1YNVX

Asp79 makes a large, unfavorable contribution to the stability of rnase sa
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
96
structure length
96
Chain Sequence
b'DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIITGEATQEDYYTGDHYATFSLIDKTC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanyl-specific ribonuclease Sa
publication title Asp79 Makes a Large, Unfavorable Contribution to the Stability of RNase Sa.
pubmed doi rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase
total genus 26
structure length 96
sequence length 96
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2005-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1ynvX00
3D5IA 3AHWA 4BU4A 1HZ1A 1B21A 1B2XA 1AY7A 1BNSA 1JBRA 1SARA 1GMRA 1TRQA 1FW7A 3DGYA 5GSPA 1Q9EA 4GSPA 1I70A 2KF5A 1RDSA 1HYFA 2AAEA 1I2GA 4J5GA 1TTOA 2SARA 2F5MA 3BIRA 1LOVA 2GSPA 1I2FA 1B2MA 1AQZA 1X1XA 2KAAA 1X1UA 2BU4A 1RSNA 2F5WA 1BSCA 1BRKA 1B2SA 1RMSA 1BNEA 1GOUA 1RN4A 3WHOA 1X1WA 3URPA 1BANA 1GOVA 1I8VA 1RHLA 1YVSA 1I0XA 1I3FA 1B2ZA 1FYSA 1MGRA 1PYLA 2HOHA 2KF3A 1DE3A 1RGGA 2RNTA 1T2IA 1LOYA 1JBTA 1BAOA 3D4AA 1RCKA 1BSEA 1UCKA 1RN1A 1UCIA 1PY3A 1RCLA 1UCJA 5RNTA 1I3IA 1BNGA 3Q3FA 1DETA 1B20A 3HOHA 1RGLA 1X1YA 1R4YA 3BU4A 1A2PA 6RNTA 1G02A 1LNIA 1BRHA 9RNTA 1LOWA 8RNTA 1BSBA 1BNIA 1RGCA 1BNFA 1RTUA 3AHSA 1FUTA 1BGSA 6GSPA 1BOXA 1GMPA 1RNBA 3GSPA 2KF6A 4GHOA 2C4BA 1BSDA 3D5GA 1BU4A 1I0VA 7RNTA 2F4YA 1YGWA 1YNVX 1CH0A 1I2EA 5HOHA 1T2HA 3AGNA 1GMQA 1UCLA 1BRNL 1BRSA 3WR2A 5BIRA 2KF4A 7GSPA 4J5KA 4BIRA 1IYYA 3DH2A 1ZGXA 2F56A 4HOHA 3RNTA 1B27A 3KCHA 1LRAA 1C54A 1BNJA 1B3SA 1BSAA 1RNTA 1RGHA 2BIRA 4RNTA 1GSPA 1B2UA 1FUSA 1BRJA 1TRPA 1RGKA 1BRIA 1BIRA 1RLSA 2RBIA 1RGAA 3SYUA 5BU4A 1JBSA 1GOYA 1MGWA 1BRGA 1RGEA 3AGOA 1BUJA 3A5EA 1BVIA 1FZUA 4HAAA 2ZA4A 1RGFA 1BNRA 2AADA
chains in the Genus database with same CATH superfamily
4IIAA 1IQ8A 4N3VA 2H0HA 3AMOA 5M19A 1B2XA 3FG1A 1LQGC 5JPPA 1JBRA 3BLZA 3K0ZA 3LMLA 2J8XB 4K1UA 3DGYA 3RDEA 1Q9EA 2F86B 3PCRA 4LYLB 4XDWA 3BNBA 2HMKB 1ROVA 2W2CA 1AVKA 1I2GA 1UGHI 4U13A 2SARA 2F5MA 3EJVA 3BIRA 2CG0A 2Z7AA 2O9UX 1I2FA 1B2MA 2H0IA 1OHPA 5IW9A 4O3VA 1W6YA 3LOYA 1RSNA 2GU1A 2QGUA 2RGQA 2XRXB 1IDPA 2CC3A 4MEIA 5I97A 4WYKA 1W5ZA 1TU5A 2CWVA 3HX8A 3IJEB 4X2OA 1IQYA 1FUWA 3WHOA 4CPKA 3I563 1SJWA 1ROAA 2ML5A 2F98A 2IMJA 1BANA 4HBRA 1CQSA 1Q40A 2HMLB 1I3FA 3EC9A 1DYUA 4BL2A 1QALA 5M1AA 5BVBA 3EF8A 1RGGA 3CC43 1LOYA 2BNGA 5HGRA 3MG1A 2D42A 1JZOA 1LOXA 1RCKA 2WO0A 4KZ1A 3NQYA 1V58A 2W0QA 1RN1A 3NV0B 4HM5B 1O7MB 1UCIA 2XFTA 4MJDA 3NBJA 3LT8A 1PY3A 3NQZA 1E3RA 4EC6A 1DMNA 3Q3FA 5AIIA 3SX1A 2FNQA 1ZO2A 3Q1CA 4FMAA 4JRFA 3RGAA 2Y73A 4NREA 2HMOB 3JUPA 6RNTA 1AVLA 4K90B 4Q53A 3KIIA 1LNIA 2CWTA 3SLUA 2Q07A 3L0RA 2Z76A 4O02B 3TDGA 4MMXB 4HKVB 2XSOB 3G4S3 4CDLA 3FGYA 1K28A 6GSPA 1BOXA 1MWTA 4I4KA 3X41A 3EQQB 1KWIA 3QK9A 4HM3B 1FGQA 3DY5A 5AIHA 2C4BA 4N6UA 5CXOA 5KP3A 1BSDA 3DXOA 3SOYA 1BU4A 1LQMB 2CX0A 3KN4A 1MWSA 3LTDA 1UI8A 2CFWA 3KKGA 2O3OA 1N8R4 1EKMA 4I5QA 5CK6A 3MYTA 2E2TA 3DZLA 4WFOA 1G0TA 4WHAA 5FW5A 3QRDA 2PZVA 1BRSA 3DGLA 3KSPA 4FCJA 2MC8A 5KP4A 1IVWA 1IVXA 3KSED 1VQK3 3FSDA 3FZWA 5AI1A 1C54A 3WDGB 3OV4A 1BSAA 3S27A 1RNTA 1Q814 2UX0A 2BIRA 1TUHA 3DGNA 1GSPA 3HI7A 4LSOA 3VSYA 1FUSA 2ZL8A 1N8QA 1VQP3 5BU4A 2BMQB 1IVUA 2BHMA 2XSHB 3AGOA 4N6TA 1R4CA 3U97A 2L1SA 1K41A 1QAKA 1RGFA 4GSPA 3N8BA 1STDA 2WGOA 4LGQA 3X3YA 4BU4A 4EBGA 3CCM3 1Q7Y4 2Z6BA 1BNSA 5AIGA 1SARA 1O7PB 1V57A 1W7CA 1FW7A 1W6CA 5GSPA 5LC7A 2UUGC 3LXUX 1W2B2 1STFI 1HYFA 1M9GA 3FLJA 3F7XA 1Z1SA 1UI7A 4HM7B 3WMDA 1N5PA 1NDOB 2P0XA 3PCSA 5CLKA 2GBWB 3PS8A 8CHOA 3ZG5A 2LYXA 3CCJ3 3SOAA 3NX0A 3FH1A 3OWUA 4RNYA 3DGOA 3N54B 2GU3A 4NHFA 1U5OA 1RKYA 1TFOA 2BU4A 1OACA 1DVCA 1VQ63 1W2ZA 3EBTA 3LTAA 2CW9A 1VQ53 3ZFZA 5G2GA 1RMSA 2MF7A 1S723 3IPTA 5FGOA 3OW22 1DVDA 1FA3A 4IPBA 5IEOA 2XEPA 5ELUA 1Y4KA 1I8VA 1YVSA 2XH9A 3FG4A 1YJN3 1DMQA 3S67A 1OHOA 2HOHA 2B24B 2ML6A 5EQLA 1IV9A 2RNTA 1E3VA 1T2IA 3GZBA 4R1KA 3D4AA 5STDA 3CCQ3 1JBTA 1VQO3 2ZHXB 1UCKA 1A2KA 3SEDA 5IG4A 1JB2A 4BTYA 1F8NA 4OK0A 4STDA 2BMRB 4KFFA 4L8OA 2OQEA 1RCLA 3J7Yd 1UW1A 5DREA 1UCJA 3H3HA 3CD63 1I3IA 1MWRA 4HM1B 1DETA 4HYZA 2C10A 1K8A4 3CNMA 2P09A 1GD4A 1A2VA 4LZIA 3HOHA 4N6NB 3BU4A 2CG1A 3DMCA 2Z77A 3U1WA 1N9EA 3JVCA 2R4IA 3ZG0A 3BNEA 3LT9A 3E99A 6STDA 3LTCA 4OUQA 2CH9A 2WOFA 3SXXA 9RNTA 3NV0A 4XBYA 2IA7A 2W03A 2IUKA 1WQLB 3CU3A 1RTUA 3AHSA 5AYRB 4N6V0 4BL3A 1VQQA 3FF0A 3G8ZA 2K54A 5G1KA 1NJI4 4GHOA 4K61A 1RRHA 4FMBA 5CF2A 2XGLA 1M1K4 2W04A 1E97A 1RRLA 1CYUA 1I0VA 3K5TA 2JDIH 2F4YA 5EEOA 1YNVX 1EEJA 2BMOB 4H61A 3NXJA 5HOHA 1T2HA 1UDII 2WOHA 3X3XA 1QVF2 2STDA 3V99A 3O8YA 3HK4A 5IG0A 3WOEB 4J5KA 4BIRA 1UUWB 1T3BA 1C7HA 1OF5B 4HOHA 1D6ZA 4R4KA 2A15A 7STDA 1AR0A 4HM6B 4NPBA 4RNTA 2OTL3 1W02A 3LZAA 5JPUA 1YIJ3 2OCTA 1KSIA 1VZZA 4KFEA 1BIRA 4DKIA 1RGAA 4K1VA 3OWYA 1MGWA 4KVHA 4RNZA 1ASKA 1WNHA 2W9QA 3SVAA 4HJLB 2E2VA 4EXRA 2UGIA 3CCE3 1NWWA 5AIFA 1WMNA 3B4PA 3MHEA 2KRTA 3NBRA 1T5YA 4N6LA 3D5IA 4AKYA 3DGMA 5AYSC 1AY7A 3HIGA 1O7GB 1TRQA 1ZS7A 1OPYA 2HMMB 3T8UA 3CXC2 1Q824 3PYJA 1JB4A 3GZRA 2HMJB 4O2HA 1I70A 1G96A 2KF5A 3IMAB 5TGNA 2AAEA 3K63A 4LMIA 2W9PA 4J5GA 4KT3B 2CX1A 1QJGA 1TTOA 3B4OA 4X2HA 4OVMA 2IUJA 1OHSA 3BB9A 1IU7A 1NB3I 4RZMA 2GSPA 2KAAA 1X1UA 4KFDA 3UNLA 2QA43 5DRVA 3DUKA 2SBLA 2F5WA 4XBTA 3KZTA 1VQL3 1B2SA 1HKXA 1SIIA 5D83A 5ELJA 5IG3A 1GOUA 3FF2A 1W01A 1RN4A 1VQ83 3UJMA 4BTWA 2K0MA 1W6GA 2XR8B 1RJOA 3D3LA 1YIT3 1A67A 3BNDA 5IERA 1B2ZA 1PYLA 1K734 1DE3A 3MPHA 3GWRA 1J2BA 1PFPA 2FGTA 3ALAA 3UB1A 4JF8A 1BSEA 2OOVC 3M8CA 4MMYB 3STDA 1OH0A 3WA3A 1BUQA 3V92A 1GY5A 2D1WA 1US1A 2GEYA 4HM2B 3CPOA 2QEX3 1B20A 1JV2B 1JN5A 1N5HA 1UGIA 3F7SA 4FMDA 1JJ22 3LTBA 4WWUC 1RGLA 1X1YA 2QIYA 3EN1B 3MWZA 1A2PA 3F40A 3CC73 1EQKA 3MG3A 2RSXA 4EV2A 5IG5A 3S5CA 1FGOA 4WP5A 1A90A 4AKZA 1SIHA 1JN5B 3CC23 1GYBA 1LOWA 1W00A 1YGEA 2OWPA 3JUQA 8RNTA 1BNFA 3EB8A 3CMA3 1BGSA 4O8SA 2XF3A 3WODG 5IF6A 2W56A 3LH4A 4R80A 4MMZB 1SPUA 1L5GB 5JBSA 3CNXA 3F14A 1U8CB 3NHXA 3D5GA 1JNQA 3KFQC 3MSOA 4XDVA 1M1XB 7RNTA 1YGWA 3FKAA 3G0KA 2W56B 4HM0B 4HVNA 3AGNA 1UCLA 1KD14 3UL6A 3LYGA 5BIRA 2INXA 4GL6A 4R9LA 4CCVA 1OGZA 2F56A 4HM4B 3RNTA 3H51A 3PXMA 1YVBI 4ZM8A 3V98A 4AEQA 3ROBA 3AMOB 4HM8B 2JQ5A 1EG9B 1UUVB 3G16A 4EV5A 2P0MA 3PGBA 3BNCA 2F99A 2L4VA 3OX9A 1GY6A 1BRJA 2BO9B 1TJDA 1FGMA 2KXGA 4J8TA 1BRIA 2IYJA 2RBIA 4XBXA 1JBSA 1NU3A 5BXQA 3WA2X 1VQN3 1BVIA 1FZUA 1OF5A 4ILFA 3G6E3 5AEWB 1TIJA 1JZDA 2CFLA 2KCDA 3MG2A 1BNRA 2AADA 1IK3A 2W6JH 3AHWA 1ULJB 1HZ1A 1B21A 1O7NB 2R41A 3GAXA 4TX4A 1NB5I 3VGNA 2PNCA 2FXTA 1GMRA 1NO3A 2P05A 1Q42A 4FR9A 4WYKB 2H0GA 2WGQA 1D6UA 3EX9A 3K9MC 1MNLA 1RDSA 1S5AA 1TFKA 2V1LA 3EN8A 4FCZA 4LEHA 5KP1A 1OCVA 3PZWA 2C11A 1Q40B 3NM7A 1QVG2 2CKFB 2M7OA 4IT7A 2YX9A 2CFKA 1LOVA 2CWUA 1AV4A 3DM8A 1IQXA 2XFSA 3I553 1AQZA 1X1XA 2E2UA 3JUNA 3N9HA 1ISKA 1IT7A 2B1XB 5AEUB 1BSCA 1BRKA 3RGRA 3WOFB 5IENA 1LXEA 1GD3A 3Q2PA 1BNEA 5EVHA 1ULIB 1JKGA 3CPW2 1X1WA 2I9WA 3FCSB 4L8PA 3URPA 5M18A 1YJ93 4QWTA 1GOVA 3EE1A 1RHLA 3X40A 2CFGA 1I0XA 2RFRA 3UL5A 1MGRA 1FYSA 1N9JA 1RN7A 2KF3A 1JRQA 5D82A 5CF1A 2ZDJA 1BAOA 4H3UA 2XGNA 1NNVA 1JKGB 1FGTA 1SQWA 2GEXA 3F8XA 3I0YA 4J9AA 1Q7HA 1QAFA 1IT8A 1YHQ3 2RCDA 2HMNB 5RNTA 1BNGA 3OWSA 2YFIB 3Q90A 4FCMA 1GY7A 2GXFA 1LNHA 2BT3A 1HU9A 1R4YA 2CIUA 3FG3A 3CCL3 1KQS2 3F8HA 1G02A 3D79A 1UUGB 1QMAA 1ZX2A 1EUIC 3GRDA 1BRHA 1LVNA 4XM4A 3VF1A 1M904 1O7WB 3EHCA 4EW5A 1FGRA 1BSBA 1WMOA 3X3ZA 1IV7A 1BNIA 1RGCA 2GBXB 5G1LA 3ER7A 2P38A 3MKIA 3NUVA 3OXAA 4CJNA 1FUTA 1VQM3 1KC84 2K3DA 1TP6A 1GMPA 2CFDA 3ECFA 1RNBA 3GSPA 2KF6A 4RBNA 4PEJA 3B7CA 3X42A 1IVVA 3GZYB 1W4NA 2CHCA 1CYVA 2YFLB 1WMPA 4N6MA 4G1MB 3D9RA 3B8LA 1YJW3 1WTHA 4L7KA 3G713 1CH0A 3HZPA 3KE7A 3CCV3 1I2EA 4XB5A 1GMQA 1BRNL 2OTJ3 3F9SA 1DMMA 3WR2A 3T8NA 2KF4A 3T0UA 3GZXB 7GSPA 3HIIA 1IYYA 3DH2A 1ZGXA 5IEPA 1O7HB 4HZ9B 1OGXA 3CCU3 1YI23 1B27A 2OQEC 3KCHA 1D6YA 1LRAA 3NM2A 4HZBB 5D81A 2IY2A 3CCS3 1BNJA 1MOLA 1B3SA 3CME3 3JUOA 1GS3A 1RGHA 4FMCA 1VQ43 3K7CA 4GB5A 1B2UA 1V74A 2LQVA 4BTXA 1PU4A 1EA2A 4R9KA 1CEWI 5A0OB 4ORLA 1JB5A 1K9M4 3CCR3 4EYCA 1MWUA 1TRPA 1RGKA 1RLSA 4N6OB 3S29A 3SYUA 2CK3H 1GOYA 1OUNA 1VQ73 2Y74A 3S28A 1Q864 1BRGA 1RGEA 1BUJA 3EBYA 3A5EA 2OOVA 4HAAA 3JUMA 2ZA4A 2YFJB 3A76A 5LC6A 1VQ93 3NBBA
chains in the Genus database with same CATH topology
3D5IA 3AHWA 4BU4A 1HZ1A 1B21A 1B2XA 1AY7A 1BNSA 1JBRA 1SARA 1GMRA 1TRQA 1FW7A 3DGYA 5GSPA 1Q9EA 4GSPA 1I70A 2KF5A 1RDSA 1HYFA 2AAEA 1I2GA 4J5GA 1TTOA 2SARA 2F5MA 3BIRA 1LOVA 2GSPA 1I2FA 1B2MA 1AQZA 1X1XA 2KAAA 1X1UA 2BU4A 1RSNA 2F5WA 1BSCA 1BRKA 1B2SA 1RMSA 1BNEA 1GOUA 1RN4A 3WHOA 1X1WA 3URPA 1BANA 1GOVA 1I8VA 1RHLA 1YVSA 1I0XA 1I3FA 1B2ZA 1FYSA 1MGRA 1PYLA 2HOHA 2KF3A 1DE3A 1RGGA 2RNTA 1T2IA 1LOYA 1JBTA 1BAOA 3D4AA 1RCKA 1BSEA 1UCKA 1RN1A 1UCIA 1PY3A 1RCLA 1UCJA 5RNTA 1I3IA 1BNGA 3Q3FA 1DETA 1B20A 3HOHA 1RGLA 1X1YA 1R4YA 3BU4A 1A2PA 6RNTA 1G02A 1LNIA 1BRHA 9RNTA 1LOWA 8RNTA 1BSBA 1BNIA 1RGCA 1BNFA 1RTUA 3AHSA 1FUTA 1BGSA 6GSPA 1BOXA 1GMPA 1RNBA 3GSPA 2KF6A 4GHOA 2C4BA 1BSDA 3D5GA 1BU4A 1I0VA 7RNTA 2F4YA 1YGWA 1YNVX 1CH0A 1I2EA 5HOHA 1T2HA 3AGNA 1GMQA 1UCLA 1BRNL 1BRSA 3WR2A 5BIRA 2KF4A 7GSPA 4J5KA 4BIRA 1IYYA 3DH2A 1ZGXA 2F56A 4HOHA 3RNTA 1B27A 3KCHA 1LRAA 1C54A 1BNJA 1B3SA 1BSAA 1RNTA 1RGHA 2BIRA 4RNTA 1GSPA 1B2UA 1FUSA 1BRJA 1TRPA 1RGKA 1BRIA 1BIRA 1RLSA 2RBIA 1RGAA 3SYUA 5BU4A 1JBSA 1GOYA 1MGWA 1BRGA 1RGEA 3AGOA 1BUJA 3A5EA 1BVIA 1FZUA 4HAAA 2ZA4A 1RGFA 1BNRA 2AADA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D5I A;  3AHW A;  4BU4 A;  1HZ1 A;  1B21 A;  1B2X A;  1AY7 A;  1BNS A;  1JBR A;  1SAR A;  1GMR A;  1TRQ A;  1FW7 A;  3DGY A;  5GSP A;  1Q9E A;  4GSP A;  1I70 A;  2KF5 A;  1RDS A;  1HYF A;  2AAE A;  1I2G A;  4J5G A;  1TTO A;  2SAR A;  2F5M A;  3BIR A;  1LOV A;  2GSP A;  1I2F A;  1B2M A;  1AQZ A;  1X1X A;  2KAA A;  1X1U A;  2BU4 A;  1RSN A;  2F5W A;  1BSC A;  1BRK A;  1B2S A;  1RMS A;  1BNE A;  1GOU A;  1RN4 A;  3WHO A;  1X1W A;  3URP A;  1BAN A;  1GOV A;  1I8V A;  1RHL A;  1YVS A;  1I0X A;  1I3F A;  1B2Z A;  1FYS A;  1MGR A;  1PYL A;  2HOH A;  2KF3 A;  1DE3 A;  1RGG A;  2RNT A;  1T2I A;  1LOY A;  1JBT A;  1BAO A;  3D4A A;  1RCK A;  1BSE A;  1UCK A;  1RN1 A;  1UCI A;  1PY3 A;  1RCL A;  1UCJ A;  5RNT A;  1I3I A;  1BNG A;  3Q3F A;  1DET A;  1B20 A;  3HOH A;  1RGL A;  1X1Y A;  1R4Y A;  3BU4 A;  1A2P A;  6RNT A;  1G02 A;  1LNI A;  1BRH A;  9RNT A;  1LOW A;  8RNT A;  1BSB A;  1BNI A;  1RGC A;  1BNF A;  1RTU A;  3AHS A;  1FUT A;  1BGS A;  6GSP A;  1BOX A;  1GMP A;  1RNB A;  3GSP A;  2KF6 A;  4GHO A;  2C4B A;  1BSD A;  3D5G A;  1BU4 A;  1I0V A;  7RNT A;  2F4Y A;  1YGW A;  1YNV X;  1CH0 A;  1I2E A;  5HOH A;  1T2H A;  3AGN A;  1GMQ A;  1UCL A;  1BRN L;  1BRS A;  3WR2 A;  5BIR A;  2KF4 A;  7GSP A;  4J5K A;  4BIR A;  1IYY A;  3DH2 A;  1ZGX A;  2F56 A;  4HOH A;  3RNT A;  1B27 A;  3KCH A;  1LRA A;  1C54 A;  1BNJ A;  1B3S A;  1BSA A;  1RNT A;  1RGH A;  2BIR A;  4RNT A;  1GSP A;  1B2U A;  1FUS A;  1BRJ A;  1TRP A;  1RGK A;  1BRI A;  1BIR A;  1RLS A;  2RBI A;  1RGA A;  3SYU A;  5BU4 A;  1JBS A;  1GOY A;  1MGW A;  1BRG A;  1RGE A;  3AGO A;  1BUJ A;  3A5E A;  1BVI A;  1FZU A;  4HAA A;  2ZA4 A;  1RGF A;  1BNR A;  2AAD A; 
#chains in the Genus database with same CATH topology
 4IIA A;  1IQ8 A;  4N3V A;  2H0H A;  3AMO A;  5M19 A;  1B2X A;  3FG1 A;  1LQG C;  5JPP A;  1JBR A;  3BLZ A;  3K0Z A;  3LML A;  2J8X B;  4K1U A;  3DGY A;  3RDE A;  1Q9E A;  2F86 B;  3PCR A;  4LYL B;  4XDW A;  3BNB A;  2HMK B;  1ROV A;  2W2C A;  1AVK A;  1I2G A;  1UGH I;  4U13 A;  2SAR A;  2F5M A;  3EJV A;  3BIR A;  2CG0 A;  2Z7A A;  2O9U X;  1I2F A;  1B2M A;  2H0I A;  1OHP A;  5IW9 A;  4O3V A;  1W6Y A;  3LOY A;  1RSN A;  2GU1 A;  2QGU A;  2RGQ A;  2XRX B;  1IDP A;  2CC3 A;  4MEI A;  5I97 A;  4WYK A;  1W5Z A;  1TU5 A;  2CWV A;  3HX8 A;  3IJE B;  4X2O A;  1IQY A;  1FUW A;  3WHO A;  4CPK A;  3I56 3;  1SJW A;  1ROA A;  2ML5 A;  2F98 A;  2IMJ A;  1BAN A;  4HBR A;  1CQS A;  1Q40 A;  2HML B;  1I3F A;  3EC9 A;  1DYU A;  4BL2 A;  1QAL A;  5M1A A;  5BVB A;  3EF8 A;  1RGG A;  3CC4 3;  1LOY A;  2BNG A;  5HGR A;  3MG1 A;  2D42 A;  1JZO A;  1LOX A;  1RCK A;  2WO0 A;  4KZ1 A;  3NQY A;  1V58 A;  2W0Q A;  1RN1 A;  3NV0 B;  4HM5 B;  1O7M B;  1UCI A;  2XFT A;  4MJD A;  3NBJ A;  3LT8 A;  1PY3 A;  3NQZ A;  1E3R A;  4EC6 A;  1DMN A;  3Q3F A;  5AII A;  3SX1 A;  2FNQ A;  1ZO2 A;  3Q1C A;  4FMA A;  4JRF A;  3RGA A;  2Y73 A;  4NRE A;  2HMO B;  3JUP A;  6RNT A;  1AVL A;  4K90 B;  4Q53 A;  3KII A;  1LNI A;  2CWT A;  3SLU A;  2Q07 A;  3L0R A;  2Z76 A;  4O02 B;  3TDG A;  4MMX B;  4HKV B;  2XSO B;  3G4S 3;  4CDL A;  3FGY A;  1K28 A;  6GSP A;  1BOX A;  1MWT A;  4I4K A;  3X41 A;  3EQQ B;  1KWI A;  3QK9 A;  4HM3 B;  1FGQ A;  3DY5 A;  5AIH A;  2C4B A;  4N6U A;  5CXO A;  5KP3 A;  1BSD A;  3DXO A;  3SOY A;  1BU4 A;  1LQM B;  2CX0 A;  3KN4 A;  1MWS A;  3LTD A;  1UI8 A;  2CFW A;  3KKG A;  2O3O A;  1N8R 4;  1EKM A;  4I5Q A;  5CK6 A;  3MYT A;  2E2T A;  3DZL A;  4WFO A;  1G0T A;  4WHA A;  5FW5 A;  3QRD A;  2PZV A;  1BRS A;  3DGL A;  3KSP A;  4FCJ A;  2MC8 A;  5KP4 A;  1IVW A;  1IVX A;  3KSE D;  1VQK 3;  3FSD A;  3FZW A;  5AI1 A;  1C54 A;  3WDG B;  3OV4 A;  1BSA A;  3S27 A;  1RNT A;  1Q81 4;  2UX0 A;  2BIR A;  1TUH A;  3DGN A;  1GSP A;  3HI7 A;  4LSO A;  3VSY A;  1FUS A;  2ZL8 A;  1N8Q A;  1VQP 3;  5BU4 A;  2BMQ B;  1IVU A;  2BHM A;  2XSH B;  3AGO A;  4N6T A;  1R4C A;  3U97 A;  2L1S A;  1K41 A;  1QAK A;  1RGF A;  4GSP A;  3N8B A;  1STD A;  2WGO A;  4LGQ A;  3X3Y A;  4BU4 A;  4EBG A;  3CCM 3;  1Q7Y 4;  2Z6B A;  1BNS A;  5AIG A;  1SAR A;  1O7P B;  1V57 A;  1W7C A;  1FW7 A;  1W6C A;  5GSP A;  5LC7 A;  2UUG C;  3LXU X;  1W2B 2;  1STF I;  1HYF A;  1M9G A;  3FLJ A;  3F7X A;  1Z1S A;  1UI7 A;  4HM7 B;  3WMD A;  1N5P A;  1NDO B;  2P0X A;  3PCS A;  5CLK A;  2GBW B;  3PS8 A;  8CHO A;  3ZG5 A;  2LYX A;  3CCJ 3;  3SOA A;  3NX0 A;  3FH1 A;  3OWU A;  4RNY A;  3DGO A;  3N54 B;  2GU3 A;  4NHF A;  1U5O A;  1RKY A;  1TFO A;  2BU4 A;  1OAC A;  1DVC A;  1VQ6 3;  1W2Z A;  3EBT A;  3LTA A;  2CW9 A;  1VQ5 3;  3ZFZ A;  5G2G A;  1RMS A;  2MF7 A;  1S72 3;  3IPT A;  5FGO A;  3OW2 2;  1DVD A;  1FA3 A;  4IPB A;  5IEO A;  2XEP A;  5ELU A;  1Y4K A;  1I8V A;  1YVS A;  2XH9 A;  3FG4 A;  1YJN 3;  1DMQ A;  3S67 A;  1OHO A;  2HOH A;  2B24 B;  2ML6 A;  5EQL A;  1IV9 A;  2RNT A;  1E3V A;  1T2I A;  3GZB A;  4R1K A;  3D4A A;  5STD A;  3CCQ 3;  1JBT A;  1VQO 3;  2ZHX B;  1UCK A;  1A2K A;  3SED A;  5IG4 A;  1JB2 A;  4BTY A;  1F8N A;  4OK0 A;  4STD A;  2BMR B;  4KFF A;  4L8O A;  2OQE A;  1RCL A;  3J7Y d;  1UW1 A;  5DRE A;  1UCJ A;  3H3H A;  3CD6 3;  1I3I A;  1MWR A;  4HM1 B;  1DET A;  4HYZ A;  2C10 A;  1K8A 4;  3CNM A;  2P09 A;  1GD4 A;  1A2V A;  4LZI A;  3HOH A;  4N6N B;  3BU4 A;  2CG1 A;  3DMC A;  2Z77 A;  3U1W A;  1N9E A;  3JVC A;  2R4I A;  3ZG0 A;  3BNE A;  3LT9 A;  3E99 A;  6STD A;  3LTC A;  4OUQ A;  2CH9 A;  2WOF A;  3SXX A;  9RNT A;  3NV0 A;  4XBY A;  2IA7 A;  2W03 A;  2IUK A;  1WQL B;  3CU3 A;  1RTU A;  3AHS A;  5AYR B;  4N6V 0;  4BL3 A;  1VQQ A;  3FF0 A;  3G8Z A;  2K54 A;  5G1K A;  1NJI 4;  4GHO A;  4K61 A;  1RRH A;  4FMB A;  5CF2 A;  2XGL A;  1M1K 4;  2W04 A;  1E97 A;  1RRL A;  1CYU A;  1I0V A;  3K5T A;  2JDI H;  2F4Y A;  5EEO A;  1YNV X;  1EEJ A;  2BMO B;  4H61 A;  3NXJ A;  5HOH A;  1T2H A;  1UDI I;  2WOH A;  3X3X A;  1QVF 2;  2STD A;  3V99 A;  3O8Y A;  3HK4 A;  5IG0 A;  3WOE B;  4J5K A;  4BIR A;  1UUW B;  1T3B A;  1C7H A;  1OF5 B;  4HOH A;  1D6Z A;  4R4K A;  2A15 A;  7STD A;  1AR0 A;  4HM6 B;  4NPB A;  4RNT A;  2OTL 3;  1W02 A;  3LZA A;  5JPU A;  1YIJ 3;  2OCT A;  1KSI A;  1VZZ A;  4KFE A;  1BIR A;  4DKI A;  1RGA A;  4K1V A;  3OWY A;  1MGW A;  4KVH A;  4RNZ A;  1ASK A;  1WNH A;  2W9Q A;  3SVA A;  4HJL B;  2E2V A;  4EXR A;  2UGI A;  3CCE 3;  1NWW A;  5AIF A;  1WMN A;  3B4P A;  3MHE A;  2KRT A;  3NBR A;  1T5Y A;  4N6L A;  3D5I A;  4AKY A;  3DGM A;  5AYS C;  1AY7 A;  3HIG A;  1O7G B;  1TRQ A;  1ZS7 A;  1OPY A;  2HMM B;  3T8U A;  3CXC 2;  1Q82 4;  3PYJ A;  1JB4 A;  3GZR A;  2HMJ B;  4O2H A;  1I70 A;  1G96 A;  2KF5 A;  3IMA B;  5TGN A;  2AAE A;  3K63 A;  4LMI A;  2W9P A;  4J5G A;  4KT3 B;  2CX1 A;  1QJG A;  1TTO A;  3B4O A;  4X2H A;  4OVM A;  2IUJ A;  1OHS A;  3BB9 A;  1IU7 A;  1NB3 I;  4RZM A;  2GSP A;  2KAA A;  1X1U A;  4KFD A;  3UNL A;  2QA4 3;  5DRV A;  3DUK A;  2SBL A;  2F5W A;  4XBT A;  3KZT A;  1VQL 3;  1B2S A;  1HKX A;  1SII A;  5D83 A;  5ELJ A;  5IG3 A;  1GOU A;  3FF2 A;  1W01 A;  1RN4 A;  1VQ8 3;  3UJM A;  4BTW A;  2K0M A;  1W6G A;  2XR8 B;  1RJO A;  3D3L A;  1YIT 3;  1A67 A;  3BND A;  5IER A;  1B2Z A;  1PYL A;  1K73 4;  1DE3 A;  3MPH A;  3GWR A;  1J2B A;  1PFP A;  2FGT A;  3ALA A;  3UB1 A;  4JF8 A;  1BSE A;  2OOV C;  3M8C A;  4MMY B;  3STD A;  1OH0 A;  3WA3 A;  1BUQ A;  3V92 A;  1GY5 A;  2D1W A;  1US1 A;  2GEY A;  4HM2 B;  3CPO A;  2QEX 3;  1B20 A;  1JV2 B;  1JN5 A;  1N5H A;  1UGI A;  3F7S A;  4FMD A;  1JJ2 2;  3LTB A;  4WWU C;  1RGL A;  1X1Y A;  2QIY A;  3EN1 B;  3MWZ A;  1A2P A;  3F40 A;  3CC7 3;  1EQK A;  3MG3 A;  2RSX A;  4EV2 A;  5IG5 A;  3S5C A;  1FGO A;  4WP5 A;  1A90 A;  4AKZ A;  1SIH A;  1JN5 B;  3CC2 3;  1GYB A;  1LOW A;  1W00 A;  1YGE A;  2OWP A;  3JUQ A;  8RNT A;  1BNF A;  3EB8 A;  3CMA 3;  1BGS A;  4O8S A;  2XF3 A;  3WOD G;  5IF6 A;  2W56 A;  3LH4 A;  4R80 A;  4MMZ B;  1SPU A;  1L5G B;  5JBS A;  3CNX A;  3F14 A;  1U8C B;  3NHX A;  3D5G A;  1JNQ A;  3KFQ C;  3MSO A;  4XDV A;  1M1X B;  7RNT A;  1YGW A;  3FKA A;  3G0K A;  2W56 B;  4HM0 B;  4HVN A;  3AGN A;  1UCL A;  1KD1 4;  3UL6 A;  3LYG A;  5BIR A;  2INX A;  4GL6 A;  4R9L A;  4CCV A;  1OGZ A;  2F56 A;  4HM4 B;  3RNT A;  3H51 A;  3PXM A;  1YVB I;  4ZM8 A;  3V98 A;  4AEQ A;  3ROB A;  3AMO B;  4HM8 B;  2JQ5 A;  1EG9 B;  1UUV B;  3G16 A;  4EV5 A;  2P0M A;  3PGB A;  3BNC A;  2F99 A;  2L4V A;  3OX9 A;  1GY6 A;  1BRJ A;  2BO9 B;  1TJD A;  1FGM A;  2KXG A;  4J8T A;  1BRI A;  2IYJ A;  2RBI A;  4XBX A;  1JBS A;  1NU3 A;  5BXQ A;  3WA2 X;  1VQN 3;  1BVI A;  1FZU A;  1OF5 A;  4ILF A;  3G6E 3;  5AEW B;  1TIJ A;  1JZD A;  2CFL A;  2KCD A;  3MG2 A;  1BNR A;  2AAD A;  1IK3 A;  2W6J H;  3AHW A;  1ULJ B;  1HZ1 A;  1B21 A;  1O7N B;  2R41 A;  3GAX A;  4TX4 A;  1NB5 I;  3VGN A;  2PNC A;  2FXT A;  1GMR A;  1NO3 A;  2P05 A;  1Q42 A;  4FR9 A;  4WYK B;  2H0G A;  2WGQ A;  1D6U A;  3EX9 A;  3K9M C;  1MNL A;  1RDS A;  1S5A A;  1TFK A;  2V1L A;  3EN8 A;  4FCZ A;  4LEH A;  5KP1 A;  1OCV A;  3PZW A;  2C11 A;  1Q40 B;  3NM7 A;  1QVG 2;  2CKF B;  2M7O A;  4IT7 A;  2YX9 A;  2CFK A;  1LOV A;  2CWU A;  1AV4 A;  3DM8 A;  1IQX A;  2XFS A;  3I55 3;  1AQZ A;  1X1X A;  2E2U A;  3JUN A;  3N9H A;  1ISK A;  1IT7 A;  2B1X B;  5AEU B;  1BSC A;  1BRK A;  3RGR A;  3WOF B;  5IEN A;  1LXE A;  1GD3 A;  3Q2P A;  1BNE A;  5EVH A;  1ULI B;  1JKG A;  3CPW 2;  1X1W A;  2I9W A;  3FCS B;  4L8P A;  3URP A;  5M18 A;  1YJ9 3;  4QWT A;  1GOV A;  3EE1 A;  1RHL A;  3X40 A;  2CFG A;  1I0X A;  2RFR A;  3UL5 A;  1MGR A;  1FYS A;  1N9J A;  1RN7 A;  2KF3 A;  1JRQ A;  5D82 A;  5CF1 A;  2ZDJ A;  1BAO A;  4H3U A;  2XGN A;  1NNV A;  1JKG B;  1FGT A;  1SQW A;  2GEX A;  3F8X A;  3I0Y A;  4J9A A;  1Q7H A;  1QAF A;  1IT8 A;  1YHQ 3;  2RCD A;  2HMN B;  5RNT A;  1BNG A;  3OWS A;  2YFI B;  3Q90 A;  4FCM A;  1GY7 A;  2GXF A;  1LNH A;  2BT3 A;  1HU9 A;  1R4Y A;  2CIU A;  3FG3 A;  3CCL 3;  1KQS 2;  3F8H A;  1G02 A;  3D79 A;  1UUG B;  1QMA A;  1ZX2 A;  1EUI C;  3GRD A;  1BRH A;  1LVN A;  4XM4 A;  3VF1 A;  1M90 4;  1O7W B;  3EHC A;  4EW5 A;  1FGR A;  1BSB A;  1WMO A;  3X3Z A;  1IV7 A;  1BNI A;  1RGC A;  2GBX B;  5G1L A;  3ER7 A;  2P38 A;  3MKI A;  3NUV A;  3OXA A;  4CJN A;  1FUT A;  1VQM 3;  1KC8 4;  2K3D A;  1TP6 A;  1GMP A;  2CFD A;  3ECF A;  1RNB A;  3GSP A;  2KF6 A;  4RBN A;  4PEJ A;  3B7C A;  3X42 A;  1IVV A;  3GZY B;  1W4N A;  2CHC A;  1CYV A;  2YFL B;  1WMP A;  4N6M A;  4G1M B;  3D9R A;  3B8L A;  1YJW 3;  1WTH A;  4L7K A;  3G71 3;  1CH0 A;  3HZP A;  3KE7 A;  3CCV 3;  1I2E A;  4XB5 A;  1GMQ A;  1BRN L;  2OTJ 3;  3F9S A;  1DMM A;  3WR2 A;  3T8N A;  2KF4 A;  3T0U A;  3GZX B;  7GSP A;  3HII A;  1IYY A;  3DH2 A;  1ZGX A;  5IEP A;  1O7H B;  4HZ9 B;  1OGX A;  3CCU 3;  1YI2 3;  1B27 A;  2OQE C;  3KCH A;  1D6Y A;  1LRA A;  3NM2 A;  4HZB B;  5D81 A;  2IY2 A;  3CCS 3;  1BNJ A;  1MOL A;  1B3S A;  3CME 3;  3JUO A;  1GS3 A;  1RGH A;  4FMC A;  1VQ4 3;  3K7C A;  4GB5 A;  1B2U A;  1V74 A;  2LQV A;  4BTX A;  1PU4 A;  1EA2 A;  4R9K A;  1CEW I;  5A0O B;  4ORL A;  1JB5 A;  1K9M 4;  3CCR 3;  4EYC A;  1MWU A;  1TRP A;  1RGK A;  1RLS A;  4N6O B;  3S29 A;  3SYU A;  2CK3 H;  1GOY A;  1OUN A;  1VQ7 3;  2Y74 A;  3S28 A;  1Q86 4;  1BRG A;  1RGE A;  1BUJ A;  3EBY A;  3A5E A;  2OOV A;  4HAA A;  3JUM A;  2ZA4 A;  2YFJ B;  3A76 A;  5LC6 A;  1VQ9 3;  3NBB A; 
#chains in the Genus database with same CATH homology
 3D5I A;  3AHW A;  4BU4 A;  1HZ1 A;  1B21 A;  1B2X A;  1AY7 A;  1BNS A;  1JBR A;  1SAR A;  1GMR A;  1TRQ A;  1FW7 A;  3DGY A;  5GSP A;  1Q9E A;  4GSP A;  1I70 A;  2KF5 A;  1RDS A;  1HYF A;  2AAE A;  1I2G A;  4J5G A;  1TTO A;  2SAR A;  2F5M A;  3BIR A;  1LOV A;  2GSP A;  1I2F A;  1B2M A;  1AQZ A;  1X1X A;  2KAA A;  1X1U A;  2BU4 A;  1RSN A;  2F5W A;  1BSC A;  1BRK A;  1B2S A;  1RMS A;  1BNE A;  1GOU A;  1RN4 A;  3WHO A;  1X1W A;  3URP A;  1BAN A;  1GOV A;  1I8V A;  1RHL A;  1YVS A;  1I0X A;  1I3F A;  1B2Z A;  1FYS A;  1MGR A;  1PYL A;  2HOH A;  2KF3 A;  1DE3 A;  1RGG A;  2RNT A;  1T2I A;  1LOY A;  1JBT A;  1BAO A;  3D4A A;  1RCK A;  1BSE A;  1UCK A;  1RN1 A;  1UCI A;  1PY3 A;  1RCL A;  1UCJ A;  5RNT A;  1I3I A;  1BNG A;  3Q3F A;  1DET A;  1B20 A;  3HOH A;  1RGL A;  1X1Y A;  1R4Y A;  3BU4 A;  1A2P A;  6RNT A;  1G02 A;  1LNI A;  1BRH A;  9RNT A;  1LOW A;  8RNT A;  1BSB A;  1BNI A;  1RGC A;  1BNF A;  1RTU A;  3AHS A;  1FUT A;  1BGS A;  6GSP A;  1BOX A;  1GMP A;  1RNB A;  3GSP A;  2KF6 A;  4GHO A;  2C4B A;  1BSD A;  3D5G A;  1BU4 A;  1I0V A;  7RNT A;  2F4Y A;  1YGW A;  1YNV X;  1CH0 A;  1I2E A;  5HOH A;  1T2H A;  3AGN A;  1GMQ A;  1UCL A;  1BRN L;  1BRS A;  3WR2 A;  5BIR A;  2KF4 A;  7GSP A;  4J5K A;  4BIR A;  1IYY A;  3DH2 A;  1ZGX A;  2F56 A;  4HOH A;  3RNT A;  1B27 A;  3KCH A;  1LRA A;  1C54 A;  1BNJ A;  1B3S A;  1BSA A;  1RNT A;  1RGH A;  2BIR A;  4RNT A;  1GSP A;  1B2U A;  1FUS A;  1BRJ A;  1TRP A;  1RGK A;  1BRI A;  1BIR A;  1RLS A;  2RBI A;  1RGA A;  3SYU A;  5BU4 A;  1JBS A;  1GOY A;  1MGW A;  1BRG A;  1RGE A;  3AGO A;  1BUJ A;  3A5E A;  1BVI A;  1FZU A;  4HAA A;  2ZA4 A;  1RGF A;  1BNR A;  2AAD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...