMH 5ITBH 1AGEA 1DQLL 4P49A 3SDDB 3EFDH 4MXVF 5D93C 4Y19B 3WD5L 4ZS7H 1U3JA 1BOGA 5DJ0A 1IZJA 3MLZH 2YD4A 3FO0L 5I16A 4UNUA 5BJTB 4XAWL 3PDOB 3H9HB 3RWFA 3HMXH 2R2EA 2QHRL 2VDOH 3P2TA 4QT5B 2PF6A 4G5ZL 2YZ1A 1FG9C 5IG7B 3WFCL 3BZDA 3RWDB 1JZ6A 2EDHA 3BDYH 1YQVL 5D96C 3VRJA 3H3KA 1KB5H 3PF2A 3MLXL 1SJXA 4N90E 4LHUD 2LAAA 4R0LB 2FIKA 4F2MB 4F58H 1I8LA 2DYPA 1WBYA 4LCWE 1IQDB 3N1GC 1IGFH 2QR0B 1WICA 3U0TA 1MCCA 1CGSL 1FGNL 2A6IA 4PJFA 3ZKSD 4NNPH 1HH9A 3NFPA 1VKXB 4GKOA 5IBUB 3QEQE 2IG2L 5EU4A 3VG0L 2AV7B 3BMWA 5EORH 4XP4H 5KAQF 4HLZG 4ZMAT 2XQBL 2R39A 3M1BB 1XFPA 2EE2A 1MCBA 1IC7L 3I75A 5IHZB 1JHKH 4EUPA 1UT9A 2UWEF 4NOFA 1F6LL 4KHXH 3MCKB 5EBLA 3VFWA 1AKJA 1QFWM 1LO3L 3QDGE 2GCYB 5KSVB 5DZOA 1F45A 1C1EH 3SCMD 2EYTB 2CK0H 2CKBL 4NO2B 3F65A 5D4QA 5BZWA 2NY5L 1P53A 2H2PC 5H94B 1XT5A 4PREB 3L1OL 4N0FA 3K7UA 4GG6B 3V4UL 4U1HB 2X1XR 4JM4H 1YEHL 2D2OA 3GMOB 1IGFL 1U3ZA 2G2RB 1C8PA 2DQCL 1QKZL 3UTPE 1WFTA 1TZHB 1T1WA 4PG9B 3MBEA 4MMZC 1PFCA 1WZ1L 1XR9A 4N0RA 1FG2A 2ENSA 1IL1A 4OM1H 3UDWC 4YHZH 1A6TB 2VKXA 2VSDA 3EO1B 4RMRA 3MUJA 2OCFD 3QI9A 2OBGA 4ELKB 3RVVD 3LKQA 2BZDA 3F7YA 5EBMB 2CDFA 4LFHG 3IS0X 1MHCA 1IM9A 2ZUWA 3OSKA 3VRLE 1CDGA 4K3EH 2IAMA 1B0RA 1C7SA 5FUZH 1RK1B 2V5MA 1QFUH 5EPMA 2ZG2A 1FVDA 1ZLVH 4NGHL 3GUTA 4ODXA 1KCSL 2AABL 4JRXA 4X7CC 3D85D 2Q8BL 4K3GA 5IIEB 4JHZA 5TDPA 3AS1A 4MJ5A 1JPGB 4IRSD 1JHLH 2VLRB 3HZKB 4ZYKA 3IU3B 4BQ6A 1D9KA 2DLTA 3DURA 5ESQB 4M1CC 4LLDA 5ABDE 5IFJA 1KC5H 1TVBB 3ARED 5C0ND 3NGBB 3K81A 4U1LB 3FRUB 3PP3H 5DUMH 1FIGH 3LDBC 1DSFL 3TN0A 4KV5F 1GGCL 3BAEL 3EFDL 4J8RA 4RAVB 5L8JB 1VSCA 3ROOB 3UTTD 4C56E 3BRDA 4OFVA 4Y88A 1A1MA 4F57L 5AAWA 4Q9CA 3W9DB 1NCCH 2X2YA 1AXIB 2YEZA 2BX5A 4DUVA 3QZWB 3CXDH 5DRZA 2R4SH 1HEZB 1MIE