1YNVX

Asp79 makes a large, unfavorable contribution to the stability of rnase sa
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
96
structure length
96
Chain Sequence
DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIITGEATQEDYYTGDHYATFSLIDKTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Asp79 Makes a Large, Unfavorable Contribution to the Stability of RNase Sa.
pubmed doi rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase
molecule keywords Guanyl-specific ribonuclease Sa
total genus 26
structure length 96
sequence length 96
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2005-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1ynvX00
1JBTA 1MGRA 1TRPA 7RNTA 1I3FA 1BRHA 1BNEA 4HAAA 1RGLA 1I2GA 1YVSA 2KF6A 1RN1A 1LOVA 1AQZA 1LRAA 1T2HA 1FW7A 1I0XA 1BNJA 1IYYA 1BNRA 1FUSA 1YGWA 2AAEA 1LOWA 1BRIA 1GOYA 1BUJA 4HOHA 1DE3A 1RGKA 2F5WA 3DGYA 4J5GA 1RSNA 1LOYA 3DH2A 4GSPA 1B2XA 5GSPA 2KAAA 3KCHA 4J5KA 1BRGA 1RN4A 6RNTA 1RHLA 1UCLA 1GOVA 1ZGXA 3AGOA 2RBIA 3AGNA 1RCKA 1RGHA 1BOXA 1B2ZA 1BRJA 1B21A 3AHWA 2HOHA 1I2EA 1JBRA 1BRSA 1JBSA 1RNBA 2AADA 1RGCA 4BU4A 3BU4A 1BNSA 1I3IA 2GSPA 3WHOA 5RNTA 7GSPA 3HOHA 1Q9EA 1HZ1A 2ZA4A 1BSBA 1YNVX 2F5MA 1PYLA 1TTOA 1BVIA 4BIRA 1DETA 1FYSA 1BNIA 1RGGA 1B3SA 2BIRA 1GMPA 1I0VA 1RGFA 5HOHA 9RNTA 2KF4A 1UCIA 1BGSA 1B27A 8RNTA 1BAOA 1B2MA 1AY7A 1BRKA 1C54A 1GSPA 1GOUA 5BU4A 1I70A 1RTUA 1UCJA 1SARA 2C4BA 3D5GA 3D4AA 3GSPA 4RNTA 1LNIA 1RMSA 1PY3A 1HYFA 4GHOA 1BSEA 1GMRA 1FUTA 1RDSA 1RNTA 2SARA 1BNGA 1X1YA 2F4YA 3SYUA 1TRQA 3Q3FA 1B2UA 1R4YA 2BU4A 2KF5A 1RGAA 6GSPA 1FZUA 3RNTA 1BSCA 1BANA 1G02A 1T2IA 1I2FA 1UCKA 1BNFA 1I8VA 1BU4A 5BIRA 2RNTA 1BSDA 1RGEA 3D5IA 1BRNL 1B2SA 1RLSA 1BSAA 2F56A 1BIRA 1RCLA 1X1XA 1X1UA 3A5EA 2KF3A 1CH0A 3AHSA 3BIRA 3WR2A 1MGWA 1GMQA 1B20A 1X1WA 3URPA 1A2PA
chains in the Genus database with same CATH superfamily
1NNVA 1TFKA 1JBTA 1LVNA 1Q7HA 1SIHA 4KVHA 5IG0A 3CXC2 3B8LA 2XFSA 3JUPA 3LTBA 3WODG 1YVSA 3LTCA 1QALA 5M1AA 3X3XA 1ULJB 1YIT3 1I0XA 4N6V0 3PZWA 3EF8A 3BB9A 1YGWA 3DGLA 1AV4A 1JZOA 2MF7A 3EBTA 5ELUA 1EQKA 3PYJA 5ELJA 1ISKA 3FH1A 2F5WA 3HK4A 4KFFA 3DGYA 1KSIA 1NO3A 3IMAB 1Q7Y4 1PFPA 5FW5A 1N5HA 1QAKA 3QK9A 4GSPA 2CIUA 1DMNA 2KAAA 1QVF2 1L5GB 5CF1A 1NJI4 4J5KA 4XBYA 1UW1A 3FG4A 3G16A 5IG5A 1RN4A 1ZS7A 6RNTA 2J8XB 1VQL3 2BT3A 3AGNA 3CCR3 2I9WA 3GWRA 1BRJA 2ZHXB 3B4PA 3HI7A 1E3VA 1WMNA 1STFI 2HMLB 1GY5A 1TP6A 1G96A 1V57A 3MKIA 1A67A 3GZRA 2K3DA 1JBSA 1RNBA 1RGCA 3CCM3 2OCTA 1S5AA 1K41A 5KP4A 1W00A 1OHOA 5RNTA 3PCRA 1EA2A 1Q9EA 5D81A 1FGQA 1A90A 3NQYA 1W6CA 3NUVA 1RRHA 1TTOA 1WNHA 1A2KA 3S28A 3SOYA 1VQN3 2OQEA 4RBNA 3H3HA 2GXFA 3CMA3 1U8CB 5I97A 3KSPA 3I553 2UUGC 3Q1CA 3EN8A 1GY7A 1D6ZA 3LTAA 1IK3A 1RGFA 2D1WA 9RNTA 2KF4A 1W7CA 1BGSA 5CLKA 5AIGA 4BL3A 1JJ22 3SOAA 1B27A 1W2ZA 4RNYA 3DUKA 3STDA 4FCMA 1IVXA 4N6UA 1BAOA 8RNTA 1UGIA 4LSOA 1RRLA 1GOUA 3UJMA 1KQS2 1I70A 3UNLA 3ALAA 4RNTA 1RMSA 1YVBI 4G1MB 1GYBA 1HYFA 3BNBA 1BSEA 1YGEA 3DMCA 5AYSC 1GMRA 1N9JA 1FUTA 2KXGA 3WOFB 4AEQA 2SARA 1BNGA 1MWTA 5G1LA 1CEWI 1UI7A 2CWUA 2BU4A 1RGAA 1IT7A 1TIJA 2L1SA 1OCVA 1BSCA 3F8XA 5TGNA 2A15A 3V99A 1T2IA 2KCDA 5IERA 3CCV3 1I2FA 1TFOA 4N6TA 1I8VA 1Z1SA 2ML6A 3MHEA 1OHSA 1YI23 1VZZA 3GZBA 1QVG2 1OHPA 2LQVA 4HM3B 4R9KA 5M19A 5A0OB 2CX0A 3FG3A 1VQ63 3D5IA 1GY6A 1N8QA 5IW9A 1KWIA 1MWUA 1BSAA 3CNMA 3SLUA 4FCJA 3CME3 1DVCA 1X1UA 4IT7A 1UUGB 2KF3A 3A5EA 4NHFA 3BIRA 1D6YA 1MGWA 3WA3A 3FCSB 3NM7A 1NWWA 4WWUC 1FW7A 3MSOA 3G713 1MGRA 1TRPA 4XBTA 3RGRA 1F8NA 2HMNB 3N8BA 1O7PB 3ECFA 3X3YA 3F7XA 4HAAA 5STDA 1K734 1IQ8A 1E3RA 1I2GA 1Q42A 4I4KA 4LYLB 2CFKA 1S723 3HIGA 4ORLA 1AVLA 2W03A 1Q864 1FUWA 2JDIH 3SVAA 3MG2A 1BRIA 2STDA 4WFOA 1GOYA 3T8NA 3CCU3 2OTL3 1MWRA 1VQ83 4AKZA 4DKIA 1CYVA 4J5GA 1RSNA 2ZDJA 4XDWA 2CFWA 4WP5A 3HX8A 2QGUA 2WOFA 4K1VA 4EV5A 3CU3A 2M7OA 3CC23 3DH2A 5AIHA 2B24B 2XH9A 1JB5A 3JUMA 1M904 1LOXA 2WOHA 4XBXA 1VQO3 3D79A 2PNCA 5JBSA 1J2BA 1ZGXA 3UL6A 2CFGA 1W02A 2BMRB 3X41A 1EG9B 1B21A 2PZVA 4FMBA 4FMAA 2CHCA 5BXQA 3LH4A 2W2CA 1YJ93 2IUKA 3CNXA 2O3OA 1BRSA 4K1UA 4IIAA 3FLJA 2W0QA 3BNEA 3EE1A 3BU4A 2XGLA 3KIIA 4O2HA 3E99A 2CWVA 3HOHA 2HMMB 4OK0A 2W6JH 1Q824 1BSBA 4BTYA 2F5MA 2FNQA 1LXEA 2ZL8A 1JKGA 5IENA 1FGTA 1BVIA 5DRVA 4BIRA 2F99A 3MPHA 1MOLA 1O7HB 1FYSA 1DMMA 4EV2A 5LC7A 3JUQA 2W56A 3MG3A 4BL2A 1ROAA 1RJOA 3CCJ3 1VQ93 1V58A 3CPW2 2E2TA 3HIIA 2OOVA 1CQSA 1TUHA 4HVNA 3K7CA 4EYCA 1UI8A 1E97A 3DY5A 1N5PA 2CW9A 1B2MA 1AY7A 3LTDA 5BU4A 3D5GA 1JB2A 4RZMA 3N54B 3GSPA 2YFLB 2WGQA 3OWSA 3QRDA 2YX9A 3X40A 1PY3A 7STDA 1Y4KA 4HYZA 2GEXA 1ROVA 2YFJB 3K9MC 3IJEB 1VQ53 1M1XB 1N9EA 2F4YA 1U5OA 1TRQA 3Q3FA 2SBLA 4TX4A 3SYUA 3SEDA 1OF5A 3NX0A 1VQP3 1OGZA 2KF5A 4K61A 4HBRA 5AIIA 5D82A 1FZUA 1US1A 5IF6A 1N8R4 2BMOB 2W56B 3IPTA 1BANA 1DYUA 4HZ9B 2F98A 2QA43 3K0ZA 4R1KA 4LEHA 3M8CA 5IG3A 2FGTA 5JPPA 2W9PA 4MMZB 4BTWA 1IV9A 1G0TA 1NDOB 3LZAA 4LMIA 4N6OB 4EBGA 1OACA 4HM6B 3NM2A 1JN5A 5BIRA 2W9QA 3S29A 1C7HA 3G6E3 1Q814 1VQ43 3L0RA 2QIYA 5AEUB 1BRNL 1B2SA 1AR0A 2L4VA 3LYGA 3NHXA 3SXXA 1RCLA 3GZXB 1TU5A 3AMOA 3WR2A 1IDPA 5AIFA 2RSXA 5HGRA 1GMQA 1X1WA 1A2PA 3B7CA 3LOYA 3S67A 5M18A 2XRXB 3G8ZA 7RNTA 4CDLA 1I3FA 1BRHA 5JPUA 1BNEA 1R4CA 1O7WB 1W5ZA 2BO9B 2XF3A 3JVCA 3OWUA 3NBJA 4JRFA 3CCE3 2Z6BA 4R80A 1RN1A 1LOVA 1AQZA 2IY2A 1LRAA 3F40A 2Z76A 4NREA 1SQWA 1BNRA 4O8SA 1FUSA 2AAEA 3ER7A 3FGYA 1JZDA 4J8TA 4Q53A 2IUJA 3GAXA 4HM5B 4KT3B 1VQM3 4FMCA 1BUJA 2BMQB 4HOHA 1M9GA 3MWZA 3NXJA 2RCDA 2H0IA 1UUVB 1OF5B 1WTHA 3FZWA 1W6YA 3I0YA 3F9SA 2CWTA 5GSPA 5CF2A 1HKXA 1K28A 1TJDA 3CPOA 4QWTA 4L7KA 3LMLA 2HMJB 2BNGA 2F86B 3HZPA 1KC84 2XGNA 1PU4A 2RBIA 3OXAA 4MMYB 1FGOA 1RCKA 3NBRA 1BOXA 1O7GB 4MJDA 3LT9A 2XEPA 3X42A 1RN7A 2CG1A 3AHWA 3OX9A 2HOHA 2GU1A 6STDA 3J7Yd 3G4S3 1WQLB 4O3VA 4STDA 1JBRA 3KKGA 1K8A4 1FGMA 3D3LA 2Q07A 4R4KA 4WYKB 2AADA 3D9RA 4FCZA 1BNSA 1I3IA 2GSPA 3O8YA 4HKVB 4HM4B 4PEJA 2E2VA 4XM4A 1HZ1A 2ZA4A 1MWSA 1JRQA 2CK3H 1DMQA 1HU9A 3SX1A 2OTJ3 3UL5A 4CJNA 1D6UA 3ZG5A 1KD14 1EEJA 2XSOB 4BTXA 3MYTA 1DVDA 3DM8A 4LGQA 1FGRA 1RGGA 2QEX3 1K9M4 1Q40A 3F7SA 1B3SA 4MEIA 4EC6A 5CXOA 1BUQA 4HM2B 3G0KA 3MG1A 5KP1A 4N3VA 2BHMA 1EKMA 3BLZA 1UCIA 1W2B2 3UB1A 2Z7AA 3K63A 3PXMA 4JF8A 3GZYB 2INXA 5EVHA 2H0HA 4K90B 3T8UA 4KFDA 1BRKA 4HM0B 4J9AA 2C4BA 4FR9A 1SARA 2IMJA 2CC3A 3EQQB 3I563 3CCL3 3WMDA 3S5CA 2Y73A 4GHOA 1UGHI 1OPYA 2XFTA 1JB4A 3B4OA 4KZ1A 8CHOA 3EX9A 5LC6A 3NV0B 1IU7A 2IA7A 4WHAA 1B2UA 1R4YA 3EBYA 2WO0A 5EQLA 1JNQA 3FKAA 4LZIA 4HM8B 6GSPA 2GBWB 2CFLA 4WYKA 1VQQA 3RNTA 4MMXB 5AI1A 4H3UA 2XSHB 4H61A 3EJVA 1BNFA 4ILFA 4N6NB 2H0GA 3F14A 3GRDA 5EEOA 1IVVA 1BU4A 2W04A 4O02B 2UX0A 2RNTA 4U13A 3CC73 3PGBA 5IEPA 1IVUA 4EW5A 1RLSA 2V1LA 3FF0A 1BIRA 2JQ5A 5DREA 2D42A 1IT8A 1X1XA 3FF2A 3WOEB 2RFRA 4HZBB 1CH0A 2Z77A 3AHSA 3NV0A 4NPBA 4L8PA 1IQYA 1Q40B 1EUIC 2K0MA 1JV2B 3EC9A 1SPUA 2C10A 2WGOA 3DGOA 4X2OA 2B1XB 2MC8A 3NQZA 4KFEA 1JN5B 1RGLA 2CX1A 1WMOA 2IYJA 2KF6A 1T2HA 3KFQC 1GD3A 2KRTA 3DGNA 1BNJA 4FMDA 1YHQ3 1IYYA 1LOWA 3DXOA 2OWPA 4X2HA 3WA2X 1OGXA 2GBXB 3U97A 1OUNA 3H51A 1GD4A 1DE3A 1RGKA 1QAFA 2HMKB 3T0UA 1LOYA 4EXRA 4N6LA 1YJN3 3DGMA 4N6MA 1B2XA 1O7MB 4HM1B 1ZO2A 3KCHA 1BRGA 3A76A 1ZX2A 4IPBA 1RHLA 1UCLA 1GOVA 3NBBA 3AGOA 1UDII 1QJGA 2LYXA 3DZLA 3VGNA 3KZTA 1RGHA 1OH0A 1B2ZA 1GS3A 3ZFZA 5FGOA 1SJWA 1W4NA 1I2EA 5G2GA 1T5YA 1ASKA 3RDEA 2P0XA 3TDGA 2OQEC 2HMOB 3BNDA 3VSYA 3K5TA 1VQ73 3FG1A 3WDGB 1JKGB 4BU4A 3CC43 5D83A 1O7NB 5AEWB 3WHOA 5IG4A 3FSDA 2R41A 3X3ZA 4GB5A 7GSPA 1ULIB 2P0MA 1YNVX 4ZM8A 1PYLA 2UGIA 3PS8A 5KP3A 3PCSA 1V74A 4XB5A 1DETA 2CFDA 3LXUX 5G1KA 3ZG0A 2ML5A 1BNIA 1M1K4 1YIJ3 2BIRA 1GMPA 1I0VA 1W6GA 5CK6A 3VF1A 3JUOA 5HOHA 1NU3A 1MNLA 3OWYA 1FA3A 2E2UA 5IEOA 3KE7A 1VQK3 2CKFB 2CH9A 4HJLB 2R4IA 3KSED 4HM7B 1QMAA 1C54A 1GSPA 3EN1B 3N9HA 2RGQA 1RKYA 1RTUA 1UCJA 3OW22 4CCVA 3CCQ3 3D4AA 3V92A 1LNIA 4OUQA 3Q90A 1STDA 2O9UX 2P05A 1RDSA 1RNTA 1A2VA 4I5QA 2C11A 2P09A 2Y74A 1LQMB 1NB5I 1X1YA 4AKYA 1NB3I 3EB8A 2K54A 1IQXA 4L8OA 1LNHA 4R9LA 2XR8B 3KN4A 1YJW3 3V98A 3Q2PA 5BVBA 1G02A 3LT8A 3U1WA 3RGAA 3CCS3 4XDVA 4GL6A 2CG0A 1UCKA 4OVMA 3OV4A 3F8HA 1CYUA 1T3BA 2GU3A 1AVKA 3EHCA 1SIIA 3AMOB 1WMPA 1BSDA 3S27A 2P38A 1RGEA 1IV7A 2YFIB 2FXTA 3BNCA 2F56A 1LQGC 1IVWA 2OOVC 2GEYA 3JUNA 3CD63 1UUWB 4CPKA 5AYRB 1W01A 1B20A 4RNZA 3URPA 3ROBA
chains in the Genus database with same CATH topology
1JBTA 1MGRA 1TRPA 7RNTA 1I3FA 1BRHA 1BNEA 4HAAA 1RGLA 1I2GA 1YVSA 2KF6A 1RN1A 1LOVA 1AQZA 1LRAA 1T2HA 1FW7A 1I0XA 1BNJA 1IYYA 1BNRA 1FUSA 1YGWA 2AAEA 1LOWA 1BRIA 1GOYA 1BUJA 4HOHA 1DE3A 1RGKA 2F5WA 3DGYA 4J5GA 1RSNA 1LOYA 3DH2A 4GSPA 1B2XA 5GSPA 2KAAA 3KCHA 4J5KA 1BRGA 1RN4A 6RNTA 1RHLA 1UCLA 1GOVA 1ZGXA 3AGOA 2RBIA 3AGNA 1RCKA 1RGHA 1BOXA 1B2ZA 1BRJA 1B21A 3AHWA 2HOHA 1I2EA 1JBRA 1BRSA 1JBSA 1RNBA 2AADA 1RGCA 4BU4A 3BU4A 1BNSA 1I3IA 2GSPA 3WHOA 5RNTA 7GSPA 3HOHA 1Q9EA 1HZ1A 2ZA4A 1BSBA 1YNVX 2F5MA 1PYLA 1TTOA 1BVIA 4BIRA 1DETA 1FYSA 1BNIA 1RGGA 1B3SA 2BIRA 1GMPA 1I0VA 1RGFA 5HOHA 9RNTA 2KF4A 1UCIA 1BGSA 1B27A 8RNTA 1BAOA 1B2MA 1AY7A 1BRKA 1C54A 1GSPA 1GOUA 5BU4A 1I70A 1RTUA 1UCJA 1SARA 2C4BA 3D5GA 3D4AA 3GSPA 4RNTA 1LNIA 1RMSA 1PY3A 1HYFA 4GHOA 1BSEA 1GMRA 1FUTA 1RDSA 1RNTA 2SARA 1BNGA 1X1YA 2F4YA 3SYUA 1TRQA 3Q3FA 1B2UA 1R4YA 2BU4A 2KF5A 1RGAA 6GSPA 1FZUA 3RNTA 1BSCA 1BANA 1G02A 1T2IA 1I2FA 1UCKA 1BNFA 1I8VA 1BU4A 5BIRA 2RNTA 1BSDA 1RGEA 3D5IA 1BRNL 1B2SA 1RLSA 1BSAA 2F56A 1BIRA 1RCLA 1X1XA 1X1UA 3A5EA 2KF3A 1CH0A 3AHSA 3BIRA 3WR2A 1MGWA 1GMQA 1B20A 1X1WA 3URPA 1A2PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JBT A;  1MGR A;  1TRP A;  7RNT A;  1I3F A;  1BRH A;  1BNE A;  4HAA A;  1RGL A;  1I2G A;  1YVS A;  2KF6 A;  1RN1 A;  1LOV A;  1AQZ A;  1LRA A;  1T2H A;  1FW7 A;  1I0X A;  1BNJ A;  1IYY A;  1BNR A;  1FUS A;  1YGW A;  2AAE A;  1LOW A;  1BRI A;  1GOY A;  1BUJ A;  4HOH A;  1DE3 A;  1RGK A;  2F5W A;  3DGY A;  4J5G A;  1RSN A;  1LOY A;  3DH2 A;  4GSP A;  1B2X A;  5GSP A;  2KAA A;  3KCH A;  4J5K A;  1BRG A;  1RN4 A;  6RNT A;  1RHL A;  1UCL A;  1GOV A;  1ZGX A;  3AGO A;  2RBI A;  3AGN A;  1RCK A;  1RGH A;  1BOX A;  1B2Z A;  1BRJ A;  1B21 A;  3AHW A;  2HOH A;  1I2E A;  1JBR A;  1BRS A;  1JBS A;  1RNB A;  2AAD A;  1RGC A;  4BU4 A;  3BU4 A;  1BNS A;  1I3I A;  2GSP A;  3WHO A;  5RNT A;  7GSP A;  3HOH A;  1Q9E A;  1HZ1 A;  2ZA4 A;  1BSB A;  1YNV X;  2F5M A;  1PYL A;  1TTO A;  1BVI A;  4BIR A;  1DET A;  1FYS A;  1BNI A;  1RGG A;  1B3S A;  2BIR A;  1GMP A;  1I0V A;  1RGF A;  5HOH A;  9RNT A;  2KF4 A;  1UCI A;  1BGS A;  1B27 A;  8RNT A;  1BAO A;  1B2M A;  1AY7 A;  1BRK A;  1C54 A;  1GSP A;  1GOU A;  5BU4 A;  1I70 A;  1RTU A;  1UCJ A;  1SAR A;  2C4B A;  3D5G A;  3D4A A;  3GSP A;  4RNT A;  1LNI A;  1RMS A;  1PY3 A;  1HYF A;  4GHO A;  1BSE A;  1GMR A;  1FUT A;  1RDS A;  1RNT A;  2SAR A;  1BNG A;  1X1Y A;  2F4Y A;  3SYU A;  1TRQ A;  3Q3F A;  1B2U A;  1R4Y A;  2BU4 A;  2KF5 A;  1RGA A;  6GSP A;  1FZU A;  3RNT A;  1BSC A;  1BAN A;  1G02 A;  1T2I A;  1I2F A;  1UCK A;  1BNF A;  1I8V A;  1BU4 A;  5BIR A;  2RNT A;  1BSD A;  1RGE A;  3D5I A;  1BRN L;  1B2S A;  1RLS A;  1BSA A;  2F56 A;  1BIR A;  1RCL A;  1X1X A;  1X1U A;  3A5E A;  2KF3 A;  1CH0 A;  3AHS A;  3BIR A;  3WR2 A;  1MGW A;  1GMQ A;  1B20 A;  1X1W A;  3URP A;  1A2P A; 
#chains in the Genus database with same CATH topology
 1NNV A;  1TFK A;  1JBT A;  1LVN A;  1Q7H A;  1SIH A;  4KVH A;  5IG0 A;  3CXC 2;  3B8L A;  2XFS A;  3JUP A;  3LTB A;  3WOD G;  1YVS A;  3LTC A;  1QAL A;  5M1A A;  3X3X A;  1ULJ B;  1YIT 3;  1I0X A;  4N6V 0;  3PZW A;  3EF8 A;  3BB9 A;  1YGW A;  3DGL A;  1AV4 A;  1JZO A;  2MF7 A;  3EBT A;  5ELU A;  1EQK A;  3PYJ A;  5ELJ A;  1ISK A;  3FH1 A;  2F5W A;  3HK4 A;  4KFF A;  3DGY A;  1KSI A;  1NO3 A;  3IMA B;  1Q7Y 4;  1PFP A;  5FW5 A;  1N5H A;  1QAK A;  3QK9 A;  4GSP A;  2CIU A;  1DMN A;  2KAA A;  1QVF 2;  1L5G B;  5CF1 A;  1NJI 4;  4J5K A;  4XBY A;  1UW1 A;  3FG4 A;  3G16 A;  5IG5 A;  1RN4 A;  1ZS7 A;  6RNT A;  2J8X B;  1VQL 3;  2BT3 A;  3AGN A;  3CCR 3;  2I9W A;  3GWR A;  1BRJ A;  2ZHX B;  3B4P A;  3HI7 A;  1E3V A;  1WMN A;  1STF I;  2HML B;  1GY5 A;  1TP6 A;  1G96 A;  1V57 A;  3MKI A;  1A67 A;  3GZR A;  2K3D A;  1JBS A;  1RNB A;  1RGC A;  3CCM 3;  2OCT A;  1S5A A;  1K41 A;  5KP4 A;  1W00 A;  1OHO A;  5RNT A;  3PCR A;  1EA2 A;  1Q9E A;  5D81 A;  1FGQ A;  1A90 A;  3NQY A;  1W6C A;  3NUV A;  1RRH A;  1TTO A;  1WNH A;  1A2K A;  3S28 A;  3SOY A;  1VQN 3;  2OQE A;  4RBN A;  3H3H A;  2GXF A;  3CMA 3;  1U8C B;  5I97 A;  3KSP A;  3I55 3;  2UUG C;  3Q1C A;  3EN8 A;  1GY7 A;  1D6Z A;  3LTA A;  1IK3 A;  1RGF A;  2D1W A;  9RNT A;  2KF4 A;  1W7C A;  1BGS A;  5CLK A;  5AIG A;  4BL3 A;  1JJ2 2;  3SOA A;  1B27 A;  1W2Z A;  4RNY A;  3DUK A;  3STD A;  4FCM A;  1IVX A;  4N6U A;  1BAO A;  8RNT A;  1UGI A;  4LSO A;  1RRL A;  1GOU A;  3UJM A;  1KQS 2;  1I70 A;  3UNL A;  3ALA A;  4RNT A;  1RMS A;  1YVB I;  4G1M B;  1GYB A;  1HYF A;  3BNB A;  1BSE A;  1YGE A;  3DMC A;  5AYS C;  1GMR A;  1N9J A;  1FUT A;  2KXG A;  3WOF B;  4AEQ A;  2SAR A;  1BNG A;  1MWT A;  5G1L A;  1CEW I;  1UI7 A;  2CWU A;  2BU4 A;  1RGA A;  1IT7 A;  1TIJ A;  2L1S A;  1OCV A;  1BSC A;  3F8X A;  5TGN A;  2A15 A;  3V99 A;  1T2I A;  2KCD A;  5IER A;  3CCV 3;  1I2F A;  1TFO A;  4N6T A;  1I8V A;  1Z1S A;  2ML6 A;  3MHE A;  1OHS A;  1YI2 3;  1VZZ A;  3GZB A;  1QVG 2;  1OHP A;  2LQV A;  4HM3 B;  4R9K A;  5M19 A;  5A0O B;  2CX0 A;  3FG3 A;  1VQ6 3;  3D5I A;  1GY6 A;  1N8Q A;  5IW9 A;  1KWI A;  1MWU A;  1BSA A;  3CNM A;  3SLU A;  4FCJ A;  3CME 3;  1DVC A;  1X1U A;  4IT7 A;  1UUG B;  2KF3 A;  3A5E A;  4NHF A;  3BIR A;  1D6Y A;  1MGW A;  3WA3 A;  3FCS B;  3NM7 A;  1NWW A;  4WWU C;  1FW7 A;  3MSO A;  3G71 3;  1MGR A;  1TRP A;  4XBT A;  3RGR A;  1F8N A;  2HMN B;  3N8B A;  1O7P B;  3ECF A;  3X3Y A;  3F7X A;  4HAA A;  5STD A;  1K73 4;  1IQ8 A;  1E3R A;  1I2G A;  1Q42 A;  4I4K A;  4LYL B;  2CFK A;  1S72 3;  3HIG A;  4ORL A;  1AVL A;  2W03 A;  1Q86 4;  1FUW A;  2JDI H;  3SVA A;  3MG2 A;  1BRI A;  2STD A;  4WFO A;  1GOY A;  3T8N A;  3CCU 3;  2OTL 3;  1MWR A;  1VQ8 3;  4AKZ A;  4DKI A;  1CYV A;  4J5G A;  1RSN A;  2ZDJ A;  4XDW A;  2CFW A;  4WP5 A;  3HX8 A;  2QGU A;  2WOF A;  4K1V A;  4EV5 A;  3CU3 A;  2M7O A;  3CC2 3;  3DH2 A;  5AIH A;  2B24 B;  2XH9 A;  1JB5 A;  3JUM A;  1M90 4;  1LOX A;  2WOH A;  4XBX A;  1VQO 3;  3D79 A;  2PNC A;  5JBS A;  1J2B A;  1ZGX A;  3UL6 A;  2CFG A;  1W02 A;  2BMR B;  3X41 A;  1EG9 B;  1B21 A;  2PZV A;  4FMB A;  4FMA A;  2CHC A;  5BXQ A;  3LH4 A;  2W2C A;  1YJ9 3;  2IUK A;  3CNX A;  2O3O A;  1BRS A;  4K1U A;  4IIA A;  3FLJ A;  2W0Q A;  3BNE A;  3EE1 A;  3BU4 A;  2XGL A;  3KII A;  4O2H A;  3E99 A;  2CWV A;  3HOH A;  2HMM B;  4OK0 A;  2W6J H;  1Q82 4;  1BSB A;  4BTY A;  2F5M A;  2FNQ A;  1LXE A;  2ZL8 A;  1JKG A;  5IEN A;  1FGT A;  1BVI A;  5DRV A;  4BIR A;  2F99 A;  3MPH A;  1MOL A;  1O7H B;  1FYS A;  1DMM A;  4EV2 A;  5LC7 A;  3JUQ A;  2W56 A;  3MG3 A;  4BL2 A;  1ROA A;  1RJO A;  3CCJ 3;  1VQ9 3;  1V58 A;  3CPW 2;  2E2T A;  3HII A;  2OOV A;  1CQS A;  1TUH A;  4HVN A;  3K7C A;  4EYC A;  1UI8 A;  1E97 A;  3DY5 A;  1N5P A;  2CW9 A;  1B2M A;  1AY7 A;  3LTD A;  5BU4 A;  3D5G A;  1JB2 A;  4RZM A;  3N54 B;  3GSP A;  2YFL B;  2WGQ A;  3OWS A;  3QRD A;  2YX9 A;  3X40 A;  1PY3 A;  7STD A;  1Y4K A;  4HYZ A;  2GEX A;  1ROV A;  2YFJ B;  3K9M C;  3IJE B;  1VQ5 3;  1M1X B;  1N9E A;  2F4Y A;  1U5O A;  1TRQ A;  3Q3F A;  2SBL A;  4TX4 A;  3SYU A;  3SED A;  1OF5 A;  3NX0 A;  1VQP 3;  1OGZ A;  2KF5 A;  4K61 A;  4HBR A;  5AII A;  5D82 A;  1FZU A;  1US1 A;  5IF6 A;  1N8R 4;  2BMO B;  2W56 B;  3IPT A;  1BAN A;  1DYU A;  4HZ9 B;  2F98 A;  2QA4 3;  3K0Z A;  4R1K A;  4LEH A;  3M8C A;  5IG3 A;  2FGT A;  5JPP A;  2W9P A;  4MMZ B;  4BTW A;  1IV9 A;  1G0T A;  1NDO B;  3LZA A;  4LMI A;  4N6O B;  4EBG A;  1OAC A;  4HM6 B;  3NM2 A;  1JN5 A;  5BIR A;  2W9Q A;  3S29 A;  1C7H A;  3G6E 3;  1Q81 4;  1VQ4 3;  3L0R A;  2QIY A;  5AEU B;  1BRN L;  1B2S A;  1AR0 A;  2L4V A;  3LYG A;  3NHX A;  3SXX A;  1RCL A;  3GZX B;  1TU5 A;  3AMO A;  3WR2 A;  1IDP A;  5AIF A;  2RSX A;  5HGR A;  1GMQ A;  1X1W A;  1A2P A;  3B7C A;  3LOY A;  3S67 A;  5M18 A;  2XRX B;  3G8Z A;  7RNT A;  4CDL A;  1I3F A;  1BRH A;  5JPU A;  1BNE A;  1R4C A;  1O7W B;  1W5Z A;  2BO9 B;  2XF3 A;  3JVC A;  3OWU A;  3NBJ A;  4JRF A;  3CCE 3;  2Z6B A;  4R80 A;  1RN1 A;  1LOV A;  1AQZ A;  2IY2 A;  1LRA A;  3F40 A;  2Z76 A;  4NRE A;  1SQW A;  1BNR A;  4O8S A;  1FUS A;  2AAE A;  3ER7 A;  3FGY A;  1JZD A;  4J8T A;  4Q53 A;  2IUJ A;  3GAX A;  4HM5 B;  4KT3 B;  1VQM 3;  4FMC A;  1BUJ A;  2BMQ B;  4HOH A;  1M9G A;  3MWZ A;  3NXJ A;  2RCD A;  2H0I A;  1UUV B;  1OF5 B;  1WTH A;  3FZW A;  1W6Y A;  3I0Y A;  3F9S A;  2CWT A;  5GSP A;  5CF2 A;  1HKX A;  1K28 A;  1TJD A;  3CPO A;  4QWT A;  4L7K A;  3LML A;  2HMJ B;  2BNG A;  2F86 B;  3HZP A;  1KC8 4;  2XGN A;  1PU4 A;  2RBI A;  3OXA A;  4MMY B;  1FGO A;  1RCK A;  3NBR A;  1BOX A;  1O7G B;  4MJD A;  3LT9 A;  2XEP A;  3X42 A;  1RN7 A;  2CG1 A;  3AHW A;  3OX9 A;  2HOH A;  2GU1 A;  6STD A;  3J7Y d;  3G4S 3;  1WQL B;  4O3V A;  4STD A;  1JBR A;  3KKG A;  1K8A 4;  1FGM A;  3D3L A;  2Q07 A;  4R4K A;  4WYK B;  2AAD A;  3D9R A;  4FCZ A;  1BNS A;  1I3I A;  2GSP A;  3O8Y A;  4HKV B;  4HM4 B;  4PEJ A;  2E2V A;  4XM4 A;  1HZ1 A;  2ZA4 A;  1MWS A;  1JRQ A;  2CK3 H;  1DMQ A;  1HU9 A;  3SX1 A;  2OTJ 3;  3UL5 A;  4CJN A;  1D6U A;  3ZG5 A;  1KD1 4;  1EEJ A;  2XSO B;  4BTX A;  3MYT A;  1DVD A;  3DM8 A;  4LGQ A;  1FGR A;  1RGG A;  2QEX 3;  1K9M 4;  1Q40 A;  3F7S A;  1B3S A;  4MEI A;  4EC6 A;  5CXO A;  1BUQ A;  4HM2 B;  3G0K A;  3MG1 A;  5KP1 A;  4N3V A;  2BHM A;  1EKM A;  3BLZ A;  1UCI A;  1W2B 2;  3UB1 A;  2Z7A A;  3K63 A;  3PXM A;  4JF8 A;  3GZY B;  2INX A;  5EVH A;  2H0H A;  4K90 B;  3T8U A;  4KFD A;  1BRK A;  4HM0 B;  4J9A A;  2C4B A;  4FR9 A;  1SAR A;  2IMJ A;  2CC3 A;  3EQQ B;  3I56 3;  3CCL 3;  3WMD A;  3S5C A;  2Y73 A;  4GHO A;  1UGH I;  1OPY A;  2XFT A;  1JB4 A;  3B4O A;  4KZ1 A;  8CHO A;  3EX9 A;  5LC6 A;  3NV0 B;  1IU7 A;  2IA7 A;  4WHA A;  1B2U A;  1R4Y A;  3EBY A;  2WO0 A;  5EQL A;  1JNQ A;  3FKA A;  4LZI A;  4HM8 B;  6GSP A;  2GBW B;  2CFL A;  4WYK A;  1VQQ A;  3RNT A;  4MMX B;  5AI1 A;  4H3U A;  2XSH B;  4H61 A;  3EJV A;  1BNF A;  4ILF A;  4N6N B;  2H0G A;  3F14 A;  3GRD A;  5EEO A;  1IVV A;  1BU4 A;  2W04 A;  4O02 B;  2UX0 A;  2RNT A;  4U13 A;  3CC7 3;  3PGB A;  5IEP A;  1IVU A;  4EW5 A;  1RLS A;  2V1L A;  3FF0 A;  1BIR A;  2JQ5 A;  5DRE A;  2D42 A;  1IT8 A;  1X1X A;  3FF2 A;  3WOE B;  2RFR A;  4HZB B;  1CH0 A;  2Z77 A;  3AHS A;  3NV0 A;  4NPB A;  4L8P A;  1IQY A;  1Q40 B;  1EUI C;  2K0M A;  1JV2 B;  3EC9 A;  1SPU A;  2C10 A;  2WGO A;  3DGO A;  4X2O A;  2B1X B;  2MC8 A;  3NQZ A;  4KFE A;  1JN5 B;  1RGL A;  2CX1 A;  1WMO A;  2IYJ A;  2KF6 A;  1T2H A;  3KFQ C;  1GD3 A;  2KRT A;  3DGN A;  1BNJ A;  4FMD A;  1YHQ 3;  1IYY A;  1LOW A;  3DXO A;  2OWP A;  4X2H A;  3WA2 X;  1OGX A;  2GBX B;  3U97 A;  1OUN A;  3H51 A;  1GD4 A;  1DE3 A;  1RGK A;  1QAF A;  2HMK B;  3T0U A;  1LOY A;  4EXR A;  4N6L A;  1YJN 3;  3DGM A;  4N6M A;  1B2X A;  1O7M B;  4HM1 B;  1ZO2 A;  3KCH A;  1BRG A;  3A76 A;  1ZX2 A;  4IPB A;  1RHL A;  1UCL A;  1GOV A;  3NBB A;  3AGO A;  1UDI I;  1QJG A;  2LYX A;  3DZL A;  3VGN A;  3KZT A;  1RGH A;  1OH0 A;  1B2Z A;  1GS3 A;  3ZFZ A;  5FGO A;  1SJW A;  1W4N A;  1I2E A;  5G2G A;  1T5Y A;  1ASK A;  3RDE A;  2P0X A;  3TDG A;  2OQE C;  2HMO B;  3BND A;  3VSY A;  3K5T A;  1VQ7 3;  3FG1 A;  3WDG B;  1JKG B;  4BU4 A;  3CC4 3;  5D83 A;  1O7N B;  5AEW B;  3WHO A;  5IG4 A;  3FSD A;  2R41 A;  3X3Z A;  4GB5 A;  7GSP A;  1ULI B;  2P0M A;  1YNV X;  4ZM8 A;  1PYL A;  2UGI A;  3PS8 A;  5KP3 A;  3PCS A;  1V74 A;  4XB5 A;  1DET A;  2CFD A;  3LXU X;  5G1K A;  3ZG0 A;  2ML5 A;  1BNI A;  1M1K 4;  1YIJ 3;  2BIR A;  1GMP A;  1I0V A;  1W6G A;  5CK6 A;  3VF1 A;  3JUO A;  5HOH A;  1NU3 A;  1MNL A;  3OWY A;  1FA3 A;  2E2U A;  5IEO A;  3KE7 A;  1VQK 3;  2CKF B;  2CH9 A;  4HJL B;  2R4I A;  3KSE D;  4HM7 B;  1QMA A;  1C54 A;  1GSP A;  3EN1 B;  3N9H A;  2RGQ A;  1RKY A;  1RTU A;  1UCJ A;  3OW2 2;  4CCV A;  3CCQ 3;  3D4A A;  3V92 A;  1LNI A;  4OUQ A;  3Q90 A;  1STD A;  2O9U X;  2P05 A;  1RDS A;  1RNT A;  1A2V A;  4I5Q A;  2C11 A;  2P09 A;  2Y74 A;  1LQM B;  1NB5 I;  1X1Y A;  4AKY A;  1NB3 I;  3EB8 A;  2K54 A;  1IQX A;  4L8O A;  1LNH A;  4R9L A;  2XR8 B;  3KN4 A;  1YJW 3;  3V98 A;  3Q2P A;  5BVB A;  1G02 A;  3LT8 A;  3U1W A;  3RGA A;  3CCS 3;  4XDV A;  4GL6 A;  2CG0 A;  1UCK A;  4OVM A;  3OV4 A;  3F8H A;  1CYU A;  1T3B A;  2GU3 A;  1AVK A;  3EHC A;  1SII A;  3AMO B;  1WMP A;  1BSD A;  3S27 A;  2P38 A;  1RGE A;  1IV7 A;  2YFI B;  2FXT A;  3BNC A;  2F56 A;  1LQG C;  1IVW A;  2OOV C;  2GEY A;  3JUN A;  3CD6 3;  1UUW B;  4CPK A;  5AYR B;  1W01 A;  1B20 A;  4RNZ A;  3URP A;  3ROB A; 
#chains in the Genus database with same CATH homology
 1JBT A;  1MGR A;  1TRP A;  7RNT A;  1I3F A;  1BRH A;  1BNE A;  4HAA A;  1RGL A;  1I2G A;  1YVS A;  2KF6 A;  1RN1 A;  1LOV A;  1AQZ A;  1LRA A;  1T2H A;  1FW7 A;  1I0X A;  1BNJ A;  1IYY A;  1BNR A;  1FUS A;  1YGW A;  2AAE A;  1LOW A;  1BRI A;  1GOY A;  1BUJ A;  4HOH A;  1DE3 A;  1RGK A;  2F5W A;  3DGY A;  4J5G A;  1RSN A;  1LOY A;  3DH2 A;  4GSP A;  1B2X A;  5GSP A;  2KAA A;  3KCH A;  4J5K A;  1BRG A;  1RN4 A;  6RNT A;  1RHL A;  1UCL A;  1GOV A;  1ZGX A;  3AGO A;  2RBI A;  3AGN A;  1RCK A;  1RGH A;  1BOX A;  1B2Z A;  1BRJ A;  1B21 A;  3AHW A;  2HOH A;  1I2E A;  1JBR A;  1BRS A;  1JBS A;  1RNB A;  2AAD A;  1RGC A;  4BU4 A;  3BU4 A;  1BNS A;  1I3I A;  2GSP A;  3WHO A;  5RNT A;  7GSP A;  3HOH A;  1Q9E A;  1HZ1 A;  2ZA4 A;  1BSB A;  1YNV X;  2F5M A;  1PYL A;  1TTO A;  1BVI A;  4BIR A;  1DET A;  1FYS A;  1BNI A;  1RGG A;  1B3S A;  2BIR A;  1GMP A;  1I0V A;  1RGF A;  5HOH A;  9RNT A;  2KF4 A;  1UCI A;  1BGS A;  1B27 A;  8RNT A;  1BAO A;  1B2M A;  1AY7 A;  1BRK A;  1C54 A;  1GSP A;  1GOU A;  5BU4 A;  1I70 A;  1RTU A;  1UCJ A;  1SAR A;  2C4B A;  3D5G A;  3D4A A;  3GSP A;  4RNT A;  1LNI A;  1RMS A;  1PY3 A;  1HYF A;  4GHO A;  1BSE A;  1GMR A;  1FUT A;  1RDS A;  1RNT A;  2SAR A;  1BNG A;  1X1Y A;  2F4Y A;  3SYU A;  1TRQ A;  3Q3F A;  1B2U A;  1R4Y A;  2BU4 A;  2KF5 A;  1RGA A;  6GSP A;  1FZU A;  3RNT A;  1BSC A;  1BAN A;  1G02 A;  1T2I A;  1I2F A;  1UCK A;  1BNF A;  1I8V A;  1BU4 A;  5BIR A;  2RNT A;  1BSD A;  1RGE A;  3D5I A;  1BRN L;  1B2S A;  1RLS A;  1BSA A;  2F56 A;  1BIR A;  1RCL A;  1X1X A;  1X1U A;  3A5E A;  2KF3 A;  1CH0 A;  3AHS A;  3BIR A;  3WR2 A;  1MGW A;  1GMQ A;  1B20 A;  1X1W A;  3URP A;  1A2P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...