1YOBA

C69a flavodoxin ii from azotobacter vinelandii
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
179
structure length
179
Chain Sequence
b'AKIGLFFGSNTGKTRKVAKSIKKRFDDETMSDALNVNRVSAEDFAQYQFLILGTPTLGEGELPGLSSDAENESWEEFLPKIEGLDFSGKTVALFGLGDQVGYPENYLDALGELYSFFKDRGAKIVGSWSTDGYEFESSEAVVDGKFVGLALDLDNQSGKTDERVAAWLAQIAPEFGLSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flavodoxin 2
molecule tags Electron transport
source organism Azotobacter vinelandii
publication title A crystallographic study of Cys69Ala flavodoxin II from Azotobacter vinelandii: structural determinants of redox potential
pubmed doi rcsb
total genus 59
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1yobA00
3OX2A 5TGZA 5F51A 1RCFA 2BF4A 1FLVA 4HEQA 2Z9CA 3FX2A 5BUCA 1CZHA 1YCGA 1AKRA 2V5VA 3UXHA 3S2YA 1AKVA 3QE2A 1DXOA 1QR2A 2QWXA 3LT5A 2N1MA 3ESXA 2GSWA 1FVXA 4Y7CA 2Z98A 5LBUA 1X77A 2OHIA 3F90A 2HNBA 1OBOA 4FGKA 2R97A 4LTDA 3O73A 4NLLA 1SQSA 3F6SA 5EMNA 4YQEA 3W7AA 5FX2A 5LLDA 4N82A 1J9EA 1JA1A 2QMYA 2QX8A 3EYWA 3NHSA 1FLDA 1QHEA 1CZRA 3OX1A 3W78A 2Q9UA 3TZBA 4OXXA 1FLNA 2HNAA 2QX4A 3KAQA 4C14A 1RLJA 4S24A 3GFQA 1YCFA 1V4BA 4C0XA 3D7NA 1AKUA 1QBGA 3K20A 4FX2A 3P0RA 2Z9DA 2AMJA 3B6KA 4DIKA 4ICIA 2BZSA 2QR2A 3W79A 2BPOA 5LBTA 4QOGA 1ZWLA 5LJLA 4C76A 4H2DA 3B6JA 5LMCA 2FX2A 4LTMA 3HLYA 2FOXA 1T0IA 2W5UA 3TEMA 5NULA 1GG5A 4PU0A 1E5DA 4DY4A 4ZVLA 3ES9A 2OHJA 1SG0A 1H66A 2RG1A 3F2VA 3KEGA 3UXEA 1FUEA 2FLVA 3ZHOA 1C7FA 2FAXA 2M6SA 1KBQA 3N3BC 3G5MA 3OWHA 4U7GA 1CZKA 1YRHA 3NHKA 4F8YA 2MOKA 3GFSA 1AG9A 1CZOA 2A5LA 3OJWA 4ZVMA 4ESEA 2BN4A 1CZNA 4CETA 4LTNA 3ESZA 2FZVA 2MT9A 4R81A 3RPEA 1D4AA 1JA0A 3B6IA 3NHFA 4BMPB 1AKQA 1BU5A 1T5BA 2Q62A 3B6MA 4U7FA 3FW1A 4J8PA 3OWXA 4YAWA 4YAUA 5F12A 1OFVA 1AKWA 1D04A 1XYVA 1YKGA 2XOEA 1XYYA 2FVXA 1BVYF 4PTZA 4QOJA 5NLLA 2F1OA 1FX1A 2KLBA 2X2PA 4M0CA 1XT6A 1QRDA 2HPVA 3W77A 3F6RA 1H69A 2FCRA 5ULLA 1KBOA 3NHYA 3SVLA 1TLLA 4YAOA 4FGLA 2FZ5A 1B1CA 2R96A 3ESYA 4H6PA 3U7IA 3OJXA 2M6RA 1J9GA 5FUQA 2V5UA 3O2NA 5F4BA 3GAMA 3N3AC 3NHPA 4BMOB 4ZVNA 1AMOA 1DXQA 2QX6A 3NLLA 3FNIA 4GR9A 2ZKIA 4QOIA 1ZX1A 3KLBA 1WSBA 5JROA 2OHHA 5B3LA 5LJIA 1FLAA 1XI2A 3NHLA 4U7HA 4YAFA 1D03A 3NHWA 3KAPA 2MTBA 2MWMA 4LAFA 3OVMA 3L9WA 1AZLA 2B3DA 4ZVKA 5B3KA 1OBVA 3HR4A 3L9XA 1YDGA 4QOHA 4N9QA 4Y9UA 3TE7A 4QOEA 4YALA 1RLIA 5LVAA 3K1YA 4PTYA 5FA6A 1RTTA 1AKTA 1CZUA 1YOBA 2WC1A 2XODA 3U7RA 2D5IA 3EDOA 1ZWKA 3R6WA 4XDGA 5EA2A 3QFRA 1J9ZA 3GFRA 4LA4A 4DILA 2QX9A 2KQUA 5EAIA 4D02A 3HA2A 1YCHA 1J8QA 3NFRA 1DX9A 2Z9BA 2X2OA 4NULA 4Y9RA 2QMZA 1F4PA 1NNI1 2V9CA 3FVWA 3N39C 3NHRA 1FTGA 4QOFA 3JSXA 2BMVA 3FJOA 4C0WA 4GI5A 3LCMA 1C7EA 4QODA 1WSWA 3NHUA 4HS4A 2FDXA 5A4KA 2OYSA 1I1OA 4XDHA 1AHNA 4FGJA 4GQIA 4N65A 1CZLA 1VMEA 3NHJA 6NULA 2ARKA 3OX3A 3QFCA 4CF6A 1TIKA
chains in the Genus database with same CATH superfamily
1LH0A 1YCDA 4NZ9A 3OCWA 2Q7OE 1S2LA 3CRZA 2IU3A 1U02A 4ZA2A 2ISCA 4GOXA 3H11A 1P2GA 3KAJA 5FWDA 2IXBA 1GT91 1HQCA 2EIXA 1LXCA 2OC4A 1W1IA 3LW7A 1GZ4A 1NPDA 3Q2IA 4C6TB 1Q19A 4JENA 2WMNB 4TLEA 1BKDR 3O03A 4EAAA 4ZYXA 4BKUA 3W7AA 1GPJA 1Z6AA 4B7CA 1M5RA 1PVVA 5LYJB 4UU1A 1U9JA 3PPYA 1DBPA 2PA3A 2V55B 1AKYA 2XT6A 1W85B 3GN1A 1A2OA 4Q21A 4JH0A 4KZKA 1UDAA 1WCV1 1Z16A 2G9QA 5ELXA 1XZPA 3UAOA 1EVIA 3I3OA 5B36A 5LQJA 3WRVA 3QWHA 4XCQA 3DFMA 1DPFA 2GPTA 3DDOA 4TMZA 1AXRA 3AUYA 1L4LA 4PCLA 1TYEB 3NVMB 1PEYA 1TM1E 3H2KA 5DCLA 1M1NB 3SQXA 1DADA 2ZIGA 2J4CA 1IOWA 2QSYA 4DUGD 1D2CA 4P4LA 2HI0A 1MEOA 5IDXA 3IR5A 1L9KA 5F2OA 1DKOA 3FCOA 1LI5A 4Z0PA 5JZVA 1AZWA 2R6HA 5LMUB 2XQFA 3G0OA 3STYA 3B5EA 4Q4CA 3GJ7A 1KHHA 3I5AA 3LUBA 2BI7A 2HJSA 3O9VA 5DK4A 3OEEA 3RU9A 2AXEA 1Z37A 3OT1B 1U3CA 2OHFA 4N8EA 1DAPA 2Q62A 4DR4B 5KTSA 3Q0EA 1N2XA 5EWJA 2ATVA 5F73A 3ZQ4A 1T29A 4GPIB 1W48A 4PPFA 3N58A 4UW9A 5CTAA 1L4UA 4A0QA 1R4MA 4UDXX 1JEQA 1A5BB 3CLRC 4KIWA 4RJIA 1UBUS 5AKZA 1G21A 2HDHA 3EUFA 3ZNQA 3ZU3A 1B1CA 1LTKA 3R6GA 3VNUA 1FEZA 3LU1A 1Z4MA 4HX9A 1MC1A 5ICSA 1R64A 2HQOA 3BIFA 2YR0A 4FOSA 3BKXA 2DKFA 4LBVA 4IZOA 1E2MA 2RJOA 1XMVA 1ZOSA 4M1OA 5ER6A 1YBMA 3T3EA 4M38A 3LCCA 2I9PA 5BXYA 1L7NA 2Q50A 1YHZA 4DLYA 4I36A 4FNOA 3R8CA 2JGMA 3LGSA 4EPTA 1JE1A 1ZM9A 1E1QA 1LRLA 4WA7A 4FYPA 1W5TA 2LRHA 3C0KA 1NNEA 5HIAA 3L9XA 1OI7A 1A4IA 3DEJA 1ZMTA 1LDGA 3HKEA 1JR3E 2C8VA 2O2SA 1XPUA 2YCLA 4Z0TA 2QKYA 1FP4B 4DXDA 3FBGA 3LVRE 2KM1A 2IIPA 3MINB 4F3YA 1OJLA 4ZZIA 2BFDA 1SXQA 1TK3A 1U5BB 5K3SA 3SEFA 2WU3A 2BEVA 4FSXA 4Y1EA 1N5LA 1ZNXA 3L0IB 5CYFA 1TYZA 5BW4A 4RVFA 5AJVB 4DEXA 1E6CA 1NMXA 4HNAA 1GEEA 2AMFA 1C7EA 2I1LA 2OAEA 3SQDA 3CRVA 1YQTA 3CF0A 3U2QA 1YH3A 4MWGA 4PXYA 2O7NA 5EIXA 4XDHA 2O54A 3DYBA 4OL0A 2CVFA 2DY0A 1EUQA 3H5RA 3H99A 2N46A 2X8LA 3CBQA 3SG0A 2IH4A 1KMQA 1RBYA 2FA9A 3HCOA 2VDVE 4OBXA 2FPXA 4MK4A 2UUPA 3KU1A 1JI0A 4KIJA 2PEYA 1SEPA 1CUBA 4Q7LA 5CR9A 4LDNA 4IOKA 1WUYA 3TD9A 4QG7A 3T7EA 3BRCA 3CEAA 1FZTA 4KWEA 2EZ8A 2I1WA 1NX9A 2WFLB 1JQ5A 4QRHA 5EERA 5HIMA 4CJXA 2FWAA 2ZWOA 3BWCA 1XHEA 3P0IA 2WAMA 5K3FB 3ZY3A 3LKZA 3GEHA 4Q1FA 2VSYA 1TM7E 3W2EA 3PNVA 4B47A 3G2JA 1TJNA 1HOTA 5AVTA 2DFVA 1RPAA 4PZZA 1HG1A 1ID8A 3W4KA 2J5QA 1HETA 3MPUA 3PGA1 2O1WA 1UBHS 1GADO 3HR8A 1HMPA 1N0HA 5MF6A 1FY2A 4L4UA 5CJPA 5KOYA 2YZ7A 2WM9B 1FJGB 2B99A 2FWRA 1EWQA 1YFJA 3NTXA 4L8WB 3FFAA 1O89A 4G8DA 2P2SA 4FYKA 1JYFA 5EHNA 3ABRB 4JEHA 4ZRNA 3M6WA 3F3KA 4CMHA 4YT5A 1LBIA 3D3WA 4MR9B 4QTYA 3E18A 2BTOA 1DKUA 1E2PA 2MMGA 3UCXA 2IDMA 4E4TA 4ARZB 8MHTA 2IYPA 1CNEA 2O3RA 1ODJA 1B3BA 3BH6A 3PVSA 4B80A 1DWUA 2FX3A 1C9EA 1XTPA 4TSKA 4KQKA 3FDJA 4MVYA 1DLIA 1EE1A 2P5TB 3N6RA 4O3FA 5KDOA 4EUSA 1C9JA 3ZLTA 3WL3A 2YV4A 2PRYA 3I6QA 2JVJA 2P9TA 4NBNA 2ZJAA 1JU9A 1XK6A 1KOLA 3TIFA 3FBWA 3P97A 2IKQA 3WBJA 5KHOC 4JXKA 2AF4C 4J7AA 3OFNA 1G38A 1LPNA 4TMWA 3TOSA 2VTEA 3IMCA 1GVHA 1W8DA 2CFSA 2LCFA 3B6EA 4HNSA 4E51A 2DR2A 3V8MA 2C9BA 3LV8A 2BH2A 4CMAA 4YPFA 3D3WB 2NYUA 3A0RB 2ZT6A 2HHAA 3M7IA 1POWA 2O52A 3OZXA 4HEA1 1Q74A 3MJFA 4NAVA 4XQEA 5IXJA 4NTZA 3WOHA 1T43A 3S2ZA 1MH1A 2J4DA 1LLCA 3R0QA 2DPXA 2CMDA 1RC1A 1C1XB 1HWYA 2ZW9A 5JV5A 4L8VA 3ZJVA 1QIMA 2QTLA 2VSXA 5A3VA 4EGSA 2PZEA 3IEMA 1GTVA 3TPCA 3QSYA 2DTDA 5ALYA 1HLGA 3QKWA 4MQFB 2GEFA 4WFKA 1EJ0A 2OYRA 3GA7A 3HDJA 4BBAA 2DT8A 1Z35A 4YR7A 4AY6A 2H1RA 3GZNB 1I6KA 1XJ5A 3DSRA 1P9NA 4I5DA 3E5HA 1PBTA 1QX3A 1JQKA 3I09A 3ACCA 1LA2A 2R8PA 3L7YA 4KUHA 1NQAO 2P40A 3MQ2A 3IOEA 1Q6ZA 1VJDA 4QGGA 4YLEA 3W6NA 3K9QO 1SKYE 1DWOA 2AFHB 4HS4A 1DKPA 3H5VA 3Q9NA 1JFSA 4TZ6A 2K2QB 2DCUA 1N8NA 4JYCA 1FOEB 3RROA 1J8VA 1GAXA 1UOOA 3JASA 1II0A 2PYZA 4Q4HB 4FZ5A 3WRYC 1NN5A 4U63A 4X45A 3DBRB 4Y9SA 5TIIA 1AKMA 1ZMRA 4D3ZA 5F51A 1EUCA 3F5SA 3FUCA 3IQEA 3T9FA 4BMVA 4BKPA 2Q3DA 3FHOA 3P4XA 4FYVA 3QX9A 2DH6A 2X40A 4GPEA 4WA8A 4ZT2A 2JA1A 2XB9A 2Y1DA 3EGVA 4F72A 2AXQA 4PS1A 3H5IA 3D9QX 3IDOA 4ES6A 1IUKA 1UJCA 2OHIA 3QVVA 4W8HA 4EAQA 4YCLA 5IFLA 3FWHA 2PKWA 1T9AA 4J0IA 2XUHA 4OL9A 4TWRA 5KBYA 1CQWA 2HU2A 5FR1A 1J0CA 1N9KA 4N82A 1YBFA 3CT6A 5A2QA 2F17A 1TUBA 1IEXA 3AF3A 3ZV4A 5AW1A 2OHOA 4X00A 1MO6A 3UG7A 3UW1A 4MGHA 1O95A 2FG6C 2A5FA 3A3NA 2W6MA 3WGKA 5KOHB 4U3JB 5JE8A 2XBUA 1KPGA 1NHGA 2QR2A 2BPOA 5FLXA 2NU8A 3BEDA 1FA9A 2CLDX 3WFIA 1SD2A 1KDYA 1CD5A 1JWLA 2DBRA 4OK3A 1I5OA 2WIAA 1A9TA 1KK2A 3N2KB 1AUOA 3Q6MA 1CS0B 5FO0A 1CR1A 3OFND 2GM4A 1Z06A 2B3TA 1GQSA 1S8OA 2H11A 2HCFA 1Z25A 1JFRA 4CV0A 4ZWNA 4FYIA 2D7CA 1WDMA 2HIHA 3IHKA 4AZWA 4ENSA 2XAUA 2QRGA 3AY6A 2D3TA 2LBPA 2P6MA 3EF0A 2RG7A 1JEQB 1UP7A 2XMRA 1Y6GA 5B64A 1R4MB 1TQ4A 2VRCA 4CEJA 2EWWA 2R6FA 4KREA 5HQTA 3F97A 2XHZA 4L78A 4Z8XA 3ZCRA 3R0XA 2JKZA 2PX8A 1NBMA 1DKNA 3PHGA 1IUPA 3ZDBA 5SY6A 5AVQA 2ZYDA 1XWWA 2C8LA 3B70A 4HGOA 4L75A 1O94A 4P32A 1VJ5A 4YHBA 5HF9A 4KR9A 5JRDS 2DH5A 2YC4C 1M2OA 3D2BA 3OZEA 2C82A 2VZ0A 4FYJA 4M8KA 4OHMA 4YYZA 5DNDA 5I7SA 5KYNA 1Y8ZA 1P62B 2IUYA 4R2XA 4GRIA 3ONFA 5IBPA 3VJLA 4Z3DA 4F3CA 4RTRA 3EGXB 1GNVA 4ID3A 5JH7B 1LNQA 3KQKA 2R2GA 1C4KA 1N0IA 3ENQA 3WLIA 2BONA 4WZBE 1OILA 1WSBA 1MC4A 2OCYC 4JXXA 1CP2A 3OTGA 5IDYA 1I2BA 1SG6A 3CCCA 3LMKA 2A30A 4MLPA 1ULZA 4CM8B 5I7EA 3ANYB 2O14A 2V7TA 3BJRA 3N70A 4RNCA 5IVKA 2VH2A 1NR1A 5K8CA 2O2ZA 1XHLA 2PS1A 2XMGA 3NBYC 2NUTA 1J4AA 1PUXA 3R7LA 5K8UA 4M9XA 3F73A 3T94A 3SBXA 4NJMA 4HY3A 2L17A 1NLYA 4CCWA 2PVPA 5D1HA 1DAFA 3MUEA 3BRWD 3MXTA 4J0HA 1ZNQO 2J0UA 4X6XA 3UMCA 4DJTA 4HMPA 4ERXA 5B6JA 1OD6A 2DY1A 1PR6A 3DUWA 1GPNA 1HT1E 3KTAA 4I99A 4EZEA 4O4HF 3C8UA 3EFOB 5E8JA 2P79A 1PNTA 1PKXA 1J0AA 4BXOA 2XYHA 1E9RA 3QTBA 4HKTA 5ALWA 2WU4A 1KH1A 4Y1RA 5DN6A 3WJ7A 4FM9A 3C97A 1F8FA 1QHSA 4Q02A 1QYDA 1INLA 1Y89A 3Q0IA 3EWAA 2GN1A 3MEQA 6PFKA 1M74A 2QUBA 2C2HA 1Z28A 4AJOA 2B9VA 2ZB4A 3PS9A 1RWVA 2GEUA 5AOAA 2I9KA 1JKFA 4BYGA 4Q3AA 1YSCA 2NZ2A 3RNOA 2GFQA 3WE7A 1KO4A 1GY8A 9ATCA 3LK6A 5JCXA 1AF7A 2JCVA 4FIZA 4B4WA 4M0UA 4TWJA 1XNJA 5L9AA 1C4WA 3M3DA 1FQJA 5FX2A 1SZPA 4HN2A 2GJSA 3PC7A 2I2XB 1LRJA 2JGDA 1H65A 3HYCA 5TJ9A 1FU4A 3AO0B 1H42A 1E1CB 2WF7A 5TV2A 3R7SA 1X7DA 3SK0A 5F77A 4M8SA 3KLOA 2Q6VA 4RK0A 1P61B 1VXOA 2R60A 3OTOB 1CVLA 1EWRA 1WUJS 3A37A 2WHPB 3EVFA 2YFKA 4AUKA 3K73O 4QPCA 1MEEA 4YCMA 2C20A 3M81A 1T24A 4GR4A 1SWWA 1Q7EA 3G7NA 3QVKA 1NJSA 2VRBA 5EZYA 4RL6A 4KUGA 1PTJA 2W6OA 3D6JA 1P7WA 2BH9A 1IJKA 3LDHA 1WHTA 4GOMD 4Z0NA 3TSCA 4BGEA 2XDWA 3B1ZA 3BDAA 2C7QA 1SXJE 4K9OA 4RTLA 4MA0A 2DB3A 3AQIA 1QIEA 4BFUA 4KLCA 1T36B 4FCCA 5ALHA 2IOFK 4KWTA 1AZSC 3ZWVA 2WNSA 3UH1A 1BCRB 1AB6A 3VDMA 1IQ0A 2H06A 4N4AA 2JLYA 1R8YA 5HNKA 2HA2A 4V0ME 4RQTA 1GA1A 3AGPA 4JL8A 1T1SA 3KC2A 2EVWX 2H1LA 2NT3A 3QVWA 4YREA 2HPVA 2WIDA 3GP3A 3HMKA 3K6SB 2ZS8A 1QAQA 1Y37A 3TLZA 4EG7A 3JZDA 1QIDA 2HJWA 4UHDA 3UUGA 3L92A 4UNSA 2XUFA 3OFSA 1KTVA 3IRUA 4ZI3A 5HR5A 5FUQA 3RVRA 2O6HA 4QARA 2GVDC 4Z7NB 1UDRA 4V03A 2ATXA 2XZTA 4HHEA 3RTAA 1U8YA 4HT3B 1OYOA 5JNLA 4OHFA 3COYA 1G9SA 2WUVA 1C3OA 1P6UA 1BA3A 4O08A 5CTJA 2XUQA 1SK8A 5I9LA 5E8RA 3AUUA 5DASA 3WLMA 3IFSA 4RETA 3QXHA 1GIAA 2CV0A 5GIOE 3QOXA 3PX3A 4NR0A 2JBHA 4RSMA 1EFPB 4TLDA 1Y33E 3N53A 3FTEA 2C4NA 5E1BA 2JANA 1X1DA 3ABZA 1D8TA 4HNGA 2Q27A 2QZSA 3DDNA 4PIPA 1H8HA 3JQDA 4GEKA 1G5HA 3LY8A 2HRQA 4CNBA 2H59A 5F78A 3G8CA 3C3CA 3CS3A 2ZT8A 4BJ1A 4E2ZA 2DPMA 2GM5A 1UPXA 2RHBA 1TK2A 3N39C 4I1OA 5FYDA 3QELA 4ECEA 3T06B 4BLQA 5ALFA 3BILA 2OV4A 4WCDA 4PN7A 4FCWA 3H9JA 4EJSC 5ALVA 3NPAA 3N8HA 1NMYA 4HFNA 3VR5A 4J94A 2HF9A 1G3IA 3DB1A 1PV2A 4IHAA 2MSLA 4P3NA 4MMYB 1XPOA 4UKDA 1EYZA 1J0BA 2ZBVA 4IDPA 4IWNA 4MXDA 1K7CA 3U44A 2GVZC 3Q9UA 3HP1A 2XWBF 2KMLA 3T1OA 4NHOA 2F3RA 1U6IA 4AY4A 4EY5A 4FLFA 1G98A 4J0KA 2VDKB 1V1RA 4P7KA 4XJVA 2AEEA 4KSYA 4BVFA 4R3UC 3U4DA 3QEMA 1TIPA 2UYYA 4LKOA 3Q9SA 4GNKA 5LWHA 1Z8DA 3KYCB 4N3AA 1VMIA 4ZO7A 1CEXA 5JPCA 1ISPA 5J2TA 1LPBB 2N75A 3I5XA 5CFPA 1P39A 3SICE 3QMMA 2C78A 4WK0B 5JNVA 3AW8A 1VRVA 3ZV5A 2NXWA 1ACLA 2H9YA 2VPZA 2Y1XA 5AK4A 1GPDG 1U0TA 3IT0A 3DVAB 3HE3A 4DPKA 5LMCA 1RJWA 1DP4A 1T8PA 4INAA 1SU8A 2GOYA 3CO0S 1PFWA 4HYTA 1QV9A 4M9SA 5EZSA 1ORVA 3UCFA 2NSJA 5ICFA 2OT3B 3UXEA 3ZBTA 1MBZA 4OHBA 4KHPB 1USVA 2SHKA 2NV0A 4EYQA 1MIOB 4CR8A 1OR8A 1M1XB 1P73A 4PLCA 1CDZA 3M4NA 1ZCFA 3AC0A 1YZQA 4XX0A 1X7XB 2ZIVB 3EF3A 1OAKA 1LFDB 2ZAYA 4TTIA 3WMGA 2CLOB 4B35A 2VQDA 2CMGA 5F12A 2QDKA 3RSHA 2JGFA 3ZJ5A 5B7GA 2B5OA 1DO0A 1JG1A 1QE3A 2ORVA 1USWA 2I6XA 2KPOA 5DRTA 3WL5A 4ZZ2A 4AMUA 2PK3A 3SKXA 4BV3A 2ERYA 5EWMA 3V80A 4ZCTA 5LP1A 1NAHA 2AWNA 1KQGA 2H9IA 1ZBQA 4XSGA 3R41A 5ERXA 3G5TA 5KVAA 3EIXA 2E4YA 4NYMR 4F9TA 1HE8B 1ODIA 4P31A 2NU7B 2AOXA 1N2CA 4QJ4A 4KP7A 1V5IA 4BO4A 1JMVA 3KU4A 4JQOA 3S2SA 4D4IA 1S0UA 3KB6A 4DARA 3AU9A 5KI6A 4P92A 2P65A 2ZJ2A 4C7MA 2QD4A 2HLNA 1W4ZA 4CTKA 3EXHA 5ILGA 2NMVA 1N5MA 2PTGA 3WHIA 1WB4A 5CM8B 1PHRA 1UXGA 2E7ZA 1UDXA 3OF5A 3QOFA 4FFSA 5IFKA 3BSWA 3HEAA 3LSYA 4QBGB 4NU5A 5JASA 1M8GA 2XNSA 4KUEA 5KX5F 1VBFA 5LQKA 4KRYA 4QDKA 2ZBDA 1P2DA 1SM4A 5CBPB 1ZRMA 4G3XA 3OZGA 4QUEA 1FVOA 5JBIA 2ZUTA 2CXHA 2ZDGA 3ZLVA 4OAPA 5AW2A 1ZWKA 1DO2A 3P26A 1A96A 4BFCA 4CF4A 4FFRA 1K6JA 1OV4A 3ENZA 3VKGA 1HUQA 5CNJA 1XZCA 2EKZA 3C7KA 3E7WA 4BNLA 3LP5A 3K8QA 4UMDA 1EVYA 4QODA 3GLVA 1NVGA 3U09A 3HVIA 2CNBA 3P9KA 4XW2A 4YWJA 3LZCA 1N6IA 3EQ8A 4IKEA 5C34B 3EQ6A 3VO2A 1ZLXA 4Q15A 2WG0A 4RF3A 5DXFA 1AIPA 1HEYA 1Q7BA 2VBGA 2C58A 4BATA 5ELLA 2QTVA 1YZGA 1QV6A 1Z0ZA 2BFEB 3K4PA 3SQMA 2IZOA 4JT2A 4DCPA 4WJLA 1X92A 4Q3EA 4ZAYA 2ZB3A 4HB3A 4R9UC 1YQQA 2HLHA 1Q22A 3AUJB 4KQ2A 5IT4A 2XYVA 2FI1A 3KT0A 4IEEA 1R10A 4MP6A 1RWPA 5IZCC 3NNDA 2C1EA 2ZSAA 1FXWA 2N47A 2DFLA 4MEJA 4NPAA 4R8KA 5FWNA 2GJAA 3U4CA 2B4RO 2VPIA 3MCVA 1JAYA 4PC2A 2V0GA 2IZ1A 3H7IA 1RS0A 4JC8A 2KW5A 2R1TB 1U0NA 4HUJA 2WBLC 1PDWA 4MVJM 3IEPA 5DWDA 3V1LA 1IIBA 2ZQZA 3WLAA 1VKRA 2X9QA 2G1AA 2VSQA 3NWBA 4JLUA 4BMSA 4OQ4A 3R3VA 1QGOA 3TOVA 5ESXA 1R74A 1F20A 2Q3HA 1L7RA 3TAHA 5IAGA 4C04A 4C7OA 2SKCA 1YDEA 2UU9B 5FDFA 3EOZA 1K6MA 2JD1A 4RJLA 4E13A 2FOXA 1D4ZA 1ZW1A 2OG1A 2OQ2A 2OM2A 4PU0A 3VHXB 1P6XA 1TLFA 3VFDA 1Z13A 1Y9EA 1YZVA 1XFDA 4EG5A 3WL4A 1RYFA 4LXGA 2YFHA 4WHMA 3V33A 2VA9A 4B3DA 3L3BA 2Q5JA 1DX4A 5H4HA 1A72A 1E4VA 4IIJB 1OFVA 3OFJA 3AB8A 4CKBB 4BNMA 1M7GA 4KYUA 1IBCA 2Q4TA 5ALZA 3KOOA 4UCXA 3RUFA 4EO4A 4H6WA 1XT6A 4RVUA 4K1XA 2P9HA 4UNNA 5DFAA 3WL8A 3RAEC 1RKBA 4CLHA 3RKUA 4P84A 4NCNA 3RT7A 4RKFA 4G86A 3M6LA 3UAVA 2BEKA 3IKJA 2P3LA 2EX4A 1H4SA 1JMKC 4MKGA 4QX6A 4A5OA 2GFIA 1G7TA 2RGRA 3VR2D 5H5JA 3O26A 4MUHA 2WHRA 3H2GA 3IV7A 5B58T 4CM9D 4IXMA 1S2GA 2PO7A 4KFUA 4ACBA 2CSXA 2IGTA 1VECA 2ZUBA 3KSUA 1VPDA 4BASA 2YW2A 4HPWA 4M83A 1OF1A 1V7QA 3H97A 1X7ZB 4D9HA 1V8FA 1L5VA 3I12A 3LGXA 3AVQA 1U1FA 3K1ZA 4I4LA 4TT8A 1IJFA 1H6BA 2B5VA 4OIMA 4B2IA 3RRMA 2W6IA 1K7FB 2A4KA 3GRPA 3I1JA 3K4QA 3R7NA 5JSHA 5F1PA 1CS4C 2WJ4A 3MELA 4LZJA 2C42A 3FVWA 3W9YA 2M1XA 1ADYA 3Q1KA 4M37A 1EFRD 1XGKA 1RRFA 1XNRB 1XB2A 4FBGA 4IVRA 4CDGA 1U2EA 2DUJA 5F2KA 3BMNA 3E0XA 3DBVO 3JQ7B 3FHLA 2ZYUX 3F1KA 4M89A 4NFHA 3VO9A 1O5OA 3CRQA 3HB1A 4LHVA 3WSWA 5KOIA 1GL6A 1E8MA 3NEPX 1XQWA 3I9FA 3WC4A 1ZD5A 1WMFA 4ZT4A 1W30A 4DABA 1VBNA 4YJ2F 2R1VA 3D8TA 4CHGA 1GDHA 3HCAA 1ISSA 1IWBB 3FIUA 4TT3D 4B74A 1Z12A 2D54A 2XGGA 4K9KA 2XEXA 2W71A 3AU8A 4HWKA 3MWEA 4N0QA 4UUOA 4WOBA 1GLVA 4V0OA 1T2EA 2R97A 5EZ5A 3L01A 4N7JA 3GJXC 2BAGA 3L7LA 1GG8A 3ORYA 4I1SA 5T6MA 1XROA 2VK2A 3ETCA 3GCWA 3H9BA 1WBJB 4NNOA 4QO7A 3NVKI 2GX6A 1DQPA 3EZ9A 1BE1A 5FPSA 3PYMA 3KVNA 4LVCA 4RANA 5BNZA 3JWJA 2OGUA 3BHJA 4A5SA 4DB2A 1GCAA 1PHPA 4LZWA 4HGZA 1UKAA 2C7VA 2R8YA 2VEDA 3AI3A 3MWJA 2VOEA 5HKAA 3N0WA 1IM5A 1SIBE 3PT9A 2Q1UA 4HWSA 2WIFA 3QTTA 4MKRA 2F8MA 4CN8A 4HTFB 3EH1A 4LHXA 4C4TA 4RK4A 1X15A 2JCBA 2JIBA 1YRHA 4GE3A 3M6IA 4MRVA 1TVEA 2V7BA 3U80A 1V6AA 3I30X 4PBTA 2C5LA 3R7BA 2HPHA 1PWYE 1MKYA 2IHUA 3RFTA 1T5BA 1Q57A 2CLIB 2FN8A 1QZ3A 2QAGB 3MTGA 4S1PA 3MWGA 3RIEA 3A6EA 3E5RA 5ECDA 3ZGYA 4LF6B 3A3YA 3MC1A 4MINA 4CIBA 2DPHA 4Z4HA 5K0EA 2QD1A 4REOA 3EZGA 3LECA 2QTCA 3WKAA 1XZQA 1NN3A 1UL1X 3OZBA 4QXAA 4D4HA 1K5PA 2WK1A 1US8A 4FNMA 4RTQA 2FR1A 3DF7A 2RSLA 2CNKA 3H5WA 5F35A 5FLKA 4UE6A 2G7ZA 2PLNA 2P4SA 4TL8A 4DCCA 1MP0A 1CUSA 3SYMA 3C6KA 4YRCA 3PEVA 5DLEA 3NEJA 4KGZA 3GRRA 5ECGC 1NWHA 2GSDA 1QONA 3BRWA 1CT9A 5I9NA 2R87A 3PRJA 1RYYA 2C04A 3EASA 1D1PA 1WAMA 3ZWDA 1FTSA 3OE7A 1JDVA 1JE0A 3FFXA 3GJ6A 4KKVA 4KYIB 1C29B 2QTAA 1DUSA 2RKOA 3AESA 3ENKA 3FTDA 3JQ6A 4CM4B 5HJEA 5LOVA 1I51A 5MGBA 2WYVA 3FGNA 4P36A 3PF8A 5TQVA 1ZD1A 2RB5A 2H31A 4KO3S 4WKNA 5CEEA 4KR6A 1P7VA 1T8YA 3CUTA 3T5GA 4CM4A 1XRNA 1P2UA 5LOVB 4DCOA 5ICGA 3HG7A 1QHHA 3DQQA 4BNHA 5FA6A 2CV2A 4WACA 4GPD1 4TQAA 4K3VA 5DBOA 4B5LA 5JAMA 5LKRA 3U16A 2ZYIA 3ETGA 4RM3A 5E1MA 1JHAA 1QH8A 2ZJFA 1JEJA 1XJCA 2NX2A 3FTNA 4ZV7A 3MOGA 4M6WA 5HFJA 1WY5A 3SFTA 3V3KA 3RD5A 1Z26A 1ZW6A 2I2AA 3G2LA 2IX3A 1DRWA 1T4BA 4S12A 2A1UB 2Z58A 3G2IA 3L6EA 3W6ZA 3LY7A 2IY8A 2OORA 2XGOA 3I5MA 4HVTA 4PRKA 1CNFA 3FY4A 4UD6A 1N2EA 3B1JA 4OUDB 4EG1A 1PFYA 3SSAA 3GEMA 1GR0A 1SGWA 4LVOA 2NUAA 2GLXA 4W1PA 3OX3A 5J2UA 4EG0A 4HNUA 1XAJA 2B6NA 3HLTA 3FJYA 4U7TB 3AFMA 5THKA 1MV5A 3EQ7A 3K0KA 5EI5A 4LJAA 1DT5A 2LZ0A 5JJBA 2XXBA 1ZGBA 1C9NA 5AVXA 3W34A 3MTEA 1QC5B 4YLYA 1T2NA 1VIYA 2EJTA 3OQOA 1WZ2A 3I2JA 4N0DA 2ZJ5A 4A7PA 5BR1A 2NVOA 3GLIA 3V6MA 4X9XA 2QX8A 1WXEA 3DZJA 3HN6A 1DUVG 4Y67A 5DTJA 4WBNF 3ULKA 4OM7A 5DBEX 4KPUB 4F9FA 1UIRA 4OXXA 2ZWPA 5LP6B 3GLFA 1A27A 1RWXA 1EFRA 4JI8B 4QRIA 4P5PA 4QHTA 4DV4B 1LF5A 3IV6A 4II3A 3RUCA 3W2TA 3HUEA 3DFUA 5C81A 1ODCA 1A8UA 2JAWA 4ZOQI 1AUPA 3DNMA 5ISMA 1RPJA 1L8LA 2OB1A 3FAZA 2Z2IA 1G42A 4O4LB 2B4QA 4F4DA 3TEMA 4ZCPA 4A15A 4IEFB 4QUDA 2ACWA 3L82B 1K08A 3WP0A 4COKA 4HX2A 2HRCA 3NTUA 3AG6A 3AL3A 3OQIB 3HRIA 1M33A 5FAXA 1Q15A 4DM4A 2PH5A 3GUHA 3LUDA 3I1IA 3IUMA 5LYYA 4GKKB 5KYXA 2A0UA 4JLKA 5FRDA 1CZNA 2WA1A 1UJNA 3E9RA 1GWNA 1TVCA 1ZUNB 2GBGA 2GT1A 2EYQA 3ESZA 3Q7SA 4MEAA 5JWHA 3JALA 4F1JA 3INGA 4JS0A 1B7GO 1CR4A 121PA 3AIOA 3B51X 3CKLA 4IH1A 4XRRA 9LDBA 3LQ1A 4BVAA 4UFPA 3A14A 3P9ZA 1RT9A 1FMJA 2I4IA 4JOSA 2YJ6A 4HNHA 4M1WA 2ZJ6A 1JNYA 1TCCA 3LF2A 3GGJA 1DGQA 1OVGA 2QN6A 3I6BA 4XB2A 3GT4A 4MZDA 3BTVA 2OSVA 3KUXA 4GP7A 3AP2A 5EP2A 1UKVY 3VZSA 4F85A 1V11B 5BN5A 2VWQA 2IZZA 5CGQB 2W2TA 4WNYA 4ZVNA 5TNXA 2WHPA 3SPXA 4A03A 3T9AA 2QX6A 4QAJA 1L5FA 4KL8S 3O3MB 3QQPA 3KZ1E 4TXHA 3N2IA 2FF5A 3I9KA 5TF4A 2X7XA 4ENRA 1L5KA 1RZRA 3V4VB 1UMDB 2V54A 4JA0A 1JZSA 1VHQA 1K68A 3DGFC 1Z2AA 4I9UA 4RPIA 4M9ZA 2BMAA 4A0GA 1TPZA 2R7LA 2E49A 5FTWA 3N07A 4FEAA 1QGUA 3DV0A 4ZJUA 2EBHX 4HSGA 4I4CA 3FDZA 2DUNA 1H94A 1H2RS 3VSBA 3W5BA 3RYHB 2IELA 3I4LA 2XVZA 3MG9A 4DC9A 1QQTA 1YOBA 2NGRA 5LDDC 3CZMA 1GFZA 3AHCA 2EAUA 2B30A 2CVQA 4WZZA 1KY2A 3ZXXA 3OM1A 2BEUB 2EF0A 3LRPA 1CIPA 3ND9A 2OGWA 1YJAA 2FGJA 2IW3A 3DXYA 1S3SA 4YJ3B 2QTTA 4ARVA 3CLTD 2W2KA 1W96A 2Q5EA 1V37A 2OC9A 4QFCA 3IIEA 5GAJA 3DC7A 2DSTA 2GF9A 1ESNA 1R6BX 3IXLA 1B76A 4LK3A 1FQOA 1OB2A 3SQNA 5K05A 1TNDA 3L0CA 3TQHA 4KQ9A 1OFUA 2PL3A 3PWZA 4B3CA 4BVEA 4YMHA 1PF7E 2GYYA 1JI3A 4L73A 4JI4B 3ZTWA 1CLEA 1F6BA 3P9SA 2IOHA 4YACA 3KXKA 1MN6A 1RQXA 3U3OA 5FWYB 4XQ0A 1RJFA 1XTBA 5AJZA 2QWXA 2WFZA 2Q1WA 2AZDA 2HCRA 3MFYA 2RD2A 4M9CA 2Z98A 3HR7A 3TTWA 3OPXA 1SEVA 2WIJA 4R31A 1S8AA 4R1LA 4WCVA 5D5PA 4ALJA 5EJIA 3VC7A 4QG3A 3DLBA 1YZKA 2JGNA 2PKQO 4QYIA 1EGMB 3WDMA 1SC9A 4YUZA 5F21A 5AHKA 1W44A 1IK4A 4G0VA 3G0DA 2QX4A 2ZGVA 2E6KA 2JAUA 2XY4A 3GH3A 2DETA 2ZCVA 1M83A 1VSUA 4YV7A 3SYRA 2QNBA 4DLVA 5B6IA 2C4MA 1JIUA 1UMBA 5TY0A 4EPRA 2O4UX 2VATA 1YWGO 4UUNA 5KREA 3EGIA 5DF1A 4YP1A 3RYFB 4RTPA 1DAGA 2FZCA 3KKMA 4XSHA 4WXYB 3KR9A 1JHUA 2XTNA 3KDAA 4ZU6X 3D6HA 1X80A 4P3XA 5DTQA 1AOXA 1XLTA 3TQOA 2WZCA 1CB7A 5ENVA 3H1PA 1PLKA 1RI3A 3C3KA 2P9YA 4RV5A 4N18A 2MYUA 1RHUA 1B43A 4TSFA 4R9RA 4XH9B 1Q7RA 5E7JA 2FWMX 5CXUA 3HBFA 5EJEA 1SVWA 4HP8A 1ISGA 1CEYA 2E2WA 4IQGA 5EXTA 2H48A 4Z4FA 3G0GA 1RYHA 3AR5A 4N41A 1N5IA 1OLOA 1OVMA 1WSDA 2PBZA 2D62A 2JAQA 2RAFA 2W4MA 1K3TA 3OZTA 4JBHA 4JEMA 4WN9B 2I87A 4XOUA 5FUWA 3AEYA 5FI3A 5EMLA 2H7YA 3MW8A 5CHEA 5EMJA 3LI2A 4KE8A 4DSNA 3U7GA 4N0EA 3SOZA 4EYKA 4EYSA 5IJWA 1AQIA 3BXXA 1AC5A 5LLSA 4GYJA 2ZZKA 4Q3LA 2QE7D 4UARA 4D82A 1FRZA 1Z82A 4B7UA 2LNDA 2EBUA 3NRBA 3HRKA 4XFJA 1PWEA 1KZ7B 3EFHA 2AL7A 2OO7A 3B7WA 2YMMA 5DTEA 3RK1A 2C2MA 3NASA 3P0EA 1NRWA 4Q4JB 4EHIA 3UA3A 4EMSA 1N5JA 2BUCA 4UCWA 3UKJA 2R79A 2VDJA 1FSFA 5KVVA 4MCIA 3V46A 3QX3A 4WCFB 4QJIA 1QFYA 3LW8A 1W5FA 2GS9A 4JLOA 4EB0A 2B3DA 3FAKA 1DO8A 1VIMA 2HWWA 3NDIA 2FEPA 1DG3A 2P0AA 3KWJA 4ALMA 1OLUB 2XRYA 3HI4A 3LUFA 4QOHA 5H81A 4IH4A 5JZSA 4XWYA 5AJTA 4CL2A 2VJKA 3HBLA 2ORED 1YBHA 3CVOA 5FQOA 2ZBPA 1S96A 1UOPA 1VE3A 1L1QA 1YASA 1KYYA 3NS7A 1P9RA 3GJZA 1YCHA 2H2IA 3R44A 1S6YA 4LWPA 3UA4A 1VPEA 2WV7A 4NBTA 4BBJA 1L3IA 5HILA 4D96A 3WX0A 2O5CA 4AG6A 3HDQA 4I5IA 2ZRDA 1CJSA 3B85A 4BV8A 2Z1MA 4KN5A 3P71T 5KQRA 1RACA 3FOZA 4UOQA 5BQXA 4IVQA 2RH9B 1UIMA 1T6BY 5CLGA 1CX9B 3AHGA 3U4AA 3AJ9A 2P9EA 3FPJA 3MFQA 4W63A 4C30A 4DNXA 1DTWA 1OXVA 1YHNA 2NV2B 2ZJBA 3QF7A 4J4TA 1GL9B 1J2JA 1QWSA 1QNLA 1XG5A 4YROA 4MUGA 1IG0A 3KR1A 4L9WA 4QUIA 2C4VA 3DHWC 1IOVA 3CNNA 4K9SA 5BVHA 2CDCA 4FGWA 4QM7A 1MOPA 3OZFA 2XCOA 3GQBB 4EO9A 5K0BA 4IQFA 3IV9A 3OZ7A 3WR5A 5LZ2A 3FGZA 2OYCA 3IPXA 3K30A 1QO9A 4IUCS 4IHJF 2FH5B 3NBZC 2CXUA 2V7EA 4O8ZA 2ANCA 3ID6C 3MAGA 4QUJA 3PFGA 5CXQA 4G1MB 5BWOA 4DLKA 5MN5A 1DBWA 4ZJPA 2B1RA 4MHSA 2CBGA 5KX5B 4NBWA 3RRXA 2R25B 2C88A 2O3JA 4E5UA 2JIZD 4YP6A 1ETHA 1KFKB 2BGGA 4N47A 4JI6B 1P1JA 1YR1A 1I13A 5AJWA 3REOA 3ZS8A 3AVYA 5T5QA 4RLHA 1NVKA 4AZTA 4Q3CA 4Y2VA 3HUDA 5GOZA 1WX1A 2AN3A 2WKWA 4C4SA 2VF4X 1PR1A 3G2MA 3KVRA 4QUGA 5A3RA 1PV4A 4JT8A 4DZTA 1PG5A 1G5PA 1ZUWA 3W6OA 5BV0A 2Q99A 4Q34A 1BHQ1 3UT5B 3LE8A 2VN8A 4LNUA 2VF7A 4ZHQF 1K4YA 2P2CA 2CLLB 4TLCA 5TMDA 4D8WA 4IJUA 2BJVA 1H4VB 1OAOA 2DPYA 2LKDA 4RJKA 3INNA 4UFOA 4IGAA 2QM8A 1CRZA 3WYGA 1RCTE 1JHXA 1ETUA 5JS8A 5EUMA 1C7RA 5IBCA 1NXVA 4DV6B 1N3BA 4G85A 4E1AA 4JC5A 1NL3A 3TD6A 1UPAA 1KP2A 3STWA 4PV7A 2PUHA 3QLUC 1NPTO 4UEOA 5I7HA 2XKJE 2PXAA 1KQPA 2AE1A 2Y0DA 3AWDA 2RC5A 1B3RA 1WW8A 3VU9A 5GZ6A 3W9SA 1N2IA 2GK6A 2WR8A 3SIRA 5TJHA 4ZIRB 4BNVA 1FLAA 1XI2A 4I8IA 5CLHA 6GPBA 3QW2A 4DADA 4GQBA 3A1DA 4UAVA 5LB4A 3CLUC 1YZTA 1KC3A 4YDSA 3M4XA 1WMBA 2P91A 3PGXA 5JCZA 4DA4A 5JJ5A 2VT3A 1AS0A 3DOHA 1OC4A 2G36A 4EW3A 2PSEA 5JNUA 4IGKA 4TVKA 2WKQA 5EKXA 1KF0A 4A1OA 5DN9A 2I80A 4C9BA 2EV9A 4TVSA 2OV1A 3OLCX 5DYNA 3I5YA 3CNHA 2GJ8A 3HKDB 4DT1A 4O0LA 2J08A 4QYMA 4RZ3A 4BN0A 1IY2A 2J31A 5LQCA 3Q7IA 2ZQYA 1GZSA 3SLKA 1Z0DA 1B00A 1JDZA 1EX1A 1YB1A 1JKJB 1WA5A 1Z2PX 4Q4AB 1XMSA 4P7BA 5E9WA 1GPBA 3AJ8A 1KAHA 4OXKA 1BS1A 3EZFA 4RX1A 1C1DA 1QP4A 1Q0HA 2XYRA 1U1IA 5F3RA 3LBIA 2OG2A 3HV0A 3U0BA 4I8DA 4AYTA 4L8GA 4MI3A 1UXHA 1NJ6A 2A6PA 3LXXA 3EEBA 2HSJA 2C29D 3DEKA 4PY2A 2MSNA 2BFBA 4MVJG 2WA2A 2YJ5A 2LKCA 4JKIA 5B2FA 2PAAA 1XZMA 4QOSA 5H59A 3SMVA 5K3OA 1E6KA 4U6NA 1ZD4A 4LY9A 4BY9E 1NBME 1FTQA 1VJGA 4FEYA 3T3OA 2IVFA 1VBKA 3UUFA 5KQSA 1U3GA 1CQIA 5IDQA 3K9HA 4EHAA 1KIFA 3DMTA 1QHEA 2G8NA 3UAZA 1ZN8A 3RYFA 3SN6A 3D3EA 4PWYA 3SJAA 3ZGVA 3TIXB 5IX8A 5DM70 3PYLA 3S1LA 3C5HA 1V4BA 1PG0A 4M88A 3IP7A 1NQOA 2BI8A 1A5SB 4ND4A 1S7GA 2B8NA 3UWKA 4Z9XA 1RXUA 5FL3A 4TV9B 1OT5A 1ZJ6A 2O2IA 3D0OA 3GJ0A 4EUEA 3QA3E 3DGEC 1ZUNA 4Q3KA 5GV8A 3HUUA 3BXEA 5NULA 4L0CA 2QAGC 4PN3A 2OHJA 5E95A 2BBSA 4Q47A 5E4JA 4HVAA 4K6KA 4KR0A 2FUNB 3WQBA 1QYXA 2FOIA 2EFEB 2IF0A 4Q93A 4YPOA 4LJRA 4PFJA 1N9ZA 2K87A 4EX7A 3WAJA 1JKMA 3AFNA 3DAYA 5MN4A 4OQNA 5EEGA 4JI0B 1SA0B 3WO0A 5CFMA 1D6MA 3B8HA 2A92A 2C7RA 3LPAA 3LXUX 2H8KA 3G9TA 1YKGA 3WVNA 3OUTA 3K8YA 1CVIA 2LDBA 4M46A 4I46A 4WASA 1GJRA 5B1YA 3JQCA 5ITSA 5ARCA 5L6MB 3OIVA 3GJYA 1RWOA 3QFHA 1A9YA 4EF5A 4IJQA 3ESQA 3GGDA 4JJ8A 3S44A 2ISSD 5MGNA 4CLXA 4Q9IA 2WFAA 2WAXA 3A4LA 4BGIA 5A7FA 4DGQA 5AUPB 4JJ7A 1G9TA 4FZVA 4U7WA 5IKEA 2VYVA 3I9OA 3ICOA 5JS1A 1TRHA 3H04A 4C0KA 2CMHA 4ZGWA 4BB0A 1KL7A 1KTIA 4C7BA 4Y0AA 1OPRA 2CUNA 4NJMB 1IL0A 3AR7A 3TFOA 1LBEA 6AT1A 3LA8A 3E8SA 1OCEA 2LVBA 1MJGA 2VPPA 4KO8A 4WGFA 2P6NA 2WSIA 4XGRA 1VL6A 2EZ4A 4PG7A 5F33A 3LCJA 4KQHA 1N77A 3AT1A 4U2CA 2B82A 4Z9FA 4EARA 1L7MA 2NTJA 3B89A 5B7QA 5AW0A 2BF7A 2ZM6B 3B5IA 2PUTA 4MYHA 4JI2B 2LIVA 1YR2A 3BCUA 4GBGA 3C3JA 4LXXA 4MI1A 3AEUA 4OQDA 4HFJA 1UCFA 1YUNA 1M1YE 1ULTA 3WGJA 3WJAA 5JU6A 1KC1A 1N3YA 3T4UA 1O9GA 3V8PA 1HKUA 1P4AA 3GYBA 2VHEA 3MWDB 2AXNA 2JEYA 1SWVA 4LZZA 5G0UA 5IDVA 3WZ2A 3EAQA 4MKHA 5FOUA 4DV2B 1YDWA 1GTG1 3HLKA 3VOSA 1YQUA 5TQ2B 2WU8A 2WUFA 3DLCA 3E2MA 4DLXA 5J58A 3S7ZA 5KJ1A 4X62B 2VDNB 1JQ3A 4IFIA 1E69A 3ZQUA 6NULA 1YI1A 1ID1A 1U7ZA 1KVUA 1PV1A 2X86A 2ZK7A 1P60A 3G8YA 3OBBA 4M7WA 4D81A 5GZ1A 1VIDA 2OV3A 3SI7A 5KCMA 1T8UA 2PT5A 3VZCA 4DR1B 1TTPB 3BJZA 3GUCA 2PUAA 2EEZA 1YT5A 3AH8A 4R0NA 3M6UA 2OAGA 2ECQA 2NU9A 2XHEA 1I7PA 5FBLB 4E22A 1GKYA 1RLUA 3EUEA 2Q0SA 4NEHB 3LUAA 3VDNB 1HKHA 2HBQA 3AY0A 4FT2A 4U1RA 4E31A 1J8DA 2WUDA 3U4MA 2JPDA 1LW6E 1M2VA 3KZCA 1ZC4A 1HDIA 1FFGA 3OZSA 4FHZA 5C31A 2VXOA 1KQNA 1ZINA 1HZZA 3FI9A 4UZFA 1FLDA 1ODTC 5FORA 4DM7A 4B0OA 3CT4A 1ZJYA 1O2DA 4PSUA 4EA8A 4G4JA 4QWMA 2OKCA 3Q12A 3V7FA 2ATCA 2J3HA 1FDUA 2Z57A 3NANA 3ORSA 4AM8A 5A5EA 4H59A 4HDQB 2JDID 6REQA 2HADA 4DYHA 2V7GA 2BD0A 3W6PA 3P4YA 3R0IA 5AHRA 2NYAA 5KNCD 3VV3A 2C31A 1A5ZA 4Q37A 1BGVA 4G07A 1P5JA 1W19A 3OSZA 4IIBA 3Q9LA 4AN4A 3DE6X 2XUGA 2YWFA 4RHFA 5B1HA 2CZGA 1KSHA 2CDBA 4G1CA 5K2MA 1CLUA 4BO8A 4ZICA 1J1IA 2H0AA 1YE3A 1NI3A 1D2RA 2ZYSA 3X1YA 3DE7X 4RJTA 1Y4SA 4PZDA 1MQ8B 2EKPA 4MRMA 4PLPA 1V3TA 4WI1A 1KK3A 5AK5A 4AZ3B 4C87A 3I61A 2OCIA 2MSKA 1Z83A 1XMPA 1Z3CA 4MYUA 2JFFA 4UFNA 2IYWA 3CZ9A 1L8QA 2VHQA 1ZONA 4Q19A 3ZI0A 3FZNA 1J0XO 3SC2B 2XBMA 2F1OA 1V39A 3C14C 3C3PA 1U31A 2HWKA 1H9BA 4M0CA 3FYSA 4P6VF 1RQ7A 1U0HC 1YV9A 3DDWA 4GGPA 4I2VA 3QF4B 2NUAB 2C3UA 4UM7A 1XDGA 4B2LA 1GSAA 3PDCA 4KC0A 1IU9A 1M2VB 3BK7A 3IVRA 3MMPA 3OP1A 5EJ2A 2FV8A 1X3SA 5DV9A 4ZQCB 1DAOA 4R7GA 5IULC 4BIMA 1YR9A 1Y1RA 1B42A 1D5CA 1U2DC 1HTTA 2VP5A 3E9NA 3PI7A 2ZRAA 4C43A 4WBNB 1VHJA 4WY5A 1URPA 1YC5A 4LJ9A 3RV3A 3ROPA 5A7GA 1UPBA 4NOJA 2G6TA 4O02B 4QYTA 1G8FA 4Q16A 2Z6VA 1XSEA 3PHCA 1A9ZA 5C32A 5EUCA 1FX0B 1T0JB 4AYXA 1M34B 4ZVKA 5KKCA 3IKTA 2R751 4QUHA 3NKLA 1PGOA 3C6YA 1LEHA 3D2LA 3OECA 2ASEA 2XLBA 4N01A 5C80A 5K6AC 3ER6A 2RCYA 2FX5A 4FZJA 2DQYA 1W75A 4CT0A 5IDWA 2CJWA 1RKUA 4BZPA 5KNBA 1L5RA 2CKMA 3WMWA 2WJYA 2WVJA 4GF5A 3UHPA 4B3SB 3GJRA 1J8QA 1SY7A 1BIFA 3MVEA 1G17A 2YOHA 4BLRA 5CB4B 4M99A 3H4MA 4BYMA 4XLZA 2YIVX 4A8HA 2ZRFA 5ESWA 2O3TA 3IDZA 5I01A 1ZYUA 4ZRDA 1ZM7A 1P3JA 4K2HA 2KBFA 1UBEA 3CX4A 4LMBA 2AHOA 3RTGA 4LFAB 5LA6A 3D54D 2TRSB 1UM8A 3OQ6A 3SBEA 1IAQA 5AR1A 4EKIA 4EVRA 1LTHR 4I5EA 1K6EA 1RCFA 2X9VA 3F7MA 2RK6A 3V1MA 3HYTA 4F6CA 4WZ6A 3OEHD 1EVQA 8LDHA 3QE4A 1DCTA 1KKUA 3HJNA 2DWCA 3BE5A 3VU1A 4MCJA 4AX4A 2GSWA 4TZKA 4FQ5A 2JI6A 3W3AH 2Q5HA 3O4FA 3UHAA 3KALA 3SVZA 4GWLA 3IBTA 2AEMA 4L76A 2PJUA 1HE4A 3W05A 2RIRA 1LPAB 2KBEA 2WMDA 3LQKA 2IL1A 1A1VA 2IYXA 2REOA 4JUDX 2VTDA 4NONA 4RGQA 2R6GA 3OEHA 2B78A 2P0YA 3L8FA 4K9QA 4TTVA 1QIHA 2B92A 2YC2C 4Y1GA 5HQJA 3UC9A 1E6MA 1UPFA 1MMFB 2JGDB 3L7AA 4DCNA 3HJFA 2BEWA 4Y18A 4QTTB 4P9NA 4N5HX 2BV3A 1F2TB 2BZSA 2R1UA 2VJAA 4HGRA 5LBTA 5CD1A 4D3DA 4OATA 4X20B 1UXKA 4L6IA 3ROTA 1T0IA 2WILA 3R09A 1XPRA 3LM8A 1L5OA 2C83A 4LVUA 1BJTA 3ZHOA 1NDUA 1SRQA 2ZYVX 3GQVA 4I9FA 3EX7C 4JKOA 1QTNA 4YJ3F 1E3LA 1WM1A 3D59A 2GI4A 1Y1QA 3A9RA 4LRTB 1DZ3A 3WDKA 2BBOA 3GUZA 4HBZA 3TF5A 4Z4QA 3QV2A 1CUIA 1YDHA 4ZEWA 2NO7A 3I34X 3KKZA 4Y1RB 1AKQA 2OCGA 4C01A 1QE5A 4J8PA 2ODPA 3V4ZA 3T5CA 1WBBA 3S8EA 1ULBA 4IUYA 4KIGA 5IW8A 4CMIB 1HGXA 1P1HA 3PA6A 5ALNA 5EGNA 5EL0A 4BFLA 2FCRA 4FFMA 3JQ7A 2GJ9A 5CW1A 1KEEA 2O8DA 1XN1A 3U7IA 1R4ZA 1FYEA 4FFLA 4P22A 1E96A 4X95A 4CVNA 3M6AA 2G82A 2BHNA 1G8YA 1GPAA 2J46A 4MIYA 3TZHA 4HXEB 3ZUGA 5HVNA 4TMTA 4CKEA 5G4LA 5JQGB 2ZOSA 8GPBA 2P2NA 5GONF 1LZLA 2GHQA 3GRUA 5CCDA 5KHLB 4C4OA 1Z4NA 3O2JA 3DTVD 4WK4B 4CDRA 2YYYA 5JZ9A 1OX6A 4RD4A 4N7RA 1ZAYA 2NU6B 4MW0A 3P9RA 4GLJA 4X94A 4YP9A 2GHRA 3LQ2A 3U9TA 5MHTA 2JHPA 3I2FA 2IYRA 5FLYA 3ILHA 4GGOA 3ZEIA 5F7OA 1PL8A 3DV2A 1Y1KE 3G8AA 3U7RA 2YFQA 1MIHA 1U4OA 2O50A 1Q1EA 2AW5A 2VYNA 2X0DA 3ACBA 3SQOA 3T35A 2G4CA 3CF4A 4DILA 4DV7B 2YIJA 2VUSA 4AXBA 2YWJA 1P2FA 1X74A 2YRWA 4K87A 2AE2A 3RE1A 5CRIA 1ZOOA 1TF7A 8AT1A 3QJGA 5IH3A 4LC0A 2MIIA 4TQUS 3PP8A 4MJLA 5CJ2A 4ZV9A 2QD3A 4J2OA 3SJ7A 2CXTA 3JAWB 2Z8YM 3DE5X 3O4VA 2DR3A 4OHXA 1MRZA 3BHIA 5BMVB 2F64A 3G85A 2YJNA 2XCLA 2HCBA 2HL6A 3FSEA 3P2JA 2FSSA 4FMDF 4WOJA 4DDMA 3BFJA 4CKEB 1E2LA 2Q5FA 3N0RA 1Z0AA 1RQ2A 1V43A 2DFNA 2QP4A 4O4JF 5C7LO 5HOQA 1P0QA 2IW1A 3MWLA 4XUDA 4UHCA 4ER6A 3EBOA 3FZQA 2P7IA 2J87A 3GDWA 4LBZA 1DQYA 5DEOA 5FFNA 3IR7A 3TTVA 2XUJA 3LYUA 4M8IA 1D2GA 2ZJ0A 4MQLA 3WYFA 3SHTA 3R5SA 4RGYA 3MT7A 3RK0A 3RVNA 3L6OO 4UVDA 2DLNA 5KOHA 5KNDH 2P2ZA 5IARA 1PWXA 3R6DA 3SDSA 2VHTA 2C4TA 1DXHA 2IY7A 4H0CA 3ZBPA 5ITVA 3VR6H 4ZYWA 4YRKA 3FVQA 3QUTA 1K1EA 3BWYA 4GKBA 4ZI7F 3S5JA 2VTBA 3ZWBA 2E4AA 3PCRB 2XMDA 3ZV7A 3T5BA 1LLDA 1XCMA 5DW0A 2Q49A 2H85A 4PZPA 5L4SA 3K16A 3UNXA 3OE1A 3UAXA 1Z5UA 4G0PA 5LYJA 4NCIA 2F3UA 3TBKA 5HFAA 4ZP1A 1RBQA 4FS3A 2RAVA 4X85A 3GNLA 5ER9A 1QK3A 1VHWA 4UVIA 4JQZA 1HRDA 1L8XA 2VT6A 5G1OA 2FZGA 2X1MA 3DBIA 1GV1A 4BMCA 2XCTB 1I3MA 3GMIA 2ZBFA 4Y6SA 1N2JA 1Z34A 4DBZA 1D4AA 4ATNA 3TL6A 1U0EA 1DCFA 2PQ2A 4MKFA 1WD5A 1KYVA 3EUWA 3MMZA 1G0OA 1F8XA 3AHJA 2DFPA 4XR4A 4C5CA 2VKTA 1I4LD 1QO7A 2Y05A 3OLYA 2NADA 4R7TA 5FPHA 1VHLA 1WB5A 3NTOA 4XEHA 2GNAA 3WGQA 1PLJA 1Y81A 2IYOA 1ISJA 2NU9B 1QDEA 2M6RA 3IB6A 4AO6A 4P3KA 2IYEA 1OXTA 4KN6A 2PZAA 1U0JA 4G5YA 1EUYA 2QG6A 4HZUA 4NE2A 4G9BA 1SFRA 3V2GA 4NYIR 2D1RA 3QEBZ 1OWOA 2HHHB 2XF2A 3C4QA 2QTHA 3HVRA 2GPYA 1B6RA 3M1IA 3WNDA 2FQ1A 3HJCA 3KRTA 2QRZA 4ZOLB 3ZE9A 3T9BA 1RU3A 1BW9B 1RAAA 4MTLA 2IWRA 2PGOA 2PL9A 1Q3HA 3CV3A 4HQ6A 3T7CA 3ZKWB 5BSTA 1V5FA 2BGIA 3TQRA 3PTAA 3DYIA 1UBFA 2XGMA 4YAJA 1BVHA 1T35A 2O8NA 4O4IB 4X8MA 3E7FA 5FXMA 3RTBA 3WMXA 2K6GA 4ER7A 3PGJA 3BTUA 4TYPA 1VM6A 3PD1A 2HMVA 1A77A 1QO0A 1XELA 3D6FA 4LN1A 4OYRA 1TXGA 2PU5A 3GFRA 2TMDA 5BNIA 3D8HA 3IDQA 3KXPA 2YZGA 3U62A 5LQDA 1VKNA 1XZFA 3PJFA 2PD4A 1DBRA 1NNI1 3D6NB 3B60A 2ZU0C 3FJOA 3WRXC 2P62A 4GC5A 5DWQA 3IELA 2VQFB 2QVLA 4ZHQB 1D4OA 4RIEA 4XI9A 4YQYA 5G40A 2H1HA 2HNKA 2CKDA 3IA7A 2NM0A 1WMSA 4RD2A 4UULA 3GLGE 1QB8A 4ZTBA 4MWDA 3ZKWA 4HATA 3KYJB 4Z1MD 1ENPA 1UP6A 3TLMA 2EGUA 4XVCA 1WB9A 3IAUA 1BGWA 3JRXA 1PZFA 1JG4A 2CUZA 3IAEA 1YKSA 2DBZA 1SHJA 4UU0A 5EXSA 2RGNC 2VNAA 3PNMA 1XX6A 1GZ3A 1A2BA 1AKVA 5IJXA 3HYRA 2CHFA 1G6Q1 3L7BA 3L6RA 3WB1A 1CJVC 5K03A 5CCBA 2OR3A 4D4KA 2XE8A 3I05A 5AVSA 2WAOA 1CUHA 3MRVA 5EYPB 1RM0A 3F67A 4LE2A 4P58A 4TLMB 2X9NA 4ZOAA 4BO0A 3UATA 2A0WA 3MWYW 5EE9A 2K5UA 2PUBA 2FFHA 4CM9A 1G21E 3OQ1A 4J7UA 3QKTA 3GFQA 4L4ZA 4ZDJA 4MIKA 1TFUA 5IVIA 2UYHA 4WH0A 2FDCA 2PMKA 2F59A 2AI3A 1SQ5A 2ZWVA 7AT1A 4UBLA 1YF3A 4BP9A 1ADCA 2VHCA 2GEJA 1LDYA 2GZSA 4F4JA 3PUHA 5GTDA 3DBHB 1ZISA 2ZUWA 4F60A 5FJJA 3SE0A 3UXMA 1PJ3A 1TQ2A 4LBWA 2HWUA 1X9GA 5CA1A 1ZJ4A 4HMOA 2ZPTX 1SXGA 4WKOA 1SBNE 4YO8A 1F2UB 2VRWA 4HB2A 2P4QA 4RK1A 3TDKA 2EKQA 4B09A 3OQBA 3PK0A 4ZYLA 5BV8A 3THWB 4CMIA 4DA6A 2D1TA 3OWXA 4ZPXA 3U3JA 3D4BA 2QLFA 3UK7A 3V7NA 1PZXA 1NVVQ 4P4TA 3SC4A 3TSZA 1Q17A 3IBCA 3FLEA 1FUIA 2TMYA 4BB5A 1TKCA 4BO1A 1T4DA 4GFDA 2AOVA 3DT6A 5DX0A 4D8TA 1JQJC 2QDXA 2Z6UA 3KCQA 4IKPA 1FVFA 3HFJA 4J0JA 4JVNA 4YN3A 3ZWWA 3E5NA 3G5AA 3NFYA 1N4AA 3WY9A 4WLVA 3NMUF 3LPCA 4WGGA 3R6TA 4D9MA 2VJDA 1OB5A 4G5RA 2IBTA 2IU4A 4JLDA 2WNHA 5HW0A 5I48A 2WWYA 5JAPA 5FWYA 1EDOA 1PDVA 4TKZA 3A9UA 1QG0A 2ERXA 1VKOA 1PTJC 1Z0UA 3FKSA 3QVGA 1G18A 1W46A 5REQB 1L5NA 1G8SA 2EZTA 4X3CA 1R8SA 2R7NA 1OREA 6LDHA 3U4HA 4XD7A 3K1TA 3WWCA 1Y9DA 4MCAA 4F12A 1E77A 3TSWA 1NMEA 4D6PA 3F49S 3VZRA 1KO1A 3ZE0B 1WOMA 3M1AA 3SF8A 2XWJI 5KU1A 1ZI9A 4MJXA 1VFNA 5JCJA 2ZJYA 4X1YA 4CR7A 4NULA 5HKOA 2XUOA 2QMZA 4DA0A 2PGXA 3OLQA 1J42A 1W9HA 2WQZA 2C3MA 2YQ4A 3O92A 4XZ3A 1Q1NA 3V3TA 1J0DA 1R16A 1YVUA 4GWGA 1HFWA 4F96A 1ZUIA 4OLBA 3KEOA 3V8BA 4M22A 2W6QA 2AR9A 5ADWA 2UXDB 1Z75A 2VCEA 2XGSA 4DQKA 5BWCA 4PC3A 3D4OA 3DZHA 5F2NA 2WWXA 1T5LA 1MG0A 2C1ZA 2J41A 3LUKA 1FFAA 1LU9A 1GNQA 2D5AA 2QPLA 1C0EA 1OFHA 5D87A 4D8UA 1SZCA 5I6DA 1AQNA 3DEIA 1Y5LA 3HPQA 3ZEAA 1LSOA 4DDUA 2HYIC 3ANMA 2O8CA 4L22A 2ICAA 3B2QA 3ZKAA 1CG6A 1JRLA 3NIGB 3PEFA 2G0NA 1OI4A 1YD7A 2H5JA 2V7XA 4LXTA 4E70A 2BISA 4CEIA 1D4FA 3QFFA 2D7JA 4HOYA 3NM5A 4RYLA 1DC5A 1FVHA 2VK4A 4LNUB 4XE5A 2JK0A 5A2GA 4RD0A 3TX2A 1CYEA 1M5TA 2DUWA 1JG6A 3LY5A 3A4TA 3BIXA 1M34A 2FWJA 3JWHA 5DRYA 4ICIA 3GG9A 5LJLA 2APJA 1JG7A 4EJMA 4JLVA 4F3TA 3KVYA 2H1IA 1PS9A 5ALIA 1T91A 4MVJA 1BN6A 3UK1A 1N0WA 1UR5A 2ZSBA 5K8IA 4GXQA 4PG5A 2HMSA 5JIBA 3WL7A 5IWAB 3D1VA 3RS5A 5JCOC 1AXGA 3G8BA 5DO9A 4I3GA 4AS3A 4BFTA 4PSKA 3OIYA 4QDXA 3V4RA 1XD9A 2QN2A 4GZMA 2B83A 1MA0A 3WYDA 4XIFA 1HI9A 3O8QB 1MX9A 2M9MA 3L1JA 3SC6A 1Y4ZA 2JFVA 1OMOA 1MENA 4X6YA 1RI5A 5C8YF 2QXYA 1YVDA 2XTMA 3FPAA 5JSUA 3HYLA 3L84A 3LX6A 1JTFA 4J91A 3WISA 2H63A 3GWGA 5FWXB 2YMLA 5TX7A 4AZ3A 2DZDA 4IM7A 4D99A 2FHPA 1T4MA 3K9BA 4RVHA 3ZWYA 3K71B 4EY3A 4LJLA 3PKJA 4D4GA 4DR6B 3I58A 3H2YA 3GGOA 3Q3JB 4AMGA 2ZS9A 4A0SA 5L3RA 1T25A 1WO8A 1K0FA 1GCGA 3A8TA 3GAMA 1U0SY 5C1OA 4GX2A 1LK5A 2ESRA 3PV0A 4URZR 1FFXB 4I6JA 2QRVA 2OPBA 4ABYA 4DA7A 2Y1CA 5BYAA 4JU8A 4UNRA 5KNBH 1PZNA 1BWQA 4LZPA 4NBLA 2RMKA 5ABPA 1CUXA 1Y7LA 1MAUA 3R0ZA 4Q4AA 3WHPA 2GK4A 3PPIA 4KXYA 4UVEA 4GLLA 1LC3A 4AMBA 4PWZA 3L6DA 2H2GA 4C0LA 1L5GB 5FHQA 2R7AA 2IYQA 3BSYA 2VUTA 3U3MA 2V3VA 1WMEA 3UM9A 3UKDA 2Q0HA 4ZHSA 1NG9A 3THOA 4DHEA 1I14A 2OD9A 4G0UA 2AFHA 4ZQFA 1JP7A 1PT9A 1YS6A 3VAYA 1TCAA 3DDZX 3W2IA 3BM5A 2ID4A 1O0BA 4BU1A 3O83A 4FDLA 4NPHA 1WXXA 2G3YA 4RESA 3WGVA 3RFFA 4H6XA 3SZRA 4Z3OA 3KKQA 4GS5A 3CFYA 5JW6A 3B1YA 2X1LA 1VYUA 2PN1A 3EA4A 4RVNA 4ZCMA 3K2BA 5E7MA 4CLRA 2WYWA 2HA7A 2J67A 3WK5A 2W2MA 5IAKA 3ZW8A 3L4JA 1M3SA 1QK5A 2MSWA 4GKAA 2FJ0A 3ECAA 1G6HA 4I3HA 5BURA 4XYBA 4BUJA 1Q14A 3SWWA 1O97D 2M2IA 4ZKDA 3GUYA 1LC0A 1VTKA 2NZXA 5KNLA 3G89A 3K0CC 3OZRA 2PE5A 2JLBA 1JDJA 3F46A 1NLMA 1NOIA 4MUFA 4TXJA 2VDWB 3REGA 4YI3A 4HB4A 2RHTA 1BCSA 2IP2A 4K81B 1NRXA 9GPBA 2SECE 5JALA 4ZT3A 1V6CA 4IMPA 4COOA 4RCVA 5BR7A 1BFUA 3CSUA 4G0QA 5EMNA 4MW6A 2IX9A 1DQRA 1FMLA 2IPOA 5G0SA 1R5OA 3A36A 4HG2A 4X5OA 4MW9A 3EXFB 1ZIPA 4Z51A 2R7KA 3MGAA 4K1LA 1VE6A 5AFSA 1RDFA 3QXCA 5HE9A 4HJXA 3P32A 4OPMA 5B7PA 1QKIA 5JYDA 4BJ6A 4RPGA 3E9MA 1KFCB 3ZZTA 4YV0A 1U3UA 2XUIA 4MB2A 3ELBA 3VU8A 1UJ4A 4R5MA 1R18A 2W5UA 2NVBA 2I3DA 1D8AA 1CYDA 3VR0A 2C2YA 2CDNA 2IHZA 2O2XA 3Q87B 2C5GA 1EFDN 3KEGA 3MUOA 4MLCA 3VGJA 2Q3JA 3L6UA 3WLJA 2BGTA 2P4EA 3D8UA 4C0QC 4ALIA 1CZKA 2XUPA 2ZROA 2MOKA 2LUOA 3JQRA 4LPKA 821PA 4ZVMA 1Y7HA 5H0IA 4REQA 1M8JA 3KQOA 2J8ZA 1NVTA 3B6IA 1I32A 3F9RA 3TX6A 5CA0F 1U0GA 4J4HA 4NH4A 1UQTA 1N2ZA 1V8PA 3PLRA 3S2GA 1FX1A 1AGNA 4GMFA 2I54A 3EDCA 5BW5A 2JG3A 1XRPA 4KBGA 2ZITA 5TMBA 4HDAA 1S01A 5KNDD 1UANA 5DSXA 1T6XA 3GXOA 4UCQA 4DCSA 5IVDA 3EG9B 1OI2A 2ZI4A 2A9PA 3MWEB 3ZTYA 1MGPA 4UUMA 1OAAA 1D6SA 5JMPA 4WLNA 1W59A 1UWVA 3N2GB 4YMWA 1AKNA 4M0MA 2AQKA 4UTZA 5A4KA 5K8TA 2JIRA 1O87A 3TI9A 4CM3A 2B8TA 3DXFA 1MCZA 4IX1A 2PL5A 1PIWA 2OESA 4RY9A 4TV9A 4WK2B 3V1UA 4IY1A 3GDGA 1GKIA 1QGAA 3GFFA 1H1LB 5BRAA 1NONA 2HOQA 3A25A 3CE6A 1DI0A 1WZCA 3GRKA 2PRSA 4C2UA 5HBGA 5AJXA 4XIGS 1E1YA 1P5HA 5SZJA 3ROZA 1OLXA 4FHGA 2YZKA 1A2KC 4I66A 2EBWA 4N39A 1S7CA 3ILSA 3A3KA 1G8JA 4TL6A 5T64A 5LZ9A 1NW7A 3GP5A 4RY8A 2X58A 4CMGA 5EIAA 4JYZA 3HM2A 1TA9A 5TR9A 1G55A 2EFYA 1CE8B 1H0SA 3PWSA 2R47A 3BWBA 2BFDB 1F48A 4M54A 4QXOA 2GEBA 3HN2A 3KVVA 3OPYB 1WHSB 3AIKA 2VP0A 5DHTA 9MHTA 2CWWA 2GXSA 1NMSA 3OZCA 4HRYA 4B3HA 1FW6A 3VU0A 5JXWA 3AZPA 3ZHTA 1LDMA 1WMDA 2EKBA 1Z4KA 1OXXK 4HK4A 2FP4B 2JBWA 4PTZA 2Q0XA 1J5PA 2N9UA 4LXIA 4N3NA 1BX3A 3ZIAD 4HAYA 4F56A 4HV4A 3BWVA 4ZDWA 1HXHA 3FX2A 1EDEA 2GD0A 4EB6B 3LX4A 5AI9A 4KTTE 1C14A 5KTPA 1WV1A 1JJBA 2ZRPA 3MM4A 2K4MA 3PTZA 4WBNA 1KOJA 1ZGJA 3U6BA 3B7PA 4G81A 4DJ5X 3AZOA 2F67A 4MR9A 1EGAA 2H6EA 1AK1A 4JUBA 3GRAA 1HRKA 3U3RA 2X0JA 4FDUA 4OK5A 5K6AA 1I94B 3GROA 3FUWA 3BIJA 3FOCA 2FU5C 2L18A 4M2LA 2MSCB 1I30A 4DLLA 2XITA 4BFWA 1YS4A 3FOWA 3QPCA 1MHTA 1B23P 1BVUA 1WXDA 4OJMX 4MRSA 1E58A 4RZHA 5IF9A 2MINA 4LMAA 4M3NA 4YR9A 3K0BA 2Y9MB 3OH8A 1PSDA 1ZWLA 4Q9JA 2QPOA 3RC7A 4ZYZA 4MA5A 5BSUA 1O96A 1TB4A 721PA 4LEIA 2AG6A 1F14A 1MVLA 2RG1A 4DJFC 4P0QB 5K0NA 1L3BA 4KNYA 5ERYA 3OZUA 5BSFA 2H1CA 3LPDA 4UDOA 4ZC8A 4BNDA 1K8RA 5JY6A 1B6SA 2BFAA 2HQ1A 4LDRA 4PHGA 1LPMA 1VJ1A 1XMJA 3RODA 1IMOA 3TL3A 1NNUA 3QA9A 3HCCA 3W7VA 3BGDA 1JDBC 1F0KA 4L0MA 2D5BA 4XKJA 5JAZA 1GPWB 2E5FA 4EG8A 1LPOA 1ONNA 2ZTUA 4RMIA 1H05A 3MAAC 3SSNA 4QL3A 3DULA 2YS7A 1SQ6A 2BDTA 4DYVA 4ETNA 3OQVA 1Z7YA 2RHWA 3GPBA 3OG9A 5HM8A 1MFPA 2Z09A 3EPJA 3TJMA 1P0MA 1FRFS 3UWDA 1ZESA 3SCZA 3WQSB 1T8TA 3BMOA 2ZWMA 4PLYA 1P45A 3LXRA 4XVRA 5AMXA 4EY8A 3E22B 3CINA 3X44A 4G5XA 1T3LA 2GNOA 5ALLA 1DDIA 3SJUA 3QU9A 1XLVA 1WSAA 4G9GA 1DC7A 4HDSA 3UMFA 2QTVB 3NUZA 1OC2A 4HSEA 1NJ2A 2QVZX 4QPNA 4ZDKA 2EDAA 3S1AA 1I7NA 3HZZA 1QYRA 1CCWA 1I5EA 1EFKA 1JKJA 1KEWA 4MPPA 3TJZA 4A8JA 1UZAA 2IYVA 2ZUCA 3CLSC 1W0CA 1CZUA 3FKJA 4UCFA 2XODA 4WXRA 1SCIA 2W93A 2B9EA 2UVPA 2BMDA 1HLDA 3BA1A 4P08A 4ENWA 3DZKA 4GPTA 1HEIA 5F23A 4ESVA 3NHRA 3A6DA 3BUSA 2AJCA 1Q95A 1EEXB 3UYKA 2CZQA 1EIWA 1J00A 1WPQA 4QECA 3UGKA 4F84A 5CH5A 4HDSB 2HHCA 5FBRB 4F4HA 4UEQA 2ZIWB 2HIMA 1DQNA 5AUNB 5C35A 1PT8A 1IN6A 4YRDA 4W9NA 1YAJA 3WGIA 2V6FA 2A84A 1H9AA 1H4TA 1GCOA 1A5TA 1NN0A 2Y1LA 3E3NA 1MW9X 3H1GA 1NP6A 3D6MA 3OQPA 2D4HA 3W04A 5JD5A 1JPVA 1GZ7A 1Q7TA 1Q7GA 2O5RA 2ZRGA 3EG5A 4RMNA 3WGNA 3LKVA 2CFTA 3VSCA 3CVJA 1I0IA 3O95A 3OT4A 4EM6A 2I7XA 1JPNA 3C74A 4JI7B 3OA0A 5AKYA 1XTUA 1FDTA 1W581 3RS3A 1N6LA 3PXCX 4I50B 5GGYA 3EJ6A 3OWOA 5M2QA 3TZLA 4V0QA 2REQA 1KI8A 3OZVA 4NCAA 2VZLA 5E7IA 4KIFA 4GOKA 1LNZA 3LF1A 5J4VA 3DM9B 1EZ4A 1ABBA 3I2GA 4QU0A 2BL4A 1TMKA 4FBLA 4Y2GA 2ZSEA 2W37A 3IDAA 2EIHA 5FOSA 3P4UA 3VYUB 1XYGA 2PXHA 2ZIZA 3FMGA 5FULA 3G79A 1OZHA 3E27A 3N2GA 2ON6A 2PZKA 2O4CA 4LXQA 2KX7A 2V97A 4HTFA 1PKEA 1YKFA 3V5NA 4D42A 4HN4B 4BFVA 3F7TA 2W6CX 1QG4A 1VYHA 1TUGA 4WZBB 3Q41A 4RF2A 1QRUA 3KSBC 2ZIUB 4QU8A 4UBNA 1MXFA 2QP3A 4JR2A 4EQZA 4ZZ3A 1E2BA 4OHOA 1P2TA 2O23A 1NYQA 3NOQA 4DCUA 4XVQA 3NP9A 5CT6A 3C3WA 2W6ID 4P54A 3RJ9A 1E99A 5B3KA 1QXSA 4EJ6A 1ZRSA 3KJQA 3OCJA 1DBVO 3U9SA 4KSBA 4DQDA 1MT3A 2P5UA 1H9CA 1HV8A 3O47A 5FOXA 1SHTX 3RYIB 1WEHA 4B87A 1AUXA 5BUZA 2X4DA 1ZKDA 5DTRA 1WW2A 1ZCBA 3HWRA 4HJRA 2C9DA 5CIQA 1AUQA 3R9KA 4FWBA 2EJUA 5CT9A 3AQ4A 1I2MA 5K0TA 5SZIA 3TZCA 2P41A 2W2OA 4CI9A 1QQ5A 1IBRA 1UPCA 4KVZA 1EJ2A 3L18A 2W43A 1O3YA 4YXWD 4TM7A 3T5DA 4AQ7A 1TM2A 4UEJA 1CY8A 4RH0A 1LLUA 4JHXA 2IPLA 3GPDG 3A4IA 1XMQB 2V58A 4RIFA 4BKOA 1MFZA 3RASA 2P30A 3DEAA 4RD3A 1RRKA 4CETA 1E9AA 2ZWIA 5AKGA 2BSAA 5KTKA 4HL6A 3RAGA 2EGGA 3D6AA 3HB7A 1V4NA 1CE8A 4P0PB 2R00C 1E4EA 3MUFA 1O9BA 4CUKA 2I2FA 1VPLA 2CJYA 4FW9A 3VC2A 2ZYHA 2EARA 3ICWA 5CVTA 1NVDA 1QB7A 1XA0A 1PFUA 4IOMA 1QH8B 1X3LA 3SMQA 4WXEA 3VH1A 5CEJA 2G25A 3KPUA 4ODIA 4H08A 4D02A 2WTNA 1NV8A 3M1LA 2CLMB 4GO1A 4GW3A 4D0RA 5DT9A 4RK5A 5IK2D 3MBOA 2GZRA 1LVHA 4ND1A 4PGGA 1TTQB 3HVUA 1OGIA 4LS3A 5KYWB 1ZA1A 4HH0A 1QU2A 1I9GA 1SCUA 4H15A 3QITA 4R8VA 2Y9PB 1U63A 5C53B 4LOAA 1AGXA 3L8ZA 1WETA 2QGFA 3IAM6 1KKLA 5KSOA 3ZYZA 5FNVF 1D2HA 1JV2B 4RF5A 5HWSA 1X1SA 5DZSA 5G1NA 3TW8B 1VP3A 2ZBUA 4KRGA 3MCAA 4PHHA 8ABPA 3AF6A 4GP6A 3AKYA 1KH2A 3D1JA 4UM5A 5TS3A 1HSOA 3WV4A 4F0JA 2E85A 4DR2B 2J48A 4KFRA 4RZ2A 3E53A 4OB7A 4GSKA 5BR4A 1AA9A 3MK31 1T10A 2WJAA 2OBLA 4GGMX 2BFMA 2H54A 1JAZA 3GYGA 4HDCA 1PR5A 4OJTA 3LL4A 1GRRA 4PZUA 3ZN2A 3MYYA 4KPEC 1FDSA 2GM3A 3BGSA 3IAAA 1BEZA 3TMAA 1HT3A 3NUGA 1XUOA 2XMZA 2ZFUA 1OYWA 4U8GA 4IJ6A 4GOJA 3Q3IA 2PMDA 1MB2A 5B3JC 4YMLA 1U9CA 2W11A 3N05A 5BSWA 2PFKA 5FPYA 1QFXA 1N5KA 3CG0A 3FB1A 1Z2DA 1XKTA 2ZATA 4Q3OA 2FK8A 1YJBA 2HRDA 3B1KA 2A3RA 2IITA 1LPSA 4EPWA 4FD3A 4H3HB 2PZLA 3UMVA 4JLMA 3DAFA 2NUPA 4JAVC 4MSUA 5TVGA 3Q8LA 1P8AA 1T2CA 2HIGA 4BCDA 4KHZA 3TFWA 2R1TA 4B33A 3PZRA 4MWTA 3LBAA 1R4NB 4QXPA 4F4FA 1YE5A 1EBUA 3VNVA 1KMMA 3PNQA 4G6ZA 1RKVA 4PC6A 3PQDA 1L5ZA 2YVQA 5KX5A 2IP1A 2P75A 2PJZA 1A8HA 4C0BA 1J23A 3PHHA 5D5QA 3N2ZB 3QPDA 3RJ5A 2YWHA 2XWQA 4JFRA 1YK0A 2I2WA 4XTRA 3GGSA 3ZE7A 2IXTA 4ZYYA 4OX9Y 4N5IX 3OESA 4OQQA 3I37X 3DVQX 1S2DA 3CR3C 1JFFB 3IAM1 4XB1A 3WJ1A 2ZKIA 2BGLA 4PGMA 4RUKA 2DECA 2JHGA 3ZG6A 3RC8A 3EIFA 3EC7A 1R0CA 2PRKA 1SD5A 1V4VA 5GJVC 4BE7B 5AIBA 3IJEB 2GYVA 1BE0A 4RLFA 1DEHA 1OX4A 4IDBA 4E5KA 3VO1A 4TWAA 3RAPR 3VKFA 1Z38A 3F7NA 1H2HA 2J4FA 2ZCUA 2W2KB 4N7BA 2GZHA 1FW8A 3WI7A 3ZE1B 2JIZA 3QXXA 3IA2A 4YCJA 1Q6YA 3KX2A 5D3KA 1FYFA 2J7PD 2PFSA 3K6RA 5KEIA 3A2KA 1JECA 2ZRMA 3D8NA 6ADHA 4IIGA 2VJLA 3PQ3A 2WWIA 5JQWA 5K01A 4Q9AA 5AM4A 5E1OA 2Y0EA 1CNMA 3O94A 3JSXA 3OF3A 4K9MA 3EDQA 2RH8A 3A2NA 4DV5B 3CU5A 3LCMA 4JGIA 5ES3A 1P0CA 1YR7A 2P2DA 1YS1X 4XFDA 1I7DA 1X8KA 2XX3A 5LZ7A 4LC1A 5JMWA 3ELWA 3IVMA 1LQ2A 3PRKE 4QNMA 4W5HA 4EF6A 5LQNA 2X0RA 4DCJA 4L5JA 1T0BA 3O0DA 3QI7A 2OHGA 5IHPA 3COJA 4X8LA 5EHIA 3TR5A 1TD9A 4H1UA 2BR5A 4J9UE 1SKAA 1L1FA 4YX9A 1BU8A 2WSYB 2K7FA 2M6LA 3QE2A 4XQCA 4YYEA 2P35A 3DFIA 3JVEA 1LVUA 2VAVA 4S1VA 3W8NA 2CL7X 4ZYVA 5BN5B 4BP1A 1G0NA 2G5GX 1X77A 2I2CA 2QF7A 3PXBA 4MQEA 1K86A 3X1WA 1LPPA 3DMGA 5TF0A 2WMYA 1EJBA 3GLSA 1HZZC 1QCZA 1PI3A 3AXTA 4J6FA 5K7SA 4DMLA 5AOVA 2HDOA 1NGSA 2WSSA 1NW5A 5A5VA 1L7VC 1HH4A 3ZGZA 5LZ8A 1N7GA 3JQEA 4W1QA 4B6GA 5K4GA 1XCLA 1ZVVA 1C9DB 3ITEA 4EZBA 2A57A 5E3IA 3TLGB 5THXA 4ZGBA 5A3SA 1KEZA 1BHO1 1P0FA 2R6ZA 3H18A 3PFBA 4AIRA 2DBVO 2TS1A 3S6JA 3PQ2A 3IALA 3OI7A 2Y27A 1L2TA 1R0WA 4C1BA 5F3DA 3GF4A 1XV5A 1OXUA 3EBLA 3Q0TA 1GDTA 1P31A 4YTEA 4ZO8A 3KO8A 1XQ6A 1PW5A 3FPSA 1EXVA 2FN7A 1T4CA 1W87A 1MEJA 4WDQA 1QOPB 2CDAA 5ITWA 5HKKD 5LOVF 3L1IA 2Q1SA 5LXTF 1Z22A 3E03A 4HZGA 1NBOA 3ZHBA 1PR2A 3GI1A 2GTPA 3ABIA 1JSCA 1EM6A 4E33A 4R84A 1QRDA 1SBTA 3V2HA 3DD1A 5EJ4A 2W8BB 4RM2A 1H1DA 3THYA 4FQ8A 1MW8X 5IJ9A 4MV4A 1ZH6A 4RHEA 3QYFA 4YCAA 1JDSA 5DNVA 5BN1A 1YOVB 2UUBB 1XOIA 3OPYI 3AR2A 1ZEMA 2HH9A 3UXYA 5HCUA 5TGTA 1R6AA 3LIPA 4CV3A 1B0UA 1W4CA 3IOCA 4RSRA 3TLJA 1RRMA