1YNVX

Asp79 makes a large, unfavorable contribution to the stability of rnase sa
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
96
structure length
96
Chain Sequence
DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIITGEATQEDYYTGDHYATFSLIDKTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Asp79 Makes a Large, Unfavorable Contribution to the Stability of RNase Sa.
pubmed doi rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase
molecule keywords Guanyl-specific ribonuclease Sa
total genus 26
structure length 96
sequence length 96
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2005-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1ynvX00
1RGEA 1BU4A 1I0VA 1SARA 1TRPA 1BRNL 1Q9EA 2HOHA 1YVSA 3AHSA 1DE3A 5BU4A 1BSAA 1GOYA 1I2GA 1RN1A 1RNBA 3HOHA 1I8VA 1RDSA 1BRIA 2KF4A 1T2HA 1BNSA 1BRSA 5GSPA 1RSNA 1RHLA 1BNGA 1BNJA 1RGFA 5BIRA 1BRKA 4RNTA 1B2XA 1PYLA 1X1YA 2RBIA 1BGSA 3KCHA 1R4YA 1FZUA 1FW7A 1BNFA 3DGYA 1FUTA 4J5KA 1RGGA 3AGNA 1YNVX 8RNTA 1X1UA 2C4BA 1X1XA 2F56A 3WHOA 1RLSA 1CH0A 2BIRA 1BRHA 1BSCA 1AY7A 1RN4A 1BSBA 1BIRA 1GSPA 1PY3A 3URPA 3GSPA 1B27A 6GSPA 4GSPA 5RNTA 3D5GA 2AAEA 1BRJA 1B2MA 1TRQA 1I2EA 1RMSA 1B2ZA 2KF3A 1BRGA 1RTUA 1BAOA 1LNIA 1RGAA 2BU4A 2SARA 2GSPA 2AADA 5HOHA 1B20A 1G02A 2KF6A 3BU4A 1B21A 1HYFA 1BOXA 1I70A 7GSPA 1RNTA 1RGCA 1YGWA 1UCJA 1RGHA 1BNIA 1I2FA 1RCKA 1T2IA 1LOYA 1MGWA 4J5GA 1UCKA 2F4YA 3D5IA 3DH2A 1RGLA 9RNTA 1BVIA 1UCIA 1B2UA 1LOVA 1I3FA 1GOVA 3AHWA 4GHOA 1RCLA 1GOUA 7RNTA 2KF5A 3RNTA 4BU4A 1GMQA 1BSDA 1ZGXA 4BIRA 1I0XA 3A5EA 3D4AA 1BSEA 2F5WA 1AQZA 1LRAA 1B3SA 2KAAA 1LOWA 1GMPA 1TTOA 4HOHA 1RGKA 1GMRA 1FUSA 6RNTA 1B2SA 1BNEA 3BIRA 1JBRA 3SYUA 3AGOA 1BNRA 1UCLA 4HAAA 1A2PA 3Q3FA 1JBTA 1HZ1A 1BANA 1FYSA 1I3IA 2F5MA 1X1WA 2ZA4A 3WR2A 1JBSA 2RNTA 1BUJA 1MGRA 1DETA 1C54A 1IYYA
chains in the Genus database with same CATH superfamily
1RGEA 3GRDA 5KP1A 1BU4A 1SARA 4H61A 4WFOA 5EEOA 1BRNL 1Q9EA 1RKYA 3DGMA 4ILFA 4XDVA 2CFKA 5CXOA 4R9KA 1EKMA 2XEPA 3QK9A 3NQYA 1VQQA 1BRIA 1G0TA 2UGIA 1VQK3 1AVKA 1GY6A 1WMOA 3FG4A 2ZL8A 3NM7A 1GS3A 1BRSA 2ML5A 2XGNA 1RHLA 1BNGA 3MHEA 4OUQA 1KD14 2CX0A 2CK3H 3X3XA 3CXC2 1B2XA 5ELJA 1IU7A 1JV2B 3K9MC 2B1XB 4KVHA 3PXMA 3EB8A 1BUQA 3EN1B 4QWTA 3WOFB 2I9WA 1BNFA 3DGYA 3GZBA 3LOYA 4LYLB 4WHAA 1RGGA 1M904 1GY7A 1YNVX 4MEIA 3SVAA 8RNTA 1VQ63 5M1AA 1X1UA 2CKFB 3N54B 3RGAA 1YJW3 1VQ53 1X1XA 2F56A 3V92A 5D81A 5AEWB 1TFOA 4MJDA 3TDGA 1SIHA 5IW9A 1MWSA 4DKIA 4EC6A 2K0MA 3FG3A 3N8BA 2YX9A 5TGNA 1IQYA 3DGNA 3CC23 1LQMB 2W9QA 3STDA 4EBGA 2Z6BA 1STFI 2OQEA 2AAEA 1D6ZA 3JUOA 4G1MB 4K61A 1VQO3 3FF0A 1IQ8A 3U1WA 1TRQA 5AIFA 1RMSA 1US1A 4MMXB 1CEWI 3A76A 3CU3A 2CG0A 1S5AA 4JF8A 4NHFA 1BAOA 4O8SA 1Q814 3CC43 2BU4A 1GYBA 2SARA 4EV2A 5EVHA 3JVCA 1J2BA 3L0RA 5HOHA 2XGLA 3CCL3 4RZMA 1IK3A 3SXXA 1MWUA 1YGEA 2QGUA 1RGCA 4J9AA 1YGWA 2GEYA 3S5CA 1RGHA 1FA3A 4L8PA 3X41A 1T5YA 1BNIA 1OCVA 1I2FA 1RCKA 1T2IA 2QIYA 2V1LA 1F8NA 4IT7A 1RRLA 4J5GA 1E3VA 1KWIA 2CIUA 1KC84 3GAXA 3SLUA 3NBRA 1CQSA 1BVIA 2HMLB 3BNBA 1UUGB 3BB9A 1NJI4 4FMDA 3LTBA 1LOVA 3I563 3EBYA 1GOVA 3B4PA 1M1K4 1DVDA 3EF8A 2OTL3 2GU1A 4GHOA 1DVCA 1RCLA 2L4VA 4WP5A 5LC7A 1FGTA 3ALAA 1GMQA 4BIRA 2GU3A 4HM4B 1K41A 2JQ5A 1BSEA 4L7KA 4K90B 4WYKB 1JB2A 1UW1A 2W9PA 3NQZA 1AQZA 1LRAA 1N8QA 3MKIA 1W6GA 3UB1A 3EBTA 3JUMA 1YIJ3 1JRQA 1YVBI 2OQEC 1GMRA 3V98A 1B2SA 3G0KA 6RNTA 1S723 1VQ73 2ML6A 3AGOA 3V99A 1BNRA 1IVVA 1CYVA 4R1KA 1NWWA 4HJLB 4WYKA 3S27A 2F99A 2LYXA 2HMNB 1VQ43 3WR2A 1FYSA 1I3IA 3UL5A 3E99A 2GEXA 1E3RA 1MGRA 3CNMA 3IMAB 2D42A 2SBLA 1HU9A 3KIIA 2YFLB 4XM4A 2XFTA 3NV0B 5AYRB 1SIIA 2HOHA 1EQKA 1YVSA 5CK6A 3WDGB 1SJWA 1BSAA 3EC9A 1LNHA 1Q42A 1UUVB 3MG1A 3G6E3 1A67A 1RN1A 1D6YA 1WTHA 3LYGA 2CHCA 1I8VA 1RDSA 1PFPA 3BNEA 1ULIB 3HX8A 1W02A 5DRVA 1UGIA 1QAKA 4PEJA 1RSNA 4HM7B 1SPUA 2E2VA 4KFDA 1BNJA 2L1SA 3VGNA 3IJEB 5BIRA 5JPPA 5G2GA 5IEOA 5M19A 3GZXB 5I97A 3CCQ3 1QVF2 4NPBA 3J7Yd 3FCSB 3OWSA 1Q40A 1BGSA 2BO9B 1AVLA 3DM8A 1FW7A 2RSXA 1FUTA 3EHCA 5KP3A 1Q824 3MYTA 3LTAA 3GWRA 5HGRA 7STDA 2C4BA 5IENA 1RLSA 3UNLA 1N9JA 5G1KA 2BIRA 4U13A 1OACA 1WMPA 2XR8B 5CF2A 3OWUA 3UL6A 2FXTA 1BSBA 2QA43 1GSPA 1PY3A 2XH9A 3NX0A 4XBXA 1VQN3 3GSPA 2XF3A 3FGYA 4XDWA 6GSPA 4FMBA 4GSPA 2P0XA 3D5GA 4R80A 4XBYA 3ZFZA 1K734 4HM8B 3H51A 4BL2A 4CCVA 1N5HA 1ULJB 2KRTA 1BUJA 3OW22 3DGLA 1RTUA 4HZBB 4RNZA 3CC73 3FZWA 5IG0A 1UDII 2GSPA 1V74A 3K5TA 2AADA 2WOHA 1VQL3 5BVBA 1B20A 3ECFA 3BU4A 1B21A 1BOXA 1RNTA 2HMMB 1UCJA 2MF7A 4BL3A 2FNQA 3K7CA 3WMDA 2CW9A 3B8LA 4O2HA 3QRDA 3D5IA 1RGLA 2OCTA 3DGOA 1UCIA 3BLZA 4STDA 3WA2X 3DMCA 1B2UA 2ZDJA 3EN8A 1OGZA 3SX1A 3CMA3 1I3FA 1IQXA 1LQGC 1WMNA 3LT9A 3I553 5EQLA 2C11A 2HMKB 4HM0B 2IUJA 1YHQ3 2Y74A 3B4OA 1BSDA 1ZS7A 3ER7A 2XFSA 3A5EA 3SOYA 1JN5B 3CD63 5FW5A 2HMJB 1VQ83 1NU3A 4Q53A 2KAAA 1Q7Y4 1LOWA 1GMPA 1MWRA 4HYZA 3KZTA 1JBRA 2C10A 4KT3B 4LEHA 2GXFA 4N6NB 3EE1A 1FGMA 1A2PA 1OPYA 3X3ZA 4LGQA 3F40A 3AMOA 2F5MA 2O3OA 1JKGA 4O3VA 1D6UA 2D1WA 3X42A 5CLKA 5AIHA 4AKYA 3CCE3 1C7HA 1KQS2 3KKGA 4NREA 3S29A 1W5ZA 3D9RA 5AEUB 5CF1A 3KE7A 3F7XA 1DMNA 4BTXA 1IYYA 1JB4A 2B24B 2UUGC 4FMCA 5AYSC 1V57A 3T8UA 5IF6A 1QJGA 1K28A 2P0MA 2PZVA 3AHSA 1A2VA 1GD3A 3HI7A 4N6OB 5IG5A 5BU4A 1GOYA 2BMRB 3PZWA 3WOEB 4X2HA 3MWZA 1TUHA 3CCU3 1JZOA 4N6TA 1Y4KA 4WWUC 1IV7A 5DREA 3CME3 2BNGA 2STDA 5A0OB 1BNSA 5GSPA 1N5PA 3CCR3 1RGFA 1BRKA 1W7CA 2R41A 3HIIA 1N8R4 4N6UA 5KP4A 1JZDA 3G8ZA 3FH1A 1PYLA 1YJN3 3CNXA 1KSIA 1X1YA 1MNLA 2CWVA 2RBIA 2CWUA 3KCHA 4RBNA 3PYJA 3X40A 1VQP3 1VZZA 4RNYA 4J5KA 2Y73A 2W2CA 3DXOA 1O7MB 1TFKA 2OTJ3 4R9LA 1W01A 1QAFA 1N9EA 4HZ9B 1V58A 4BTWA 4CJNA 1OGXA 4IPBA 2XRXB 2M7OA 4N3VA 3WHOA 1STDA 3MG3A 2GBXB 2CFGA 2RFRA 2H0IA 4HM5B 1TJDA 2RCDA 3K63A 1BRHA 1BSCA 1GD4A 1OUNA 3OWYA 3EX9A 3ZG0A 2OOVC 1UGHI 3HK4A 3URPA 3D79A 1YJ93 1L5GB 2QEX3 3CPW2 3DUKA 5IG3A 1EG9B 3MG2A 1BRJA 5IG4A 4IIAA 1Q864 1M1XB 3JUNA 1RJOA 4MMYB 2CFDA 4XBTA 2UX0A 1A90A 1TP6A 4HM6B 3ROBA 2XSHB 4HM1B 1G02A 4R4KA 3UJMA 3FSDA 4LZIA 1U5OA 3NUVA 1IVUA 1QALA 4CDLA 7GSPA 1QVG2 1K9M4 2WGQA 3IPTA 1K8A4 2CX1A 1WNHA 1NB3I 1LOYA 1MGWA 4OVMA 1UCKA 3PGBA 1DMQA 4KZ1A 3T8NA 3LZAA 2IA7A 3MPHA 2W03A 3Q1CA 2WGOA 1OHOA 3MSOA 4EV5A 2K3DA 2ZHXB 4ZM8A 1Q7HA 2INXA 3N9HA 4HVNA 2MC8A 3LXUX 4FMAA 1E97A 3WA3A 3F14A 3EQQB 2YFJB 1GOUA 1UI8A 3PS8A 3X3YA 3KFQC 1NDOB 3HIGA 3RNTA 7RNTA 4LSOA 1FGOA 2KCDA 1NO3A 4HM3B 1I0XA 1EA2A 3AMOB 3D4AA 3LT8A 3CPOA 3JUPA 3SEDA 2F5WA 2Q07A 3F8XA 3NBBA 2W0QA 1U8CB 2BHMA 4I5QA 3B7CA 4HBRA 4HOHA 2CG1A 1RGKA 4GL6A 3CCV3 3Q90A 3BIRA 3SYUA 1LVNA 1OF5A 6STDA 1R4CA 1EUIC 2BMQB 3FLJA 2KXGA 2F98A 5ELUA 1NB5I 1JBTA 1O7GB 1HZ1A 1BANA 1O7NB 4H3UA 5JBSA 1AR0A 1JNQA 1M9GA 5AIGA 3ZG5A 4EYCA 3EJVA 4GB5A 1ZX2A 2A15A 5LC6A 1ROAA 1FGQA 5AIIA 4FR9A 3LH4A 1C54A 4JRFA 1W6YA 1I0VA 1TRPA 3KSED 4ORLA 3S28A 5FGOA 2P38A 1DE3A 1Z1SA 3OX9A 3RGRA 2GBWB 1I2GA 3PCRA 1GY5A 1W6CA 1MOLA 2R4IA 3HZPA 3NHXA 4X2OA 4AKZA 1RNBA 1WQLB 1UUWB 3HOHA 3KSPA 2H0HA 3FF2A 3G713 2KF4A 3D3LA 2WOFA 3DZLA 3NV0A 2OOVA 1T2HA 3CCS3 1TIJA 3G16A 3OV4A 4FCJA 1ZO2A 1JJ22 5D82A 5D83A 4L8OA 1TU5A 4HM2B 4O02B 2XSOB 4RNTA 1HKXA 1W4NA 1IVWA 4MMZB 1O7HB 2F86B 3GZYB 1EEJA 1RN7A 5STDA 3GZRA 1DYUA 3G4S3 1R4YA 3NBJA 3O8YA 1FZUA 2O9UX 5IERA 3KN4A 1VQM3 1ISKA 2CH9A 1IVXA 3VSYA 4LMIA 3NM2A 1JKGB 3AGNA 3I0YA 1Q40B 3CCJ3 3PCSA 1RRHA 4OK0A 3SOAA 1CH0A 3CCM3 8CHOA 1UI7A 4XB5A 1OHSA 1DMMA 2W56A 4EXRA 1IV9A 2CFLA 3FG1A 2YFIB 1A2KA 3RDEA 1AY7A 1RN4A 3U97A 3VF1A 1BIRA 2E2UA 3BNDA 3K0ZA 5JPUA 1VQ93 2K54A 1B27A 4N6MA 4KFFA 5RNTA 2W56B 3DY5A 1SQWA 1MWTA 3Q2PA 5AI1A 2CC3A 1B2MA 4BTYA 4I4KA 1I2EA 1B2ZA 2KF3A 1G96A 1ROVA 1BRGA 2IMJA 2BMOB 3BNCA 1LNIA 4CPKA 1RGAA 3H3HA 3S67A 3FKAA 4KFEA 4EW5A 3WODG 2KF6A 4K1UA 1HYFA 1OH0A 1T3BA 1I70A 1CYUA 3LMLA 3F8HA 1AV4A 2OWPA 1W2ZA 2J8XB 1QMAA 2RGQA 3LTDA 1O7WB 1O7PB 2LQVA 3NXJA 2F4YA 3DH2A 3F9SA 9RNTA 2HMOB 4J8TA 1W2B2 5IEPA 1LXEA 2Z76A 1IT7A 1JN5A 2CFWA 1W00A 3LTCA 1OHPA 1PU4A 3AHWA 1IT8A 1OF5B 4K1VA 3OXAA 2BT3A 2JDIH 2CWTA 4FCZA 2KF5A 5M18A 2FGTA 2P05A 3JUQA 1JB5A 4BU4A 1ZGXA 1LOXA 2W04A 4HKVB 4FCMA 2IYJA 1FUWA 2WO0A 4AEQA 2PNCA 2Z7AA 1B3SA 1TTOA 5BXQA 1YI23 1FUSA 2H0GA 2W6JH 1BNEA 3F7SA 4N6V0 1UCLA 4HAAA 1FGRA 2P09A 3Q3FA 5G1LA 1NNVA 4N6LA 4TX4A 2E2TA 2Z77A 1ASKA 2ZA4A 1JBSA 1X1WA 2IUKA 1IDPA 2RNTA 1YIT3 3T0UA 1DETA 3M8CA 2IY2A
chains in the Genus database with same CATH topology
1RGEA 1BU4A 1I0VA 1SARA 1TRPA 1BRNL 1Q9EA 2HOHA 1YVSA 3AHSA 1DE3A 5BU4A 1BSAA 1GOYA 1I2GA 1RN1A 1RNBA 3HOHA 1I8VA 1RDSA 1BRIA 2KF4A 1T2HA 1BNSA 1BRSA 5GSPA 1RSNA 1RHLA 1BNGA 1BNJA 1RGFA 5BIRA 1BRKA 4RNTA 1B2XA 1PYLA 1X1YA 2RBIA 1BGSA 3KCHA 1R4YA 1FZUA 1FW7A 1BNFA 3DGYA 1FUTA 4J5KA 1RGGA 3AGNA 1YNVX 8RNTA 1X1UA 2C4BA 1X1XA 2F56A 3WHOA 1RLSA 1CH0A 2BIRA 1BRHA 1BSCA 1AY7A 1RN4A 1BSBA 1BIRA 1GSPA 1PY3A 3URPA 3GSPA 1B27A 6GSPA 4GSPA 5RNTA 3D5GA 2AAEA 1BRJA 1B2MA 1TRQA 1I2EA 1RMSA 1B2ZA 2KF3A 1BRGA 1RTUA 1BAOA 1LNIA 1RGAA 2BU4A 2SARA 2GSPA 2AADA 5HOHA 1B20A 1G02A 2KF6A 3BU4A 1B21A 1HYFA 1BOXA 1I70A 7GSPA 1RNTA 1RGCA 1YGWA 1UCJA 1RGHA 1BNIA 1I2FA 1RCKA 1T2IA 1LOYA 1MGWA 4J5GA 1UCKA 2F4YA 3D5IA 3DH2A 1RGLA 9RNTA 1BVIA 1UCIA 1B2UA 1LOVA 1I3FA 1GOVA 3AHWA 4GHOA 1RCLA 1GOUA 7RNTA 2KF5A 3RNTA 4BU4A 1GMQA 1BSDA 1ZGXA 4BIRA 1I0XA 3A5EA 3D4AA 1BSEA 2F5WA 1AQZA 1LRAA 1B3SA 2KAAA 1LOWA 1GMPA 1TTOA 4HOHA 1RGKA 1GMRA 1FUSA 6RNTA 1B2SA 1BNEA 3BIRA 1JBRA 3SYUA 3AGOA 1BNRA 1UCLA 4HAAA 1A2PA 3Q3FA 1JBTA 1HZ1A 1BANA 1FYSA 1I3IA 2F5MA 1X1WA 2ZA4A 3WR2A 1JBSA 2RNTA 1BUJA 1MGRA 1DETA 1C54A 1IYYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RGE A;  1BU4 A;  1I0V A;  1SAR A;  1TRP A;  1BRN L;  1Q9E A;  2HOH A;  1YVS A;  3AHS A;  1DE3 A;  5BU4 A;  1BSA A;  1GOY A;  1I2G A;  1RN1 A;  1RNB A;  3HOH A;  1I8V A;  1RDS A;  1BRI A;  2KF4 A;  1T2H A;  1BNS A;  1BRS A;  5GSP A;  1RSN A;  1RHL A;  1BNG A;  1BNJ A;  1RGF A;  5BIR A;  1BRK A;  4RNT A;  1B2X A;  1PYL A;  1X1Y A;  2RBI A;  1BGS A;  3KCH A;  1R4Y A;  1FZU A;  1FW7 A;  1BNF A;  3DGY A;  1FUT A;  4J5K A;  1RGG A;  3AGN A;  1YNV X;  8RNT A;  1X1U A;  2C4B A;  1X1X A;  2F56 A;  3WHO A;  1RLS A;  1CH0 A;  2BIR A;  1BRH A;  1BSC A;  1AY7 A;  1RN4 A;  1BSB A;  1BIR A;  1GSP A;  1PY3 A;  3URP A;  3GSP A;  1B27 A;  6GSP A;  4GSP A;  5RNT A;  3D5G A;  2AAE A;  1BRJ A;  1B2M A;  1TRQ A;  1I2E A;  1RMS A;  1B2Z A;  2KF3 A;  1BRG A;  1RTU A;  1BAO A;  1LNI A;  1RGA A;  2BU4 A;  2SAR A;  2GSP A;  2AAD A;  5HOH A;  1B20 A;  1G02 A;  2KF6 A;  3BU4 A;  1B21 A;  1HYF A;  1BOX A;  1I70 A;  7GSP A;  1RNT A;  1RGC A;  1YGW A;  1UCJ A;  1RGH A;  1BNI A;  1I2F A;  1RCK A;  1T2I A;  1LOY A;  1MGW A;  4J5G A;  1UCK A;  2F4Y A;  3D5I A;  3DH2 A;  1RGL A;  9RNT A;  1BVI A;  1UCI A;  1B2U A;  1LOV A;  1I3F A;  1GOV A;  3AHW A;  4GHO A;  1RCL A;  1GOU A;  7RNT A;  2KF5 A;  3RNT A;  4BU4 A;  1GMQ A;  1BSD A;  1ZGX A;  4BIR A;  1I0X A;  3A5E A;  3D4A A;  1BSE A;  2F5W A;  1AQZ A;  1LRA A;  1B3S A;  2KAA A;  1LOW A;  1GMP A;  1TTO A;  4HOH A;  1RGK A;  1GMR A;  1FUS A;  6RNT A;  1B2S A;  1BNE A;  3BIR A;  1JBR A;  3SYU A;  3AGO A;  1BNR A;  1UCL A;  4HAA A;  1A2P A;  3Q3F A;  1JBT A;  1HZ1 A;  1BAN A;  1FYS A;  1I3I A;  2F5M A;  1X1W A;  2ZA4 A;  3WR2 A;  1JBS A;  2RNT A;  1BUJ A;  1MGR A;  1DET A;  1C54 A;  1IYY A; 
#chains in the Genus database with same CATH topology
 1RGE A;  3GRD A;  5KP1 A;  1BU4 A;  1SAR A;  4H61 A;  4WFO A;  5EEO A;  1BRN L;  1Q9E A;  1RKY A;  3DGM A;  4ILF A;  4XDV A;  2CFK A;  5CXO A;  4R9K A;  1EKM A;  2XEP A;  3QK9 A;  3NQY A;  1VQQ A;  1BRI A;  1G0T A;  2UGI A;  1VQK 3;  1AVK A;  1GY6 A;  1WMO A;  3FG4 A;  2ZL8 A;  3NM7 A;  1GS3 A;  1BRS A;  2ML5 A;  2XGN A;  1RHL A;  1BNG A;  3MHE A;  4OUQ A;  1KD1 4;  2CX0 A;  2CK3 H;  3X3X A;  3CXC 2;  1B2X A;  5ELJ A;  1IU7 A;  1JV2 B;  3K9M C;  2B1X B;  4KVH A;  3PXM A;  3EB8 A;  1BUQ A;  3EN1 B;  4QWT A;  3WOF B;  2I9W A;  1BNF A;  3DGY A;  3GZB A;  3LOY A;  4LYL B;  4WHA A;  1RGG A;  1M90 4;  1GY7 A;  1YNV X;  4MEI A;  3SVA A;  8RNT A;  1VQ6 3;  5M1A A;  1X1U A;  2CKF B;  3N54 B;  3RGA A;  1YJW 3;  1VQ5 3;  1X1X A;  2F56 A;  3V92 A;  5D81 A;  5AEW B;  1TFO A;  4MJD A;  3TDG A;  1SIH A;  5IW9 A;  1MWS A;  4DKI A;  4EC6 A;  2K0M A;  3FG3 A;  3N8B A;  2YX9 A;  5TGN A;  1IQY A;  3DGN A;  3CC2 3;  1LQM B;  2W9Q A;  3STD A;  4EBG A;  2Z6B A;  1STF I;  2OQE A;  2AAE A;  1D6Z A;  3JUO A;  4G1M B;  4K61 A;  1VQO 3;  3FF0 A;  1IQ8 A;  3U1W A;  1TRQ A;  5AIF A;  1RMS A;  1US1 A;  4MMX B;  1CEW I;  3A76 A;  3CU3 A;  2CG0 A;  1S5A A;  4JF8 A;  4NHF A;  1BAO A;  4O8S A;  1Q81 4;  3CC4 3;  2BU4 A;  1GYB A;  2SAR A;  4EV2 A;  5EVH A;  3JVC A;  1J2B A;  3L0R A;  5HOH A;  2XGL A;  3CCL 3;  4RZM A;  1IK3 A;  3SXX A;  1MWU A;  1YGE A;  2QGU A;  1RGC A;  4J9A A;  1YGW A;  2GEY A;  3S5C A;  1RGH A;  1FA3 A;  4L8P A;  3X41 A;  1T5Y A;  1BNI A;  1OCV A;  1I2F A;  1RCK A;  1T2I A;  2QIY A;  2V1L A;  1F8N A;  4IT7 A;  1RRL A;  4J5G A;  1E3V A;  1KWI A;  2CIU A;  1KC8 4;  3GAX A;  3SLU A;  3NBR A;  1CQS A;  1BVI A;  2HML B;  3BNB A;  1UUG B;  3BB9 A;  1NJI 4;  4FMD A;  3LTB A;  1LOV A;  3I56 3;  3EBY A;  1GOV A;  3B4P A;  1M1K 4;  1DVD A;  3EF8 A;  2OTL 3;  2GU1 A;  4GHO A;  1DVC A;  1RCL A;  2L4V A;  4WP5 A;  5LC7 A;  1FGT A;  3ALA A;  1GMQ A;  4BIR A;  2GU3 A;  4HM4 B;  1K41 A;  2JQ5 A;  1BSE A;  4L7K A;  4K90 B;  4WYK B;  1JB2 A;  1UW1 A;  2W9P A;  3NQZ A;  1AQZ A;  1LRA A;  1N8Q A;  3MKI A;  1W6G A;  3UB1 A;  3EBT A;  3JUM A;  1YIJ 3;  1JRQ A;  1YVB I;  2OQE C;  1GMR A;  3V98 A;  1B2S A;  3G0K A;  6RNT A;  1S72 3;  1VQ7 3;  2ML6 A;  3AGO A;  3V99 A;  1BNR A;  1IVV A;  1CYV A;  4R1K A;  1NWW A;  4HJL B;  4WYK A;  3S27 A;  2F99 A;  2LYX A;  2HMN B;  1VQ4 3;  3WR2 A;  1FYS A;  1I3I A;  3UL5 A;  3E99 A;  2GEX A;  1E3R A;  1MGR A;  3CNM A;  3IMA B;  2D42 A;  2SBL A;  1HU9 A;  3KII A;  2YFL B;  4XM4 A;  2XFT A;  3NV0 B;  5AYR B;  1SII A;  2HOH A;  1EQK A;  1YVS A;  5CK6 A;  3WDG B;  1SJW A;  1BSA A;  3EC9 A;  1LNH A;  1Q42 A;  1UUV B;  3MG1 A;  3G6E 3;  1A67 A;  1RN1 A;  1D6Y A;  1WTH A;  3LYG A;  2CHC A;  1I8V A;  1RDS A;  1PFP A;  3BNE A;  1ULI B;  3HX8 A;  1W02 A;  5DRV A;  1UGI A;  1QAK A;  4PEJ A;  1RSN A;  4HM7 B;  1SPU A;  2E2V A;  4KFD A;  1BNJ A;  2L1S A;  3VGN A;  3IJE B;  5BIR A;  5JPP A;  5G2G A;  5IEO A;  5M19 A;  3GZX B;  5I97 A;  3CCQ 3;  1QVF 2;  4NPB A;  3J7Y d;  3FCS B;  3OWS A;  1Q40 A;  1BGS A;  2BO9 B;  1AVL A;  3DM8 A;  1FW7 A;  2RSX A;  1FUT A;  3EHC A;  5KP3 A;  1Q82 4;  3MYT A;  3LTA A;  3GWR A;  5HGR A;  7STD A;  2C4B A;  5IEN A;  1RLS A;  3UNL A;  1N9J A;  5G1K A;  2BIR A;  4U13 A;  1OAC A;  1WMP A;  2XR8 B;  5CF2 A;  3OWU A;  3UL6 A;  2FXT A;  1BSB A;  2QA4 3;  1GSP A;  1PY3 A;  2XH9 A;  3NX0 A;  4XBX A;  1VQN 3;  3GSP A;  2XF3 A;  3FGY A;  4XDW A;  6GSP A;  4FMB A;  4GSP A;  2P0X A;  3D5G A;  4R80 A;  4XBY A;  3ZFZ A;  1K73 4;  4HM8 B;  3H51 A;  4BL2 A;  4CCV A;  1N5H A;  1ULJ B;  2KRT A;  1BUJ A;  3OW2 2;  3DGL A;  1RTU A;  4HZB B;  4RNZ A;  3CC7 3;  3FZW A;  5IG0 A;  1UDI I;  2GSP A;  1V74 A;  3K5T A;  2AAD A;  2WOH A;  1VQL 3;  5BVB A;  1B20 A;  3ECF A;  3BU4 A;  1B21 A;  1BOX A;  1RNT A;  2HMM B;  1UCJ A;  2MF7 A;  4BL3 A;  2FNQ A;  3K7C A;  3WMD A;  2CW9 A;  3B8L A;  4O2H A;  3QRD A;  3D5I A;  1RGL A;  2OCT A;  3DGO A;  1UCI A;  3BLZ A;  4STD A;  3WA2 X;  3DMC A;  1B2U A;  2ZDJ A;  3EN8 A;  1OGZ A;  3SX1 A;  3CMA 3;  1I3F A;  1IQX A;  1LQG C;  1WMN A;  3LT9 A;  3I55 3;  5EQL A;  2C11 A;  2HMK B;  4HM0 B;  2IUJ A;  1YHQ 3;  2Y74 A;  3B4O A;  1BSD A;  1ZS7 A;  3ER7 A;  2XFS A;  3A5E A;  3SOY A;  1JN5 B;  3CD6 3;  5FW5 A;  2HMJ B;  1VQ8 3;  1NU3 A;  4Q53 A;  2KAA A;  1Q7Y 4;  1LOW A;  1GMP A;  1MWR A;  4HYZ A;  3KZT A;  1JBR A;  2C10 A;  4KT3 B;  4LEH A;  2GXF A;  4N6N B;  3EE1 A;  1FGM A;  1A2P A;  1OPY A;  3X3Z A;  4LGQ A;  3F40 A;  3AMO A;  2F5M A;  2O3O A;  1JKG A;  4O3V A;  1D6U A;  2D1W A;  3X42 A;  5CLK A;  5AIH A;  4AKY A;  3CCE 3;  1C7H A;  1KQS 2;  3KKG A;  4NRE A;  3S29 A;  1W5Z A;  3D9R A;  5AEU B;  5CF1 A;  3KE7 A;  3F7X A;  1DMN A;  4BTX A;  1IYY A;  1JB4 A;  2B24 B;  2UUG C;  4FMC A;  5AYS C;  1V57 A;  3T8U A;  5IF6 A;  1QJG A;  1K28 A;  2P0M A;  2PZV A;  3AHS A;  1A2V A;  1GD3 A;  3HI7 A;  4N6O B;  5IG5 A;  5BU4 A;  1GOY A;  2BMR B;  3PZW A;  3WOE B;  4X2H A;  3MWZ A;  1TUH A;  3CCU 3;  1JZO A;  4N6T A;  1Y4K A;  4WWU C;  1IV7 A;  5DRE A;  3CME 3;  2BNG A;  2STD A;  5A0O B;  1BNS A;  5GSP A;  1N5P A;  3CCR 3;  1RGF A;  1BRK A;  1W7C A;  2R41 A;  3HII A;  1N8R 4;  4N6U A;  5KP4 A;  1JZD A;  3G8Z A;  3FH1 A;  1PYL A;  1YJN 3;  3CNX A;  1KSI A;  1X1Y A;  1MNL A;  2CWV A;  2RBI A;  2CWU A;  3KCH A;  4RBN A;  3PYJ A;  3X40 A;  1VQP 3;  1VZZ A;  4RNY A;  4J5K A;  2Y73 A;  2W2C A;  3DXO A;  1O7M B;  1TFK A;  2OTJ 3;  4R9L A;  1W01 A;  1QAF A;  1N9E A;  4HZ9 B;  1V58 A;  4BTW A;  4CJN A;  1OGX A;  4IPB A;  2XRX B;  2M7O A;  4N3V A;  3WHO A;  1STD A;  3MG3 A;  2GBX B;  2CFG A;  2RFR A;  2H0I A;  4HM5 B;  1TJD A;  2RCD A;  3K63 A;  1BRH A;  1BSC A;  1GD4 A;  1OUN A;  3OWY A;  3EX9 A;  3ZG0 A;  2OOV C;  1UGH I;  3HK4 A;  3URP A;  3D79 A;  1YJ9 3;  1L5G B;  2QEX 3;  3CPW 2;  3DUK A;  5IG3 A;  1EG9 B;  3MG2 A;  1BRJ A;  5IG4 A;  4IIA A;  1Q86 4;  1M1X B;  3JUN A;  1RJO A;  4MMY B;  2CFD A;  4XBT A;  2UX0 A;  1A90 A;  1TP6 A;  4HM6 B;  3ROB A;  2XSH B;  4HM1 B;  1G02 A;  4R4K A;  3UJM A;  3FSD A;  4LZI A;  1U5O A;  3NUV A;  1IVU A;  1QAL A;  4CDL A;  7GSP A;  1QVG 2;  1K9M 4;  2WGQ A;  3IPT A;  1K8A 4;  2CX1 A;  1WNH A;  1NB3 I;  1LOY A;  1MGW A;  4OVM A;  1UCK A;  3PGB A;  1DMQ A;  4KZ1 A;  3T8N A;  3LZA A;  2IA7 A;  3MPH A;  2W03 A;  3Q1C A;  2WGO A;  1OHO A;  3MSO A;  4EV5 A;  2K3D A;  2ZHX B;  4ZM8 A;  1Q7H A;  2INX A;  3N9H A;  4HVN A;  2MC8 A;  3LXU X;  4FMA A;  1E97 A;  3WA3 A;  3F14 A;  3EQQ B;  2YFJ B;  1GOU A;  1UI8 A;  3PS8 A;  3X3Y A;  3KFQ C;  1NDO B;  3HIG A;  3RNT A;  7RNT A;  4LSO A;  1FGO A;  2KCD A;  1NO3 A;  4HM3 B;  1I0X A;  1EA2 A;  3AMO B;  3D4A A;  3LT8 A;  3CPO A;  3JUP A;  3SED A;  2F5W A;  2Q07 A;  3F8X A;  3NBB A;  2W0Q A;  1U8C B;  2BHM A;  4I5Q A;  3B7C A;  4HBR A;  4HOH A;  2CG1 A;  1RGK A;  4GL6 A;  3CCV 3;  3Q90 A;  3BIR A;  3SYU A;  1LVN A;  1OF5 A;  6STD A;  1R4C A;  1EUI C;  2BMQ B;  3FLJ A;  2KXG A;  2F98 A;  5ELU A;  1NB5 I;  1JBT A;  1O7G B;  1HZ1 A;  1BAN A;  1O7N B;  4H3U A;  5JBS A;  1AR0 A;  1JNQ A;  1M9G A;  5AIG A;  3ZG5 A;  4EYC A;  3EJV A;  4GB5 A;  1ZX2 A;  2A15 A;  5LC6 A;  1ROA A;  1FGQ A;  5AII A;  4FR9 A;  3LH4 A;  1C54 A;  4JRF A;  1W6Y A;  1I0V A;  1TRP A;  3KSE D;  4ORL A;  3S28 A;  5FGO A;  2P38 A;  1DE3 A;  1Z1S A;  3OX9 A;  3RGR A;  2GBW B;  1I2G A;  3PCR A;  1GY5 A;  1W6C A;  1MOL A;  2R4I A;  3HZP A;  3NHX A;  4X2O A;  4AKZ A;  1RNB A;  1WQL B;  1UUW B;  3HOH A;  3KSP A;  2H0H A;  3FF2 A;  3G71 3;  2KF4 A;  3D3L A;  2WOF A;  3DZL A;  3NV0 A;  2OOV A;  1T2H A;  3CCS 3;  1TIJ A;  3G16 A;  3OV4 A;  4FCJ A;  1ZO2 A;  1JJ2 2;  5D82 A;  5D83 A;  4L8O A;  1TU5 A;  4HM2 B;  4O02 B;  2XSO B;  4RNT A;  1HKX A;  1W4N A;  1IVW A;  4MMZ B;  1O7H B;  2F86 B;  3GZY B;  1EEJ A;  1RN7 A;  5STD A;  3GZR A;  1DYU A;  3G4S 3;  1R4Y A;  3NBJ A;  3O8Y A;  1FZU A;  2O9U X;  5IER A;  3KN4 A;  1VQM 3;  1ISK A;  2CH9 A;  1IVX A;  3VSY A;  4LMI A;  3NM2 A;  1JKG B;  3AGN A;  3I0Y A;  1Q40 B;  3CCJ 3;  3PCS A;  1RRH A;  4OK0 A;  3SOA A;  1CH0 A;  3CCM 3;  8CHO A;  1UI7 A;  4XB5 A;  1OHS A;  1DMM A;  2W56 A;  4EXR A;  1IV9 A;  2CFL A;  3FG1 A;  2YFI B;  1A2K A;  3RDE A;  1AY7 A;  1RN4 A;  3U97 A;  3VF1 A;  1BIR A;  2E2U A;  3BND A;  3K0Z A;  5JPU A;  1VQ9 3;  2K54 A;  1B27 A;  4N6M A;  4KFF A;  5RNT A;  2W56 B;  3DY5 A;  1SQW A;  1MWT A;  3Q2P A;  5AI1 A;  2CC3 A;  1B2M A;  4BTY A;  4I4K A;  1I2E A;  1B2Z A;  2KF3 A;  1G96 A;  1ROV A;  1BRG A;  2IMJ A;  2BMO B;  3BNC A;  1LNI A;  4CPK A;  1RGA A;  3H3H A;  3S67 A;  3FKA A;  4KFE A;  4EW5 A;  3WOD G;  2KF6 A;  4K1U A;  1HYF A;  1OH0 A;  1T3B A;  1I70 A;  1CYU A;  3LML A;  3F8H A;  1AV4 A;  2OWP A;  1W2Z A;  2J8X B;  1QMA A;  2RGQ A;  3LTD A;  1O7W B;  1O7P B;  2LQV A;  3NXJ A;  2F4Y A;  3DH2 A;  3F9S A;  9RNT A;  2HMO B;  4J8T A;  1W2B 2;  5IEP A;  1LXE A;  2Z76 A;  1IT7 A;  1JN5 A;  2CFW A;  1W00 A;  3LTC A;  1OHP A;  1PU4 A;  3AHW A;  1IT8 A;  1OF5 B;  4K1V A;  3OXA A;  2BT3 A;  2JDI H;  2CWT A;  4FCZ A;  2KF5 A;  5M18 A;  2FGT A;  2P05 A;  3JUQ A;  1JB5 A;  4BU4 A;  1ZGX A;  1LOX A;  2W04 A;  4HKV B;  4FCM A;  2IYJ A;  1FUW A;  2WO0 A;  4AEQ A;  2PNC A;  2Z7A A;  1B3S A;  1TTO A;  5BXQ A;  1YI2 3;  1FUS A;  2H0G A;  2W6J H;  1BNE A;  3F7S A;  4N6V 0;  1UCL A;  4HAA A;  1FGR A;  2P09 A;  3Q3F A;  5G1L A;  1NNV A;  4N6L A;  4TX4 A;  2E2T A;  2Z77 A;  1ASK A;  2ZA4 A;  1JBS A;  1X1W A;  2IUK A;  1IDP A;  2RNT A;  1YIT 3;  3T0U A;  1DET A;  3M8C A;  2IY2 A; 
#chains in the Genus database with same CATH homology
 1RGE A;  1BU4 A;  1I0V A;  1SAR A;  1TRP A;  1BRN L;  1Q9E A;  2HOH A;  1YVS A;  3AHS A;  1DE3 A;  5BU4 A;  1BSA A;  1GOY A;  1I2G A;  1RN1 A;  1RNB A;  3HOH A;  1I8V A;  1RDS A;  1BRI A;  2KF4 A;  1T2H A;  1BNS A;  1BRS A;  5GSP A;  1RSN A;  1RHL A;  1BNG A;  1BNJ A;  1RGF A;  5BIR A;  1BRK A;  4RNT A;  1B2X A;  1PYL A;  1X1Y A;  2RBI A;  1BGS A;  3KCH A;  1R4Y A;  1FZU A;  1FW7 A;  1BNF A;  3DGY A;  1FUT A;  4J5K A;  1RGG A;  3AGN A;  1YNV X;  8RNT A;  1X1U A;  2C4B A;  1X1X A;  2F56 A;  3WHO A;  1RLS A;  1CH0 A;  2BIR A;  1BRH A;  1BSC A;  1AY7 A;  1RN4 A;  1BSB A;  1BIR A;  1GSP A;  1PY3 A;  3URP A;  3GSP A;  1B27 A;  6GSP A;  4GSP A;  5RNT A;  3D5G A;  2AAE A;  1BRJ A;  1B2M A;  1TRQ A;  1I2E A;  1RMS A;  1B2Z A;  2KF3 A;  1BRG A;  1RTU A;  1BAO A;  1LNI A;  1RGA A;  2BU4 A;  2SAR A;  2GSP A;  2AAD A;  5HOH A;  1B20 A;  1G02 A;  2KF6 A;  3BU4 A;  1B21 A;  1HYF A;  1BOX A;  1I70 A;  7GSP A;  1RNT A;  1RGC A;  1YGW A;  1UCJ A;  1RGH A;  1BNI A;  1I2F A;  1RCK A;  1T2I A;  1LOY A;  1MGW A;  4J5G A;  1UCK A;  2F4Y A;  3D5I A;  3DH2 A;  1RGL A;  9RNT A;  1BVI A;  1UCI A;  1B2U A;  1LOV A;  1I3F A;  1GOV A;  3AHW A;  4GHO A;  1RCL A;  1GOU A;  7RNT A;  2KF5 A;  3RNT A;  4BU4 A;  1GMQ A;  1BSD A;  1ZGX A;  4BIR A;  1I0X A;  3A5E A;  3D4A A;  1BSE A;  2F5W A;  1AQZ A;  1LRA A;  1B3S A;  2KAA A;  1LOW A;  1GMP A;  1TTO A;  4HOH A;  1RGK A;  1GMR A;  1FUS A;  6RNT A;  1B2S A;  1BNE A;  3BIR A;  1JBR A;  3SYU A;  3AGO A;  1BNR A;  1UCL A;  4HAA A;  1A2P A;  3Q3F A;  1JBT A;  1HZ1 A;  1BAN A;  1FYS A;  1I3I A;  2F5M A;  1X1W A;  2ZA4 A;  3WR2 A;  1JBS A;  2RNT A;  1BUJ A;  1MGR A;  1DET A;  1C54 A;  1IYY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...