1YNTB

Structure of the monomeric form of t. gondii sag1 surface antigen bound to a human fab
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
218
structure length
218
Chain Sequence
b'QVQLQQSGAELVRPGVSVKISCKGSGYTFTDYGMHWVKQSHAKSLEWIGIISTYSGDASYNQKFKGKATMTVDKSSSTAYMELARLTSEDSAIYYCARSSTWYYFDYWGQGTTLTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4F11E12 Fab variable light chain region
publication title Crystal structure of the complex between the monomeric form of Toxoplasma gondii surface antigen 1 (SAG1) and a monoclonal antibody that mimics the human immune response
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Immune system
total genus 40
structure length 218
sequence length 218
chains with identical sequence D
ec nomenclature
pdb deposition date 2005-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yntB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yntB02
3RIAK 3TBTA 1NGYA 4JFZL 3BZ4B 4EDWL 5EULV 3ARDD 4K7FB 5GGUA 5K9JH 1FV1A 5IMLA 3LQAH 1U58A 3ZMRA 3FRPA 3PWUB 3V2AR 3O2DH 3EJZD 1R24B 3QQ9C 1QR1B 4ODVL 3RWDB 2JJSC 2VMFA 2KQMA 3PDGA 5F7WC 1L0QA 4X5LA 5FM5O 3T0BA 5C0RL 5CILL 3CMOL 2XNAA 1U8KB 4XVJH 2GJ6D 4N9GB 1I3RA 2EDNA 1MI5D 2HWZL 3W0WB 3GSNL 3RIFK 2A83A 5K33A 3CFDA 1JP5A 2ATPB 1TCRB 3SY0B 2FD6L 2J8UB 3IVKB 5E2TL 2ZNWA 2VDLH 2DQGH 4D2NA 3AAZA 4ZOAA 4JFZH 1WAAE 4EDWH 3BUYA 4DGYH 4U2YA 1BF2A 3MV7D 1NDGA 1CR9L 5GRVK 4PG2C 4NQDE 1FL3B 3BPLB 4G6AC 1J8HB 2YN3A 4HWBL 4PD4J 4MNQD 3QB7C 3NZHL 3QHZH 3HCVB 1S7SB 2FIRT 3QZWG 5C0RH 5D7IE 3NMEA 5EN2B 3S4SG 3V9FA 4OZGB 3CMOH 5CILH 1G6RA 2FATL 2IPUK 1YEIL 3T2OA 1H3PL 2J88L 5GGUB 1FV1B 3EYFA 3MRKA 2FD6H 5E2TH 5IMLB 3DWTA 1U58B 5D1QB 2BERA 2RFXA 5C0NC 2BSSA 1CR9H 2NX5A 4PJ7F 3H9ZA 3BQUD 1W72A 5FO7A 3MLYL 3NZHH 5MP6L 3MPCA 3EUUA 3CFDB 2JF1A 4JN1H 4OI8A 1YEIH 5I16A 3AAZB 3QUML 4X5WA 4KMLB 2J8UE 4F8TA 1SMAA 4Q97A 1N8ZA 1NDGB 2DM4A 4PRPD 2B8OT 1OGTA 3RWJA 5DMIL 3MOBL 2WBJA 3LH2L 1AO7B 1PKQE 1VFAB 3RWHA 4O51A 3VXOB 1LE5A 3AREC 5D5MF 4FZ8L 1G6RB 4NKOA 5DHVA 2BP3A 4X98A 1P2CA 3EYFB 3MRKB 3ZDZE 1VFUA 1CCZA 3BWUC 4TN9A 1WC7A 4UNVA 2RFXB 2PXYA 1B2WH 4GAJL 1SBSL 2NX5B 1SYVA 2J1KA 3D87B 3MOBH 5D7SH 5DMIH 3RWCA 3LKPA 3LH2H 2GJZA 1W72B 5FO7B 3WV0A 2PO6A 1UM5L 1WQVT 4PBXA 2QQLL 2W9EL 5B21A 2PF6A 3DRTA 4KK5C 2BY3A 2YS4A 1NAMA 5DVLA 3GMOB 2NY5L 1YNLL 3SDAD 2XACC 1KOAA 4P9HL 2E8YA 4GKOA 3BH8A 5AYQA 1OWRM 1ITBB 1N8ZB 1IZJA 3ESUF 1N6UA 5ID1A 2YN5A 2WBJB 5KW9H 4GAJH 3RWHB 4O51B 1J0KA 1T20A 3ARFC 3E6FA 4P23D 4KDVA 1K2DA 2DLFL 4JVWA 1LE5B 1FH5L 2ADFL 2NTSP 1T5XB 4LDLB 1UM5H 4NKOB 2DQFB 2QQLH 2W9EH 4OJFH 4KUCD 4X98B 5F9WB 1P2CB 4I9WD 4NBYB 3SKUD 1YNLH 4OM1L 5KSAC 2IAMC 1HK6A 1YNKH 5FCUL 4P9HH 3JTSA 2W9LA 1EAPA 5ICZA 2I26N 4U6YA 1YY9D 1SYVB 3RWCB 4CW1B 5F6HJ 2GJZB 4U6VH 1MFAL 2VXQL 4Z0BL 3BIKB 1UQSB 2PO6B 1OP9A 4LL9A 2DLFH 1NUGA 3DRTB 3WD5L 2EH8L 3VMNA 1NAMB 3MXVL 3QO1A 3ZE2F 2XKUA 1E6JH 3NH7L 4H0HB 4XAKD 3S4SB 3LPGA 4OUUB 4YHZH 4JFFD 2YUXA 4C54A 4K3JL 1I1CA 2OS7A 2P42B 3H6JA 1OCWL 1WEJL 1ZHLA 3NAAH 4OM1H 3TPUA 5FCUH 5ID1B 2I27N 3MBEA 4QNPF 3VXUE 1M7DA 3U7WL 3HC0B 1E4WH 4OB5H 3L5HA 1T20B 5DWUL 1MIMH 4AQ1B 5TDPA 1P6AB 1OY3B 4RMQA 3QUKA 1MFAH 2VXQH 4I3RL 1FZJA 3WD5H 1UB6A 2A6DA 2EH8H 1QACA 5E00A 4XT1C 3B2UC 3MXVH 4MMXC 3ZTNH 2EIZB 1URLA 4J8RB 3C8HA 4G3YL 4JGUA 1NBVL 2ORBL 1F4AA 3MOAL 1EAPB 2XWBA 4U6YB 3RZWA 1DUZA 4IRJC 3GGWA 3D0VB 3HZMB 2GSGA 2DQEL 5DWUH 1QBML 1PSKH 1OAKH 3M17A 5T33H 2EDQA 4ZS6D 2UUDK 1KIUA 3SKNA 1ZEAL 1D5BB 4OLVL 1GGBL 4P2QA 3QUXA 4EXPX 1QVOA 3TPUB 1ZHLB 1VB9A 1ZTXL 3RWGA 3VU2A 4NC1C 4JPKH 3MBEB 4G3YH 1R3JA 1M7DB 1SQ2N 3IT8D 4M6NL 3MOAH 5D7JC 5TDPB 2P43B 4O4YL 5LCVL 2VH5L 2OMNA 2DQEH 4WI5A 1FZJB 3L3JA 5F1NB 1UB6B 2SEBB 3C8KB 5E00B 2AV7A 5DK2B 1WIPA 4M9OA 1FC1A 1GGBH 5GGQL 1SJEA 4JJ5A 2BHYA 4DJMA 2YUZA 3WO3B 1GHFH 2XWBB 3O45B 1ZTXH 2CRIA 3M1BA 1T6WA 3RZCD 2EYTA 5KSBA 1DUZB 1WCBA 3CFBA 2MQ0A 3GGWB 3OTTA 3LD8B 1FNGA 4TSBL 4MA3A 4O4YH 5LCVH 2JCCF 3DX8A 3SGDI 2VH5H 5ILTH 2UWEF 5FYJE 2NTFA 4NCC2 5EU4A 3RGVA 1KXVC 2E7MA 3IRPX 1QA9B 4RNRA 3VMOA 1AXSB 1JI1A 4NRYB 4YXLL 2IC2A 3QUXB 1QVOB 4PJ5A 1OAXL 4OCMC 4OGAC 3RWGB 1FYTE 1OT1A 5GGQH 1PG7X 2ICEB 1MNUH 3KPLB 4JFXA 5EC1A 3TNMA 5HYJA 3WN5C 3MRFB 4PJCA 3QEHA 1LNUB 1EO5A 3AS2A 4B53A 5TPWH 2J8OA 4YQXL 4TSBH 5D6CA 3L3JB 3OB0K 4B7IA 5FUOL 1ZA3A 2AV7B 2BSTA 2AI0L 4GRWE 2WWKO 1EHXA 3KJ4B 1SJEB 5GRYA 4JJ5B 4YXLH 1BFSA 1HH6A 1OAXH 3U46A 3M1BB 3N85L 1WCBB 1YMMD 3CFBB 1B4JH 1FNGB 1UACH 2X4NA 4OGXL 1TTFA 4G6FB 2OQJA 3DX8B 3GI8L 5ICYA 3ZHLA 2BNUA 4YQXH 3PGCA 2NTFB 5EU4B 3RGVB 3GO1L 4RNRB 1YUHB 2Y07L 4XTRD 5HI5C 3UTOA 2X1OA 4PJ5B 1I1RA 3P4NB 4P2QE 4ZNCD 4JFXB 4EQ2A 4ZG1A 3TNMB 4D9QD 3QEHB 3OKMA 1CGTA 3N85H 3O2VL 1TITA 4FFVD 1TTGA 1OTUC 3UTPD 2I5YL 2GHWB 2OX5A 2D0GA 4KVCL 5D6CB 1V3LA 4BM7A 4GLRI 4LCUA 4OGXH 1ZA3B 2BSTB 1VFBB 1KCVL 1QSVA 3V4UL 3PGDA 2W91A 3GO1H 1AXIB 4Y16A 4ETQB 1BD2A 3MV8A 4RGND 2HLFD 3U46B 4JANA 4PLKC 3BD4A 2ZUWA 3SBWC 4KI5E 4O9HL 3ZYZA 5IMOB 1T89C 5KSBE 4JQIH 3BKYH 3O2VH 4J3WA 2X4NB 5JO5A 5ICYB 2OQJB 4M7ZB 1T66C 2BNUB 4KVCH 3PGCB 4YFLI 3RL1A 4XVTL 1U6AL 2C1PA 3VD7A 5C1MB 1BFOB 1CL7I 3CDFA 1KCVH 3AU1A 3V4UH 2G60L 2WQRA 3ZE1E 5FO9A 2R29L 4PJ5E 3MV7B 5DVNA 4UB0L 1ADQA 4CBPA 5HYJE 4J23A 4PJCE 1CFNA 3BHBA 2VXSH 3FB5A 5BVPL 1L4IA 1G0DA 5SWSD 3I02A 3U0WL 4LCUB 1RJCA 5HDQL 4XVTH 4WDIA 1KTRL 3DV6A 2CLRA 4M43H 1BD2B 4JFYB 3MV8B 3BRGC 4M7KL 2YPVH 2G60H 5TH2A 4JANB 2XQBH 35C8H 2NYYC 1HINL 3EYOA 4JLRA 4UB0H 3T0XA 4XB7A 4X6CA 2B0SH 1X9QA 1UCTA 4KUCF 4PYGA 5JO5B 2XQYG 3C8DA 1PLGL 3QUYA 4TTDD 4F15C 2HRLA 5E6IA 3RL1B 5TDNB 4JFEA 2Y5TB 1DVFC 4PPTA 5HDQH 4NZUL 1I9RH 2OZ4H 4OFVA 5C2UB 3G6JA 1PD6A 2P8LA 4RFEB 3QXAA 1GJIA 3AU1B 2BVQA 2K9UA 1DLFL 5FO9B 3ULUL 3DUUA 4CVWA 3T8XA 5A3IC 3IFLL 1GCFA 4M7KH 1EJ6A 4J1UA 2GYSA 1Q9LA 3RDTD 5D70L 3T77A 1HINH 5CGTA 2R23B 3BHBB 4AJ0A 1J87A 2N1KA 4EI6A 3I02B 1KGCD 1M7XA 1MCDA 1MJ7H 5C0JA 2WINA 3WMSA 5HHOD 32C2A 4WDIB 4HMEA 1H5BA 2EE2A 3DV6B 2CLRB 3MFFB 2OP4L 5TH2B 1J88A 2CK2A 1DLFH 1BD2E 2D2OA 1U3HC 3I6GA 4YBLC 4WTZG 4NC2B 3EYOB 4DQOL 5I6XB 4KPHL 3WBDA 5CFHA 1XIWD 3QHTC 1WBYA 4PJBF 5F88B 4HWEH 4X6CB 3CXDL 5C92A 4JRWA 1T1YA 1EAJA 2VZUA 1NCBH 3IJYB 1JTTA 3TZVC 4O02H 1AQKH 1ES0B 4JFEB 1Z9MA 4LNVA 1RULL 3O2WL 3ZSTA 3L3DA 2P8LB 5C08D 3VDBA 4Z7QF 2BVQB 2HVKA 2IBBA 1HYSC 3SDAB 3W9DA 4KZDH 1G7LA 3UJIH 4JAMB 1ZGLM 5FYKD 3BKJH 2EDBA 4MXQC 4J1UB 5DRZA 4DQOH 4LMQI 4DN3L 4KPHH 4AQOA 1GGIL 2NPLX 2PYEA 3IFOA 4HBCL 5ESAB 5I19L 1Q72L 4Y2DA 1C5CL 1IGFL 1Q0XL 4UDTA 3ZTJG 4I13B 5C0JB 1NFDA 2WINB 5JIKA 2EKSA 5DJ6A 4QY8A 3RKPA 2YMXH 2DQJL 1H5BB 5K59F 3BT2H 4FP8L 4DKEL 1SJHA 1VHPA 3V6FA 1S5IH 3IS1X 4XNQA 3I6GB 3NIGE 2EO9A 1WBYB 5GRZA 2X4RA 2AJ3A 4DN3H 4OGYH 4KKBD 3TT1L 1FN4A 3S9DB 3WLWC 4X6CE 5I19H 1Q72H 3JV0A 3NCJH 1C5CH 1IGFH 1Q0XH 3AM8C 3L3DB 3GB7A 1QLFA 1AGFA 4JFEE 2HVKB 2N56A 1FBIL 1MFDH 4N5ED 3W9DB 1G7LB 3G6JE 4DKEH 2HAZA 4JFFB 1BWMA 4LU5H 4KAQL 4RGMC 3LN4A 4PD4K 1INQA 2FJGA 5FHBL 2FBJL 3DVFA 3WFBL 2PYEB 3IFOB 2NW2B 1M71A 4X4XA 4Y2DB 2EDHA 1YZZA 4KZEH 4UDTB 5F7FA 3TT1H 1NFDB 1RU9L 2EKSB 5DJ6B 3QPXL 4QY8B 1Y6KR 4G8GA 1PZUB 3DI2B 3F62A 1SJHB 3OAUL 3V6FB 4LVEA 1FBIH 4XNQB 1CIDA 1M1SA 3HI5L 4YHPA 3BRDA 3GJFA 2GKIA 4KAQH 1JGDA 1KTKE 2WIMA 2WK2A 2X4RB 5HGBB 4AENB 2HTLC 4JDTL 5E99H 4OLYL 1AR1C 2FBJH 5FHBH 3ZKMC 1T1XA 2W07A 3O4LA 1FN4B 2Q7NA 1GZQA 2W92A 4Y4FA 4LKCB 2R0WL 5T3XL 1D9KC 2FGWL 2FECL 3GB7B 1AGFB 3QPXH 4W70A 4IMKA 3N9GL 3MLXL 2VSDA 3LN4B 4XCYA 3HI5H 1INQB 1FGNL 2ZUQC 1MCPH 5EU6A 1UCBL 1M71B 1X44A 4ZAKD 2HKHL 4OLYH 3WDJA 5CIPH 5DD1L 1C5DA 2PYEE 2HTKC 3SJVE 1P7QD 3SKJL 2P5WA 3D2UD 5C0AA 4G8GB 2R0WH 5T3XH 1WWCA 5A40E 1NFDE 1QR4A 4PP1D 3ZT6A 5C0BB 4X9BA 2IALA 4AIZA 3BZDA 4YHPB 4EBQH 3GJFB 4RGOH 1NC2A 3MLXH 1JGDB 3P9WB 1J1OL 4J2XA 3RZCB 3WXWH 1TNNA 1HHGA 4HF5L 3VD9A 1GZQB 4Y4FB 1H9VA 1UCBH 4AIOA 1MCRA 2DLEA 1NPUA 2HKHH 5DD1H 3T09A 4QXGL 2W0LA 1GL4B 1OAUH 3O8XC 1NUDA 2Q8BL 5IQ7L 4KTEH 3EYUH 4XCYB 4K3DH 4L8SA 3H3BC 5EU6B 1LO5B 3MNVA 4NQEA 3MCG1 1I1AD 1N6QH 1T80A 4D9LL 3IXTA 1UH3A 4HF5H 3LRSA 4PJHF 2P5WB 4NCDA 5C0AB 4WW2C 3ARSA 1QSFA 3WJLA 3BEVA 5E2UL 3W2DL 4QXGH 1KJVA 2CD0A 4MCZA 1CLZL 3LQMA 4AIZB 5JQHC 1FHGA 4HSQA 5IQ7H 1NC2B 4TNWF 4NPYA 4WJ5A 3ZKSD 5C0CA 1FCCA 1MEXL 2HH0L 2ZG3A 2VQ1A 5E94A 1KLGA 1YMMB 1HHGB 4YHNB 4LNRB 3QNYA 5F9AC 1JNHA 2D7TL 2XA3A 2YPLA 4XP6L 4RMVA 4ZUUA 3O4LE 4HUNB 4D9LH 2DIBA 1NFIA 4M3JA 1FRGL 4M93C 1EH9A 1A9EB 4QWWC 2DYPD 4CMMA 1ZSDB 2LU4A 3ARGD 4QGTA 4OFKA 4Y19D 2BVYA 3MRRB 5F3BA 4QHNA 1KYOJ 3WS6C 3W2DH 4XC3H 2AABL 1CLZH 5HVWA 4P5MA 1MHPL 4L8SB 5CSZB 2FEDD 4K71C 4DEPB 1KN2H 3MNVB 2VDRH 1MEXH 5EU6E 5HPMA 3HE7C 2EDXA 5JIHA 2E7LA 3LRSB 4U33A 1Z3GL 3PXHA 3MUHL 3BUTA 1QYGH 4WWKC 4XP6H 3KG5A 1U95A 5DEFA 1QSFB 4MD4A 1FRGH 1CGSH 3BEVB 1NGQL 5C0AE 1U0QA 4AYFA 4MCZB 1EFQA 3BYYA 5JW4N 2CR6A 1JN6B 4QOKA 3VWJD 1FZKA 1EMTL 2EC9U 4ZS7L 2P4AB 5DUPH 5KVGH 2BFVL 4WJ5B 5C0CB 4HK0A 3MLVL 2VQ1B 1G6VK 5DLML 3VXUD 1JTPA 3S37H 3WNMA 3NCYP 4ZUUB 4PYHA 1NFIB 1Z3GH 5HDBE 4NNXA 4QO1A 4CMMB 2HP4A 1V3KA 1F90L 4LRNL 2HJKA 2XKNA 3REWB 5BXFB 3C09B 4IRSA 5IV2B 4PLNC 4ZO6A 1NSNL 3VFGH 4YXHH 4UOJA 5FGCB 5JUEH 4LQFH 5DYOA 4PGBB 3VJ6A 1EMTH 2W0FA 4MA8L 1IGCL 3HKFA 1YNTB 4ZS7H 2BFVH 2FJFB 3KYOA 1DBAH 2DQIH 3MLVH 4TPRL 5IJKA 5HHQA 1U8IA 5HJ3A 4DCQB 4XPGH 4NQEE 5D8JL 5EO0B 5DJCA 3DSFL 1HQ4A 3WKNA 4MD4B 1UEMA 1UWXK 1DEDA 3PL6A 1RZ7L 4BH8B 5IVNA 4OF5A 5I76A 2GUOB 2IQAA 5D93B 4QOKB 2E9JA 1NSNH 3MTRA 4POZC 3VXTA 5I8KH 4YHIB 4QHLA 3O6FA 4HK0B 1B0GA 3JV4A 3VRJA 5DMJB 1LO2L 5C0CE 4JKLA 3RWFA 4TPRH 4PJ8C 1OM3H 2YA0A 1P4BH 4NNXB 2YPLE 5HYQA 1FIGL 3LV3A 3DSFH 2XKNB 4X80H 4IRSB 1AHWA 2F19H 4DAGL 1RZ7H 4M00A 5CEZL 4LSTL 2Z0BA 4LLYA 3VJ6B 3VD4A 3LDBB 1NCNA 3WSQL 1OD9A 3KYOB 4MMZC 4HCRA 1QUNA 5IMKA 1KEMH 4Z7VA 4M5ZL 5DS8A 5HHQB 5HJ3B 3GBLA 1WT5C 5DC9B 2ENYA 5DJCB 4FQPA 2LAGB 3WFHB 1HQ4B 3CFJB 3P30L 5SX5H 3PL6B 5LBSL 2X89D 1FC2D 5I76B 4PLOB 4KC3B 3T08A 2G5RA 3A6OA 2WAHA 3D3VA 5ESQA 4DAGH 5CEZH 2XQYK 1JZ5A 4WTWA 4QOKE 5C0FA 4L3AA 2IPKA 3O6FB 3UP1A 1FYTD 1B0GB 3JV4B 3VRJB 3WSQH 3VH8A 4GSDL 3FT4A 4G9FA 1QHPA 3UJTH 3BD3A 5HYQB 3WJJA 5T1LD 1VDGA 4BQ6A 1WLHA 4QRSA 3P30H 1XF5A 1AHWB 4JO3H 4XCCL 2A2QT 5LBSH 4MQ7A 5C08B 4GW1A 1MJJB 4LLYB 2XTJC 1BVZA 4D9RD 1CDYA 1EPFA 1T83C 3NPZB 5D1XC 3A67L 2VDQL 4LLUA 2PTUA 2ZKHL 5D7IF 4J3OC 1PG7L 4GSDH 1MFEL 4ZXBC 1NGWA 5DT1H 1XR9A 4XNZC 5IWLA 5F9OL 4WO4D 2C9AA 1NCTA 4U3CA 4JFQB 5ESQB 5E9DE 3D3VB 5TFSL 2EH7L 1FLRH 5EZJA 1KLUB 3QJHB 3H9HB 3QNZA 2O26U 5C0FB 2IPKB 2BNQD 3A67H 4QGYA 1FFPA 3FT4B 3K8MA 4G9FB 3QEUA 4JY5L 2AXFA 1S5HB 4HJ0D 4NM4H 1ND0A 3PWNA 4JE4B 4KGJA 1N5YL 1PG7H 5C09A 4N0FA 5GGTA 4E41A 2FL5A 4QRSB 1XF5B 2HLAB 1K3IA 4HHAB 5DJYA 3VGAC 4GW1B 1LWRA 3ALWA 5T3ZD 2DAVA 4MJ4A 3N0PB 4K8RC 4O5LH 1R3KA 2FIKA 2EH7H 3WE6B 4WFHD 4L4TE 1PFCA 3VG0L 1X5GA 4LLUB 2WP3O 3ZLQC 5BZWA 1RIUH 4OD2A 4Z7VE 4YXKH 3QIUC 1NGWB 3GSXA 4P3DA 4JY5H 3VG9B 5GZNC 2IFFL 4TVPE 4YE4H 5GGRA 1XR9B 1D5MA 1XF3A 2VWEC 3SDDC 3ZDZF 2ERJC 1F00I 2P47B 1RY7B 1II4E 3T0EC 3VXSD 5EZJB 4OZFG 3QNZB 2EE9A 4CGTA 4Y5VB 3D3VE 3TYFB 3E2HB 1SJXA 2JIXA 4AEFA 2C3VA 3P4MB 3QEUB 1DJSA 2DN7A 3WKML 3TF7C 4Q9CA 5HYJD 5E03A 4S0TD 4PRAA 1FIEA 3LB6C 5C09B 1CDUA 2YWYA 4GUPB 4N0FB 1R0AL 1PW3A 3NTCL 2IFFH 2FL5B 5C86A 1MHEB 4R4FH 2GJJA 3E6HA 4PJ9C 4WI4A 3D39D 3MJ9L 5DJYB 1I9IL 1ZGLB 4O00A 3IKCA 4WW1B 3VI4E 1R3KB 3TESA 1A7NH 1IL1B 1QNZH 2V2XA 5D71L 3BGFB 2X4OA 3FRUA 1CLYL 2DI8A 3CVHL 5BZWB 1RSFA 4Q9QL 3KR3L 4YHKL 3GSXB 3WKMH 3V7MA 1G9EA 5GGRB 5LVEA 1XF3B 1R0AH 1JGEA 1MIEH 2MPAL 4WU7A 2WM0A 4HIJB 4FQXA 1ORSA 3QDGE 2VZ1A 1CDGA 4P3CL 1JPSH 3R06B 3HN3A 1TPXB 5DQJA 1IZKA 2GT9A 4E0RA 5HVHB 1I9IH 4L5FL 2VAJA 1BGXH 1QP1A 3LEYH 4OBSA 5GS1A 2MCPL 1F8TL 4G6AD 3N06B 1ACZA 3QO0A 5B4MD 3CVHH 5MEOA 5EWIH 1MY7A 3P9LA 4PRAB 4CVXA 4GRLA 3SDCA 2ZG2A 3L5IA 2YKLL 3E6HB 4X99A 5C09E 5KVFH 5IG7A 4FQIL 2MPAH 4E41E 5KJRL 4KQ3L 4WI9A 3S96A 4DFIA 2XZZA 2V2XB 4OZHA 4WUUA 4YWGL 5IW6B 5CWSA 3RKDC 2X4OB 5HYSG 2MCPH 1F8TH 2R9HD 3LMJL 3QP3A 4I4WA 2JB6A 2NY0D 1ULVA 3HE6A 4OTXH 2BOBA 3DUHA 1VEOA 1JGEB 1AE6L 2RQ8A 1MVFA 4TNWK 5ANMA 4FQXB 4GG6F 2YKLH 3QIBD 4EN3C 5DQJB 2GT9B 4LLQA 4UIMB 3P73A 2DL2A 4KQ3H 1G7PA 5GS1B 2H2PC 3BIBX 4YWGH 4JZNA 1CDJA 3BDYL 5MEOB 1X5KA 1JZ4A 4NN6B 3HAEH 4KROD 4XPHL 4CVXB 4GRLB 2IANA 3SDCB 3SPVB 2R1XA 4X7SL 4J12A 1K85A 4ODSL 3CLFL 4MDIA 4YZFE 2DYPB 4MGXA 3S36X 3ARGB 3S96B 2HFTA 3BJ91 5ISZD 1TXKA 3O2DA 4WUUB 2OL3B 3Q48A 1UENA 2PETA 1T4KB 4OD1H 5KTEL 1S7XA 1X5ZA 2Q76A 1L0YA 4I4WB 5JZ7D 1WZLA 2FO1A 1IRAY 4YFLF 1I85A 1QFHA 2ARJQ 3HE6B 2BOBB 5DD3L 3A6CL 3BMWA 4HAGA 1A4KA 4XPHH 5ADOL 3H8NA 4GT7A 4XWOD 3T0WA 4LSRL 5ANMB 1K8IA 1YEKL 4XX1E 3AROA 3QUYD 4JO4H 3X3FL 3NFNA 4LLQB 4MJIA 3P73B 3TA3D 2FDBP 5GRVL 1X6NA 2Q7YB 1OL0A 2GQHA 4K8RL 3LY6A 4Z7NE 4JZNB 4DZ8A 4LFHD 2C3XA 4Z0XA 3BO8A 3S3SA 4TSAH 3WIHL 1MCWW 3BPOB 3A6CH 3U30B 4MDIB 1YC7A 1RZIA 3VGGA 4WNQA 4UDUA 4LSRH 4K3EH 1YEKH 4V2CB 2DIAA 4XCEB 4YC2C 4PY8I 5BVJA 5CAYB 3BRFA 1RVFH 1BZ9A 2V5RA 1V7MH 4OZHE 4WUUE 1INEL 1S7XB 2Q76B 3QWQB 4BQ9A 4UTAL 1TIUA 4NSKA 3ZE0E 4PGEA 1MQ8A 1CF8L 3RVWC 3NACL 3GBNL 3FL7A 2ZCKL 3MJGX 5EDXA 4YR6A 4PJXA 1CVSC 3WIHH 2VXUH 1CK0H 1K8IB 4GRWF 2IF7A 3ELAT 4AL8H 1I1FB 5SWQA 2IG2L 3NFNB 4MNGB 1UT9A 3OX8A 5ANME 1JRHI 4BSWA 3MR9A 1RIHH 4PLJC 2B4CC 1X3DA 3GHEL 4QCIB 1ZT7A 4PTUA 4JM2C 2EDKA 1RQ5A 4XMLL 1XMWA 1I7ZA 1FCGA 2I24N 1BQSA 1MFCH 4IBLT 1OTTC 4X7CC 4DZ8B 3MLZL 1U42A 4KWUA 1INEH 1T1ZA 4Z0XB 3BO8B 3MRLA 3DV4A 1ACYL 3QRFM 5EH1A 5HYSB 5BJTB 3QI9C 5AAWA 2CJUL 4WHTA 2IANE 4FQJH 4LF3A 4TOYH 3SJVD 3EOAA 3B2UD 2AP2A 3L7FA 5JPNA 3D48R 3EKCA 1HHIA 5BVJB 2DQHL 1KJ2H 3QXUA 1BZ9B 1XGYH 3GHEH 3HLAA 3IDXL 1C08A 1TMCB 4HC1H 1T7ZA 4XMLH 2WQ8A 2BC4B 3PP3K 2ADIB 4NSKB 1DCLA 4PGEB 3MLZH 1DR9A 4Z5RA 4DGIL 1E28A 4YR6B 4PJXB 1U41A 4L3ED 1ACYH 1DQTA 3HI1B 3ZL4L 2GAZA 5GGSY 5SWQB 3TCXA 3TCLA 1IGIH 4BSWB 2CDFA 2QKIA 3MR9B 1PGRB 4XP9H 4JO1H 5DO2D 3SQOL 1WZ1H 4MJIE 4PTUB 3V5HA 3TBSA 3DX6A 1J86A 1AKJA 2DQHH 1I7ZB 5CS7A 5E8NB 5IK3A 3IDIA 1QBLH 5A2FA 5AUMB 5KSBF 3IF1A 1JWMA 3ULVC 1T1ZB 3O9WA 3OGOE 3MRLB 3DV4B 1T3FA 2D7NA 1OT2A 4F9PC 1IFHL 5DJXA 4CMHB 3E0GA 5E2VH 2D9QB 4DGIH 4LF3B 3L7FB 5JPNB 3QUMB 4M6ML 3C5ZC 3ZE1F 3ULUD 1HHIB 4X5XA 5I1JL 4WV1A 3RVVC 4I0PC 2IWGA 5F72S 3QIWD 4KXZI 3FQUB 4D94A 4M8VA 2R8SL 4PJCF 1CXEA 2CUIA 5ACLA 4IOFD 1IGTB 4PBVC 4Z5RB 4QTHA 1X5AA 1E28B 4JB9H 4H8WC 4G42A 5I30L 4FA8A 1IFHH 2A1WL 3OL2A 2BNRA 2GAZB 5DMYA 3ARRA 4PJXE 3ES6A 4K2UL 2Y6SD 3TCLB 3TT3H 5MERA 2CDFB 3D5OF 2QKIB 2J3SA 4P4KB 3MO1A 3V5HB 5LXGL 1QLRA 2M26A 4B0MM 1AKJB 2NY2C 4GW4A 4JRXA 5IK3B 2O5YL 3IDIB 3QCVH 2DLTA 3QR2A 1MFNA 2R8SH 2BNQB 5HHPA 1T3FB 5E95B 3MYZA 3T3PF 5DJXB 1P9MA 4L9LB 2WV3A 1FFRA 2F53D 1UZ8A 3NPSB 2XA8L 1KNOB 4WUKH 4ZUSA 3PQYA 3TN0C 2VUYA 3F58H 2XZAH 4PJEA 1QKZL 4FQCL 4WV1B 4G8IB 3DIFB 1VADA 1CXFA 3IFPA 3DX7A 4K7PX 1D5ZA 1Q0YH 2O5YH 4JN2A 3CX2A 1MCBA 4QTHB 2JJSA 4OIAA 4G42B 2Y36H 1UXSA 1EEQA 1MRCH 3ES6B 3S98A 2GK0A 5MERB 1FFQA 5JW3L 3S3PA 4W4NA 5JDJA 3UZEA 4ACPA 1QKZH 3VXSB 5IIEA 4Y4KC 5C9KA 3ZKXC 2DM2A 3FQWA 4G6JH 2H3NB 4GO6B 3UPAA 5JXEA 2YK1H 8CGTA 1OTUD 2IQ9L 5HHPB 1XF2A 2AQ2A 3MLTA 5E5RB 2WUCL 5SX4H 3C6LC 1S9XB 2R69L 4U05A 4PJAF 5IESL 4YPGA 3RJDA 4NQED 2UUDH 1O0VA 2ICWI 5IOPA 3KGRA 4JFDA 1FSKC 2P24A 3FT2A 4ZUSB 3PQYB 5CJXA 3D39B 3QPQD 3R8QA 2B4CL 3DX7B 3CU7A 3DURA 1D5ZB 2ZWLT 4LFHG 4QHKI 1FVCB 3QEQD 3EDFA 3VDCA 4X8JB 1NANI 3OMZA 1VPOH 5JLZA 2EZ0C 1A7QL 1ONQA 1NCCL 2IQ9H 2FJHA 4QKXB 4JHBA 4LSSL 2WUCH 1CQKA 2LABA 3RNQA 2R69H 5IESH 4M03A 4U1NB 5HVGB 1G7MA 4N8VG 2BNRE 1JHKL 4U6TA 4R9HA 3FZUC 1DBJL 4Q74A 4ZPVA 5JA9A 2LVCA 2XI9A 3NIGF 3WHE1 2G2RA 3FQWB 3QAZC 2Z93A 3MSPA 2B4CH 4HUXB 2YRLA 4JRXE 3T0DA 3KPNA 5GHWH 1HHKA 5KZCD 1XF2B 3MLTB 4X6CF 5EOCJ 1EXUB 3V95A 1A7QH 1NCCH 2HT2C 4YPGB 3SN6N 3AREA 4JFDB 5J13C 4N68A 2FRGP 2P24B 1IC1A 3FT2B 1KFAL 1CTNA 3LVEA 3G6JF 4JQXC 1C1EL 4NQTA 5LG1A 3WDHA 3PQYE 4FZEH 2XFXA 1DBJH 4PJEE 3VFWA 2NYYD 2PKDA 2E6QA 3CX5K 4J3XA 2APVA 1FNAA 3NCBB 1U8QA 4OD3L 4OCXH 5JLZB 3ULVL 2EXYC 3IGAA 1GPOH 5CEYA 43C9A 1MSPA 2YZ1A 2VIRB 1DVFD 4AH2A 1BVKA 1G7MB 4LIQE 4DUXA 4ZPVB 4Z7OE 1KFAH 3ABZA 4RMSA 3VFPA 1YDPA 5A3ID 5IJVA 3JZ7A 2D9CA 5A2IH 2Z93B 4HAFA 2AXGB 2EKJA 1JWUA 3SE9L 1PQZA 5E4EC 3HI6H 4HGWA 4Z95H 4OD3H 2OK0L 1JHLL 3ARFA 1NBZB 2IMNA 2P48B 3PNWA 3ULVH 5K9KA 4UV7L 3AREB 4H8WL 5K9QI 2ADJA 4J4PD 2FHBA 2BVTA 4GKZB 1MCWM 2P5EA 3R8BB 3J7HA 4QT5A 1KCSL 4U49A 1H8OA 4ETYA 5H37G 3VFWB 2IAMA 4KMQA 4KKCD 5E9DD 1CLOL 4P99A 1AGCB 1GIGL 5HI3C 5ISZB 3KPQB 1KXQE 5C3TA 1U8QB 2EE3A 1U92B 4L8CB 4IRZL 3SE9H 3RUGA 3QFJA 3IGAB 4G5ZL 4XAWL 5CEYB 1AI1L 1INDL 1JHLH 1P5VA 1BVKB 1IAOA 4H8WH 5E08L 4QXUL 3NCMA 3QUZC 3FN0L 4MSWB 1BFTA 2BMKA 3VXRD 3VFPB 1S78C 1YDPB 5IJVB 1KCSH 1KLFA 4XWGH 3CU1A 1CDIA 1MCSA 5KS9F 1JWUB 1GIGH 2Z9TA 4LSQH 4XNXH 4U1SA 4L4TD 2CMRH 5JR1L 3ARFB 1I75A 4FXGB 4GW5A 5DD0L 2J8HA 2OJZL 3PNWB 5K9KB 5DVKA 4G5ZH 4XAWH 4M6AA 4UT6H 4OCRH 4Z7WA 3WUWG 4QT5B 4LCYA 4OLEA 3OWEA 2HFEA 3HNSL 5E08H 3S5LA 2P8MA 4QXUH 4FQ2H 3FN0H 5KSAB 2IAMB 1VSCA 2D7PA 4EIGB 4HJGA 1QFPA 3BP7A 1R5WA 3EDDA 5I1HL 1ZLWK 3RUGB 4IRJA 4NQSA 3QFJB 1DP0A 3WLWD 1FJ1B 1J12A 5JR1H 2NZIA 3D6GA 5L6YH 3ULUF 1YY8B 3BZFA 2OZ4A 1D5XA 4ODUA 2BVOB 5AG8A 5J6HB 2MQCA 3HNTH 3ARDC 1RK0B 4O2CB 4XGZA 2V7NA 4LLMA 1GOGA 3M45A 1AGBA 1ZWIA 2EC9T 5KVEL 4U3XA 3MYJA 4U1SB 3OQ3B 1Q9OA 1JNNH 5D7JA 1XEDA 2HT4D 1KJMA 2G9HA 5DJZA 1I8LA 5F9JA 5AYUL 4GS7C 4Z7WB 5FV1L 4EI5D 1Q1JL 2HFEB 4YHLH 3S5LB 2P8MB 2P5EE 3QDGD 4R8WH 3H7BB 3VXME 4BK4A 3QXVA 3MRMA 2AJYL 2VISA 1ROWA 5D7KD 1LK3H 2AW2A 4HJGB 4Z78A 1R5WB 2I25N 2HTLD 3KJ6H 2YD8A 5KVEH 1AR1D 3LPFA 4IRJB 4NQSB 1KB9J 3KPSE 2X44D 3RUGE 2BJML 1N4XL 3KXFE 1D9KD 1EJOL 1TJGL 2FEEI 3BZFB 1D5XB 4OLXH 3B3IA 1BQUA 3V6ZA 3DUSA 2Z35A 2XZQH 4XGZB 2V7NB 4LLMB 2YRZA 4ELMB 5D7LE 1B3JA 1B88A 1ZWIB 2AJYH 4CRPA 2DBLL 3CLEL 2J5LC 3UBXA 4ERSL 4KY1H 4X6EA 3IFNL 2R4RL 1YYMH 4KJYB 1MWAL 1IBGL 5D7JB 1IAMA 1TQBC 3BQUC 2G9HB 5DJZB 2MQ3A 3K4AA 3MXWL 4HS6A 3FJTA 1N4XH 1N0LA 4LVOC 4FABL 1QFWL 1TJGH 4O2EA 2GTZA 3FO2A 3ILPA 1F13A 4JREC 4GXUN 4H1LG 4X4MA 2XKSA 4NZTH 2VO5A 3L1OL 1I9JH 5C07A 3ECBA 4Z78B 5DGRA 5FYLH 1HWHB 1TZGL 4Z76A 3UAJD 3CLEH 1OP3H 1BAFL 1EEUA 2CSPA 4C4KT 4ERSH 3H9YA 3IFNH 5AG9A 2JIXD 2R4RH 4HLJA 4JG1L 3HS0B 3LHPL 3B3IB 1K5NA 3DUSB 2Z35B 5FOJA 2BCKA 1OPGL 1TZHA 4RQQA 2VQTA 5DURB 3UBXB 3WN5B 3I75A 3W82A 2H2SD 3HZYA 1BAFH 4YHOH 4HS6B 2VLJA 4JG1H 4AEEA 3SGKC 2GTZB 1RZFL 3FO2B 3ILPB 2YD6A 1AGEB 1S7TA 2HT3D 1WBZA 2EYSA 3D18A 3H7LA 3RVTD 3CDCA 4LP4A 1F3DJ 3S36L 1IAIL 3MACH 4PREA 1LDPL 2VXTL 1K8DA 4HEME 1WCQA 1T89A 4P23C 4JZJA 2HRPL 4NFBA 1K5NB 2DQDL 2E8ZA 4OF7A 5D72H 1RZFH 2E9WA 3GSVB 3DHJA 4X7EC 3G5XA 3MV9D 4XPFL 3QCTL 1TZHB 1AFVL 2ZUSA 4RQQB 4HUUA 5J1TC 1P7HL 1OAQL 3MZGB 3I75B 3F12A 3QCUH 3S36H 3V8CA 1X7QA 1H8SA 1YY9C 2VXTH 4WI6A 3HE7D 5CIPA 4GQ9L 1IGML 2VLJB 5DJAA 3GBML 3Q6FA 2W0PA 1Q38A 3SHSA 1YMHA 1JF6A 4PUBL 1S7TB 2DQDH 4L4VD 4MJ2A 3D18B 1F2XK 1T7WA 4X4ME 3RHWF 4XPFH 1AFVH 1VGEH 2G75A 5GJTL 4PREB 3PWLA 5C07E 5T1KA 2YXMA 1K8DB 1OAQH 1RURL 2VLME 4PFEA 4U7KA 4P4RA 2NY7L 3WIFA 1WV7T 4NDMA 4GQ9H 1IGMH 5FYJU 4D0DA 1J10A 3WFCL 3UX9B 1JI2A 1HEZA 1M7IA 4JG0L 3G5XB 5IHUL 4AT6A 5HGDA 3KYNA 4FS0A 4MAYA 1IMHC 3EIFA 4ALAL 4C56A 4BELD 3FFCD 3INUL 3Q3GA 2CIKA 5CIPB 4AEHH 3WXVL 1BBDL 1RURH 2ARJA 2CO6B 2NY7H 3Q6FB 5DJAB 2AGJL 2PR4L 1RZGA 1YMHB 4ZS6C 2VLJE 4CKVX 2CRYA 2W60A 3P0VH 4OT1L 1WK0A 2CKBL 1MCOL 1DL7L 4POZD 3KDMB 5I66B 1OAYH 1EK3A 3PWLB 5T1KB 2FSEA 4BYHA 1U3HA 3DETD 4Z7VF 4ALAH 2VDNH 1YEHH 2BOCA 3W5NA 2QL1A 3TWCL 4MZ3A 1U91B 2C26A 5FKPA 4PJ8D 1CE6A 3C5JA 4FQ1L 4P4RB 3WXVH 4NDMB 3MV01 4FNLH 4K3HA 3CH8A 3VFNA 4F15B 2NZ9C 1FL6A 3IAPA 4D0DB 4F9LC 3TZVA 5DHYA 4WI3A 5F7NC 3JVGA 3CZFA 1DVFB 2AGJH 3AY4A 4LEXL 1M7IB 1Z2KA 4AT6B 5HGDB 3KYNB 2CKBH 2VXVH 3TYGH 2C1OA 2ILLA 2HFFA 3H42L 4YEFA 4C56B 4J3TA 4BSJA 3S88L 3Q3GB 2CIKB 2VDKL 4QRUB 1WFUA 4O2FA 1T7XA 2CPCA 4I3SL 4S0SD 3DX9A 4FQ1H 4I2XA 5DMKA 4YDJA 3I9GL 1WFTA 1RZGB 4R7NA 3VE0B 5T3XE 5L2KB 3L3OA 3UTQA 5FA4A 4HDIA 4DUVA 2I60L 5KN5A 4LVNC 4LLWA 1KJ3L 1X5XA 4WFEE 2ZPKH 4U1GC 4AG4L 3VFTA 1JZ3A 1BMGA 2FSEB 4YBLB 2X1XR 1U3HB 5IB3B 3BPCB 5F71A 4KKAD 4BUHA 3C5JB 3S88H 1BZ7B 4A6YH 4BSVA 5D6DC 3VFNB 2P46B 4I3SH 3TZVB 5E6YA 5I2IA 1U93A 5F6IC 5DHYB 3I85A 3I9GH 2QADD 2F74A 3CZFB 3AM8A 5J4MA 4OZIA 2D31A 1V7NL 3BP4A 2KKQA 2HFFB 1KJ3H 1PX3A 2DKSA 3FQXA 1JHTA 3B4NA 1KT2A 4KK6D 5LJYH 1RIVH 4C56E 4OF0A 1P69B 5BRZD 1IM9A 4O2FB 4U4BA 2ESVA 1YEEH 4I2XB 5DMKB 4YDJB 2R0KH 3O3DB 3B9KD 4NIKB 4R7NB 5JHLH 3I6KA 1LP9A 3L3OB 3UTQB 1Z0MA 4XTRC 4HDIB 5FA4B 1CVRA 5KN5B 4MB4A 4QHMB 4QRRA 3TO4C 2F15A 4H0IA 1V7NH 3VCLA 3CXHK 3BYTA 2WBKA 4LPCA 1EEYA 1UB5B 3L5JA 1G9NH 4BSVB 4NFCA 4K7PL 1JF1A 4OCYL 4HWNA 5I2IB 3O9WD 4APQA 2F74B 2ZCLH 3QDMA 2D31B 4MA1C 1HZHH 4URTB 4DW2L 4YUEL 3KNBA 4MXWL 3BP4B 2AK4D 3EYSL 4RGNC 2HLFC 4PB9L 3WHXB 1JHTB 1KT2B 1J05A 1J1XL 4RGMB 3EZJB 4HG4K 3U9PL 3P4LA 2ESVB 2EDRA 2FX8L 4QRTA 3PWPA 1NMCC 4JQVC 3PDOA 4P9ML 4Y8AA 4YZFF 3UC0H 4OCYH 4I2XE 2YRPA 5FB8A 3K80A 1BQHG 4S1SL 2A38A 1JPST 2EC8A 4LSVH 2BNRD 4QRRB 2OMBA 4YUEH 3DPBA 3CVIL 5F89A 3THMH 1L9MA 2NY6D 3EYSH 1I4FA 3QXTA 4IHOB 1J1XH 3X3GL 1MY5A 1XGTA 4UNUA 4LSUH 3W39A 1GC1L 1MQKL 3LS5L 3LEXA 1JF1B 5IVXA 2FX8H 3SE3C 4JRYA 1NL0L 3V6OC 3NOIA 1D9KB 3NFSH 4P9MH 1XCQB 4P48A 3OHXB 4HKZA 3KPRA 3QG6A 1TVDA 2R0LH 3KNBB 2BXYA 3O8XA 3QA3A 4S1SH 4OZIE 4Z7NF 2KUTA 2OM5A 1TETL 3WO4C 2AJUH 4Y89A 3D85A 2J4WL 2ZUQB 3SOBH 1TJHH 2Q8AL 2BVUA 3PWPB 3BAEL 4OV5B 1QFWI 3PDOB 2ESVE 4JPVL 1KEGL 3EO9L 3LS5H 4M61A 1MREL 5FB8B 1NL0H 3NN8A 2B1HH 3NVQA 5I1CH 2C5DC 1LP9E 5DI8B 5FO8A 4OZHF 5F89B 2VDMH 3S35X 4QRRE 1I4FB 5FUCC 3RDTC 4Y7MA 1MCIA 3EO1A 3F7YA 1XGTB 4F80A 3W39B 1IEHA 1K9TA 4WFGE 3LEXB 5IVXB 4XZUA 4JRYB 2VITA 3PABA 3R1GL 1CT8B 5CJQL 2APBA 3KPRB 3QG6B 3RJQB 4BH7B 1OP5K 3O8XB 2UY7A 3U36B 3QDME 2DL9A 3WS6A 1ZGLP 4WHYG 1JGLL 1NFKA 3D85B 5TF1H 1XIWC 5CP3H 2DJSA 4XHJD 3IYLW 3LRGA 1YEFH 3PWPE 4M61B 3RX5A 2NR6D 2F54A 4WWKA 3OKYA 4WW2B 3UTSD 2XT1B 3R1GH 4P46C 4YIQA 3ETBF 1T22A 5IKCA 5FO8B 4GMSL 5IBUB 3DRQA 5CEZE 3ZTJH 2P7TB 2E7HA 3WHE0 4RAUA 1ZK9A 3NCYS 3EO1B 3F7YB 4TUOB 5I71C 1WWBX 3O3EA 3TIDA 2A73A 1IKFL 1UWGL 3IU3A 4H20H 3WIIL 3JWDH 2VITB 5BOPA 1IC7L 5IVXE 1A2YB 3QDJA 4JRYE 4M93B 1FO0L 3V0WH 4C59B 2FB4L 4M7JH 5B39A 4NZRL 3KPRE 4NC0B 4NNPL 1FPTL 1YQVH 1M05A 4NQCA 4CADB 3MV9B 4GBXA 4GMSH 1BJ8A 5IFAL 4U1KA 1DSFH 2X9YA 4K71B 5L0QC 4NZDA 4NO0D 1XH3A 2EE6A 4KKBC 3HE7B 4S2SA 1IKFH 2PCPA 2VDOH 2F54B 4GG8A 3RHWK 4WWKB 5CZVH 1IC7H 3SGJC 4LHUD 3I2CL 5DK0A 4D8PA 4RX4D 4YIQB 1T22B 1S3KL 1S7RA 1YC8A 3KPTA 4N5EC 2FB4H 3CK0H 3DRQB 1J9CT 2LU7A 4NZRH 1SY6H 4NNPH 2JB5L 2ED8A 1MRFL 5GSRA 2D0HA 4MA7L 4RAUB 2V7HA 3CVHA 1DLHA 3TIDB 5K9QG 3D69A 3IU3B 1LDSA 1QSEA 3QSKB 1H3GA 3OAZK 4ZFOA 1BX2A 3SE8L 3AMKA 1RV6X 3IAGC 4YDIL 5ACMA 3UTZA 3VW3L 5B39B 1H3XA 3I2CH 1M05B 1U3JA 1S3KH 5EIIB 4OLUH 4PTTB 3N1QC 4JM4L 1TLKA 3ARBA 1CICD 4M1GL 3B2VH 4MDJA 3VXMD 2JB5H 2AJVH 4U1KB 1MRFH 3GSRA 4MA7H 3X12A 2CK0L 3FFCB 1XH3B 2CUMA 4S2SB 3VRLF 2PCPB 3KPSD 4U7MA 3TJEH 5DHXB 3MLPA 4GG8B 2H9GA 4EQ3A 3KXFD 1KC5L 5DK0B 4KDWA 4D8PB 1NC4D 5GRUL 5TE6L 4YDIH 2WSKA 4JPWH 5IVZB 2MHAA 3VW3H 2W0KA 1UEYA 2QSVA 4EKXA 2BVEA 2IPUG 3CPLA 5GSRB 3GIZL 3RIAF 3EFDL 3O3BB 4JM4H 3CVHB 5D7LD 1A4JA 4HPOH 4M1GH 2QSQA 5IM7B 2AK1L 2YBRA 3HAEA 3D69B 1JFQL 4NWTL 4RMWA 5IHLB 4ZAKC 3IDNA 4PJ8B 4JVPA 3TBYA 3UTZB 3QDJE 3N1FC 3C60D 4PP1C 3VD3A 1KC5H 5TE6H 3OR6B 3BP6B 1EA9C 5T1MB 1S9YB 4YBQD 3T04D 2BVPA 1NQBA 4F57L 1T83A 4NQCE 3JUZA 3BN3B 5D1XA 1T0MA 3GSRB 4ZUVA 3X12B 2X4UA 6FABH 3GDBA 3OGCA 3AFLA 5DJDA 2AK1H 2ARWA 2EDDA 4KVNL 5DF0A 4NWTH 4ZXBA 4LPXA 1FZMA 2Z31D 1FNSL 2DBJA 3LKRA 4AM0A 1DE4B 2MHAB 2EYRB 3GK8L 3K4ZA 3ARYA 5IT2L 4JFHE 4P59L 4F57H 3JWOL 1A4JB 5HHMB 5IROC 4NWUH 4YDVB 3HAEB 3EFFA 4RMUA 2D03H 1TQCC 3IDNB 5BS0A 4X4YA 2GCYA 3MRIA 1LMKA 4KVNH 2NY4C 2FYYA 2XWJA 1CFVL 1QSEE 3TBYB 4EZMA 1NMBL 3MGOA 2NW3A 3U48A 3BN9D 3TBVB 3ARUA 3QDHA 3C5ZD 1BLNA 1FNSH 1HHJB 2XTJB 1U8OA 1MF2H 5ID0A 5D1XB 3GJEB 1T0MB 4ZUVB 4P59H 4KKLC 3I6LD 2X4UB 3V5DA 1OGAA 4Y4HD 3MNZB 3TVMD 1J1PH 3BJLA 4DK6A 1R5VA 4ZXBB 1NGPH 3WIHA 2L7JA 3QIUA 3QFDA 2CIIA 4XNZB 3EYQD 1BFVL 1ZANL 1NMBH 2R2CA 3OKOA 3SDDA 3X13A 4PJEF 2LVEA 5AAMA 2UY6A 3VD5A 3T0EA 1IT9L 4PRNA 3CC5A 1W0VA 3RTQD 1F4WL 2FEDC 2Y06H 1HSBB 2UVEA 5FYKH 2BY0A 1N5AA 4E42A 2VRAA 3HNVH 5BS0B 3GZKA 2GCYB 3MRIB 4JHWH 5HHVL 5JXAL 1XZ0B 4KJQC 2FYYB 2XWJB 3RU8L 3UYOD 3QG7L 3MGOB 1HE7A 2NW3B 2YUWA 1IAKA 4N1HB 1CU4L 1HHHA 4PJ9A 1JWSA 1ZANH 1L6ZA 1KJ2A 3VGAB 2XG5A 1U8OB 5C0IA 3VWJC 5ID0B 4NKQB 4H26A 4HC1A 4WI8A 5F1SA 4PGJA 1RHFA 2ZP0T 2XY1A 3MX0A 1F4WH 1O7VA 1ITCA 1SEBA 1R5VB 4ODXA 5I8OH 3QIUB 4AEIL 2VLMD 2OTWB 5GSVB 2CIIB 3WS3A 1KTLA 1DBML 5AZEL 4HIIA 1JF5A 5HHVH 4NJAL 5JXAH 3SE4C 3RU8H 3QG7H 3OKNA 5HGHA 1T21A 1LO3H 3SDDB 3S34H 2XOTA 2ERJB 5SV3A 1CU4H 3QWRA 3ZT5A 3T0EB 4YNYA 3RQ3A 3ZZ1A 3CC5B 3O4OC 4H25A 3BSZH 1G7QA 3T2NH 4P2RE 4PJIA 4HS3A 4R4BB 1AH1A 1N5AB 3QT2A 4KK8D 3GHBH 1KIPA 3KPMA 2PXYC 4ZFZB 3C6LD 4LHUG 1KXTB 4KKNA 5BS0E 4AEIH 4PJDB 1GOHA 3V6BR 5EUOF 5AZEH 1HHHB 4NJAH 4PJ9B 1JWSB 4V1DB 4RRPA 5IBLD 4S1QH 1KJ2B 1G9ML 5D96C 2H8PA 5SWZD 4H26B 5HY9A 4ZYKA 4PRIE 1S7QB 1ZMYA 3FOLB 3HG1D 3CAFA 2HMIC 1AY1L 1LE9A 1SEBB 2EZ0D 1OGAE 4ODXB 1X5FA 5A1AA 4YDLC 3WS3B 1KTLB 2L0DA 4HIIB 3MRHA 4KK9D 4BZ1L 2I07A 3V7AE 3OKNB 2VNCA 5FGBC 5HGHB 3HUJB 3WNPA 3TLRA 5IR1A 2OJEB 2VWEE 4PRHD 4GAGH 4YNYB 2E6PA 4EN3A 5ETUA 2IH3A 3W11C 5F70A 1AC0A 4QXWA 3T0EE 4NBXB 4X6DA 1A6TA 1BPVA 4HS3B 3DARA 4ONHA 4U0QB 1IAIM 4NKIL 5JHDA 1KIPB 3KPMB 2Z91B 4KRPD 2DICA 1P84K 4WEBH 4OZ4B 5CZKA 2ZOKB 4EUPG 4NJ9H 4BZ1H 1TFHA 2WBWB 3G9AB 4AY0A 1HXMA 1P4IL 3MGAA 1H15B 4TUJA 4ZYKB 5HY9B 2ZOLA 4ZTPL 4WFED 2CDGA 2VQUA 2P1YA 3NABL 4YEEA 5FYKU 1RUAH 3L9RB 4P2CG 2NXZD 5F3HA 2P49B 1Q94A 2YHGA 3AB0C 2Q6WA 1R6VA 1J11A 2I07B 1F58H 1ZLVK 5IMMB 3K46A 1DEEB 1V3MA 2VL4A 4JKWA 4FQLH 4S11A 3CMGA 4IJ3C 5IR1B 3X11A 1CDHA 3BW9B 4EN3B 5ETUB 1QFUL 1RK1A 4MLSA 3UCRA 1S7UA 4X6DB 1A6TB 1L7TL 3ALXA 1KTDA 5EOTB 4ONHB 3ZSSA 1KCUL 4KHTL 4PJIE 1WIUA 4ODWA 1A7PL 4NO5A 5BV7C 5MENA 5CJOL 4HMCA 2I9TA 2CQVA 2NNAA 4R96A 1P1ZB 2GI7A 4UU9B 4UT7H 3P3YA 4WO4C 5HVFB 4HKJB 4XPAL 4MB5A 1CBVL 3C9NA 1HXMB 4QHUA 4LCWD 4Z9KB 4QLRA 4G6KL 3WCYA 5HI3D 1JPFA 1VEPA 2APWA 2CDGB 1A7OH 3UTTA 1UH4A 5HHXH 2HFGL 4P5TD 3ZO0A 1L7TH 1G1YA 5F3HB 1Q94B 1T03L 2Q1EA 2Q6WB 4PBWD 4NO0B 3STZA 1RJLA 1A7PH 1RMFL 2R2EA 2VLRA 3VWKA 4LQ1A 5J6GA 3NCEB 5CJOH 2D4FA 4I1NB 3FB7A 1QHOA 2XN9A 3X11B 3SGDH 6CGTA 1S78D 1RK1B 5E24E 1CBVH 2APXA 3ROLA 1S7UB 1QRNE 5I73C 2AAVA 4LRIC 4JM2A 3PWUA 1A6AA 2OL3H 4X6DE 1LVEA 2HFGH 3GNML 4JZOB 2V5SA 3RWDA 4Z7UE 4OZFH 5JHDE 5MENB 2OI9C 4L8BA 2I9TB 1F4XL 1KB5H 4K9EC 2NNAB 1NJ9B 4R96B 2F5BL 4X4ZA 3W0WA 1Z9OA 3QI9A 4NNYA 3C9NB 4DN4H 4YC2B 4I48A 4PR5A 1JPFB 4KDTC 2VDPL 3DECA 5A2JH 5ERWA 2ITDB 5B38G 1RJLB 1S7SA 2VLRB 4ODBD 5CBEA 5J6GB 4OZGA 4N0RA 3FB7B 2XN9B 1RFDL 2F5BH 5DZNA 3P4OA 3CFCL 4UBDD 1H3WM 1NC4B 4XHQA 3ROLB 1SEQL 1BIHA 2FO4A 1ZVHA 5D2LA 4JM2B 1A6AB 5EOQH 1NAML 3WNLA 5HDLA 5D1QA 3DVNA 3B9AA 3DBXA 4XMKL 3P0YH 4RAVB 4L8BB 4UOW1 2DLGA 2FX9L 4F9PA 2DTML 4ZO7A 4YX2L 1NBQA 5MENE 4HFWA 3QI9B 1IM9D 2IGFL 4NNYB 3ZKQD 1MCLA 4XPBH 1F02I 1EUUA 5F7MC 1RFDH 3QH3A 2AJSL 3CFCH 1L9NA 1UVQB 4I48B 4PR5B 1CL7L 3ARVA 2W65A 4I0PA 3PV6A 4LLAA 1SEQH 1T7YA 3EOBA 3UTTE 4XP1L 1AO7A 1VFAA 4ODVH 5ERWB 5B4MC 4XMKH 3VXOA 1IEAB 4K23L 1BQLL 5CBEB 5DR5L 4G6ML 5I1EL 2DTMH 4MS8C 2VLRE 2A0LD 2HWZH 3P4OB 3GSNH 2IGFH 3KAAA 2XN9E 4M02A 1RUQL 3MJ8A 2EO1A 2FO4B 3U7YL 3AGVA 5D2LB 4YJZL 5EZOL 4UILL 1CL7H 1V8HA 3DVNB 4N8PA 5JW4Q 1YN6B 3DBXB 4Y16C 2WWKT 1HKLL 2RR3A 2R9HC 4NYLB 1UG9A 4HWBH 3S35L 2NY0C 2VC2L 4HZLA 2DWDA 5CGMA 4HFWB 5LGKA 3OPZL 4L1HA 4G6MH 2FATH 3GMOA 3VXQA 3W0WE 5I1EH 5DZLA 1H3PH 3QIBC 3QH3B 2NXYD 3C5ZB 3TN0A 2J88H 3Q1SL 4HPYL 2W65B 4I0PB 3PV6B 1D5IL 1RUQH 4QRPD 1JNJA 4X7DC 3EOBB 5JIPA 4DKDC 4YHYC 5J1AA 1KELL 1HKLH 2LTQC 1J8HE 2V2TA 4DKFL 4KROC 1OW0C 3S35H 5BV7L 1T2JA 5EBGA 1T5XA 3MLYH 1B9ZA 4R97C 2DQFA 2Y1VA 5MP6H 4OZGE 4M1DL 4NZJA 4PJ7A 3ISWA 3MJ8B 1E27A 4L4JA 3QUMH 4MJ6A 3Q1SH 3I3BA 2NY2B 4Y4KA 1D5IH 3BFOA 5D2LE 1ZLWH 1ZOXA 4CW1A 1AJ7L 5JZ7C 1KPVB 4WFFD 3UZVB 5FF6A 3BIKA 4HZLB 1UQSA 2DWDB 3H9SD 3BXNA 2PTTA 5BV7H 1S8DB 3O3AA 4XWOC 4FZ8H 2V9TA 4ZNEA 3VXQB 4LKXB 3QUYC 3TN0B 4X6BA 3QZWA 5E6IC 4M1DH 3S4SA 3PP4L 4OUUA 4KFZC 3TA3C 5T3ZL 3I3EA 4OCNC 1CGWA 4LLDB 5GZOD 4XBGA 2Z4QB 4PJFF 3U79A 1FNHA 5J1AB 2B2XL 3HC0A 3VFOA 1SBSH 1XCTA 2V2TB 1AO7E 3BE1L 1AJ7H 2ID5A 4K94L 2QEJA 4K9EL 1E0OB 2ZZUT 1S9VB 5GGVL 1NCDL 1MCJA 4PJ7B 2FGZA 2NY5H 1E27B 3JSSA 1X6LA 3UDWC 2EIZA 4MJ6B 4J8RA 4Q9RL 4Y4KB 4CU6A 3ZKXB 2FHCA 4I3GA 5T3ZH 3DVGA 3FMGL 3B8YA 4AIXA 3D0VA 5C7XL 2B2XH 3HZMA 3QULA 2NX5E 5FF6B 5DD6A 4W6YB 5DMGD 3BXNB 3C6LB 2OBGA 3DXAA 2JJWA 1FH5H 2ADFH 5GS3A 2PTTB 3TEUA 3O3AB 3BVNA 4CN1A 1FSKB 3GRWL 4K9EH 1D5BA 4X6BB 3QZWB 5GGVH 4OFYA 4JQXA 5D5MB 2VERN 4TNVF 3EOYG 5F7DB 3WDIA 5CCKL 5GIRA 4XBGB 2FLBT 5CUSL 2X4TA 3OF6D 3O3UN 3VFOB 3HG1B 2YA1A 1XCTB 2Q3ZA 1CTOA 1PX4A 5C7XH 4Z0BH 4NN7C 4NCC1 2E27L 1UM4L 4ZOBA 2CXGA 2OTPA 5F1NA 5JW4R 2IPTL 2SEBA 1Z9LA 3C8KA 5DK2A 3NH7H 3GRWH 3HC4L 4PJ7E 1NH6A 4PRHB 3PJSA 2Y4SA 3QAZB 4K3JH 5HHNB 3DVGB 4PGCB 1OCWH 1WEJH 3O45A 3K0WA 1EX0A 5CCKH 4R7DB 3U7WH 1B6DA 4GBXD 4ZPTB 3QULB 3SCMD 5DD6B 5I1DA 3DXAB 3EBAA 1C7SA 1HIML 3BVNB 2QBWA 5J13B 4I3RH 4Y5XC 1UM4H 1QA9A 2VLKA 4ZNEE 4ZO9A 1AXSA 3TV3L 3BPNC 5FIEA 4LBEB 4MX7A 4NRYA 4Y1AA 5DO2C 4R3SB 5J57B 4TRPL 4L3CB 5GIRB 1I8MA 2X4TB 2ICEA 3KPLA 1NBVH 2ORBH 7FABL 1CDBA 3MRFA 4FMFA 5EBMA 4HQQL 1LNUA 4Y5YC 5EC2A 5GJSL 2NZ9D 1QBMH 3H3KA 1HIMH 1QSED 2E6JA 1ZEAH 4LPYA 4W6XB 1YPZA 3ULUC 4OLVH 5H2BA 3QUZA 2XTLA 3PJSB 4C55A 3EDJA 3TV3H 1CWVA 3QIWC 4TRPH 1HI6A 3GKWL 3LEVL 4HUWB 25C8L 5CP7B 2XICA 4M6NH 2DMKA 5C70A 3IJHB 4IOFC 1TVBA 5I1DB 4G80A 3FOMA 4HQQH 3X14B 1ZT1B 4FN0A 3DXAE 3MC0A 3CFIC 2Y6SC 3STBA 5FFLA 4OZIF 2VLKB 3DVIA 1YUHA 5ENWA 4MX7B 4YK4C 3CGTA 4Y1AB 1PZ5A 4P2OD 1QQDA 2APFA 1WGOA 2VOTA 3P4NA 3IJSA 4BJLA 1I8MB 5FYLE 4G7YL 4FG6D 3GKWH 3KYAA 3LEVH 5EBMB 4GAFB 4FTVD 4FXLA 4IM8A 5EC2B 2BXZA 5JW4M 1MAML 1MHCB 2H32H 5F96L 5HPOA 2HJFB 4OCWL 1EO8L 1VFBA 1LP9F 5IGXL 3G08A 1YPZB 5INCB 5H2BB 3QUZB 3P77B 3BEWB 3E8UL 5KSUA 3ARDA 4ETQA 1HI6B 3F7VB 1QEWA 3MRJA 5IB1A 5JQ6L 4ZOEA 1UKTA 5IMOA 3MROA 3ZE2E 2XY2A 3LOWA 4G7YH 1TVBB 1T0PB 4HKXA 4G80B 3FOMB 1UXWA 2CRMA 4F7PA 1FNEA 5F96H 3EO0A 3V52L 8FABA 2GJ6A 1MI5A 5IEHA 5FUOH 5ENWB 4DWHA 2DI7A 1BFOA 1PZ5B 2AV1A 5IGXH 1QQDB 2AI0H 3MRNB 3TO4D 1NBYA 2DKUA 3IJSB 3U1SL 3RI5F 3MV7A 4RFOL 5D1ZD 5B3JE 4P2RD 3DI3B 5L88L 2EEAA 1NUFA 2ICWJ 4MNQA 1A6WL 1WTGT 3IAQA 1MH5A 2G5BB 5F8QC 4WEMB 3GI8H 4OIIL 2B39A 5EPMB 3G08B 4JFOA 3V52H 2CKBA 2Y07H 5KSUB 3ARDB 2JCCB 4JFYA 4TUKL 1YPZE 3QPQC 4HIEB 1QEWB 3MRJB 3OG6B 3WJLC 5IB1B 1BM3L 4RMRA 2NY3D 4HJJL 4PRID 5E8DL 3MROB 3V5KA 4RFOH 4F3FA 4CNIA 4HKXB 5I8CB 1UXWB 5GRWA 4I77L 4F7PB 1FNEB 2I5YH 3EO0B 5L88H 3QXDA 1UFUA 8FABB 2GJ6B 5TDNA 1MI5B 3O41A 5IEHB 4GS7B 4OIBA 2Y5TA 4DVRL 2QQQA 4OIIH 2AV1B 4RFEA 4WENB 3U6RA 3UMTA 2GFBA 1NBYB 4JGJA 4TUKH 4U2ZA 3C09C 1EFXD 1BM3H 4PRPA 4M8QA 4HJJH 4O9HH 5E8DH 2DQUL 4A6YA 2I9LA 2GY5A 2R23A 4F7CA 3WYRA 1OSPL 4MNQB 1CLCA 1MH5B 3C5SA 4TQEL 4I18C 2QHRL 1R3LB 2UZIL 4JFOB 2E7LC 5DDHA 1U6AH 2CKBB 4LSPL 4DVRH 4HUVA 1F6AB 2YEZA 3MFFA 3O6LL 3KPOB 1FG9C 2R29H 4N0CC 3V5KB 1CZ8L 1SMOA 5A16A 4F3FB 4CNIB 2J5LB 1Y6MR 2C4FU 5BQ7A 5F88A 4NKDA 1MCKA 1TQBB 2ATKB 3BQUB 3MRGA 3IETB 3IJYA 3QXDB 1IQWL 5BVPH 1E4XI 3OKDB 4RZCA 1A1MA 3O41B 4LVOB 4ZOCA 1ES0A 3K8LA 3U0WH 4JY4A 2L4OA 2QHRH 2UZIH 2GJ6E 2E7BA 1LEKA 5CMAB 3U6RB 2GFBB 4JREB 1KPRB 3SDAA 3VFRA 1N64L 4JAMA 1NEZG 1UJTA 3QWRD 4QRPB 4HIHB 4PRPB 4M8QB 5DFVD 4A6YB 3MV7E 4W68A 1KSRA 2I9LB 1CZ8H 3MZTA 4F7CB 5IUSA 5ESAA 5H37H 3C5SB 1QD0A 3BGMB 4P23A 5CGYD 1PLGH 4MNQE 4J4PC 1DUYA 5DDHB 4R2GD 3TH3T 4PJGF 4NZUH 4HUVB 2YEZB 4J7RA 1CGXA 5ALCL 5EUKA 4KKCC 5ALBL 3ULUH 1N64H 3MV8E 3IFLH 2GY7B 2QQNL 5A16B 5IW3A 4Q58C 5E0QA 1JJUA 5BQ7B 1Y18A 5D70H 1RJYB 4NKDB 4ONGL 4W4OC 1A0QL 3IDGA 2W1NA 3MRGB 3B43A 4U6HB 4RBPH 4RZCB 4KJWC 1A1MB 4M48L 4JY4B 4HV8A 4P46D 1LEKB 1BBJA 3VFRB 3WUZA 1GGUA 3ARZA 4U1HA 3NA4A 1YEJL 3Q0HA 4JFFA 3Q5TA 4LHQB 2OP4H 3MA9L 5ALCH 1C12B 1PDKA 5T5FL 1QRND 2QQNH 5I1LA 2CDEA 4PRPE 2DQCL 2NW2A 4P23B 3MMEB 4ONGH 3CXDH 4BFBD 4GXVL 5CJ8A 1DUYB 2H41A 2OR9L 1AR2A 3QYCA 3NFPA 1Q9KA 1RULH 5IFJB 3O2WH 4XCFL 5ACZB 3K1KC 4HUMB 4CVUA 4ZTOL 5EUKB 1CGVA 5CD5C 5BZDB 1GSMA 5F1OB 1TJIL 2AVGA 3UPRB 1YEJH 1Y18B 5HGBA 4AENA 1F2QA 1XT5A 4TULL 1GGIH 3IDGB 2DQCH 3SEPA 4HBCH 3B5HA 4ISVA 3DMMD 3CCHA 4LKCA 4TNVK 5GQBA 5B8CC 4HV8B 2OR9H 1BBJB 1KF9B 2R15A 2DQJH 4JKKA 2ZSVA 4UINL 4XCFH 3WJJC 4U1HB 4FP8H 4BFEA 3FHAA 3VFMA 5I1LB 2CDEB 2YR3A 4WTZA 4TULH 2HT4C 3GMMA 4E5XB 1QTYT 1A6UL 3NFPB 4F9LA 5L2JA 4PJBB 1Q9KB 2D7OA 4YFDB 3LKOA 4EI5C 5C0BA 2EXWD 2X41A 4XNUL 3PIQB 4I9WE 5H8DA 1KG0A 1C5BL 5CP3A 1I8IA 3RZCA 5I1GL 4NQDD 3DGGB 3WFBH 4ISVB 5JDSA 4U6XA 3CCHB 4DOHB 4LSDA 2DKMA 1CFQA 1QG3A 1RU9H 3HZKA 3VA6A 1HNFA 4P0DA 5FA3A 2ZSVB 3VWKD 1GAFL 4Y0GA 3NBNA 4ZSOA 3OAUH 1ZV5A 1F4HA 3IDUA 3VFMB 4JFFE 5F44A 4HT1L 4NO2B 4N90E 1LO5A 4TSCL 4H1LH 4JDTH 5I1GH 1CE1L 3AVEA 3GMMB 4D0CB 5D6DA 3F6IA 5L2JB 5I75B 2FGWH 3AS1A 3KYMA 3LKOB 2UZYB 5AEAA 5FECB 1LK2A 1KG0B 2VZOA 3CDGA 5F21B 3N9GH 4Q6IC 1I8IB 1OTSD 3UROR 3RWEA 1EO7A 2B1AL 3UAJC 4HT1H 1FGNH 5CKAA 1YMMA 2WNGA 4YHNA 4LNRA 4TSCH 2OXHA 5JDSB 4U6XB 1J8HD 3VGHA 1CFQB 2D7MA 5T5NG 3SKJH 1A9EA 3HZKB 5EO9A 1ZSDA 5FA3B 3MRRA 1SY6A 4ZSOB 4LVNB 2XV6B 3MUGB 3C2SA 4U1GB 1A5FL 4OLWL 4Q2ZA 3UJJL 1DFBL 5CSZA 2EIEA 1AIFA 1UGNA 1J1OH 5K59E 1JVKA 3L3IA 2VR5A 2H2SC 4KUZL 5IB2A 2NY4D 2B20A 5DVMA 4UOW0 2WP3T 5F6IB 4WVRA 3KYMB 4G8GE 5GS0D 1LK2B 2HT3C 3CDGB 1JN6A 2KDGA 5HTSA 5C0BE 2Q8BH 3RVTC 3RWEB 1OAZL 4KKLD 1RI8A 1A5FH 2AQ1A 4OLWH 5E8PA 5FK9A 2JTDA 4ZUTB 4HW6A 1YECL 1DFBH 4LHJB 2OXGA 9CGTA 2LFGA 3OAZH 1VEMA 1AO7D 2M1KA 5T5NF 4HCRL 4GJTB 4YGVA 5EO9B 3RI5K 1FO0B 5K93A 3REWA 5BXFA 5IV2A 4PJHA 4NN5C 5E2UH 1NAKL 5J89A 4GMTL 4PGBA 3TO4B 4Q2ZB 4ZSOE 5SX5K 4RISL 1AIFB 1ORQA 1YNTA 4XMPL 2FJFA 4NO3A 3L3IB 2HH0H 3QQ3A 4R4NC 5IB2B 3LKNA 4DCQA 4KJQD 5EO0A 2D7TH 2NX5D 3MREA 3SE3A 2K7PA 3P9MA 5SWSA 3V6OA 4UZGA 5HBBA 1KBGL 4X8XA 2P5WE 3VXNA 4TVSa 4BH8A 1X4ZA 1WIOA 2GUOA 4MA1B 4ZFGL 4LOUC 1XF4A 2AABH 4RGNB 4GMTH 4YHIA 5FK9B 4PJIF 5E8PB 3S7GA 1MHPH 3PG2A 1N7ML 3UYRL 1FZOA 2EDTA 1I7RA 1YMME 4OV6F 1NMCB 1MHHB 2BHZA 2WBJD 1P5UA 4LEOA 5EA0L 4YGVB 2X70B 1KBGH 2PW1A 1NGQH 1JCKA 4PJHB 5E8OB 5TQ2L 4CVZB 4Z18A 4ZFGH 1ORQB 1SHMA 4S1RL 1JGUL 5F7KC 1EFXB 4NO3B 3QQ3B 3RDTA 5DLMH 2PXYD 3LKNB 4D9QE 3UYRH 3K7UA 3OAYH 1C7TA 3MREB 3WFHA 3P9MB 3U83A 3CFJA 5SWSB 3RNKB 1J18A 1TZIA 3UTPE 5EA0H 1I85C 2N7AA 3VXNB 3UZQA 2PO6D 3R0MA 1F90H 3DYOA 4LRNH 5HHOA 1QSFE 4E9LA 1UA6L 5EU7E 4OF3A 5GGTL 1JK8A 1JRHL 4K7PY 1XF4B 4CJ1A 5TE7L 4X6DF 1G7IA 2HMID 3WO4B 3F5WB 4KTDL 1MAKA 4XVSL 4MA8H 4Z7UF 1IGCH 4RGNE 3DETC 5D9SB 3SDXF 4S1RH 3ZDYE 3K4DA 1FZOB 1XIWA 3JBG7 1I7RB 1XGQB 3QQ4B 4LEOB 1MCCA 1AXTL 5D8JH 5IEKA 1MRDL 2FLRT 5BO1L 1OARL 3FQTA 4RWYL 3KS0J 2PW1B 4F7EA 3W11D 2QJDA 5C08A 1MJJA 1UA6H 2ZJSL 1AGDA 3HB3D 3PWJA 4PJHE 2W38A 5FGCE 1JRHH 1X5LA 4XVSH 4N5UA 2OTUB 1FAIL 3RDTB 2EIDA 5INDA 1LO2H 3V79C 4S10A 4NQXA 1TZIB 1WICA 2NMSA 3TBWA 2UYLA 4CL7A 1FIGH 3CUPB 3V6OE 5HHOB 4JFQA 5FYJD 5BO1H 1U8PA 1JK8B 1JPTL 1KLUA 1X5YA 3H9HA 3QJHA 5C0DA 4LSTH 5CKGA 1G7IB 3HRZA 2ZJSH 3GSWA 1TVHA 1XIWB 4JO2L 5JMOC 4KKAC 4M5ZH 3MBED 1FAIH 5AZ2L 3TJHD 1S5HA 2E7CA 5IEKB 4CUCA 3FQTB 2QADC 1WAAF 3BISA 2HLAA 3SGJA 4F7EB 4HHAA 4P46B 2IBGA 1AGDB 3PWJB 4JVUA 2WMPA 4KQ4L 3WE6A 3EOTL 4MNHA 4KK6C 4JGMA 5INDB 5I71B 2AKRA 5FUCE 1A3RL 4XP5L 3RY5A 3D9AL 5AZ2H 1MFBL 4NQXB 3B9KC 3TBWB 2UYLB 1W0WA 4HXBL 4PV9A 3EJJX 5BW7C 4XCCH 1U8PB 4G9DB 5HHOE 5C0DB 1R5IA 2R0ZL 3HRZB 4Y5VA 3GSWB 2DD8L 5C6WH 4WI7A 1TVHB 3FRPG 3FAXA 4P2QD 4H5SA 3TYFA 4OLZL 3QUXD 5GGSA 3F8UB 5DQ9A 3P4MA 5L0QB 2VDQH 3SGEI 2ZKHH 4LVHC 4GUPA 1MFEH 1J0ZA 1OHQA 3B9VA 4UAOC 2HN7B 3O9WC 1MHEA 5TQ0L 1T1WA 2J8UF 5D7IA 5F9OH 4HXBH 1QLEL 1ZGLA 4HWZA 4WW1A 3ILQD 3SO3C 2XZCL 5TFSH 5C08E 3U2SA 1IL1A 4OUOA 3KWWA 2A9NL 2R0ZH 2F5AL 4MNHB 2DD8H 2F8XC 2GIYA 5FYKE 3HZVA 1FLTX 4KI5D 2AKRB 2H6PB 3G5ZA 4ZAKA 4CDHA 4OZGF 3W81A 1N5YH 1JIBA 3BP5A 3GIVA 1P7QA 1W0WB 4HIJA 3D2UA 4PV9B 2ZSWB 5TQ0H 4G6FD 1XF1A 3R06A 3MLUL 1R5IB 1QLEH 1DN0A 3HR6A 3RGVD 2V2WA 4H5SB 3U9UB 4JHZA 3KLHC 2NY6C 4PRBA 5GGSB 4PJ5D 2A9NH 3C6SA 2F5AH 5DQ9B 3LQAL 2H26B 3VG0H 2UV3A 3O2DL 3CSGA 3H0TA 4G9FE 1UJ3A 3PUCA 4R0LC 5L8LB 4LASL 1GXEA 1OSZB 1QSZA 3HPLA 3U4BL 1T1WB 4HD9A 5D7IB 2VZSA 4XVJL 5E1AA 4HWZB 1P9MC 1EZVX 2DM7A 2QSCL 3T1FA 2F9BT 2X40A 3OSKA 3U2SB 2YD3A 3KWWB 2VDLL 5IW6A 4HH9A 4DUWA 4IEFB 2DS4A 2Y9RT 5IROA 1HDMA 3HZVB 4KHXL 4DGYL 4XNYL 4MQXC 5HYFA 3G5ZB 4JPIB 1I1AA 4ZAKB 1ZLVH 3BP5B 3GIVB 1P7QB 5DJ8B 4LASH 3F7RA 3NTCH 4GH7B 3D2UB 3QHZL 3U4BH 5AD0A 4C83A 3MJ9H 1DN0B 4UIMA 3LQZA 2V2WB 2QSCH 1HCFX 4PRBB 5D71H 3C6SB 1LEGA 1CLYH 2FR4A 1PEWA 5ESVB 4KHXH 3U0PA 3H0TB 3P0GB 4Q9QH 4XNYH 3KR3H 4YHKH 1UJ3B 1F3JA 1PKQB 5JXEC 3HPLB 4MHHI 4WHYH 3SPVA 1NANH 4MS8D 4YDKL 2Y72A 2DYPA 5E1AB 3VA2C 3ARGA 1EVUA 3KLAA 4Y19A 4P3CH 3T1FB 2Y23A 2YZ8A 4JN1L 2OL3A 4HH9B 3TBTB 1T4KA 5CJXC 1NGYB 4L5FH 3MRBA 4Y16D 1EGJL 1BD2D 1HDMB 3CFKA 2HG5A 3V4VL 3MV8D 4OZFA 1WSST 2CLVA 1I1AB 1TQCB 1KB5A 3NZ8A 4XHJC 2C7UA 3IKKA 3KHQA 2NY4B 2NR6C 5AD0B 4C83B 4YDKH 1QPXA 4FQIH 1GZPA 4M1CC 2XNAB 5KJRH 2WW8A 1I3RB 3L3KA 3LQZB 4P3WA 1UADC 4HWUA 2A83B 2Q7YA 3VWJA 1LEGB 3BUYB 1EGJH 2FR4B 3U0PB 3V4VH 1FG2A 3VXUA 1B2WL 3LMJH 1F3JB 2YD9A 2A6JA 5D7SL 2FBOJ 1AE6H 3SE4A 4LPUA 1J0YA 1D6EA 3KLAB 2MTPA 1C8PA 3KPPA 4Y19B 3T4YA 4XCEA 4U1LA 3LRHA 1KN4L 1TTUA 2DF3A 3MRBB 4GG6A 3CFKB 2VR4A 3V4PL 2HG5B 4PS4L 4P2YA 4OZFB 4G8EA 3EDEA 3BDYH 2DDQL 2CLVB 3LS4L 3NZ8B 1KB5B 4UMGA 5C71A 2YUVA 1WZMA 2C7UB 5KW9L 5JW5A 4N1CA 2BSSB 5JTWA 4LGSB 1CXIA 4X7SH 1DN2A 3ZYJA 1I1FA 3ARTA 4ODSH 1GZPB 4MNGA 5E6ID 3CLFH 5MI0C 1UWEL 3L3KB 3IU4L 4JFED 3L7EA 1BREA 5IF0A 4OJFL 4QCIA 2YPKA 3VWJB 2A6IA 5I16B 1WJ3A 1YNKL 1KN4H 4X5WB 2OYPA 3S37X 1V3JA 3V4PH 4PS4H 4AMKL 1FG2B 5B22A 5KTEH 5F8RC 2WWMD 3VXUB 2DDQH 1AQDA 1OGTB 2A6JB 3LS4H 3RWJB 1GYAA 5DD3H 3BESR 5HYSA 5BJTA 4U6VL 3GSNA 4GQPH 5ADOH 1D6EB 4S1DC 5FGBA 4DVBA 3KPPB 3T4YB 5GS2D 4U1LB 3X3FH 3ZDXE 1CI5A 1UWEH 4Y19E 3L3GA 3IU4H 5DHVB 3DJ9A 1E6JL 3O4OB 4GG6B 1CICC 4K8RH 4YHZL 1IC4L 4G8EB 4HWBA 2BC4A 3NAAL 2ADIA 1WC7B 4AMKH 4WHDA 2PXYB 1E4WL 4OB5L 5JW5B 4PB0L 1MIML 3HI1A 3LKPB 4XXCC 4B50A 2X89A 3L7EB 5D96B 5IF0B 2YPKB 2A6IB 3NIFE 1WFOA 5E8NA 3ZTNL 5JIIA 5AUMA 1FYTA 2E3VA 3BH8B 1IC4H 4GXUM 3TPKA 5IP4A 4UTAH 1AQDB 4N90D 1HWGB 1CF8H 3GMPA 1B90A 4YDLB 3NACH 3GBNH 2V9RA 3GSNB 2ZCKH 4XB8A 4PB0H 2PYED 3E6FB 4DVBB 5T1LA 1PSKL 1K2DB 4Y2DD 1ZXQA 4U31A 2BZDA 2DJUA 3T0AA 3QUMA 3C60C 2IBZY 2IG2H 1OAKL 3ME0A 5T33L 4KU1A 3MRDA 1GGCL 3L3GB 4LIQL 4YBQC 5HI4D 1U8JA 4P5KA 3FQUA 1KPUA 5B3JF 2MNUA 1G7HA 1RZ8A 4GG6E 1NEUA 4JPKL 3SDYL 3JTSB 1IGTA 3SO5A 3OJMB 1MAJA 5ICZB 1JPGA 1RZKC 2X2YA 3RVXD 4NHCL 2Z31C 2BX5A 2CJUH 5DRWA 2FEEL 3IS0X 3LSOA 1YPZF 4WO4A 4MNGE 4P4KA 2AQ3A 1YEGL 2LAAA 4KI5F 3QO1B 1GGCH 2VABA 4LIQH 1MLBA 5FDYA 1ERNA 1JUFA 3ZYIA 4XPTL 3IDXH 1FYTB 4P57A 1GHFL 2BNQA 1VCAA 3AB0B 3AMLA 2X5PA 1S9KC 3SDYH 2C4FT 3GMPB 2MFNA 2R2BA 1HCVA 4L9LA 4DKAA 3TGXA 3ZL4H 5T1LB 1DQQA 3BN9C 4NHCH 1KNOA 4IJ3B 1KYOK 3QUKB 4NRZA 1I8LC 5ILTL 4XP4L 4G8IA 3MRDB 5JORA 1CXHA 4G8GD 1X4XA 4YO0A 1U8JB 4P5KB 3DIFA 4GRWB 3SQOH 5JA8B 1KPUB 2A6DB 4M4PA 1YEGH 4MYWB 4LRIA 5C0BD 1G7HB 1RZ8B 4EIZC 4XPTH 2V5YA 4Y4HC 4Y8DC 2B7DT 3TVMC 1MNUL 4RFNC 5BV7B 1WZKA 2E9IA 1JPGB 3AUVA 3O4LD 5DRWB 1H0DA 3LSOB 4Y4FD 3EYQC 5TPWL 2GSGB 4IOSD 4WO4B 4M6MH 1FL5A 3M17B 2VUOA 5I1JH 3VXSA 4XP4H 2VABB 2QR0A 3SKNB 1MLBB 4LGPB 3RTQC 1JUFB 4KDTA 2H3NA 4P57B 4P2QB 2Z92A 5HGGS 2X09A 5J56B 3ET9F 1R3JB 2WUBL 5EU6D 2R2BB 2NCMA 1S9XA 5JNYA 1B4JL 5I30H 5ECJE 1UACL 1DQQB 2Y5EA 2A1WH 5T1DL 3GRWA 4K2UH 4NRZB 2P5WD 3D39A 5L7XL 4ENEC 5C0AD 5JORB 4YO0B 1ZLUK 3HA0A 5LXGH 5I73B 2AEIT 1BJ1H 1FVCA 3E3QE 4D9RE 4X8JA 1NC2D 4WRLA 5DVOA 1HILA 2OI9B 4F7MA 2EYTB 4Q7DA 5KSBB 2W9DL 2WUBH 4C58B 1H0DB 4U1NA 1A02N 2XA8H 5T1DH 4MA3B 4HLZG 1FL5B 2VKWA 3WFEL 4FQCH 5L7XH 2QR0B 3GEWB 2YC1A 3RFZC 5FXCH 2X1WL 3VGEA 2Z92B 4HUXA 4PG2A 5C3LD 4KK8C 1EXUA 4JDZA 1N3NA 1V05A 2BNQE 5HYJB 3G9VA 3QHFL 5EC1B 4LAQL 4CDGC 5JNYB 2N7BA 4PJCB 4JQIL 3BKYL 2W9DH 5DJ0A 2DLIA 3WFDL 3BWAA 5IBLC 1RHHA 2X7LA 2EDEA 2X4SA 5JW3H 1QSFD 4MJ5A 1NKOA 3WFEH 3K81A 5T3ZE 3GM0A 3GMQA 5KANI 2XXCB 1HH6B 4WFHE 3PXJA 1TDQA 1HILB 4LMQE 5C0CD 4F7MB 1HQRA 1IEBA 3GM8A 3JXAA 3OJ2C 2VIRA 3QHFH 4KK9C 4LAQH 2VXSL 4YLQT 2YPLD 4HH8A 4G43A 3IB4A 1T7VA 3QIBA 4JZJC 3WFDH 3B6SA 2R56L 4PJAA 2YC1B 4QEGA 1JZ7A 3JTTA 3FN9A 5EIVA 3VXSE 4EUPH 5E56A 2AXGA 4M43L 5ITBL 4Y2OA 2YPVL 2H32A 2XQBL 35C8L 4JDZB 1N3NB 1NBZA 4KRPC 2WZPD 3BDBA 3OKMB 1OW0A 4LSSH 2IH1A 4PG9A 5DJ0B 1RZKL 2B0SL 1JV5A 3O0RL 4GKZA 3BWAB 1RHHB 1JHKH 2X4SB 2X7LB 5I74C 4MJ5B 4OM0L 3D39E 3WFZA 1CFSA 1I9RL 2OZ4L 5F7EL 2R56H 1AGCA 5ISZA 4N0CD 3PGDB 3KPQA 3U4AA 5C0EA 3CSBA 1PY9A 4QOKD 1U92A 3GMQB 4Y16B 4YAQA 4L8CA 2NXZC 5ITBH 1AD0A 1U8MA