1YOBA

C69a flavodoxin ii from azotobacter vinelandii
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
179
structure length
179
Chain Sequence
AKIGLFFGSNTGKTRKVAKSIKKRFDDETMSDALNVNRVSAEDFAQYQFLILGTPTLGEGELPGLSSDAENESWEEFLPKIEGLDFSGKTVALFGLGDQVGYPENYLDALGELYSFFKDRGAKIVGSWSTDGYEFESSEAVVDGKFVGLALDLDNQSGKTDERVAAWLAQIAPEFGLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Flavodoxin 2
publication title A crystallographic study of Cys69Ala flavodoxin II from Azotobacter vinelandii: structural determinants of redox potential
pubmed doi rcsb
source organism Azotobacter vinelandii
total genus 59
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1yobA00
3EYWA 4H6PA 4F8YA 1YOBA 4HS4A 1B1CA 2R96A 4C0WA 2V5UA 2BZSA 3K1YA 2XODA 3NHRA 1FLAA 1FLDA 2OHIA 1FTGA 3N3AC 3RPEA 2ZKIA 3OX2A 4NULA 4ZVMA 1J9GA 2Z98A 1WSWA 1D04A 1E5DA 1FVXA 3OX3A 3NHYA 3W77A 3FVWA 2BPOA 3GFQA 2BMVA 2FVXA 3U7RA 4N82A 3P0RA 2V9CA 2FLVA 3ES9A 4DILA 3TZBA 1CZLA 2MOKA 1SQSA 4CF6A 1AHNA 3JSXA 4U7HA 2AMJA 3NHKA 1YKGA 2ARKA 4D02A 3W7AA 2MTBA 1CZHA 1ZX1A 1DX9A 1XT6A 1CZRA 4LTDA 4Y9UA 5TGZA 3SVLA 1GG5A 2FAXA 2FZVA 2QX6A 3NLLA 1BU5A 2B3DA 2HNBA 5EA2A 4NLLA 4PTZA 3NHPA 5FX2A 4LA4A 5EAIA 3U7IA 3L9WA 2M6RA 4HEQA 4QOJA 3NHFA 3KLBA 3UXHA 1YRHA 3ZHOA 1RLJA 4DY4A 2FZ5A 3FX2A 4N9QA 4OXXA 4U7FA 2X2PA 3LCMA 5A4KA 1QR2A 2XOEA 5LVAA 4LAFA 3FNIA 1AKQA 1QBGA 3F6SA 3GAMA 4J8PA 1AZLA 5FUQA 4YAFA 2QMZA 2D5IA 3NHWA 3ESYA 3W79A 1FUEA 4PU0A 3QFRA 2OHJA 1KBQA 1QHEA 2QX9A 4H2DA 4QODA 5LLDA 2FX2A 4FGLA 1H69A 2GSWA 5F4BA 4GI5A 2WC1A 3ESZA 4YQEA 4PTYA 1CZNA 1CZKA 1TIKA 2N1MA 1CZOA 1OBOA 2QX4A 3HA2A 3TE7A 3S2YA 3B6IA 4QOHA 3B6MA 1J9ZA 6NULA 1T5BA 1I1OA 3QE2A 2R97A 1J8QA 3F90A 4U7GA 1BVYF 1ZWKA 4YAOA 3LT5A 1D4AA 4GQIA 4BMPB 3L9XA 3N3BC 1C7EA 2F1OA 4R81A 4XDHA 4FGKA 3B6JA 3O73A 3QFCA 4DIKA 5F12A 1AG9A 1OFVA 1AMOA 5LBUA 2X2OA 1V4BA 1X77A 4QOIA 4C76A 1KBOA 3O2NA 4ZVLA 3F2VA 3GFRA 1FX1A 3FJOA 4ESEA 1QRDA 3NHLA 5NLLA 2BN4A 2A5LA 4CETA 3D7NA 4GR9A 5LMCA 4Y7CA 4FX2A 2OYSA 4ICIA 4C14A 2M6SA 3EDOA 4QOGA 1VMEA 3NHSA 3B6KA 1OBVA 4YAUA 3KAQA 3KEGA 1D03A 4LTNA 1YCHA 1ZWLA 1FLVA 4YALA 1RLIA 4N65A 2RG1A 1YDGA 2FOXA 4M0CA 4QOEA 3HLYA 4FGJA 4ZVKA 4QOFA 1F4PA 2HNAA 4YAWA 3NHUA 5B3LA 2BF4A 2Q62A 1NNI1 4XDGA 3ESXA 1XYYA 2MT9A 2V5VA 2Z9BA 4S24A 1SG0A 1AKWA 2W5UA 1AKUA 3F6RA 5BUCA 1JA1A 3OWHA 1AKVA 3R6WA 5ULLA 1J9EA 2QMYA 3OWXA 1XI2A 5LJLA 4BMOB 2Z9CA 1TLLA 1WSBA 3W78A 5JROA 3G5MA 2MWMA 4C0XA 1YCGA 5LJIA 1H66A 2FDXA 3OX1A 1AKTA 1JA0A 5F51A 1DXOA 2KQUA 3UXEA 5FA6A 2KLBA 3TEMA 3FW1A 3K20A 3OVMA 2HPVA 1YCFA 1XYVA 1RTTA 3OJWA 2QR2A 3HR4A 2FCRA 5NULA 2QX8A 3OJXA 3KAPA 3GFSA 2QWXA 1AKRA 1FLNA 2Q9UA 2Z9DA 1DXQA 1T0IA 4LTMA 5EMNA 1C7FA 4Y9RA 3NHJA 2OHHA 3NFRA 3N39C 4ZVNA 1RCFA 5B3KA 1CZUA 5LBTA
chains in the Genus database with same CATH superfamily
1A7AA 1MIOA 2D1TA 4WBXC 4ZMSA 1L1QA 2YZNA 1GQ2A 3UHPA 2EVWX 2FUG6 3H5OA 4C04A 1I2ZA 5JAIA 3QRWA 4H6PA 4ZPXA 1QYRA 1SVNA 4LOJA 3RR2A 4EOGA 1OGIA 2DFTA 1QHXA 3C6XA 1G5RA 2AJTA 4CIVA 4D1YA 3HUUA 4DQ0A 4POOA 2O8EB 5KNCD 4UTOA 3GGJA 5PNTA 1H8EA 1ISGA 3K0CA 4FVTA 3BXFA 2Y66A 3F1LA 4HY3A 3EDCA 4JKYA 5HRUA 1LDNA 3PP8A 4NOJA 1UOOA 1XTJA 4KR7A 1XJWA 4TL6A 3RV3A 2Q5JA 4EEKA 5CDHA 3KQQA 4PO1A 5IDVA 3DPSA 3UJPA 1X7WB 2IPLA 4DCTA 3EC1A 2QN1A 1I2AA 1FXWF 2NMVA 3EISA 4B79A 3SDSA 3I9V6 4X41A 4PG8A 1NBHA 4R2MA 2YOGA 2QTCA 1NFQA 3RCBA 3GJ3A 3RF7A 1JWBB 1MOQA 1TIBA 1WW2A 1DPGA 4ABYA 2A6PA 4D57A 1M6VA 4E6EA 1EEXB 2O19A 3CH5A 3MWEA 2VNSA 3HU2A 4F4CA 4FHFA 1EFRA 2I6TA 4XWWA 4UEWA 2OAQ1 4O2RA 2IXDA 1T9BA 1A4IA 1YZYA 5GVRA 1EE2A 1Z0ZA 1ZKMA 2HCRA 3AOEC 3HO8A 3KO8A 3R40A 3CC8A 1TL7C 4QATA 5FAXA 3R6GA 3VPAA 1AX9A 1LPBB 4RELA 4ZDWA 2VBGA 1IQ0A 4J90A 1FFHA 4I55B 5K4GA 4ZWNA 1BMDA 3GZNA 4PX9A 4RPLA 4TX1A 3SQWA 4O8CA 3FKSD 2IYXA 1JBEA 4N82A 1GOTA 1ZM4A 1K5DA 3TQOA 1WEHA 1DQSA 3SQXA 2G28A 1ESDA 1PLJA 2CLOB 1KKLA 2L42A 1XAHA 1EE9A 1WMSA 5HS6A 4Z49A 3HPRA 5JASA 4XYLA 1YZNA 3QOWA 2ORWA 4ARVA 1MG0A 1SXQA 2BFEA 2CHQA 4HH0A 4X60A 2H00A 4HZUA 4ZCTA 1BSVA 1VIYA 5FUWA 4LMBA 5E6RA 3FNHA 2J9YB 4R1LA 3DYBA 2R1TA 2C4VA 1YRYE 4I4IA 4LBZA 4QIHA 5IC6A 4ZICA 4D5EA 2J6CA 3U3KA 5K5EA 2C5AA 2AMJA 2EP8A 3NHKA 4JB8A 5DBOA 4B8WA 5CCDA 2ECFA 3CY6A 4KV9A 2YVUA 1MJ5A 3A3OA 3VX3A 4EX7A 3HDGA 2VDPB 3HA3A 2YOHA 5U4XA 3HVIA 3C8MA 2WNSA 4HUQA 3U56A 2X6RA 3QUAA 1DC5A 3NC4A 3V1UA 5HF9A 3P52A 1TCAA 2J48A 3AEYA 3P0IA 2PMEA 3GDOA 3KUKA 3MSXA 2J7PA 3H7IA 4P93A 3G0IA 4O29A 4UDNA 5E8RA 4YCNA 1VSTA 2PK3A 3TI9A 5KYUA 2QL9A 3OKFA 3LBFA 4MRMA 1M33A 5EAIA 3TL3A 3UUFA 4IIUA 5E4FA 4ZCIA 3ZE2B 1G7TA 2XPCA 4BVKA 5B64A 3A06A 3DHNA 1E77A 3KR9A 3CEPB 4FUTA 2IYQA 2A84A 1JPJA 2R8EA 2X8AA 3ZE9A 2JEYA 4HFJA 4HGNA 3UXHA 2R60A 2Y3IA 2HA7A 1J8YF 4ZCMA 4S1OA 1L8QA 2WBLC 4YUVA 3UV3A 2QQGA 1IMJA 4DY4A 1E1QD 3B13B 2UYQA 1GSHA 4IHKA 3DWEX 4TMWA 2I66A 3PNQA 7YASA 1DCMA 2CKMA 3X3HA 2B1JA 3BIXA 2YNMD 1RU3A 1X42A 2XR1A 4L5AA 2X2PA 1PS9A 4PNPA 1F5NA 3LDAA 4ERXA 2Q7XA 4JVLA 2IYVA 2WSMA 3KHKA 3HC7A 2XVMA 3NNDA 3W6ZA 2LCQA 3HZOA 1E2PA 4F3NA 4S1NA 1H93A 1M1YE 2WHRA 4R40A 1LTHR 3NCTA 4RKFA 1KK1A 2WJ6A 2ZJOA 4Z4HA 3MTBA 4A2WA 1N2CB 2Z08A 1O94C 4OHPA 5FULA 1DE0A 4YN3A 3THOA 3MZ0A 3PC4A 4NSNA 1RWBA 1VJDA 2N75A 2X76A 2ZUDA 1XCLA 2NTNA 4RSGA 4MWOA 1EVKA 4FFRA 1KO4A 3R8CA 2AWNA 3ZOKA 2GGSA 4XW2A 2VDMB 5JCXA 4GKVA 1K27A 2CNWD 3OZCA 2XYVA 5AUQA 1A7KA 3ETJA 1QYDA 1E3TA 3E23A 1T36B 1ABFA 4GQAA 3VR4A 5A04A 4QVKA 5LQMA 2OZPA 2UVPA 3OOEA 4EG6A 3LA6A 4LV5B 1SUIA 4M0EA 1W85B 4Q47A 2V3CC 1ACLA 1P1KA 4R0NA 1HQDA 4CDNA 1OXUA 5H9VA 3BTUA 4AF6A 3RLIA 1EFPA 3GJYA 5EOVA 4K6KA 2PX3A 1Z7YA 3PUIA 4D6PA 1S4QA 4D8WA 5BT8A 2XUJA 4Y30A 1A4RA 2LE0A 1O2DA 3DUFA 4L4UA 3EULA 1LPNA 4RKYA 5LDDC 1HLDA 1HNNA 1ONOA 5FOQA 1TKCA 2HSJA 3B3GA 4HLCA 3L7JA 4UBMA 5BORA 4DR5B 5DBHX 4BX2A 4CQNA 1JHOA 2P9EA 3MFYA 4E12A 4FHCA 3C39A 2EGHA 2H08A 1JG2A 1N6OA 3PC8A 3Q6NA 2D5BA 4RK6A 5LDGA 1CVLA 2ZSIA 2QG9A 2W2XA 3JWPA 3ZHUA 5K7SA 1KQGA 5F7ZA 1SBZA 1FFAA 1SIBE 2DQKA 3HVRA 4BMZA 3H9UA 4QU0A 4R51A 1SB8A 1UMDB 4XGIA 1IVSA 1U7ZA 2C1XA 3LUAA 1KFCB 1QJCA 2RAVA 1KZ6A 2VPTA 4CYMA 1L1EA 3JD1A 2XCUA 4YCMA 1DARA 1VI5A 3TZLA 4GLLA 2ZIZA 2AXQA 2X6QA 2PX0A 1R4NA 4EW1A 1CIPA 5DLQC 1FMTA 4G0NA 1NVFA 2FJPA 1POXA 4D9JA 4Y18A 2PX6A 1GUBA 3IV9A 1XZHA 2IIVA 2OCGA 1A8HA 3I12A 3AFOA 3ZIDA 2UXDB 3I1JA 4NV1A 5I9SA 3H97A 1R0LA 2E4YA 3DP9A 3TVYA 1ZIYA 3ECSA 2YDYA 1Z2PX 1QS0B 1BMTA 3F7NA 3N2IA 2ZDQA 4FSHA 1RMYA 2CL0X 3ANNA 3RV4A 5B6JA 2JEZA 3EPHA 3JSAA 3VDRA 3D43A 4WV3A 1O77A 2R0QC 1KDYA 1YJQA 2R66A 4FDUA 4YAOA 5EJ4A 3ZWWA 2QP3A 2FHPA 5SYNA 1WOYA 3HJUA 1VP3A 3HGMA 1RAIA 1RJWA 4JC8A 4QGBA 5DKFA 1FFYA 2IT1A 2VPXA 3WHIA 4DLYA 3O0DA 4K9MA 2C5EA 3T06B 2AOTA 1LBHA 4MSUA 1IIBA 2FRDA 2JLBA 1QB7A 2V58A 2WJYA 3IIIA 4RGQA 5ALEA 3ZGLA 2BDUA 3AX6A 4TTQA 2WWHA 1EK2A 1SCUA 2MMGA 2QN2A 3WL5A 1FNBA 1PWYE 1R5OA 3RTEA 1CTQA 1H2HA 3OCVA 4M9RA 3MC1A 2HR1A 1XZDA 1BW9A 1V48A 1YZTA 5JWHA 1JEDA 4MUBA 1NRIA 4L5JA 5FTLA 1RJDA 2XJ9A 1QO0D 2C5FA 1N5OX 3GH3A 4DUGA 2FXIA 2GD6A 2EX1A 1CETA 2HU8A 4DXHA 3MHPA 3QIAA 1F2UB 3IJRA 1QIHA 4L78A 2PIAA 2O06A 3LUBA 4RMIA 1Z06A 2JIDA 2XMGA 4A0GA 1IUNA 4AMYA 4URVR 1TC2A 5K6RA 4H4EA 4O4HA 2FN9A 3L01A 5E9WA 2GKGA 4ZJZA 1Y1QA 4H6XA 4J07A 3GLGB 2DFVA 4OM7A 5H5JA 4RTNA 5NLLA 4RTPA 2BMWA 4CM3A 3PQ2A 1XCBA 3B82A 3GWGA 5DVZA 4J29A 1RAAA 2Z3WA 4XQEA 5FCDA 2XVYA 1L5GB 5IASA 4RD1A 2A9QA 2D8AA 3P0FA 2ZAOA 3HJRA 2JA1A 3NO4A 3QE0A 4BFWA 2J0SA 5C5CA 5I9TA 3TQSA 1LH0A 2LDBA 1EYZA 1Y4UA 2IVFA 2QJOA 4JGIA 1QUFA 2NO9A 3G7NA 3S2GA 4X85A 2YYAA 2ATVA 2RKBA 3FBGA 1VMEA 4V2IA 1NVDA 1PWXA 2IC5A 3ABIA 1RHJA 3QOFA 4X1KB 4NZNA 4ZDKA 1TM3E 2W11A 4GLFA 1E9EA 1KAGA 2IGBA 3D3WA 4IJWA 4KO8A 4LVUA 4N5LA 2KYRA 5COQA 3RK4A 3MUNA 5DCYA 1DBQA 1IY1A 2LZ0A 2TSYB 2XUDA 1UF9A 3O90A 3RC1A 1PFQA 4RU1A 4AT1A 3BHJA 4ETWA 4EL5A 2VYND 2FDCA 3IUQA 3NX4A 1NZDA 2QVBA 3K1ZA 4NONA 5IFLA 1FC0A 3KVVA 3ND7A 3FOBA 3AUTA 3AM4A 4R7GA 3O2QB 4EVRA 1ZNWA 3BREA 5LP6C 4MPTA 1NSFA 1FLVA 5CIQA 4ZOLF 4YALA 4MIOA 5AVJA 3UEOA 4H27A 3KE9A 2JG3A 3W8NA 3WG9A 1ZR4A 1Z8HA 2V9ZA 4LOAA 4DDTA 4KXNA 1PJ8A 3DMTC 2WM2A 3EFHA 4MLPA 4E2XA 5F2NA 3NIGB 1KTIA 1KEVA 3TB4A 1ENZA 2LWIA 5BXYA 3PNBA 1ECGA 1W49A 2FEWB 3GEEA 1ATZA 2Z43A 2ZREA 2C8VA 2P4EA 3UB4A 2Y27A 4F3TA 2XGJA 3CNNA 1NXOA 1RZRD 2QAGC 3TX6A 4E1BA 2WU3A 1MD9A 2ZZKA 3ABOB 1J2EA 3IO3A 2DUNA 4Y6RA 1R4ZA 2A59A 2I29A 2H1HA 4ZK2A 3H8WA 1WB9A 2FE4A 4CTKA 1Q95A 4C4ZA 4QJ3A 5AJVB 1OZGA 4K9SA 3YASA 3R44A 1U8UA 4HL6A 2J09A 1D5WA 4JH0A 4RYDA 3CRMA 1LCIA 3PPXA 3AEXA 3OLVA 1S8OA 2WT4A 2Z9BA 4YREA 3BFPA 4KWIA 4B3MB 2CXSA 1GSIA 3H13A 3IBYA 4XXHA 1QGED 3QKWA 1J2JA 4ZGGA 5J63A 5JYBA 2WHPA 3WZLA 3IERA 4MINA 1XWIA 3U48A 1LDYA 2VP9A 3ROXA 1XRRA 4WBSA 4XVCA 1WLSA 3SC2B 4CFYA 3PXXA 1P60A 4DA7A 4K3VA 1E8MA 1G5TA 1VE6A 1Q7CA 4H31A 1QHIA 4FK8A 5K45A 3HKEA 4TYMA 2DERA 4OFZA 5E8JA 3VHXB 3HMKA 1RP7A 4JUAA 4X20B 2XRFA 1JILA 2GBLA 4LOLA 4TRJA 1DBSA 4GOND 3ZK8A 5EJ6A 5FYQA 4CKYA 4Q4AA 3V33A 5F23A 4RDCA 2R751 4NFSA 5FPSA 3DMPA 3H9QA 4GMXA 4LJSA 3Q8MA 2KSQA 1N5JA 3EUAA 1SA0A 3WSTA 1O6CA 1SEVA 3II6X 4TV8B 4CIWA 1XWWA 2B99A 5FNVF 3TX2A 4BO9A 4E4TA 5ARDA 2QF7A 1Y81A 5LXTA 2V74B 1USUA 3SIWA 1ZNZA 3OQ1A 5MN6A 1PJSA 4MRSA 3HNOA 3OKAA 3G9ZA 2WWTA 2B78A 1O03A 4OEHA 4Z86A 2Q4TA 2QM7A 4WH0A 4A2CA 3WLEA 4YACA 2OCBA 3BIOA 3LT2A 4BQRA 1RJGA 2GILA 4W9NC 4QBGB 2V7PA 4NFHA 4U3JA 2OO7A 2OXEA 1G20B 1LTQA 1GAQA 2Y1EA 3OY2A 2XB2A 4HGZA 2Y1LA 4HN4B 3A7EA 4PFQA 4EVQA 1LLFA 4BVBA 3TJZA 1EFVA 3CCFA 2J46A 3W06A 1LV8A 2BC9A 2WIBA 1USGA 4ZYVA 3W5IA 2XCOA 1KI8A 1PJ3A 4M9ZA 1XTZA 3FDZA 4UTXA 3M2TA 3DNFA 1WM1A 2X1LA 1E1CB 1XCJA 1PE0A 2H5EA 2FSVA 1XDZA 3M1AA 1J8DA 3K0AB 4CXMA 3M6XA 5EUMA 1ZNYA 3WLNA 2ZU6A 4BO3A 4EGJA 1NGSA 3IIMA 4YUWA 3NASA 1VSUA 4CUZA 3GUCA 5SZIA 1X7YA 3ZV6A 2E87A 4PLYA 5THQA 2HCJB 1IUOA 5DIZA 4RTMA 3S2SA 1AQNA 3AV3A 4WZAE 4Z54A 4E09A 1P1RA 4IHQA 4IZOA 2OUKA 3ENNA 4Q9HA 4EJ2A 2ZOSA 3WMGA 1E7QA 3LCRA 1XE3A 3M5WA 3QYPA 1UFKA 4PRKA 3TDNA 4G5HA 1XJ5A 2H29A 4YP5A 1U2GA 1T9AA 2QAGB 5EVCA 4MKFA 5EE9A 4EVSA 1SURA 3JQBA 3SQDA 3FWYA 3GUZA 5A7GA 1HT1E 3OD5A 1VI2A 3HEMA 2FMTA 1FRZA 3ZVMA 3DDNA 3SM3A 4B6SA 4BO4A 5AW6A 1AD2A 1N9KA 1TQ4A 2QN6A 1OWPA 1PGJA 4X71A 3QWFA 4MI6A 1NXPA 3BX1A 1D6NA 1Z6XA 3MS7A 3KWLA 2DFKB 4EZEA 1JG7A 1N9GB 3NQ41 2C7PA 2GTIA 4RWEA 4B71A 2ZAYA 3EXEB 4PSDA 3DVQX 3QVOA 4CQJA 5HQ3B 1P4SA 2RH4A 3AOGA 2LKCA 3ED5A 2PJUA 1YFLA 1PFGA 2G8NA 4FDTA 2PH7A 4JT9A 2RCYA 4G0YA 2WZCA 2VDVE 5GVSA 2JD2A 3GLFE 3OOHA 5KQPA 1JSLA 3HCRA 3V2GA 4MRRA 4QVGA 1LZKA 1X1QA 2FWPA 2HXSA 1FP2A 1W29A 2P6PA 2TRSB 2CLEB 2WFLA 3GPCA 3OZIA 2H2HA 5DHPA 3NIDB 2JLZA 3HO1A 4MQEA 4OQYA 4JLSA 4HCJA 1GPYA 1V3TA 4MQ4A 2O0HA 2BI8A 3K1YA 4IIHA 2PXXA 4XARA 4KYIB 1I24A 4JXZA 4HB4A 3LRXA 3P9IA 4JT8A 4HDMA 4ZVUA 3I2GA 2Z6VA 4G3XA 4MOWA 4TTRA 1O97D 3P32A 4WWHA 4ZQFA 1DCFA 2O7QA 4UAJA 5I9LA 3RIMA 4R9SA 1DVRA 4WXRA 3OCYA 4LYFA 1TVCA 3DMGA 1ADYA 4YJ2B 3UOAB 5JJ5A 1CVRA 3NTLA 3JW8A 3LSTA 3OJEA 3WKCA 5C8ZA 3RC8A 4WKPA 3DZIA 1QHGA 1RKBA 5GMOA 3IAM1 3ZE1B 4EY4A 1E5DA 1NN3A 3C1TA 4B80A 2P2LA 3FGNA 2CDNA 2WLSA 4QYSA 1KE1A 3KZKA 1IJFA 1AO0A 4X84A 2ZXFA 1PL6A 2QVXX 1FFWA 3VDMA 4PRLA 1CP2A 3GNSA 2GLXA 4F84A 1LLUA 1RIFA 2BGKA 3CWCA 2I9KA 3F8SA 1AQLA 2QLMA 2X9VA 3ICWA 4MWSA 1CX9B 3W3ZB 1G66A 2OECA 3GLKA 5BXQC 2ZJAA 4IH9A 1L5WA 4CEIB 1E5QA 2JA2A 4IJ5A 4WXMA 4XX1A 2OZLB 1Z7GA 3OJFA 4KXYA 4D9BA 1IN4A 2FSIA 1WQ4A 2I78A 1PFVA 1QK4A 4B2IA 4QSMA 2ACWA 2OGUA 5JZSA 2BHSA 4GG1A 5EC8A 2FQQA 2GO7A 4M4SA 4K28A 2MINA 3VGJA 2W8ZA 5DI3B 3WBJA 2DGDA 2WWYA 2AYXA 2AFIA 1P1IA 1W4RA 1MO3A 1GEEA 2E0IA 4GW3A 4TRMA 2NT3A 5CLHA 4Q3EA 3MELA 3PR3A 2I3GA 1H6AA 3N28A 2I2XB 2QUKA 1CVIA 2XEXA 3X1MA 1H65A 4YUAA 5K8LA 4MHTA 3DOUA 3H8VA 1EH5A 2PRZA 3HN2A 3D31A 3E9YA 4A23A 1HWYA 4QG3A 4DJ5X 3QPUA 3JR3A 3C8ZA 4MWDA 5IKEA 1HG0A 5ICFA 4FEEA 5ALKA 2REOA 8OHMA 3NETA 3TDKA 4C89A 4OH1A 1T0HB 5D1HA 4DM4A 1CZRA 4KIWA 3W2EA 4BE7B 1I9GA 2CLFB 4G1BA 3PEFA 1I5RA 3T4XA 2NSLA 3N58A 1AMUA 1KJQA 3ZHYA 1BU5A 1MVNA 2GEKA 2B3DA 1GPBA 2JGNA 4IHJA 5FQOA 1H4QA 2JLWA 4O2BA 4OMDA 1IATA 3PD0A 3O2SB 3QITA 2FMHA 3VC2A 3DTVA 1PUXA 4BBPA 3LKVA 1ZN9A 3SZRA 2O2XA 1SBQA 3A4LA 4HWGA 1JTFA 3BERA 5JAOA 1XLTC 4IV0A 1XVVA 1N5LA 5EHGA 5KOYA 1KO5A 2X5NA 1JRLA 1MJNA 4YLGA 1H8HD 5JG7A 2CNDA 4DIEA 3K6SA 1EDOA 2QUIA 2Y0DA 3NHFA 1K66A 1NR7A 3BZUA 1RWWA 4GLBA 1ISRA 3BBPA 1O54A 3M1YA 5TMEA 4LZWA 1GKYA 1XROA 1XN4A 3X1DA 4BKPA 3GO4A 5FB3A 1V7PC 2PMBA 4B81A 1RI5A 3DVAB 1LZLA 3RUDA 1P33A 3BPSA 2D1YA 5FO0A 3QF4B 3DVSX 3REQA 4LCEA 4MO9A 5K8TA 3TG8A 1V7CA 1Q77A 5FL7A 3SJCA 2ZPUA 3Q12A 1LB1B 1XA0A 2QYHA 3NHAA 3S0JA 4D44A 1FYWA 4L74A 4KBFA 1QF7A 1Q2XA 4ARUA 4BVJA 1VYUA 2JAPA 1N78A 4Q1VA 1Q0QA 3VR2A 3Q7RA 4LAFA 4B46A 2VJBA 4HEA6 1VJGA 1Z6TA 5D6OA 1N6LA 4KLRA 4JBHA 1UJBA 5L3ZA 3OCCA 4AP9A 4K9OA 1MT3A 1UJCA 2ECKA 2WF8A 3ODPA 2WJWA 2ZQ5A 3R23A 4G65A 5CH3A 1Y9AA 2O5VA 3QUCA 5AHXA 3SG0A 1Y5MA 3D0KA 2QL5A 4JLMA 3O8CA 4ZQEA 1CRQA 4H7IA 5C1PA 5FPKA 1OWLA 4B33A 5JT1A 3ZHTA 1KI6B 3T5MA 3TBFA 2HFJA 1R12A 2V4MA 3DQPA 4NCKA 2ZYAA 4YMSA 4EQ6B 1H9CA 1T6ZA 4OQZA 1XTUA 2FW0A 3TW6A 5BSGA 3HM9A 4Z8YA 1RWVA 1H6CA 2X0IA 3IJEB 3MMPA 3W1VA 1J09A 3IIJA 4CT0A 2Q2WA 3TTYA 5BSWA 4KWCA 4RABA 2P79A 3UAGA 3GJ6A 1PNTA 1X14A 3A32A 2I3DA 1E0JA 3SIRA 2II6A 4X44A 1G2QA 2BEVA 2O1SA 1BNCA 5FOWA 5E1OA 1OZ0A 1H69A 1X92A 2GSWA 1Y9JA 3KVNA 2ZANA 1TUBA 2Q3HA 3LCVB 2L18A 4G0PA 5CAEA 4R1OA 5IG2A 1LFAA 3BK7A 3DEIA 5B12A 2A7XA 4LYDA 4NVRA 2W2QA 5F5NA 3WLRA 4BV8A 5JD5A 3UJNA 3UUWA 2PKRA 5ES3A 2N1MA 3IL2A 2UXCB 4IL5A 3D8NA 1OBOA 3UB2A 3F8WA 2F8MA 4WLNA 4KX5A 3VO8A 2JLSA 4RENA 4KU4A 1MX1A 3WI7A 1WCXA 4C3ZA 4HJRA 4JJEA 2X1MA 3C3AA 1N1EA 1C81A 2XXAB 3KKMA 4BJHB 3O1LA 2R7NA 3QV1A 2FKAA 3BDIA 1WKCA 4M22A 4MB0A 3DEYX 4UAVA 2A33A 4BNXA 1I3KA 1XTKA 2B94A 2R7MA 2WNIA 4J94A 4MYDA 5GY7A 3LIPA 3D54D 3FDXA 2DR2A 4JP8A 1DBWA 3C8HA 3O3OB 4DV5B 2QRHA 1EVLA 4PZZA 1T5HX 5FWYB 1SAYA 2LTAA 1ZITA 3EGIA 2C77A 2I4NA 2EF1A 3IQEA 3TD9A 4ARBA 4BLQA 1NUQA 2QU8A 1X3SA 2GVDC 4NZOA 4X91A 2IPAB 3R7WB 5F5LA 1RPTA 3RS0A 1D4AA 1ZCZA 1V7ZA 2GN2A 2WHXA 1QGUB 4XYEA 4CE6A 4RV9A 2HLHA 2ZE6A 1N4DA 1NNUA 2P5UA 1QIDA 3KP1A 4PCVA 2NXEA 1UBOS 3V2IA 5K0SA 1RYDA 4MDFA 1R16A 4TL9A 3WK9A 1L1RA 1P9OA 3KTAA 5IWCA 3LRTA 3ZS9A 5J23A 2DR0A 1SQ5A 5EZ6B 4FI3F 1JKIA 1FFXB 3WNDA 5AVZA 4OM8A 3G6KA 1DDOA 4G36A 3EG9B 1C7RA 5DHAA 3FYUA 1BS1A 3NTUA 3O73A 1YA6A 2QMOA 5FOXA 1Z0AA 4NFYA 4RVFA 3RSCA 1P0MA 3L0PA 5L3SA 1TRKA 4I1OA 3NKLA 4MUJA 5LNK6 3TFQA 1L8XA 2GNAA 3D1LA 4F6RA 1K06A 3P96A 4W6ZA 4EA9A 3RG8A 2DPXA 3QGMA 4EG8A 2XKBA 1K86A 1BE6A 3G0DA 2VKQA 5C3UA 4QOIA 1K7EB 2PBLA 4ZEMA 1A72A 1PZNA 3C7CB 4KI7A 1V2HE 2NWQA 3AW9A 4AJ9A 2CW5A 3CU5A 3EWIA 4P82A 5AJZA 4JMLA 3I04M 3FJOA 4WK4B 1RP1A 4JBYA 4Z5XA 3C7TA 4QQFA 2CUTA 4U0JA 1U5BA 5CLFA 3HWWA 3DSRA 2GN0A 3ZE8A 1E5XA 2GEVA 3KYCB 2YJ5A 4K81B 2ZRIA 3S55A 2XXJA 3GZTB 4IGIA 3WWOA 3B52X 1GZSA 3D5TA 2C5HA 3LLUA 3NWEA 3L1UA 4M9UA 5K0TA 5EIWA 1WPXA 2ZYTX 4YMUA 1WR8A 2WZQA 3FWZA 3RC3A 3JYHA 3WC4A 4BP9A 2CZQA 2ZRPA 4RMNA 2ZIUB 3BUSA 3AJ8A 3UQYS 3NHMA 1M9NA 2AOUA 4QPNA 1TJPB 3VAAA 1P1JA 4YV7A 3EQ9A 1ZIDA 4ZANA 1WKVA 2V6FA 2XDYA 1U0GA 4R1QA 3QE9Y 2AZXA 1KK3A 5K3CA 5IJ0B 4I9HA 4DNPA 1NT4A 2IPNA 3IXMA 2YWCA 3ZJ5A 4B4KA 2D06A 3Q0IA 3OT4A 1TTPB 3B6KA 1J7JA 1PT9A 4CQMB 5CD1A 3IH5A 4NH4A 5T3UA 1T6BY 4NY1A 5DE3A 2WJGA 4EYKA 1QX4A 2EGUA 4NZ9A 1F8FA 1L8OA 3KEGA 4ZD6A 3AETA 5GPBA 1MRZA 3ELDA 4LPSA 4US0R 4NBVA 1MIOB 3RUIA 4Y6GB 1VJTA 4MQBA 3RI3A 3REFA 3HB9A 2CVFA 1UBKS 4R9UC 1V71A 3PDHA 4X6YA 4UU7A 3V7YA 3ZDYB 5FDFA 1KL7A 3PNKA 2UUPA 4FFBB 1YB4A 4DQKA 1YGPA 2FOXA 5BOSB 1QRSA 1NR1A 3ZH9B 1DAIA 5K05A 3HLYA 2HFKA 4Z51A 1TOAA 1M2JA 5IMSA 5HS4A 4U2DA 2X0KA 2EDAA 1HEIA 3EQ8A 1NBEA 3G6WA 4Q7MB 4IDOA 3QVJA 2LPMA 4MRAA 4RJIA 2QRMA 3ZY3A 3DHYA 4FT4A 1ULBA 4MA0A 3L06A 2FEAA 4X0EA 3RNOA 4F21A 2FN8A 4HDRB 4KMSA 5DTMA 3RC9A 4AF8A 2VJKA 1M2OB 2HSZA 3LC2O 1JW9B 4RPHA 4D43A 5A9RA 5K0NA 1O0SA 1H2FA 2BISA 2QE7A 1U0BB 1J24A 2MT9A 2ZRDA 3UCEA 3VNQA 3WYCA 1I7DA 2FSUA 4S24A 5AKGA 3Q6IA 3PQDA 4WFJA 1SG0A 4KAFA 3QOXA 5I4IA 5DM2A 1E0KA 1NN5A 1ODKA 3KQVA 1O8BA 1QFYA 4JNCA 2R00C 1X7DA 4DLWA 5I4CA 1H42A 1BZYA 1X94A 2ODWA 2XMDA 4J3FA 4QEDA 2ZUTA 5LWHA 4FM9A 1NYTA 2DCUA 1Y5LA 4IH4A 4KN5A 3WKBA 2H4HA 2Q0SA 2WE7A 3F6RA 4JUBA 3W8DA 2VXBA 3TINA 3DFIA 1CUXA 3W90A 4ND5A 4QU5A 3QELA 4K7JA 4AG3A 3PDIB 4TPKA 1XDDA 2BP7A 1C3XA 4GAEA 3C2QA 5FBWB 5LZ7A 4BASA 1KEKA 2QUHA 3ZVLA 2VQFB 1DHTA 1K0FA 1CEQA 1RBZA 3IP8A 4QPZA 1CIJA 4HT3B 3DBHB 1HDYA 3ULKA 2Q9AA 5HJ5A 4X93A 3ZLBA 1EVZA 2F3RA 1TLLA 4BNNA 4CV2A 1UODA 1HE2A 4V0RA 1JKXA 1V6AA 3MILA 4G0VA 2D6FA 1WUYA 2QXTA 1F0KA 5TPWB 5A1TA 2A0WA 3B36A 1N3YA 1WKBA 2EQ5A 4Z9BA 3SFZA 2IBMA 3MWDA 4BLSA 4C0XA 1P6XA 4NV3A 1XU7A 2WLTA 3T3EA 1IB0A 2GYVA 4YRIA 1CUYA 4N7RA 4MGHA 2IH5A 3IUYA 3DBVO 3JALB 3PC8C 2GRJA 2B69A 1EBBA 2BAGA 3IP6A 4Z0TA 3SLRA 5CG2A 3VOSA 4JLAA 3I53A 2WW8A 5B7QA 3ILHA 3LRPA 4IRUB 4W9RA 4HZUB 2H1LA 5F1OA 4UM9D 3WL8A 4BX3A 5E6RB 1OIWA 2RGNC 4N47A 1BG6A 1KEZA 1F6DA 4PLHA 3UMJA 3DR3A 1N2IA 1FMFA 4EGQA 3CEMA 1XZKA 3H05A 4ZV7A 5EHZA 4LEIA 3EQ7A 4G8BA 3O93A 3WL3A 1GPAA 2H1IA 4CL8A 2WTUA 2IX3A 5DFAA 4IX1A 5JVDA 1EXWA 3ASVA 4HPXB 2VRWA 1YS6A 2NQ8A 4R84A 2CB0A 4ZI7A 2RC6A 4OX9Y 4OP3A 4JI6B 3S5UA 1Z73A 1P1CA 2BELA 3WGOA 4AYXA 4AYWA 2OHOA 2WTMA 4KAXA 4AUMA 3AI2A 2R5WA 4ZO4A 5CFOA 1X1BA 4O6VA 2HSDA 2ONZA 2WF9A 4ARAA 4KTVE 1MC1A 2AX4A 4JP2A 4JI3B 1LVUA 1PJLA 4MRMB 3DBLA 4XB2A 5KYUB 1ZVVA 3KIPA 1HNWB 2ZQYA 3LUHA 4NWIA 4BAZA 5IUKC 5K0EA 3OQPA 1G0NA 4NJMB 2R6ZA 1V43A 4P38A 1R10A 1K6JA 2BEUB 2DQ4A 2XKAA 3GFSA 1E79A 4QUIA 4ZYLA 1FMLA 3K53A 4MV0A 2C59A 1V1JA 3F6YA 3I09A 1R9JA 2QUJA 1Z13A 2E4AA 2WICA 2Q4RA 3QFTA 3KOXA 2O7NA 4F5DA 3O83A 3LP6A 3PJFA 4NESA 5KWSA 4PYMA 1Z0IA 3I04A 4X7PA 5IABA 3H2SA 1Y4AE 1Z38A 4EYQA 3ZDDA 2ZVDA 3K5WA 2XUKA 2XUAA 5AVKA 3QU4A 4REOA 4Y2GA 4FOOA 5FV7A 1EU1A 1XDSA 3VU0A 3WYGA 1B73A 1BIFA 4PINA 4WD3A 4F5WA 2VPZA 1XO1A 1QH1A 3Q3JB 1J25A 1EK5A 1N25A 4U2CA 1OH7A 1NW4A 1SVLA 5ALSA 2AA3A 2HRZA 4TQAA 4RZ3A 4KXLA 1OKKD 1OF1A 4TRRA 4H7PA 1SCAA 3ORQA 3O8QB 3PI7A 5A4AA 4OJMX 1FS6A 1UT5A 4X6LA 3AK4A 2R4TA 4JJ7A 1J33A 1FSFA 4AMGA 4PN7A 4L3VA 1WNFA 2ZIEA 5CVCA 1YJBA 4JJGA 2ZSJA 4QEKA 4F3CA 1ML3A 1CQXA 1T2FA 4IO1A 2I8CA 4OH7A 3PFHA 4KE7A 4BEBA 4ETNA 1JG1A 4JSRA 3R7SA 3OQBA 5EXSA 1UPBA 3CPEA 4NX2A 3MYYA 4XM2A 3TUZC 5IM4A 3P9KA 4QREA 4HNVA 1G3UA 2JDID 3PC3A 4R16A 4LMPA 4PR0A 5LA6B 1GADO 1PR0A 2JLQA 4FGWA 4UBKA 3ZGVA 1TF7A 5U1PA 1A5TA 4FIZA 5DEOA 3CR8A 4FLMA 2GFQA 4DAEA 4HLDA 2GZSA 3ROFA 2J33A 3T5PA 4JI7B 1L5NA 1XZLA 5JS7A 1IG3A 2CNKA 3ZLTA 5DIFA 4JAVC 2YASA 1FU8A 2YWEA 2QA5A 4MHSA 2PUJA 3DVLA 4IQ0A 4TMVA 4BVGA 1DMRA 4CN9A 5K3FA 1T10A 4ALLA 2PV7A 2Y0EA 3GJSA 4X90A 1JJIA 2Q1YA 1QHHA 3I42A 4P83A 1OTHA 3UWPA 2JIRA 2JK1A 1Y34E 1VMDA 1XZPA 2L2QA 2ZT6A 3JV7A 3ZDRA 2D2XA 4AM8A 5DASA 1T4DA 1UOQA 3STXA 2F8LA 1QIMA 2HUPA 3KT6A 3G8BA 3T7DA 5CDFE 4QYMA 3UT0A 2RGRA 3VHRA 2XW6A 4CKXA 1Z26A 3IBCA 4D3DA 1RRMA 2HSGA 4F8EA 5M7EA 1VTKA 5HIJA 4Q3CA 3E3OA 4YMWA 4X95A 2WUDA 4TTAA 4CKBA 1CRLA 1E5LA 4I8IA 1K3UB 1NPDA 4IIBA 2OV8A 2GR9A 3BRCA 2O8FB 3KTFA 5LWQA 3G0CA 4F85A 3GT0A 3Q3EA 4LXIA 1JE1A 3ZX4A 2YBEA 3B1WA 3N2YA 3A0UA 4FT2A 3HU5A 4IR7A 3T3DA 4F4HA 5JYCA 4L3OA 1AHPA 5A4DA 1Q7RA 9MHTA 2ZB7A 4F96A 4XIGS 4EY6A 1HH4A 5BV8A 1W30A 3P94A 1O95C 1UXOA 2Y0CA 4GM0A 1CZLA 2G6TA 1YR1A 1JEOA 1FA9A 5KU1A 4BFXA 1NU8A 2IYRA 3FNGA 3WLPA 1Q92A 2NN3C 4RZIA 1MAAA 1P5JA 1EESA 2P68A 4DKXA 1QU2A 2G63A 1ETHA 3PEYA 4QUHA 4LIPD 4A8PA 9LDBA 1EBFA 3LY5A 5G40A 2W48A 4GVXA 2J32A 3ZY4A 4KQIA 1L5MA 5JV5A 1CZHA 1IQUA 2AN4A 1XT6A 3QOYA 3IQWA 4MS4A 4PG6A 1ISHA 1U0LA 1UMBB 1B93A 4AYTA 4D79A 3L4BC 1TVMA 1Y3CE 1SJ9A 3QTLA 1XDGA 3FR7A 3WQBA 4B4WA 4DV7B 2OVBA 4XQCA 4OBXA 2HAEA 3L1KA 1KXJA 3KZCA 1M5RA 3NBUA 1Y89A 4B4VA 4Y1GA 5J4KA 3KG2A 1RT9A 3SYKA 3GG2A 2C2BA 5C31A 1QLWA 2H8GA 3JR7A 3RHSA 4DDKA 3U60B 2IHZA 4CLRA 1Y4SA 3AVXA 2GRUA 2O05A 3DF9A 4MA5A 3MCUA 3VPSA 2BGNA 1NXVA 2YVQA 2PGJA 3MMXA 4JOQA 4UUNA 1E1LA 2VR1A 4XJTA 5K3DA 5EJFA 5KKCA 3HJAA 4W5HA 3L8YA 3CNOA 5CX1A 1R7RA 3SZUA 1B6RA 1ULAA 2WWFA 3GFTA 3QEJA 4UARA 5CH5A 4EAAA 1JR3E 1HYGA 4PPNA 5FUYA 3TIVA 1JN0A 1BWPA 1D7AA 1RLJA 3L8FA 4R54A 5TY0A 1CKEA 4EB3A 1SC4A 2WSBA 4KXVA 2W4IA 2EW8A 3EXIB 1VE1A 1V1MB 3PHCA 3Q87B 3QPBA 4Q1CA 5E9QA 3VU9B 3L7YA 4O5AA 1L0BA 3H5IA 4OXXA 4JZYA 1N0VC 1MOPA 1F9EA 3COVA 1EINA 1E1RD 2AE2A 2Q0XA 3TIIA 1ZCFA 2RHLA 5A5DA 5BMOA 1DTSA 4JQCA 2YICA 4C29A 1GIAA 5EXDA 5GOZA 2IKQA 2X8WA 3QLEA 3A6PC 1BU8A 2HJVA 3O84A 3OZUA 3KZOA 2GHQA 4EKDA 5EP2A 1RRCA 1QBGA 1EBUA 1P7WA 1OYWA 3F6SA 2W00A 4PPYA 2JKVA 3C4QA 3FHLA 5BN5B 3IP5A 4JC5A 4IMRA 3ZKAA 1THZA 4KO4S 2XA1A 4NTZA 5DT9A 4TQUS 3T9FA 1KKMA 1YJCA 1CY2A 3ACBA 1G5HA 3JQCA 4H3KB 1HFWA 3WAGA 2W2KA 4KUEA 2NSYA 3GYBA 1LW7A 2RJOA 3VO2A 2PTGA 5BWMA 2GO1A 2E6UX 2JJ1A 3DWIA 1LI4A 2IXAA 1RBMA 3D5EA 3G5AA 3O8LA 4KBGA 4MMYB 3FTPA 4EHDA 5JBNA 5C52B 2OAGA 4ONEA 2I8LA 1VGRA 5P8WA 4L8GA 2XCTB 1LJUA 3KS9A 3V1NA 3F49S 4C07A 1QAOA 3ONDA 1S0UA 3DJYA 3PSAA 2XNKA 2E9SA 2IYYA 2O57A 3BJZA 2PZAA 1GA4A 2A67A 1Z5OA 3WQHA 3DOCA 2WAMA 4RHYA 3WWYA 2NXNA 1YJAA 1N6NA 1R6DA 2QX9A 4H2DA 4YGXB 3M9XA 2CXUA 5KTRA 4QODA 4E5PA 2Y99A 3E27A 3EBLA 4R8LA 5ESWA 1U2GC 2MYTA 3TW4A 4BMXA 4ZYUA 3BXXA 5I4KA 5CJ2A 4UUMA 1G17A 1UKZA 4OATA 4L8FA 2YKGA 4XB6B 4YECA 1GPKA 3JQBC 1PL7A 2FPRA 2FI1A 1Z2CA 3EGVA 2W2MA 3WJ7A 3H6GA 3ZJTA 2BW0A 1WBBA 2D0PB 1D07A 2QP4A 3AGPA 3QTBA 1RR6A 4HRVA 3TYXA 5JADA 4NJOA 1XVUA 2ENWA 4M55A 4EPVA 4LNAA 4TMYA 2H85A 4YI5A 3L8ZA 4FXOA 4JIMA 9GPBA 3E2MA 1P2BA 1W48A 1H2YA 2IYPA 1EVJA 1YL6A 1E5VA 5LB4A 1W87A 4ALKA 3DVRX 1BKSB 1KU0A 2FHSA 2GBGA 4ZQHA 4B31A 2Q6TA 5M29A 3A2LA 4O59O 1YBVA 1GL3A 1IB6A 5ALUA 3G2QA 1WAMA 4RVOA 2Z3ZA 2WD7A 5ECYA 5ITWA 3PG5A 3ICQB 2X9QA 3DMYA 3INTA 1WDTA 3HKEB 4OYLA 2GJ4A 5DHTA 3KFLA 3R24A 4HAVA 5DGHA 5H80A 3DCYA 2R6FA 1A8SA 2DQZA 3NALA 5HIMA 4X66B 3ZK7A 1CLEA 2AHOA 1O0CA 3L7KA 5EP3A 1B0PA 3WLKX 4TYPA 1X74A 1YFZA 3H4TA 2W6JA 4KVAA 3PF8A 2K2WA 4FDMA 1GV1A 2OCPA 2ZETA 3F47A 2P4SA 2CLMB 1EGHA 3CVVA 2HD4A 4NHOA 3Q9SA 4OGLA 2V0CA 2NZYA 5KOHA 1B8OA 2O20A 1QH8A 4FZ5A 4UNQA 2PVSA 5IJAA 3PJEA 4F93B 5I8WA 3ZVRA 3MERA 2W8BA 4HQFA 3SYMA 3VVLA 1KXZA 3LV8A 3JASA 5CLGA 5HR5A 1TAGA 5GGXA 3NBYC 5EUQB 4FQ7A 2OOKA 1DRJA 5CPFA 1MAWA 3CLUC 1ID1A 4NE7A 1I3OA 1KSFX 2ESRA 2VDKB 3PXDA 3A4NA 4ZK6A 2W6PA 4WW0A 2X3YA 3V00A 1YZKA 2CJYA 4L6CA 1UOEA 4U3JB 5D8DA 3H0CA 1GL7A 4JB0A 3GP5A 5AXCA 4C6RA 1MQSA 1PF7E 3ZOZA 2RARA 3CIOA 2J0UA 5KJCA 2J5QA 4C0AC 3O2NA 3TQRA 3FHOA 1X39A 2ZYRA 3M4XA 3VU8A 3CZ4A 1RYZA 3FDZB 3J7AC 1LC0A 2IUUA 2QD2A 3DT6A 1U2ZA 5JFTA 3BL6A 5I9NA 3BRQA 2BN4A 1U1IA 3H3JA 4L5YA 2OG2A 3LGSA 2AXPA 1B8NA 1RJ9A 2H0RA 1CS0B 2V8OA 3KJZA 1XKLA 4M0PA 4R3NA 2ZM6B 3TRDA 4F38A 3Q8XB 2MR5A 1ZJ6A 3EXHC 1JAYA 4JI4B 4HEA1 1XN1A 3OCWA 3GDGA 1F20A 1E1QA 2V1XA 3DS8A 5CB4F 5J2TF 5C81A 3BH7A 4G41A 3BB3A 3D59A 3VR6D 2CE7A 3MINA 4INJA 5BOVA 1U2EA 5BSEA 1ZRNA 2FOIA 2X5XA 1SM4A 4Q66C 1LXCA 3WYFA 5BRJA 4ZALA 4KNYA 3UGJA 4UHDA 1WW3A 5FLEX 2QTHA 1DDIA 2IYSA 2ZI5A 4UHHA 3BICA 3FI9A 3FYHA 3IUEA 4L73A 5T3YA 2VJCA 5A4FS 3OESA 1STOA 3HXMA 4P80A 1NP6A 1C7ZA 3HKBB 4QO7A 1OBVA 4TLEA 1JHVA 5DNVA 3X1JA 1EWVA 1QQTA 4YJHA 2IS4A 1CT9A 3S2EA 2ZAGA 4OK5A 5FEUA 3K0SA 2I2DA 3FTNA 3P0HA 3Q7IA 3M6AA 1GKLA 2HMYB 2NGRA 3CZQA 3KXDA 5KAMA 1K3FA 1JDBC 4C6SA 3AHJA 5F1YA 1ESNA 2R2GA 3B7GA 3JVDA 4NATA 5HIIA 3AF1A 4WCVA 2CDAA 2WOOA 3FRJA 2OM2A 2G1KA 3V8PA 4C7BA 4LF5B 2OV4A 1D2NA 3FWHA 4BNHA 3PEVA 2J59A 1XZIA 3H9EO 2HQ1A 3TH5A 2ANCA 3SHQA 3VDQA 4EAQA 4NH0A 1CY8A 2PKQO 1GPDG 1P4AA 3QBJA 5FOVA 1KVUA 1RBQA 1OT5A 1X7XB 1P77A 1QDUA 3BIFA 2GPBA 2PSSA 5B1DA 4OB7A 4AWAA 1ZC4A 2GXUA 4EG0A 5DN6D 4P0QB 4AI6A 4LGCA 3R2JA 2HIMA 1IG0A 2NO6A 2QS9A 2ZIVB 3CPHA 4UCWA 2HF9A 2VAMA 1FPQA 4O8ZA 1YA4A 4S1PA 1IAQA 5B3LA 1LX7A 2WI8A 2GLTA 1RAFA 4FBLA 4M88A 2DFDA 1IOWA 4Y2TA 1GITA 3LBIA 2V65A 5C5DA 3CGWA 1Q1BA 1QKIA 1SUFA 4TKUB 4Q39A 1DHRA 4PE5B 1JR2A 3Q15C 7REQA 1BX0A 2EKBA 3IULA 1YB5A 4NCIA 2QVZX 4Y1RB 1UC4B 2BM9A 4DFDA 5JXIA 2VJMA 3LP8A 3K6KA 1NYLA 3E05A 4LZAA 4RVHA 3OQOA 3AR9A 1D2HA 4MV5A 5LSAA 4IEEA 4GPAA 2GYWA 2FY8A 3OPYI 2YWXA 3V8QA 2HYIC 2X19A 2QUAA 3SKYA 2ZR8A 1HZZA 1PZMA 2HLDA 2GPAA 2WSSD 1J5XA 2FRXA 4OK6A 4B0PA 4TQGA 2IUFA 1SWVA 2FPMA 3NB0A 1BAPA 3PDWA 1JFVA 4XOIA 1YL7A 2QD4A 2ZJ7A 2NACA 3RAFC 3RYHB 1E6CA 1PD0A 5AOVA 4E5SA 3ENZA 1DSSG 1P9LA 5GONB 1JECA 3UA4A 2BFFB 4GBJA 5G0SA 3OT1A 4WASA 3I92A 1MEOA 5CB6A 4LYYA 2IWHA 3WGTA 2X4LA 4ON9A 3SM9A 4H7DA 1ECJA 1OC4A 2AK2A 3ABZA 4WKGA 1SXJC 4N7JA 1L6RA 4A2PA 3WWEA 3B20A 4QUBA 3PD1A 1GPLA 2R8RA 4UVIA 3RSGA 3A6KA 2VUIB 2AFIB 4GO1A 5LOVF 5LQDA 2C7GA 3N7TA 5DYIA 3A1NA 4ZZIA 4P81A 1X13A 2HPZA 3D1JA 3EXHB 1RBYA 1MH9A 3JS5A 4X92A 3EOBI 4NENA 1RJEA 2WT8A 1RYHA 3OHSX 5FWXA 5BRNA 3ZXXA 3RHFA 3UOGA 5AUNB 1JEQB 4V1CA 1TE2A 3UH1A 1QKJA 4BWYA 3DMFA 2PLNA 4YHHB 3B2QA 2H65A 3OTIA 1NIJA 1T1RA 1N5RA 3W8FA 2WTEA 3GT3A 2X1VA 3JPWA 3ZG6A 5FEMA 4QJBA 1T34A 3H4IA 3QI7A 1SC9A 4GOKA 1BYUA 1C8BA 4HAUA 3GMTA 4TROA 3GFGA 2H1VA 4ZZ0A 1U2DC 2G40A 3DPIA 1S1CA 2HBYA 3W3AA 2VAPA 4IHJB 1FYEA 3CBQA 4JYCA 2AVDA 4O2BB 1IBMB 5ALHA 4ZIRA 1FXWA 2B34A 1Q6ZA 1JSZA 4BN4A 4ARCA 1PT6A 2B8WA 5P21A 2ZIXB 3BWCA 3OE7D 2WVHA 4GOLD 4C4XA 4E2ZA 4R9VA 1IPFA 3RHTA 3SVZA 4GLJA 3AXTA 1XZFA 3LGAA 3BL5A 3LDGA 1JDBB 3K6SB 2JFZA 4X7RA 2WKRA 5B6IA 1Z5VA 3PUWA 2J41A 4CHTA 3K2BA 3TLJA 3KZMA 1ILWA 3ZXYA 3ZHZA 5AFSA 4NL4H 1ZM7A 5HMMA 4Q3OA 3SAJA 1Z7BA 2Y9MB 3B51X 2O2SA 5ELLA 3T35A 2QI9C 4E6PA 2G9ZA 4RGYA 1NHWA 3Q3GE 2B0JA 4R1NA 2UUOA 5ARCA 3ZGZA 1NMYA 1GGFA 3EGXB 3BXZA 4TTPA 3LU1A 1SBTA 4F11A 2AV6A 2H4FA 1ZLXA 4YPVA 4AKSA 4DIUA 1QTRA 1YH3A 2Z8YA 3A9RA 5GV7A 2ZJBA 2F90A 2QVCA 3BK2A 3NV9A 4RMHA 2IZ5A 2VH2A 4BLOA 1MX5A 1KVQA 3GFBA 3R4CA 1QYVA 4I19A 2E1PA 3DEFA 4WLVA 1FJXA 3ZJ4A 5DB4A 3UZUA 4QG7A 1KI4A 2P9JA 4IUBS 5KSZA 4YX9A 1EFKA 3J7TA 2RI1A 1ISJA 3RSHA 2CF5A 4GMFA 5B55A 4KRYA 1OMOA 5FBVB 4JDPA 4Q18A 1DCKA 5KX5F 1Z4IA 3UXMA 1QHYA 3FSGD 3BBLA 4M3NA 4S35A 4XPZA 4BBJA 4B40A 4RLSA 3OKPA 4DJJA 3ONWA 4F8YA 2O54A 3C3KA 1Q12A 1YV9A 2FG5A 3CLVA 4KQJA 4F71A 4K6MA 2V1UA 3IAUA 4MPRA 1H3FA 1GLGA 1T91A 3GEGA 3HJNA 2V5UA 2BZSA 1BFKA 3B1VA 4NBKA 5DNWA 4AMZA 4PNHA 3JZMA 3CLHA 1U6IA 2EBFX 3EZ6A 5C18A 4YONB 2QD3A 3SJAA 2YZGA 1GG2A 1SCIA 4ISBA 4Q05A 4CBVA 3CVOA 4MCHA 5A3JA 4YB8A 1JVSA 4ZHSA 1MPXA 4D96A 3A04A 3KKEA 3SBDA 2RJNA 1FDSA 2W6QA 2B5VA 4NG5A 2VS1A 4HDKA 4QPJC 1DTEA 3N2ZB 5DTIA 3QBEA 1VE7A 2FG7C 4D0GA 1AS3A 2VP3A 1RPJA 3O5AA 1SXJB 4D0NA 3EPLA 1YS2X 3VDNB 2PCJA 2HJ9A 3E22B 3BWVA 2WVAA 4HQOA 5CAEB 4EYEA 4MVJF 2NT4A 2NUPA 2AMLA 5CT4A 5CU7A 1IPEA 4EF5A 3W77A 1O87A 1S5PA 3PXUA 2XWBF 1QDEA 2JGJA 3EQZA 3BXOA 4R2KA 4RIEA 3S8YA 2A2ZA 4O4LB 2IBTA 7GPBA 1GRNA 1RQ2A 3PA6A 2DFLA 4MV3A 4W9MC 1VPDA 1MABA 2BPOA 4M1QA 4UXIA 2XMZA 4BYMA 1I14A 4AO7A 3QE4A 5BSFA 2BMVA 1DWQA 2V54A 2B9VA 1QQ6A 3KWMA 4FYHA 1RRKA 5ALIA 4MJ3A 4F5ZA 1EP3B 2ZRMA 3U7RA 2YUTA 3OUZA 1FS5A 1Y48E 4EHHA 3A6HA 2AR7A 3QE3A 1QRRA 2R7AA 2WFMA 3HABA 4IUCS 1N8NA 3IQHX 5E6SA 5EQDA 2MSDB 2QDKA 3TQQA 1GZUA 2J4FA 5JLAA 3VYVA 4CMJA 3JQGA 1VSBA 4CKCA 1VLHA 5AI6A 3DV0B 3VR3D 3ZDBA 1OX6A 2XUHA 3KQMA 4GPZA 2P67A 4C7VA 4QDUA 4RPCA 3AJ9A 3PI6A 5I7AA 2I34A 3GOHA 4OUKX 4CMIA 4E03A 3N74A 4JS0A 3LT0A 5DHUA 4G23A 4EKGA 3TXAA 2A3RA 2C88A 4UTRA 1K63A 5IN4A 2EBHX 4XJVA 1CUCA 1E59A 3TZQA 3A9VA 3SNKA 4DBLC 4NYJR 4W1QA 1PNOA 3G8DA 2HW8A 3DFKA 1U2QA 2A5FA 5DM4A 5J1SB 3GLIA 3MQ4A 2KBEA 4QGAA 3C6QA 1PI3A 1WHSB 4CMEA 2UXBB 1CJBA 1E69A 2PH5A 2WG1A 3IVCA 3L8HA 5LCXA 4G0MA 5E4JA 3L6EA 2H5LA 2N0SA 3DZKA 2JW5A 3L1VA 5EL0A 2QOEA 3WIVA 5B7PA 4GNKA 4N3CA 4UHJA 1TGVA 2QRJA 4I3HA 3EFOA 4UDOA 1Z4PX 4K9QA 1XMQB 1QZTA 5EA2A 3ZHXA 4EENA 1VB5A 2WUVA 1QM5A 3EPPA 3E0XA 3HY6A 5JPIA 1O94D 2VWGA 4RE5A 3DDOA 4LECA 2WJ4A 1E7MA 3O1JC 3THSA 3OKCA 5L9AA 3J81k 1VXOA 2JJ2A 2X4DA 3PXCX 4G0QA 2BEWB 1JQLB 4F6LA 4D3SA 4Z1OA 1OVMA 2P2YA 3KWFA 1U8ZA 3GLUA 3SIPA 5CIYA 2JAQA 2WU8A 2XIJA 3TJRA 3FPCA 1ISFA 1VHQA 5CNMA 3CJQA 4LW8A 3WIUA 1Q7TA 2AD1A 5DT2A 5EJEA 3TF5A 2O5CA 4V0OA 1U81A 3OLCX 3OZDA 2WM8A 4RA6B 4EJ6A 2VQDA 3A11A 1RVDA 1ZMBA 2PD4A 4FWIB 4MVJP 1SZPA 1YRAA 2OV2A 3EFBA 3BZWA 4MYSA 1LLQA 2RHMA 1YAJA 2IYAA 1B6SA 3IKLA 2K7ZA 3DMNA 3IQZA 4PLPA 3RIXA 3JYQA 3WIOA 4QWWA 3OPYB 1PHPA 4AK9A 3ZIUA 1BCSB 2IDZA 5DP1A 1XPJA 1JEYA 1G4AE 1M1UA 2HHJA 5L3VA 1AKQA 2VVTA 4D6XA 2GPYA 1S6YA 2WIDA 2NSJA 1A2BA 3FKJA 3N2LA 4DKJA 3AY3A 4HUJA 2C3UA 2BM8A 1T29A 4B74A 1AQIA 4KMOA 1UKVY 2AEFA 2FB9A 1U3FA 2AYZA 3ND5A 1TMKA 2OGWA 5K3BA 3I2HA 4D9FA 4AY5A 2R7LA 4WERA 4UCFA 1KP3A 5EJMA 1DAOA 1VXRA 2C2XA 4ETIA 2EG5A 5BN4B 1JDSA 3RUFA 1E3LA 2BFAA 4LJ9A 3AETB 3IKMB 5I4BA 4HDNB 4I4TA 4LY0A 3ML1A 4WUTA 1DELA 3HB5X 2YZ2A 3ZUPA 2VFAA 5I7SA 1DBPA 1EVYA 5BVGB 2OT3B 4M99A 5CYFA 3FCAA 1WZ2A 1U9JA 1AMNA 1J56A 1FUEA 2B8JA 1HM5A 1RSZA 2R84A 5TPZA 1J5EB 4ZKDA 3F7MA 4HDOB 2G1PA 3K05A 1JL3A 1MJGA 2W42A 1UQTA 2VWHA 5JI3E 2QU7A 2R11A 5DEIA 4NFLA 4B6JA 3GJ5A 2NADA 1U28C 1NUUA 3ZI4A 1XQ9A 2FR8A 4JL5A 5F21A 5TMDA 4FNOA 4RGBA 3W4IA 1QVRA 1P39A 1ZJZA 5IYZF 3JAKA 2JBHA 2O5EA 1V8PA 3Q3CA 4PTYA 1CZNA 1CZKA 5K2MA 1L4YA 1QANA 2DPHA 5DMHA 4LGYA 1NRJB 3BK1A 4RXUA 4F1JA 1OLOA 3AR3A 3F9RA 3VV3A 3CT4A 2EFDB 5AJTA 2QLJA 3FTDA 4BN5A 2C0CA 2CKDA 2PN1A 2R8ZA 4LKRA 4RD4A 5E2BA 4D3FA 4YCAA 4Z8XA 5ALTA 2EWMA 3H8SA 2YRWA 3R3UA 1E94E 4EDFA 2I5PO 3LO8A 2GBPA 4DDHA 4MQ6A 3C6ZA 2EJUA 1MB4A 3W7VA 4BB9A 4PIVA 5BYJA 2OBFA 1HLFA 4KTTE 2ZCUA 3MVEA 2IUYA 4GM1A 2HRBA 2FFBA 5B58C 1W0CA 2V0NA 1JXOA 2FXVA 2PWBA 2ZFUA 3P7MA 5FPHA 4P34A 1UAYA 4BGUA 3GLGA 5F78A 3IT1A 1UDAA 1BVRA 3B9PA 2HL6A 4KGZA 1YS9A 2XA2A 4NPHA 5EWMB 5IT5A 1Y1SA 4IIGA 1HE4A 2BP7B 2DYKA 2JKYA 3OETA 3QPVA 4M54A 4DR2B 1AK9A 4KVGA 2P90A 3N2GA 5HDQA 1CS4C 2ATCA 2BGIA 4GQIA 2OWEA 5BNFA 1GCUA 4R1MA 4ZU3A 4EA6A 1EKXA 3GDFA 5IAGA 2G25A 1T24A 3O1IC 4HNAA 3M9WA 2G72A 3WV5A 3CINA 3A58B 1I33A 2ZSKA 2HZBA 4U2FA 4ZOLA 4Z7JA 5K4HA 4WCFA 1E9AA 1YR2A 4G6ZA 1G5PA 4RZQA 3O47A 2B4TO 4UU8A 4B3BA 3SN6A 2PKCA 3ZQKA 1Z0UA 5JJKA 1Z29A 2WUEA 1XRJA 5EMKA 4YMIA 4C0BA 3F97A 2NVUA 1RXCA 3V97A 3INYA 3R41A 1VHTA 2J3HA 3RVLA 2FP4A 3FXAA 3AUAA 1UXKA 3RWMB 3VR6H 2APJA 3UB3A 4DDMA 2PH3A 2AYYA 2JAWA 5JVDB 3W9SA 1UKYA 2XSZA 3A1DA 4OVKA 5CRIA 2ZSEA 4MQFA 2XI4A 1ZMXA 3DM5A 5CA0A 1YA8A 4RL6A 5BYBA 4RF5A 4OAQA 1R8XA 4X1IA 5DZSA 3MHTA 4D74A 1ZQ1A 1H8HA 4KPUB 2IIBA 5KQGA 3HXOA 1JJVA 2FPPB 3HYSA 4N48A 5J4LA 2REBA 4AS1A 1IM8A 4YCCA 4MVJD 2ZG6A 4FNAA 2PT9A 4A73A 4J0GA 2C98A 1E9CA 2P9HA 1D6JA 4UJ5A 4UZEA 3LOPA 4X1YA 1G6KA 3PHHA 3QFHA 1GZ4A 2JIZD 1QMPA 4TWIA 2DEUA 4F46A 2W2OA 1TNDA 4KAJA 4DEXA 3U81A 3DOEA 3RFFA 1S02A 3EGDA 5HDBB 2H9YA 4G5QA 1ULUA 4BNDA 4BC1A 3SQMA 5DLEA 4ENUA 7ABPA 2FLWA 3QSYA 3FY4A 1PNQA 1PIWA 4KC0A 4KLCA 1QG2A 5HG0A 2DFNA 4F2WA 1NOJA 1KO7A 3UQZA 2NU7A 4QO8A 4BCBA 1HSOA 3QH4A 1JDPA 2DHQA 3HJBA 5TSDA 1O4VA 1KIFA 1IEXA 4AMBA 2B1QA 1K7XB 3T3MB 3RVSA 1FX0B 4J0IA 1F2DA 4G9EA 4JOCA 3RUAA 1Z3CA 2QUBA 4IBOA 1QNLA 3EMVA 3OPXA 4BJ1A 3GRPA 1HZJA 2JCYA 3TECE 4URXR 5TQVA 5JZMA 3L2OB 4LF8B 2F9FA 5FIUA 4KQ6A 3THWB 3PQ3A 4LE1A 5MGBA 1NLZA 1MEEA 2YZ7A 2EAUA 1ZWLA 2AOXA 2R8BA 1FRQA 4Q6WA 3NBMA 2MCFA 3BSWA 3TGLA 4UVDA 4XWAA 2C83A 4G5XA 3HB7A 3BN3A 5T8KA 2N46A 1LUAA 1SOWA 5J2UB 1J99A 1MO2A 3S40A 2PLRA 2WV7A 3MCAA 5LQRA 1T8WA 3H42B 3PFNA 4JYMA 1BX1A 4QASA 3UWOA 3QMMA 3PQ4A 4IX9A 1B6TA 1RW4A 1ZJJA 4C21A 1XNRB 3TMKA 2QYOA 2VP5A 1T1IA 3DQZA 3UJ3X 5LLTA 3M5CA 3UMFA 1X2BA 2J87A 1JHPA 1FJ2A 4R1PA 3EIEA 3CV3A 4CT4B 1Q1QA 4F92B 2JI8A 3KZNA 1X15A 3W6NA 1JWLA 1IZ8A 1F06A 1B0UA 4FGZA 4REQA 3PA8A 5H3CA 5MN4A 4HX9A 3UHJA 1RWPA 1U1DA 3GJRA 5EHIA 3ZGYA 3LF1A 2ZGVA 4OAPA 4BS9A 1D2RA 4JOSA 3R75A 2REQB 4AN4A 4FU0A 5B6PA 1QYIA 1A2KC 2V7EA 2QNBA 1L7EA 1NVEA 5CEJA 3KJFA 1T5OA 1DXHA 1Z2OX 1G8HA 2XDWA 5BT9A 4I1SA 2MSEB 2XT6A 4JU9A 1X38A 3URKA 3OQJA 1N9ZA 4L3WA 4HWSA 5G41A 1YRQA 2IODA 3E1GA 1XU9A 3O4IA 2Z58A 4QEZA 4YASA 3KR2A 5IAAA 1EFTA 5DCUA 3UUGA 2WWRA 2CB9A 1F0YA 4L2IA 3C97A 5A4JA 3IJPA 3OWXA 3S81A 4Q9DA 5DGCA 1MFPA 3TSWA 1MPTA 1Q6YA 4X8HA 1QPBA 3GP8A 5BNTA 1E2MA 3KR0A 4ITUA 2WDPA 3COSA 4RC9A 3TE6A 4A91A 5HKKD 4R68A 4CKBB 2I2WA 4BOYA 2ZJ3A 2GEJA 2OG1A 1G5IA 2VF2A 2SKEA 3H1PA 3E9EA 4WKBA 1S2DA 1J5PA 2GOYA 2JAHA 2QSZA 4DLKA 3H4MA 3VI4B 4WT7A 1M2HA 4PC2A 3MEQA 4J43A 1P8JA 3MGAA 4LE2A 2XTAA 4FJ2A 5FUVA 5LC1A 1JQ3A 2A94A 4QDJA 3TXXA 5KVAA 3OX1A 1NW7A 2WU4A 2I80A 3N1UA 2P65A 4KZKA 2YCBA 1SFRA 1T3SA 5D3ZA 2WINI 2XMBA 4WA8A 4C03A 4B6OA 1MX9A 3CSSA 3C5VA 4OBWA 2LKDA 3QKIA 2M32A 5ELXA 1GGVA 2JGIA 4JLWA 1YKFA 3NYWA 4GMHA 5H16A 4MIEA 4UEKA 5LDHA 1T3GA 1W36D 4U5XA 5EIFA 1UPTA 5D85A 4BQNA 5CA1F 1F3OA 3GVCA 2QGFA 3DBOB 4CCWA 3QFFA 4R8VA 1OLUA 4KE8A 4Z1MD 2ES4A 1Z5GA 2ZT7A 3K7EA 3ZEIA 4JWKA 1LBQA 1HDCA 2A58A 1ZVMA 3NFYA 3PZRA 3B8EA 4X45A 1XNQB 2XGOA 3RBXA 3JQFA 4S3MA 1A4XA 1M1YB 4UHFA 3U7HB 4DR6B 3TD2A 3LUGA 4DSZA 2ZWPA 2PFKA 5CCXA 3O8NA 1L4GA 2XGGA 3M3PA 4K86A 4US2R 3QWBA 4HH1A 4B0OA 4W5TA 5NULA 3EG5A 5BWLA 3PUKA 1UC5B 5AI8A 4CNBA 5JJCA 4RZHA 1Y5IA 4LJKA 1K8RA 1NULA 1E3WB 2Q9UA 4M1TA 5CX1B 2PGAA 4YLEA 2WF7A 1KSJA 2D8MA 3TEFA 1G20E 1GCAA 4RS3A 5L4NA 2GTPA 4FB5A 5I8ZA 16PKA 2ZBRA 1E63A 1G3MA 4OQMA 4CW7A 1OVGA 1BO6A 1NI5A 1YCDA 4F3KA 1SD1A 1GAXA 2BKEA 2X6TA 5JH7F 4QRDA 1T3TA 3V4VB 1XKXA 1AUXA 3A37A 1DBVO 1ZEJA 3H04A 3SU8A 1I6LA 4WXYB 1C1YA 2V6BA 4PYNA 3ILXA 4D81A 3ZNPA 1U0TA 3DTYA 2F8TA 3ITNA 5CHYA 1MA0A 3S44A 3EAQA 2DY1A 1NXSA 2EW2A 2G3YA 1UJ6A 2Z57A 3STWA 5LQUA 5AMXA 3SS7X 1UINA 5HNKA 2QJWA 3NMUF 1XEWY 2BJWA 1ZY2A 2IXBA 3IOBA 3MG9A 2BUBA 5DRTA 4DOMA 5JYEA 3H4VA 3Q2OA 4IMIB 4N03A 4C4PA 4ZDJA 1I3LA 3M4YA 3B2NA 1DIBA 1NPTO 1VMIA 4MVJE 4V1CI 5IJWA 3QNUA 4MKHA 1NVVQ 1D2AA 3P2IA 1XQWA 4M98A 5BN3A 1UWKA 1JT2A 3JQ8B 4QBKA 2OQVA 1GUAA 2JHPA 1AK1A 1K0UA 5DM0A 2P30A 2D1QA 4X97A 4EGCB 4FMPA 3KDAA 3VVMA 4CM5A 1HMYA 3NM6B 3GBPA 3GEDA 2PT7A 5JSZB 3COYA 4F1WA 2UV8A 3C5EA 2OD9A 1OR8A 3U4GA 2J0QA 1W2WB 1JXMA 2YX1A 2YMLA 3UMVA 3CO0S 4Y2VA 2PYZA 1P7PA 1ISMA 2YNMC 4KH0A 3TNJA 4CDRA 7AT1A 2FFHA 3MRTA 4WI1A 4WOKA 3BKWA 1R64A 3KSDO 2B3TA 4QFMA 4BZXA 4EWLA 4HDCA 1PBNA 5DPMA 2HYDA 5AHWA 4O2AF 2G0TA 3AEQB 3EXFA 4P92A 3RJTA 1IXKA 1LSUA 2WSYB 3G9UA 1NJ5A 3M2PA 5CVEA 4HYTA 4EHLA 5I7FA 1N77A 2H52A 6YASA 3HP4A 3D8HA 3H5NA 4MH0R 4ZQBA 1RZ3A 5BR4A 1U7DA 3FIJA 3NHYA 1FQOA 4U1RA 4BNVA 4YXWA 3BFXA 3HHPA 4B83A 2PUDA 5E0OA 1OIVA 2WSLA 5ICEA 4DMLA 2PUCA 3BQMB 1SD2A 3E1KA 1P3JA 1Q0ZA 4BKOA 1R9GA 3MGCA 1VRCA 4M0UA 3LPDA 3KYDA 1DZ3A 3Q5GA 3OZRA 4LPKA 4F91B 2GCEA 2JFNA 2JRLA 2YXLA 4AC9A 1F8YA 4B3DA 4XRGA 3MXOA 4WE3A 4WDQA 3DWGA 3V1TC 5F9MA 3GJZA 2IY9A 4NHEA 2UZIR 3T8YA 2VHXA 5H7XA 4M1YA 3I6MA 3IOCA 3LF2A 3WBKA 1NLMA 2D2FA 4PFJA 4JLVA 1DX6A 1QC5A 4MQUA 3HZHA 3CKYA 2QLLA 4IDEA 2QRZA 4BEWA 4Y9SA 1YQQA 5IF3A 4QL3A 2CMKA 2WMOB 4HTFA 4UU1A 4JHXA 3EVFA 4YMTA 1Z2AA 5ENZA 5CK4A 2CMHA 1C9DB 3P45A 3TNLA 2QEQA 1A9ZA 3T9EA 1U2TA 1WL8A 3GBSA 2ZS9A 1YS7A 1TMGE 2C9ZA 3EYAA 4Q93A 2QLNA 5IDQA 1AHIA 2VDWB 4D42A 1UBGA 1LK0A 4G0XA 3D8BA 1UBCA 5JC1A 1F2TB 3OPQA 2AC7A 1QH8B 3GRVA 2WDZA 4PC1A 2Y1WA 2DHRA 3W7AA 3QV2A 4TUYB 4QUJA 5I9MA 3OQMA 2RSLA 1QU3A 3SEQA 3AFHA 2PZFA 3JASB 2FZVA 3V4LA 4JL8A 2C9YA 3I05A 5GZ3A 5JW6A 1UZUA 1VIMA 5CNKA 2XE6A 1IBKB 3JZAA 2GAJA 3HSSA 4JJAA 4IIJB 4EBBA 3E8SA 1N6IA 4HH4A 2VBFA 3GQBB 4P84A 1SGWA 2XRYA 3KFVA 3D4OA 3OZ7A 1PZHA 1NTRA 3CUVA 3ESAA 4IWYA 3SX2A 1PJQA 1JLRA 2YY5A 1Q0SA 1C9YA 2ZTHA 3ZHRA 2P6OA 4PLCA 1GG9A 1G9TA 1E0DA 2CLIB 4X00A 3U7IA 2VN8A 2BE9A 3EC7A 4BGDA 1HOTA 2XVZA 4NAVA 1DWPA 3EK2A 4MVYA 1W35A 2P27A 2W37A 2Z5GA 3FSRA 3MJHA 1OI3A 1FZTA 2O6LA 4FUQA 1E7RA 2CLDX 5FXMA 2HI0A 4A7PA 3UWDA 1QNFA 1VZ3A 4NEHB 3HCOA 1OPXA 4XIJA 3IQFA 4EECA 2C9BA 4RKWA 2CC2A 1M72A 4J9VA 4YJ3F 4XIFA 5K03A 1ZK1A 2W22A 2ZT5A 3K4QA 5GQSA 3CF4G 4FFPA 5T41A 4PSAA 3AJEA 2X5KO 3M1IA 3SNHA 4Q7JB 4BJ5A 4L85A 1X7ZA 1HT2E 1Y5NA 5HTOA 5ILOA 3H5RA 5KHAA 1XTVA 4PZCA 2OYCA 4HG2A 4D82A 3N2EA 3MINB 3ORRA 2JBWA 1IHPA 4MEBA 1VCIA 2O4UX 4XWOA 4NI5A 4D8YA 1ND6A 1QVZA 4JYPA 5F7OA 3V9PA 3K5PA 4ZTZB 5AM4A 4ARZA 5DI9A 3JWIA 4C0HA 1ENPA 2CMFA 5BQ5A 1WUIS 2YXNA 3BDVA 1JSRA 1CFZA 1NASA 3K9GA 1BFUA 4WGGA 4PSCA 2R86A 3AU9A 1X8LA 4PSKA 5F1KA 5F52A 4Z3DA 3VPHA 3S5JA 1XZAA 1ZS9A 1G3QA 3WK6A 1BQEA 1E2QA 2DX7A 1P8AA 2QMZA 3Q40A 4GYJA 1N75A 4JLJA 5HBGA 3WNCA 4YMVA 1IRIA 1ESZA 2R8YA 5DBEX 2X22A 1Z47A 3AB7A 4QICA 3W6OA 4RF3A 4ED9A 5CFPA 3G68A 3LJKA 4I0WB 1U8EA 4X94A 1PJCA 2JL1A 1CFJA 2H59A 4JEHA 4JLPA 4KLAA 3KSMA 4LVCA 3PL1A 4P33A 3DPUA 4R2XA 5TEWA 3U9SA 1NNEA 3DLHA 2EARA 1DDGA 2I67A 2EJCA 4RUKA 3BEDA 2C0QA 3MXTA 4GPBA 1RFLA 1K75A 4B8ZA 2FEKA 3KALA 2A3NA 2QVLA 4Q9LA 3HSYA 1QVWA 1YR3A 4B87A 1GGJA 4CMKA 2VP6A 4PO9A 4KLNA 4WOBA 1WDMA 3K70D 2G5CA 4O4HF 5AI5A 5JXJA 3RVQA 2N47A 3BAFA 4HVLA 1GA1A 1LJLA 2FJ0A 2AVNA 2YWJA 1NTOA 3KSRA 1Y9ZA 2VBCA 1BEUB 3M4JA 1VJ0A 4OHXA 3ROTA 1VQ1A 1EFRD 1YIOA 1DNPA 3PD7A 1NUPA 3B6MA 2VJMB 3SFTA 5CVJA 3CFYA 4L07A 4ZZ3A 3ZY2A 1ZG3A 3BMQB 4BPRA 1SO8A 2HBZA 2FZLA 3H1AA 2YV4A 4J0KA 1KKUA 1TK9A 1XZGA 3L7OA 4OXKA 2QTMA 1BQ4A 2AFHA 3GFPA 2CXNA 3NI2A 4L50A 2R2AA 3LPNA 4HPWA 4F56A 4EJ0A 1BVYF 4GUAA 7MHTA 1ZU4A 2WTBA 3LO5A 2HN9A 4XEHA 2DTEA 4Y67A 2NV0A 2YWBA 1Z28A 3ZEAA 3KL2A 2AXNA 1V11B 3LHKA 5D87A 5EWLA 5GIPE 4AIRA 4GZLA 3S4YA 2RAPA 4NNOA 4PPGA 2HT1A 4J16C 1BJRE 2JBAA 3HJCA 4MGEA 1NV8A 3RTDA 5AVTA 2YVAA 4C05A 3K32A 1KE2A 1YKSA 2DAPA 2CN1A 4O1MA 3LHSA 4HWPA 5AOAA 4D4JA 4MVCA 2W7TA 4MVJH 1PFUA 1Z5UA 3CKMA 3U4HA 4CEHA 1K5HA 1GV0A 4I36A 4R5MA 3BE5A 4XWKA 2PPLA 5HCNA 1NE7A 1R3DA 2BGUA 5EFOA 4DSNA 4EYGA 4WZAB 1KORA 1PK7A 4P1ZA 1LY1A 3V55A 1K68A 2YV5A 1ZI9A 4IH1A 4ITRC 4NENB 3UJ6A 2AFVA 3A10A 4CLOA 1I7LA 2QG4A 5FWXB 4RNDB 3K1JA 3G0OA 3QLUA 3HFJA 4KX3A 2IV7A 4IYJA 4V1CB 3OTOB 4L57A 1LDBA 5M5BA 3VAYA 4PLWA 2IS2A 4KPYA 4WZ6A 1H22A 1X77A 5D1NA 3IB3A 3TSZA 1EJBA 3QKTA 4RK7A 1X9HA 3U0BA 4KIUA 5FTMA 5DF1A 3MJTA 3J81A 4WVFA 4Q1FA 2Q50A 4UUAA 2I9PA 3EGOA 4ENVA 2C9CA 3T1QA 1QXSA 4XFDA 3ZWQA 1COWA 3I72A 1KMQA 4H60A 3ZWCA 4I5FA 1TYEB 3OIGA 3ELBA 5FUBA 3G2LA 2A30A 4A5OA 1KRXA 4DPKA 3LWZA 2C4NA 3SPXA 3G2JA 3G2KA 4KI0A 4K3UA 4KXMA 3IDQA 2YY7A 3X2SA 3X2EA 4DLLA 4HEHA 1E62A 1RDFA 5EYPA 2ZCVA 2NUTA 4ASUA 1PTJA 5AVWA 1NI4B 1ZI8A 3GLFB 1M8KA 1VMKA 4JVSB 2FWJA 1VL0A 1HDXA 4HH3C 4CCYA 1E1RA 1VP9A 1N6PA 4IOJA 5JXGA 2PX4A 3LK6A 3E35A 5SICE 2JJYA 2NUAA 3O0TA 1K4YA 1OLSB 3VYSB 1SQ0A 4HLQB 4KUHA 5LB2A 1P72A 1SHZA 3ZYZA 3HG7A 2J0EA 3VX4A 4JX8A 2EG9A 4EYSA 2ZRBA 3Q9NA 4P4NA 3NWPA 1GN8A 1O3YA 2Z5FA 2WMYA 1TM1E 4NCAA 2I6GA 5F98A 4P86A 4NJEB 3FDFA 4IIDA 2QTFA 3DO5A 1W4BA 3H2BA 1XXHA 2O3UA 1KZ7B 1R0ZA 2GAAA 4JMPA 4RCYA 1NA5A 3U9LA 2K4MA 5KNBH 4U5QA 3D1VA 4EG5A 3QVVA 1A8PA 1VIVA 3VR4D 1I51A 4MIYA 5I7HA 2RBKA 4EQZA 2C4TA 4PZ9A 4KPEC 1FSZA 1DJPA 1M2WA 3U3ZA 2WAOA 2GM4A 2FEPA 1FYVA 4MUFA 3ID6C 1JQDA 3F96A 3UF0A 1JU4A 3SDZA 2BSAA 4IDQA 5B3AA 3ZU5A 1Y8RA 1U3VA 1UK8A 1IOZA 5DO9A 1ZN2A 3HCNA 5B4UA 2Q0QA 4WBNB 4ZRDA 1XTRA 1WUHS 3M3HA 3WJAA 3GY0A 3PFGA 2AUNA 4XDGA 3E7PA 4FEGA 1JPNA 3UFXB 3O75A 5F35A 4WHMA 1NWHA 4YRKA 2OCDA 1LV7A 1SK8A 3C41J 1OAKA 3R09A 3T9CA 4BX9A 4YRBA 5LZ2A 3NKFA 2WA2A 2CF6A 4MUMA 3OCXA 1AV7A 4KACA 1VL5A 1ZNQO 3L7CA 1AKUA 1E92A 2CBZA 3DCJA 3DZHA 4TMFA 4LJ4A 4ER6A 1RWNA 2FE1A 5C7LO 2Z5LA 3FMIA 2R85A 3FNRA 1C9JA 1V1RA 2FFQA 3U4QA 3LUFA 1AH2A 3MWGA 4ZEWA 4J03A 3ZY5A 2WQ7A 3UPUA 1R37A 3NIWA 1MABB 1NF2A 1QCYA 3V1KA 2ZITA 4DDWA 3QXGA 4MS3A 1WMDA 2B61A 1RI3A 4GEGA 1YSCA 4L72A 1WQ3A 1VA4A 1SU7A 5AK3A 2H1SA 1N2ZA 4Q9IA 1B2LA 1EK1A 3QPDA 1KEUA 1XVAA 2XNJA 4AUEA 2PU5A 4TKVA 1SELA 3QYJA 5I45A 1LPOA 5D5HA 3ZDAA 1J2UA 1U31A 2FR8C 4CKCB 5IDYA 1O97C 4TT3A 4B7XA 4FR2A 4BMDA 3C7DB 1EK0A 3H9CA 1A9OA 1XX6A 1AS0A 4PSVA 3WV4A 3EIQA 2BTQB 1ZDMA 4EELA 2QZPA 5CBPA 2IHNA 5HF6A 3COWA 1PJTA 1GL9B 3AHIA 3F3KA 1YR7A 5ALLA 2XB9A 1WY7A 1QK3A 2AG0A 3UXEA 3CEHA 3I1IA 3PC7A 1AO3A 5K51A 1PV1A 4FXPA 1RE0A 3BYZA 4J4BA 2K7FA 3U13A 1XKTA 1AXGA 1SKAA 4CIYA 2IXTA 1C80A 2OE2A 3BIWA 2IV3A 2MDTA 3E9ZA 3PUJA 3VR0A 1I10A 3EFOB 1OD6A 2B4KA 1U1CA 3HBJA 1MRSA 3WKAA 4DUGD 3EHDA 4YYZA 1Z68A 4MUGA 3DHEA 5E38A 3C7KA 1JHYA 1Z16A 3DZBA 5HFJA 3BWYA 1BA3A 2Q5QA 4BVFA 1JIUA 3JD4A 1R0BA 5GGYA 4I55F 4PYQA 4NCJA 1TZJA 5G3ZA 3A1WA 4E30A 2SICE 4F9FA 1H4VB 4E5NA 4EUNA 1R5BA 5J43A 1EP1B 4YP6A 4BGIA 2ZAIA 1GAWA 2YFHA 2RHOA 2ZYWX 3IEUA 3OJXA 4N49A 3IBSA 4DSUA 2C7QA 1ZHFA 4H3VA 3VBCA 4IDFA 2NNLD 2H2GA 4LISA 3ADKA 4EUSA 3K0FB 4YPFA 3I73A 3R0JA 3KUUA 3BGSA 4LTMA 1RKVA 4PGGA 1HL7A 2VH5R 4N0PA 1EZ1A 1NKTA 1ZAYA 3DL2A 3KSUA 2BFDA 4RMJA 8ABPA 2X86A 4CFSA 4P5PA 1FSSA 1OU0A 1KEEA 4NU0A 4WCFC 1OILA 3VR6A 3E5MA 4OI1A 1U02A 1PZXA 1OFTA 2JFVA 3NBZC 4M53A 4AKIA 4RPGA 3I45A 1VCHA 3QHAA 4H77A 4LBVA 2W0SA 3E9CA 4LUCA 4B6RA 1T3HA 2GRAA 3UG6A 5F9FA 4EF4A 4XAQA 4PGFA 3N6RA 2IEBA 1NKSA 2P7HA 4RWZA 5DCWA 3NJ8A 3QVXA 3SOPA 1W19A 3IESA 3TB6A 4B85A 4CIXA 5BRAA 3O95A 3S8MA 3K9CA 4Q7LA 5LBTA 1T9HA 2VDRB 4EL0A 2DLNA 1TA4A 2F59A 4WLOA 3TZEA 2F64A 1EWQA 1U94A 4LHEA 4XVHA 4NAUA 4M0LA 2WAYA 1LNSA 3ZKWA 3ABSB 3O9VA 4AY6A 5FHRA 4CKEA 4LOKA 3MT9A 1P81A 1KO8A