1YNVX

Asp79 makes a large, unfavorable contribution to the stability of rnase sa
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
96
structure length
96
Chain Sequence
DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIITGEATQEDYYTGDHYATFSLIDKTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanyl-specific ribonuclease Sa
publication title Asp79 Makes a Large, Unfavorable Contribution to the Stability of RNase Sa.
pubmed doi rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase
total genus 26
structure length 96
sequence length 96
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2005-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1ynvX00
1R4YA 2BIRA 1B2XA 1BSBA 5RNTA 1BOXA 1X1YA 1X1UA 1DETA 3WR2A 1A2PA 1RGHA 1GMPA 1GOUA 1I2GA 1BNSA 3A5EA 1LOVA 1RCLA 3BU4A 1GMQA 1TRQA 1BRSA 1RMSA 1FUTA 1UCLA 1B2ZA 1HYFA 1I70A 2BU4A 1I0VA 1BNFA 1BVIA 1BNEA 4HOHA 2HOHA 1BSAA 1X1WA 3AGOA 1LOWA 1BNJA 1BANA 1UCIA 1TTOA 1RGGA 1G02A 1RGFA 1LNIA 1GOYA 3RNTA 4GSPA 5BIRA 1UCKA 1Q9EA 1RCKA 2F4YA 1FW7A 1FZUA 1RNBA 1RGKA 1RGCA 1UCJA 1RTUA 1I0XA 2RBIA 5HOHA 1BIRA 4J5GA 1B20A 1BNIA 1YVSA 4HAAA 1IYYA 1MGRA 3D5IA 1SARA 1GOVA 1B2SA 2RNTA 3AHSA 3D5GA 1RHLA 1I2FA 2KF3A 1BRKA 1I8VA 1TRPA 6GSPA 2ZA4A 1RDSA 1CH0A 1BSDA 2GSPA 2C4BA 1BUJA 3KCHA 1MGWA 1PY3A 1B3SA 9RNTA 1BNRA 1BAOA 3URPA 1JBTA 1YGWA 1B21A 1JBSA 1AQZA 1BGSA 1FYSA 1BNGA 1RGAA 2KAAA 2AADA 5GSPA 1RLSA 1PYLA 1C54A 3SYUA 1FUSA 5BU4A 1AY7A 1BRGA 1T2IA 3DGYA 2KF4A 3Q3FA 1X1XA 1RN4A 3BIRA 3AGNA 1RNTA 2KF5A 1B2MA 1I3FA 2SARA 1JBRA 1BRHA 1I2EA 1T2HA 1ZGXA 4BU4A 1RSNA 1I3IA 3GSPA 2AAEA 1BSCA 1BRJA 4BIRA 3D4AA 4J5KA 3HOHA 7GSPA 1RN1A 7RNTA 1YNVX 1RGEA 3AHWA 4RNTA 2KF6A 4GHOA 3DH2A 8RNTA 1HZ1A 1LRAA 1RGLA 1BSEA 3WHOA 1GMRA 1BRNL 1B2UA 1LOYA 2F56A 2F5MA 1BU4A 2F5WA 1GSPA 6RNTA 1DE3A 1B27A 1BRIA
chains in the Genus database with same CATH superfamily
3J7Yd 2HMNB 1B2XA 1MWRA 2XFTA 2IUJA 2XRXB 4MMZB 3N54B 1LVNA 1T3BA 1BOXA 1X1UA 1VQ83 3LOYA 2ML6A 1W4NA 2UGIA 2MF7A 1RGHA 2B24B 1I2GA 1UUWB 3PCSA 2E2VA 3UNLA 5AI1A 3M8CA 1VQN3 1KQS2 4FMDA 3D79A 1TRQA 4KT3B 5G1KA 5IERA 3GZYB 3JUMA 4N6OB 1YIJ3 3T8UA 2L1SA 4XM4A 4FMCA 1B2ZA 3OWUA 4N6TA 1EQKA 1ULIB 1SIHA 1BNFA 3K7CA 3SX1A 4N6LA 4N6MA 5EVHA 4LGQA 1IDPA 1UUGB 1BNEA 5ELJA 1FGTA 1BSAA 1X1WA 3AGOA 4KZ1A 4XBTA 4EBGA 1NJI4 2W9PA 1E3VA 1GS3A 2P38A 3EE1A 4O2HA 1KWIA 4PEJA 5AIFA 1LNIA 2XFSA 5M19A 4MMXB 1GOYA 3PGBA 4FMBA 4GSPA 4K1UA 1YJN3 4WHAA 3Q2PA 1TFOA 3ECFA 3HZPA 3JUOA 4K61A 3UL5A 1Q42A 1WMOA 3BLZA 4HM3B 1A2KA 5HGRA 1KD14 1NWWA 1RNBA 1JN5B 3G0KA 3IPTA 1RGKA 1RGCA 1UCJA 2RBIA 1I0XA 5HOHA 4HVNA 2IMJA 2LYXA 4ORLA 3F8HA 1BIRA 1EG9B 1UGIA 3PS8A 4J5GA 3S29A 4LZIA 4WYKA 1VQ73 3D3LA 1IYYA 4XDVA 3GZXB 5STDA 1CYUA 1DVCA 3EBTA 1RHLA 1U8CB 3K9MC 4XB5A 2PZVA 1Q7HA 1DMQA 1Q824 2XSOB 1T5YA 1UUVB 2F99A 5KP4A 1VQQA 2IA7A 2GSPA 1AV4A 2P0MA 2E2UA 1NNVA 3FG1A 4CPKA 3BNBA 4I4KA 1ZS7A 1YIT3 1UW1A 5IG3A 1OF5A 9RNTA 1BNRA 2HMKB 1W5ZA 1BGSA 5IW9A 1MNLA 1RLSA 1ZX2A 3K63A 1ISKA 1FUSA 1GY5A 1AY7A 1W00A 1HU9A 5G2GA 3CC73 5M18A 1FGOA 1OCVA 3GAXA 2KF4A 1DYUA 3OV4A 3F8XA 4CCVA 3LTCA 1D6YA 4MJDA 2CG1A 3CME3 3LT8A 3NQYA 1JBRA 2W04A 2WGQA 1IT7A 1IT8A 5IF6A 2D42A 3V92A 3FG3A 3GZBA 4BU4A 4EV2A 3I0YA 1RN7A 1BSCA 2Z77A 3NQZA 1N5PA 1YI23 1QVF2 7GSPA 2IUKA 2XEPA 1RN1A 3X3ZA 3FSDA 3MSOA 1A90A 2OQEA 4EC6A 3EBYA 3AHWA 4HM0B 2OTJ3 1HZ1A 3DXOA 3JUQA 3SOYA 1BSEA 1BRNL 1C7HA 3PZWA 4O3VA 2CX1A 1LOYA 1M9GA 2F56A 2GEXA 3ROBA 3SVAA 5JPUA 1OGXA 4LYLB 5KP3A 3FF2A 1B27A 2YFIB 1R4YA 1JN5A 2XF3A 1JV2B 1FGQA 1X1YA 1WMNA 4WYKB 1O7NB 3B4OA 2Z76A 1A2PA 1MWTA 2BNGA 1GMPA 1BNSA 4OUQA 4HJLB 3S5CA 3SLUA 3WA2X 1LNHA 4GL6A 3BU4A 1RKYA 1VQL3 1MWUA 4RNYA 3VGNA 3V99A 3DY5A 1RMSA 3WDGB 1JRQA 3X3YA 1TUHA 2GU1A 1CQSA 1VQK3 1RJOA 2BU4A 3F7SA 1JB5A 1I0VA 4AKZA 2HMLB 3CCE3 1AR0A 2F98A 2ML5A 2OOVC 2R4IA 4FMAA 4MMYB 3WA3A 2HOHA 3FGYA 3X41A 1LOWA 2JQ5A 5IG5A 3TDGA 1MWSA 1D6ZA 1GD3A 3F14A 4ILFA 4KFEA 1IV7A 3H3HA 3RNTA 5BIRA 5AIGA 3CCR3 3HI7A 3UL6A 1UCKA 5IENA 3Q1CA 5IEPA 3Q90A 1FUWA 1R4CA 3FLJA 3U97A 2F4YA 3HIGA 2H0GA 1LQMB 1ASKA 4HZ9B 2IY2A 3MHEA 4KFFA 4WFOA 5ELUA 2BO9B 1VQO3 4NREA 3DGLA 1B20A 1BNIA 1JJ22 5AYSC 1YHQ3 2RFRA 1CYVA 2BMQB 1O7GB 2WOFA 1ZO2A 2CG0A 3D5IA 3EN1B 1SARA 2WGOA 5EQLA 3HIIA 2XR8B 4BL3A 1I2FA 1JZOA 2I9WA 6GSPA 1OACA 2UUGC 2W03A 1BSDA 3EN8A 1O7HB 2H0HA 2W56B 3KCHA 3HK4A 3KSPA 3OX9A 3V98A 2D1WA 4XDWA 1IQYA 2XH9A 1N8QA 2Z7AA 2L4VA 1YGWA 1OUNA 4R9KA 1V57A 1JBSA 1AQZA 7STDA 1K9M4 2KAAA 4JRFA 1M904 2AADA 5GSPA 2A15A 1PYLA 2MC8A 5BU4A 4HYZA 1BRGA 2CX0A 4HM7B 4J8TA 5FW5A 1RN4A 2OWPA 2YFLB 1A2VA 2JDIH 3AGNA 2F86B 3BNDA 3MG2A 2KF5A 3S27A 1GY6A 5BVBA 1B2MA 4HM4B 1AVLA 1JNQA 3OW22 1FGRA 4XBYA 2C11A 2CK3H 2KCDA 3T0UA 5AEWB 1K28A 4FCZA 4R1KA 1I2EA 1UDII 3MG3A 3K0ZA 3JUNA 1PU4A 1RSNA 1I3IA 3GRDA 5DRVA 1QAFA 1UI7A 3BNCA 4RBNA 5JBSA 1TU5A 3HOHA 3AMOB 7RNTA 5AIIA 3VSYA 3EX9A 4BTWA 2OCTA 4RNTA 3L0RA 4HBRA 4QWTA 1W6CA 3DH2A 1JZDA 3LTDA 4LEHA 1G96A 4Q53A 3EQQB 1B2UA 2UX0A 1ROVA 2P09A 4KVHA 4J9AA 3CCU3 2F5WA 4K1VA 1GSPA 4EXRA 4HKVB 1FGMA 1US1A 6RNTA 3GWRA 3NM2A 5BXQA 1J2BA 1BSBA 1VQ63 5D81A 1OH0A 2PNCA 2Y73A 3CNXA 2QIYA 4HZBB 1DETA 3LMLA 3BB9A 1JKGB 3PYJA 3ER7A 1GOUA 1QVG2 3A5EA 2CHCA 1RCLA 5G1LA 4N6NB 1GMQA 3DGNA 1QMAA 2P0XA 4WWUC 1FA3A 1BRSA 3KZTA 4K90B 1FUTA 4N6V0 1OPYA 1UCLA 1TFKA 5IG0A 4BL2A 1HYFA 1TIJA 1F8NA 2GBXB 2W56A 3F7XA 4N3VA 3CCQ3 4WP5A 4KFDA 2CFKA 4LSOA 5A0OB 2J8XB 2XGNA 1S723 3LT9A 3B7CA 4HOHA 3LTBA 3FKAA 1OHOA 3ALAA 5CF2A 5EEOA 1BANA 3DUKA 1UCIA 4R9LA 1VZZA 2CWVA 3A76A 4BTYA 4EYCA 1EUIC 4G1MB 2Y74A 1IVUA 3LYGA 1ULJB 2Q07A 1RRHA 3FZWA 5D83A 2OQEC 1VQ43 1O7WB 3KN4A 2W9QA 1Q9EA 1SJWA 1RCKA 2BT3A 1U5OA 5DREA 3N9HA 1FW7A 2K3DA 1FZUA 3CPOA 3T8NA 3BNEA 3X40A 1RTUA 5CLKA 3I563 4CJNA 3NM7A 3CCJ3 3EC9A 2XGLA 3OXAA 2H0IA 2XSHB 4HM6B 1W6YA 4HAAA 3F9SA 3QK9A 3STDA 1B2SA 2CWTA 2RNTA 4O8SA 4R4KA 1O7MB 2BHMA 3CU3A 3CCL3 3AMOA 3H51A 3WMDA 1VQM3 2OOVA 2KF3A 1TRPA 3O8YA 5LC6A 5JPPA 1EKMA 1RDSA 1WMPA 2E2TA 1V74A 2WO0A 3E99A 1NB5I 2C4BA 1KSIA 4HM5B 1MGWA 3OWSA 1VQP3 1GD4A 1N9EA 2CKFB 2FGTA 3EJVA 1Q40B 1JB2A 2Z6BA 4I5QA 1YJW3 1B3SA 1A67A 3CC23 1YVBI 1BAOA 4NHFA 3RGRA 3URPA 1JBTA 1B21A 1VQ53 3MG1A 3ZFZA 1FYSA 1BNGA 1RGAA 4HM1B 1SQWA 3FF0A 1GY7A 2CIUA 2K54A 1C54A 3SYUA 1N9JA 1EEJA 1RRLA 3DGYA 1K41A 4FCJA 5I97A 1M1K4 5AYRB 3Q3FA 3WODG 3X42A 2CFGA 1JKGA 1RNTA 3KFQC 1YGEA 1UI8A 3ZG0A 1I3FA 3EHCA 1NDOB 3HX8A 1Q7Y4 2CW9A 2SARA 1WNHA 3LTAA 2FXTA 4LMIA 3SXXA 2ZDJA 1DMNA 1ZGXA 1T2HA 3JVCA 3I553 4IIAA 3GSPA 3KKGA 2AAEA 1BRJA 3UB1A 2INXA 4BIRA 3G16A 1W01A 2GBWB 2LQVA 4HM2B 8CHOA 4X2HA 2QEX3 2P05A 4FR9A 2W2CA 2KF6A 2YX9A 3B4PA 3QRDA 1LRAA 1G0TA 1L5GB 1GMRA 3FCSB 4O02B 1K8A4 1VQ93 3SOAA 1STFI 2F5MA 2WOHA 5IG4A 3EB8A 1BU4A 1NO3A 3NBBA 3F40A 3SEDA 2C10A 1UGHI 1DE3A 2O3OA 1BRIA 2BIRA 1IVWA 1YJ93 5FGOA 1LXEA 1TJDA 3KE7A 3NX0A 5RNTA 2SBLA 4CDLA 3DZLA 3WR2A 1M1XB 2RCDA 2V1LA 3G4S3 2GEYA 2QGUA 3MPHA 1Q864 5KP1A 5AEUB 3KIIA 1S5AA 1LOVA 3LXUX 5TGNA 4HM8B 4N6UA 3EF8A 2FNQA 1IQXA 1QAKA 1JB4A 1LOXA 2HMJB 1N8R4 1ROAA 5M1AA 1I70A 1D6UA 3DGMA 5LC7A 6STDA 3ZG5A 4AKYA 3NBRA 4GB5A 3NV0B 4L8OA 1BVIA 1Q40A 4RZMA 2GXFA 3WOEB 3DMCA 2CFDA 3FG4A 2M7OA 3CCS3 4OK0A 5IEOA 3OWYA 1BNJA 3NXJA 1EA2A 2CH9A 3B8LA 1TTOA 1IVVA 2CWUA 2W6JH 1RGGA 1G02A 2ZHXB 3FH1A 1RGFA 2GU3A 2QA43 3UJMA 4IT7A 3LH4A 3CD63 3G713 3PCRA 1Q814 1N5HA 4L7KA 2BMOB 3MWZA 3NHXA 2HMOB 1Z1SA 2CC3A 1LQGC 1IV9A 4BTXA 4IPBA 1CEWI 1OHSA 2YFJB 3X3XA 1NB3I 3DGOA 3U1WA 4U13A 3CCV3 1QJGA 1WQLB 1YVSA 4H61A 1O7PB 1SIIA 3CPW2 3CCM3 4STDA 1MGRA 1SPUA 3RDEA 1KC84 1DVDA 1GOVA 3AHSA 3D5GA 1OGZA 2RGQA 1BRKA 1I8VA 1Y4KA 2ZA4A 1CH0A 2K0MA 1QALA 4X2OA 2KRTA 1BUJA 1W7CA 4XBXA 2B1XB 3G8ZA 3CC43 1E3RA 3CMA3 3IJEB 1PY3A 4EV5A 1K734 4L8PA 2CFLA 1W02A 3K5TA 5CK6A 1OHPA 3DM8A 1PFPA 1T2IA 3NUVA 2STDA 2ZL8A 3S67A 1X1XA 4R80A 3BIRA 1W6GA 3D9RA 3JUPA 4FCMA 2CFWA 1IQ8A 5CXOA 3RGAA 4EW5A 1V58A 4TX4A 2W0QA 5D82A 3KSED 1W2B2 2O9UX 1HKXA 3MYTA 5CF1A 1DMMA 4NPBA 4RNZA 1BRHA 4MEIA 1WTHA 3NBJA 3S28A 1IVXA 3N8BA 1AVKA 1GYBA 4OVMA 3D4AA 4J5KA 3NV0A 4DKIA 1IK3A 1MOLA 1YNVX 3PXMA 5AIHA 1RGEA 1TP6A 3CXC2 2BMRB 3CNMA 3LZAA 4GHOA 3VF1A 4ZM8A 2RSXA 2HMMB 3MKIA 8RNTA 1IU7A 1NU3A 1RGLA 2KXGA 4H3UA 3WHOA 3WOFB 1BUQA 1OF5B 1E97A 1W2ZA 2OTL3 3IMAB 2R41A 4AEQA 3G6E3 1STDA 4JF8A 3GZRA 2IYJA
chains in the Genus database with same CATH topology
1R4YA 2BIRA 1B2XA 1BSBA 5RNTA 1BOXA 1X1YA 1X1UA 1DETA 3WR2A 1A2PA 1RGHA 1GMPA 1GOUA 1I2GA 1BNSA 3A5EA 1LOVA 1RCLA 3BU4A 1GMQA 1TRQA 1BRSA 1RMSA 1FUTA 1UCLA 1B2ZA 1HYFA 1I70A 2BU4A 1I0VA 1BNFA 1BVIA 1BNEA 4HOHA 2HOHA 1BSAA 1X1WA 3AGOA 1LOWA 1BNJA 1BANA 1UCIA 1TTOA 1RGGA 1G02A 1RGFA 1LNIA 1GOYA 3RNTA 4GSPA 5BIRA 1UCKA 1Q9EA 1RCKA 2F4YA 1FW7A 1FZUA 1RNBA 1RGKA 1RGCA 1UCJA 1RTUA 1I0XA 2RBIA 5HOHA 1BIRA 4J5GA 1B20A 1BNIA 1YVSA 4HAAA 1IYYA 1MGRA 3D5IA 1SARA 1GOVA 1B2SA 2RNTA 3AHSA 3D5GA 1RHLA 1I2FA 2KF3A 1BRKA 1I8VA 1TRPA 6GSPA 2ZA4A 1RDSA 1CH0A 1BSDA 2GSPA 2C4BA 1BUJA 3KCHA 1MGWA 1PY3A 1B3SA 9RNTA 1BNRA 1BAOA 3URPA 1JBTA 1YGWA 1B21A 1JBSA 1AQZA 1BGSA 1FYSA 1BNGA 1RGAA 2KAAA 2AADA 5GSPA 1RLSA 1PYLA 1C54A 3SYUA 1FUSA 5BU4A 1AY7A 1BRGA 1T2IA 3DGYA 2KF4A 3Q3FA 1X1XA 1RN4A 3BIRA 3AGNA 1RNTA 2KF5A 1B2MA 1I3FA 2SARA 1JBRA 1BRHA 1I2EA 1T2HA 1ZGXA 4BU4A 1RSNA 1I3IA 3GSPA 2AAEA 1BSCA 1BRJA 4BIRA 3D4AA 4J5KA 3HOHA 7GSPA 1RN1A 7RNTA 1YNVX 1RGEA 3AHWA 4RNTA 2KF6A 4GHOA 3DH2A 8RNTA 1HZ1A 1LRAA 1RGLA 1BSEA 3WHOA 1GMRA 1BRNL 1B2UA 1LOYA 2F56A 2F5MA 1BU4A 2F5WA 1GSPA 6RNTA 1DE3A 1B27A 1BRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R4Y A;  2BIR A;  1B2X A;  1BSB A;  5RNT A;  1BOX A;  1X1Y A;  1X1U A;  1DET A;  3WR2 A;  1A2P A;  1RGH A;  1GMP A;  1GOU A;  1I2G A;  1BNS A;  3A5E A;  1LOV A;  1RCL A;  3BU4 A;  1GMQ A;  1TRQ A;  1BRS A;  1RMS A;  1FUT A;  1UCL A;  1B2Z A;  1HYF A;  1I70 A;  2BU4 A;  1I0V A;  1BNF A;  1BVI A;  1BNE A;  4HOH A;  2HOH A;  1BSA A;  1X1W A;  3AGO A;  1LOW A;  1BNJ A;  1BAN A;  1UCI A;  1TTO A;  1RGG A;  1G02 A;  1RGF A;  1LNI A;  1GOY A;  3RNT A;  4GSP A;  5BIR A;  1UCK A;  1Q9E A;  1RCK A;  2F4Y A;  1FW7 A;  1FZU A;  1RNB A;  1RGK A;  1RGC A;  1UCJ A;  1RTU A;  1I0X A;  2RBI A;  5HOH A;  1BIR A;  4J5G A;  1B20 A;  1BNI A;  1YVS A;  4HAA A;  1IYY A;  1MGR A;  3D5I A;  1SAR A;  1GOV A;  1B2S A;  2RNT A;  3AHS A;  3D5G A;  1RHL A;  1I2F A;  2KF3 A;  1BRK A;  1I8V A;  1TRP A;  6GSP A;  2ZA4 A;  1RDS A;  1CH0 A;  1BSD A;  2GSP A;  2C4B A;  1BUJ A;  3KCH A;  1MGW A;  1PY3 A;  1B3S A;  9RNT A;  1BNR A;  1BAO A;  3URP A;  1JBT A;  1YGW A;  1B21 A;  1JBS A;  1AQZ A;  1BGS A;  1FYS A;  1BNG A;  1RGA A;  2KAA A;  2AAD A;  5GSP A;  1RLS A;  1PYL A;  1C54 A;  3SYU A;  1FUS A;  5BU4 A;  1AY7 A;  1BRG A;  1T2I A;  3DGY A;  2KF4 A;  3Q3F A;  1X1X A;  1RN4 A;  3BIR A;  3AGN A;  1RNT A;  2KF5 A;  1B2M A;  1I3F A;  2SAR A;  1JBR A;  1BRH A;  1I2E A;  1T2H A;  1ZGX A;  4BU4 A;  1RSN A;  1I3I A;  3GSP A;  2AAE A;  1BSC A;  1BRJ A;  4BIR A;  3D4A A;  4J5K A;  3HOH A;  7GSP A;  1RN1 A;  7RNT A;  1YNV X;  1RGE A;  3AHW A;  4RNT A;  2KF6 A;  4GHO A;  3DH2 A;  8RNT A;  1HZ1 A;  1LRA A;  1RGL A;  1BSE A;  3WHO A;  1GMR A;  1BRN L;  1B2U A;  1LOY A;  2F56 A;  2F5M A;  1BU4 A;  2F5W A;  1GSP A;  6RNT A;  1DE3 A;  1B27 A;  1BRI A; 
#chains in the Genus database with same CATH topology
 3J7Y d;  2HMN B;  1B2X A;  1MWR A;  2XFT A;  2IUJ A;  2XRX B;  4MMZ B;  3N54 B;  1LVN A;  1T3B A;  1BOX A;  1X1U A;  1VQ8 3;  3LOY A;  2ML6 A;  1W4N A;  2UGI A;  2MF7 A;  1RGH A;  2B24 B;  1I2G A;  1UUW B;  3PCS A;  2E2V A;  3UNL A;  5AI1 A;  3M8C A;  1VQN 3;  1KQS 2;  4FMD A;  3D79 A;  1TRQ A;  4KT3 B;  5G1K A;  5IER A;  3GZY B;  3JUM A;  4N6O B;  1YIJ 3;  3T8U A;  2L1S A;  4XM4 A;  4FMC A;  1B2Z A;  3OWU A;  4N6T A;  1EQK A;  1ULI B;  1SIH A;  1BNF A;  3K7C A;  3SX1 A;  4N6L A;  4N6M A;  5EVH A;  4LGQ A;  1IDP A;  1UUG B;  1BNE A;  5ELJ A;  1FGT A;  1BSA A;  1X1W A;  3AGO A;  4KZ1 A;  4XBT A;  4EBG A;  1NJI 4;  2W9P A;  1E3V A;  1GS3 A;  2P38 A;  3EE1 A;  4O2H A;  1KWI A;  4PEJ A;  5AIF A;  1LNI A;  2XFS A;  5M19 A;  4MMX B;  1GOY A;  3PGB A;  4FMB A;  4GSP A;  4K1U A;  1YJN 3;  4WHA A;  3Q2P A;  1TFO A;  3ECF A;  3HZP A;  3JUO A;  4K61 A;  3UL5 A;  1Q42 A;  1WMO A;  3BLZ A;  4HM3 B;  1A2K A;  5HGR A;  1KD1 4;  1NWW A;  1RNB A;  1JN5 B;  3G0K A;  3IPT A;  1RGK A;  1RGC A;  1UCJ A;  2RBI A;  1I0X A;  5HOH A;  4HVN A;  2IMJ A;  2LYX A;  4ORL A;  3F8H A;  1BIR A;  1EG9 B;  1UGI A;  3PS8 A;  4J5G A;  3S29 A;  4LZI A;  4WYK A;  1VQ7 3;  3D3L A;  1IYY A;  4XDV A;  3GZX B;  5STD A;  1CYU A;  1DVC A;  3EBT A;  1RHL A;  1U8C B;  3K9M C;  4XB5 A;  2PZV A;  1Q7H A;  1DMQ A;  1Q82 4;  2XSO B;  1T5Y A;  1UUV B;  2F99 A;  5KP4 A;  1VQQ A;  2IA7 A;  2GSP A;  1AV4 A;  2P0M A;  2E2U A;  1NNV A;  3FG1 A;  4CPK A;  3BNB A;  4I4K A;  1ZS7 A;  1YIT 3;  1UW1 A;  5IG3 A;  1OF5 A;  9RNT A;  1BNR A;  2HMK B;  1W5Z A;  1BGS A;  5IW9 A;  1MNL A;  1RLS A;  1ZX2 A;  3K63 A;  1ISK A;  1FUS A;  1GY5 A;  1AY7 A;  1W00 A;  1HU9 A;  5G2G A;  3CC7 3;  5M18 A;  1FGO A;  1OCV A;  3GAX A;  2KF4 A;  1DYU A;  3OV4 A;  3F8X A;  4CCV A;  3LTC A;  1D6Y A;  4MJD A;  2CG1 A;  3CME 3;  3LT8 A;  3NQY A;  1JBR A;  2W04 A;  2WGQ A;  1IT7 A;  1IT8 A;  5IF6 A;  2D42 A;  3V92 A;  3FG3 A;  3GZB A;  4BU4 A;  4EV2 A;  3I0Y A;  1RN7 A;  1BSC A;  2Z77 A;  3NQZ A;  1N5P A;  1YI2 3;  1QVF 2;  7GSP A;  2IUK A;  2XEP A;  1RN1 A;  3X3Z A;  3FSD A;  3MSO A;  1A90 A;  2OQE A;  4EC6 A;  3EBY A;  3AHW A;  4HM0 B;  2OTJ 3;  1HZ1 A;  3DXO A;  3JUQ A;  3SOY A;  1BSE A;  1BRN L;  1C7H A;  3PZW A;  4O3V A;  2CX1 A;  1LOY A;  1M9G A;  2F56 A;  2GEX A;  3ROB A;  3SVA A;  5JPU A;  1OGX A;  4LYL B;  5KP3 A;  3FF2 A;  1B27 A;  2YFI B;  1R4Y A;  1JN5 A;  2XF3 A;  1JV2 B;  1FGQ A;  1X1Y A;  1WMN A;  4WYK B;  1O7N B;  3B4O A;  2Z76 A;  1A2P A;  1MWT A;  2BNG A;  1GMP A;  1BNS A;  4OUQ A;  4HJL B;  3S5C A;  3SLU A;  3WA2 X;  1LNH A;  4GL6 A;  3BU4 A;  1RKY A;  1VQL 3;  1MWU A;  4RNY A;  3VGN A;  3V99 A;  3DY5 A;  1RMS A;  3WDG B;  1JRQ A;  3X3Y A;  1TUH A;  2GU1 A;  1CQS A;  1VQK 3;  1RJO A;  2BU4 A;  3F7S A;  1JB5 A;  1I0V A;  4AKZ A;  2HML B;  3CCE 3;  1AR0 A;  2F98 A;  2ML5 A;  2OOV C;  2R4I A;  4FMA A;  4MMY B;  3WA3 A;  2HOH A;  3FGY A;  3X41 A;  1LOW A;  2JQ5 A;  5IG5 A;  3TDG A;  1MWS A;  1D6Z A;  1GD3 A;  3F14 A;  4ILF A;  4KFE A;  1IV7 A;  3H3H A;  3RNT A;  5BIR A;  5AIG A;  3CCR 3;  3HI7 A;  3UL6 A;  1UCK A;  5IEN A;  3Q1C A;  5IEP A;  3Q90 A;  1FUW A;  1R4C A;  3FLJ A;  3U97 A;  2F4Y A;  3HIG A;  2H0G A;  1LQM B;  1ASK A;  4HZ9 B;  2IY2 A;  3MHE A;  4KFF A;  4WFO A;  5ELU A;  2BO9 B;  1VQO 3;  4NRE A;  3DGL A;  1B20 A;  1BNI A;  1JJ2 2;  5AYS C;  1YHQ 3;  2RFR A;  1CYV A;  2BMQ B;  1O7G B;  2WOF A;  1ZO2 A;  2CG0 A;  3D5I A;  3EN1 B;  1SAR A;  2WGO A;  5EQL A;  3HII A;  2XR8 B;  4BL3 A;  1I2F A;  1JZO A;  2I9W A;  6GSP A;  1OAC A;  2UUG C;  2W03 A;  1BSD A;  3EN8 A;  1O7H B;  2H0H A;  2W56 B;  3KCH A;  3HK4 A;  3KSP A;  3OX9 A;  3V98 A;  2D1W A;  4XDW A;  1IQY A;  2XH9 A;  1N8Q A;  2Z7A A;  2L4V A;  1YGW A;  1OUN A;  4R9K A;  1V57 A;  1JBS A;  1AQZ A;  7STD A;  1K9M 4;  2KAA A;  4JRF A;  1M90 4;  2AAD A;  5GSP A;  2A15 A;  1PYL A;  2MC8 A;  5BU4 A;  4HYZ A;  1BRG A;  2CX0 A;  4HM7 B;  4J8T A;  5FW5 A;  1RN4 A;  2OWP A;  2YFL B;  1A2V A;  2JDI H;  3AGN A;  2F86 B;  3BND A;  3MG2 A;  2KF5 A;  3S27 A;  1GY6 A;  5BVB A;  1B2M A;  4HM4 B;  1AVL A;  1JNQ A;  3OW2 2;  1FGR A;  4XBY A;  2C11 A;  2CK3 H;  2KCD A;  3T0U A;  5AEW B;  1K28 A;  4FCZ A;  4R1K A;  1I2E A;  1UDI I;  3MG3 A;  3K0Z A;  3JUN A;  1PU4 A;  1RSN A;  1I3I A;  3GRD A;  5DRV A;  1QAF A;  1UI7 A;  3BNC A;  4RBN A;  5JBS A;  1TU5 A;  3HOH A;  3AMO B;  7RNT A;  5AII A;  3VSY A;  3EX9 A;  4BTW A;  2OCT A;  4RNT A;  3L0R A;  4HBR A;  4QWT A;  1W6C A;  3DH2 A;  1JZD A;  3LTD A;  4LEH A;  1G96 A;  4Q53 A;  3EQQ B;  1B2U A;  2UX0 A;  1ROV A;  2P09 A;  4KVH A;  4J9A A;  3CCU 3;  2F5W A;  4K1V A;  1GSP A;  4EXR A;  4HKV B;  1FGM A;  1US1 A;  6RNT A;  3GWR A;  3NM2 A;  5BXQ A;  1J2B A;  1BSB A;  1VQ6 3;  5D81 A;  1OH0 A;  2PNC A;  2Y73 A;  3CNX A;  2QIY A;  4HZB B;  1DET A;  3LML A;  3BB9 A;  1JKG B;  3PYJ A;  3ER7 A;  1GOU A;  1QVG 2;  3A5E A;  2CHC A;  1RCL A;  5G1L A;  4N6N B;  1GMQ A;  3DGN A;  1QMA A;  2P0X A;  4WWU C;  1FA3 A;  1BRS A;  3KZT A;  4K90 B;  1FUT A;  4N6V 0;  1OPY A;  1UCL A;  1TFK A;  5IG0 A;  4BL2 A;  1HYF A;  1TIJ A;  1F8N A;  2GBX B;  2W56 A;  3F7X A;  4N3V A;  3CCQ 3;  4WP5 A;  4KFD A;  2CFK A;  4LSO A;  5A0O B;  2J8X B;  2XGN A;  1S72 3;  3LT9 A;  3B7C A;  4HOH A;  3LTB A;  3FKA A;  1OHO A;  3ALA A;  5CF2 A;  5EEO A;  1BAN A;  3DUK A;  1UCI A;  4R9L A;  1VZZ A;  2CWV A;  3A76 A;  4BTY A;  4EYC A;  1EUI C;  4G1M B;  2Y74 A;  1IVU A;  3LYG A;  1ULJ B;  2Q07 A;  1RRH A;  3FZW A;  5D83 A;  2OQE C;  1VQ4 3;  1O7W B;  3KN4 A;  2W9Q A;  1Q9E A;  1SJW A;  1RCK A;  2BT3 A;  1U5O A;  5DRE A;  3N9H A;  1FW7 A;  2K3D A;  1FZU A;  3CPO A;  3T8N A;  3BNE A;  3X40 A;  1RTU A;  5CLK A;  3I56 3;  4CJN A;  3NM7 A;  3CCJ 3;  3EC9 A;  2XGL A;  3OXA A;  2H0I A;  2XSH B;  4HM6 B;  1W6Y A;  4HAA A;  3F9S A;  3QK9 A;  3STD A;  1B2S A;  2CWT A;  2RNT A;  4O8S A;  4R4K A;  1O7M B;  2BHM A;  3CU3 A;  3CCL 3;  3AMO A;  3H51 A;  3WMD A;  1VQM 3;  2OOV A;  2KF3 A;  1TRP A;  3O8Y A;  5LC6 A;  5JPP A;  1EKM A;  1RDS A;  1WMP A;  2E2T A;  1V74 A;  2WO0 A;  3E99 A;  1NB5 I;  2C4B A;  1KSI A;  4HM5 B;  1MGW A;  3OWS A;  1VQP 3;  1GD4 A;  1N9E A;  2CKF B;  2FGT A;  3EJV A;  1Q40 B;  1JB2 A;  2Z6B A;  4I5Q A;  1YJW 3;  1B3S A;  1A67 A;  3CC2 3;  1YVB I;  1BAO A;  4NHF A;  3RGR A;  3URP A;  1JBT A;  1B21 A;  1VQ5 3;  3MG1 A;  3ZFZ A;  1FYS A;  1BNG A;  1RGA A;  4HM1 B;  1SQW A;  3FF0 A;  1GY7 A;  2CIU A;  2K54 A;  1C54 A;  3SYU A;  1N9J A;  1EEJ A;  1RRL A;  3DGY A;  1K41 A;  4FCJ A;  5I97 A;  1M1K 4;  5AYR B;  3Q3F A;  3WOD G;  3X42 A;  2CFG A;  1JKG A;  1RNT A;  3KFQ C;  1YGE A;  1UI8 A;  3ZG0 A;  1I3F A;  3EHC A;  1NDO B;  3HX8 A;  1Q7Y 4;  2CW9 A;  2SAR A;  1WNH A;  3LTA A;  2FXT A;  4LMI A;  3SXX A;  2ZDJ A;  1DMN A;  1ZGX A;  1T2H A;  3JVC A;  3I55 3;  4IIA A;  3GSP A;  3KKG A;  2AAE A;  1BRJ A;  3UB1 A;  2INX A;  4BIR A;  3G16 A;  1W01 A;  2GBW B;  2LQV A;  4HM2 B;  8CHO A;  4X2H A;  2QEX 3;  2P05 A;  4FR9 A;  2W2C A;  2KF6 A;  2YX9 A;  3B4P A;  3QRD A;  1LRA A;  1G0T A;  1L5G B;  1GMR A;  3FCS B;  4O02 B;  1K8A 4;  1VQ9 3;  3SOA A;  1STF I;  2F5M A;  2WOH A;  5IG4 A;  3EB8 A;  1BU4 A;  1NO3 A;  3NBB A;  3F40 A;  3SED A;  2C10 A;  1UGH I;  1DE3 A;  2O3O A;  1BRI A;  2BIR A;  1IVW A;  1YJ9 3;  5FGO A;  1LXE A;  1TJD A;  3KE7 A;  3NX0 A;  5RNT A;  2SBL A;  4CDL A;  3DZL A;  3WR2 A;  1M1X B;  2RCD A;  2V1L A;  3G4S 3;  2GEY A;  2QGU A;  3MPH A;  1Q86 4;  5KP1 A;  5AEU B;  3KII A;  1S5A A;  1LOV A;  3LXU X;  5TGN A;  4HM8 B;  4N6U A;  3EF8 A;  2FNQ A;  1IQX A;  1QAK A;  1JB4 A;  1LOX A;  2HMJ B;  1N8R 4;  1ROA A;  5M1A A;  1I70 A;  1D6U A;  3DGM A;  5LC7 A;  6STD A;  3ZG5 A;  4AKY A;  3NBR A;  4GB5 A;  3NV0 B;  4L8O A;  1BVI A;  1Q40 A;  4RZM A;  2GXF A;  3WOE B;  3DMC A;  2CFD A;  3FG4 A;  2M7O A;  3CCS 3;  4OK0 A;  5IEO A;  3OWY A;  1BNJ A;  3NXJ A;  1EA2 A;  2CH9 A;  3B8L A;  1TTO A;  1IVV A;  2CWU A;  2W6J H;  1RGG A;  1G02 A;  2ZHX B;  3FH1 A;  1RGF A;  2GU3 A;  2QA4 3;  3UJM A;  4IT7 A;  3LH4 A;  3CD6 3;  3G71 3;  3PCR A;  1Q81 4;  1N5H A;  4L7K A;  2BMO B;  3MWZ A;  3NHX A;  2HMO B;  1Z1S A;  2CC3 A;  1LQG C;  1IV9 A;  4BTX A;  4IPB A;  1CEW I;  1OHS A;  2YFJ B;  3X3X A;  1NB3 I;  3DGO A;  3U1W A;  4U13 A;  3CCV 3;  1QJG A;  1WQL B;  1YVS A;  4H61 A;  1O7P B;  1SII A;  3CPW 2;  3CCM 3;  4STD A;  1MGR A;  1SPU A;  3RDE A;  1KC8 4;  1DVD A;  1GOV A;  3AHS A;  3D5G A;  1OGZ A;  2RGQ A;  1BRK A;  1I8V A;  1Y4K A;  2ZA4 A;  1CH0 A;  2K0M A;  1QAL A;  4X2O A;  2KRT A;  1BUJ A;  1W7C A;  4XBX A;  2B1X B;  3G8Z A;  3CC4 3;  1E3R A;  3CMA 3;  3IJE B;  1PY3 A;  4EV5 A;  1K73 4;  4L8P A;  2CFL A;  1W02 A;  3K5T A;  5CK6 A;  1OHP A;  3DM8 A;  1PFP A;  1T2I A;  3NUV A;  2STD A;  2ZL8 A;  3S67 A;  1X1X A;  4R80 A;  3BIR A;  1W6G A;  3D9R A;  3JUP A;  4FCM A;  2CFW A;  1IQ8 A;  5CXO A;  3RGA A;  4EW5 A;  1V58 A;  4TX4 A;  2W0Q A;  5D82 A;  3KSE D;  1W2B 2;  2O9U X;  1HKX A;  3MYT A;  5CF1 A;  1DMM A;  4NPB A;  4RNZ A;  1BRH A;  4MEI A;  1WTH A;  3NBJ A;  3S28 A;  1IVX A;  3N8B A;  1AVK A;  1GYB A;  4OVM A;  3D4A A;  4J5K A;  3NV0 A;  4DKI A;  1IK3 A;  1MOL A;  1YNV X;  3PXM A;  5AIH A;  1RGE A;  1TP6 A;  3CXC 2;  2BMR B;  3CNM A;  3LZA A;  4GHO A;  3VF1 A;  4ZM8 A;  2RSX A;  2HMM B;  3MKI A;  8RNT A;  1IU7 A;  1NU3 A;  1RGL A;  2KXG A;  4H3U A;  3WHO A;  3WOF B;  1BUQ A;  1OF5 B;  1E97 A;  1W2Z A;  2OTL 3;  3IMA B;  2R41 A;  4AEQ A;  3G6E 3;  1STD A;  4JF8 A;  3GZR A;  2IYJ A; 
#chains in the Genus database with same CATH homology
 1R4Y A;  2BIR A;  1B2X A;  1BSB A;  5RNT A;  1BOX A;  1X1Y A;  1X1U A;  1DET A;  3WR2 A;  1A2P A;  1RGH A;  1GMP A;  1GOU A;  1I2G A;  1BNS A;  3A5E A;  1LOV A;  1RCL A;  3BU4 A;  1GMQ A;  1TRQ A;  1BRS A;  1RMS A;  1FUT A;  1UCL A;  1B2Z A;  1HYF A;  1I70 A;  2BU4 A;  1I0V A;  1BNF A;  1BVI A;  1BNE A;  4HOH A;  2HOH A;  1BSA A;  1X1W A;  3AGO A;  1LOW A;  1BNJ A;  1BAN A;  1UCI A;  1TTO A;  1RGG A;  1G02 A;  1RGF A;  1LNI A;  1GOY A;  3RNT A;  4GSP A;  5BIR A;  1UCK A;  1Q9E A;  1RCK A;  2F4Y A;  1FW7 A;  1FZU A;  1RNB A;  1RGK A;  1RGC A;  1UCJ A;  1RTU A;  1I0X A;  2RBI A;  5HOH A;  1BIR A;  4J5G A;  1B20 A;  1BNI A;  1YVS A;  4HAA A;  1IYY A;  1MGR A;  3D5I A;  1SAR A;  1GOV A;  1B2S A;  2RNT A;  3AHS A;  3D5G A;  1RHL A;  1I2F A;  2KF3 A;  1BRK A;  1I8V A;  1TRP A;  6GSP A;  2ZA4 A;  1RDS A;  1CH0 A;  1BSD A;  2GSP A;  2C4B A;  1BUJ A;  3KCH A;  1MGW A;  1PY3 A;  1B3S A;  9RNT A;  1BNR A;  1BAO A;  3URP A;  1JBT A;  1YGW A;  1B21 A;  1JBS A;  1AQZ A;  1BGS A;  1FYS A;  1BNG A;  1RGA A;  2KAA A;  2AAD A;  5GSP A;  1RLS A;  1PYL A;  1C54 A;  3SYU A;  1FUS A;  5BU4 A;  1AY7 A;  1BRG A;  1T2I A;  3DGY A;  2KF4 A;  3Q3F A;  1X1X A;  1RN4 A;  3BIR A;  3AGN A;  1RNT A;  2KF5 A;  1B2M A;  1I3F A;  2SAR A;  1JBR A;  1BRH A;  1I2E A;  1T2H A;  1ZGX A;  4BU4 A;  1RSN A;  1I3I A;  3GSP A;  2AAE A;  1BSC A;  1BRJ A;  4BIR A;  3D4A A;  4J5K A;  3HOH A;  7GSP A;  1RN1 A;  7RNT A;  1YNV X;  1RGE A;  3AHW A;  4RNT A;  2KF6 A;  4GHO A;  3DH2 A;  8RNT A;  1HZ1 A;  1LRA A;  1RGL A;  1BSE A;  3WHO A;  1GMR A;  1BRN L;  1B2U A;  1LOY A;  2F56 A;  2F5M A;  1BU4 A;  2F5W A;  1GSP A;  6RNT A;  1DE3 A;  1B27 A;  1BRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...