1YOBA

C69a flavodoxin ii from azotobacter vinelandii
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
179
structure length
179
Chain Sequence
AKIGLFFGSNTGKTRKVAKSIKKRFDDETMSDALNVNRVSAEDFAQYQFLILGTPTLGEGELPGLSSDAENESWEEFLPKIEGLDFSGKTVALFGLGDQVGYPENYLDALGELYSFFKDRGAKIVGSWSTDGYEFESSEAVVDGKFVGLALDLDNQSGKTDERVAAWLAQIAPEFGLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flavodoxin 2
publication title A crystallographic study of Cys69Ala flavodoxin II from Azotobacter vinelandii: structural determinants of redox potential
pubmed doi rcsb
source organism Azotobacter vinelandii
molecule tags Electron transport
total genus 59
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1yobA00
4GQIA 4QOGA 4HEQA 2GSWA 2KLBA 3FVWA 3NHYA 1RCFA 2BF4A 4NULA 3OX1A 4FGLA 3JSXA 3NHUA 5LJLA 1BU5A 3GAMA 4ZVKA 4PU0A 3P0RA 1YOBA 1E5DA 1FVXA 1AG9A 3W78A 1ZWLA 3KAPA 3F6SA 2BMVA 2QWXA 2ARKA 3EYWA 5A4KA 1QBGA 5EA2A 5B3LA 1WSBA 3FX2A 1AKVA 3R6WA 2FAXA 1J9GA 3ESYA 3NHKA 1X77A 4ZVLA 3RPEA 4FGJA 1FLVA 2MTBA 2QX8A 4QODA 5F4BA 5FA6A 1D04A 4ZVMA 4H2DA 5B3KA 1FLAA 1C7FA 4U7GA 2Q9UA 1XYVA 5NULA 1NNI1 4BMPB 5LVAA 1AKWA 3S2YA 4FX2A 2V9CA 3F2VA 3NHJA 1VMEA 1XI2A 2FX2A 3F90A 4N65A 1TIKA 1B1CA 1SG0A 4PTYA 4LAFA 5ULLA 4QOFA 1YCFA 1CZHA 2MT9A 2HPVA 5JROA 1RTTA 1FX1A 1GG5A 1AKTA 1YDGA 2R96A 4C0WA 1CZNA 4U7FA 3TE7A 1RLIA 3NHLA 3NHFA 3QFCA 2FZ5A 4CF6A 2OHIA 2Q62A 3U7RA 5LJIA 4XDGA 4GR9A 4N9QA 2W5UA 5F51A 2Z9CA 3O2NA 4F8YA 4NLLA 5F12A 3F6RA 4YAOA 2RG1A 3TEMA 3OWHA 3K1YA 4ESEA 3LCMA 2X2OA 1F4PA 1OBVA 3SVLA 2FDXA 3NHPA 1CZOA 1OBOA 2HNAA 4D02A 3ZHOA 1AMOA 4CETA 4H6PA 1DXOA 3K20A 2QMZA 1ZX1A 4LTMA 2D5IA 2N1MA 4HS4A 4J8PA 4DILA 3FW1A 5LLDA 3UXEA 2MWMA 2FVXA 5EMNA 3N3BC 3FNIA 5LBTA 3U7IA 3OJXA 1XYYA 3KEGA 2XOEA 1CZKA 3N3AC 2BPOA 1QRDA 3ESXA 3L9XA 2B3DA 1OFVA 4QOHA 1BVYF 2OHJA 3GFQA 1AKRA 2HNBA 1CZRA 2V5UA 4PTZA 5NLLA 4OXXA 2QX6A 2FLVA 3OX2A 1FUEA 2QX4A 4C76A 2BN4A 4DY4A 5BUCA 1C7EA 4YAUA 4DIKA 3HA2A 3OVMA 3ES9A 4C14A 3LT5A 1TLLA 3NHRA 3EDOA 5LMCA 1YKGA 1XT6A 3B6KA 3KAQA 3B6IA 4LA4A 4S24A 1CZLA 3W79A 1D4AA 1QR2A 3W7AA 4LTDA 1KBQA 1JA0A 4Y7CA 3L9WA 2Z9BA 4ZVNA 2XODA 3FJOA 2AMJA 4Y9UA 4FGKA 2QMYA 3W77A 3OX3A 3B6JA 1AZLA 3B6MA 3OJWA 3KLBA 3G5MA 4QOIA 2OHHA 1J9EA 1H69A 2QR2A 2R97A 4YAFA 4YALA 1YRHA 2QX9A 4R81A 2BZSA 1DXQA 3UXHA 2WC1A 1AKQA 4N82A 5FX2A 1SQSA 3QE2A 3GFRA 3O73A 3NFRA 2A5LA 3HR4A 4Y9RA 2KQUA 3NLLA 5EAIA 2V5VA 3NHSA 3GFSA 1H66A 2MOKA 4QOJA 2M6RA 4C0XA 1ZWKA 4YQEA 3D7NA 1QHEA 4QOEA 5TGZA 3TZBA 6NULA 1RLJA 2X2PA 3N39C 3NHWA 1DX9A 1YCGA 4LTNA 1CZUA 1KBOA 4BMOB 5FUQA 1AKUA 1D03A 4GI5A 1V4BA 4XDHA 2M6SA 1FTGA 2FOXA 1FLDA 3OWXA 4ICIA 1JA1A 2FCRA 1WSWA 1AHNA 1T5BA 4YAWA 4M0CA 1T0IA 2F1OA 2Z9DA 2ZKIA 2OYSA 1FLNA 2FZVA 1YCHA 1I1OA 4U7HA 3QFRA 1J9ZA 1J8QA 5LBUA 3ESZA 3HLYA 2Z98A
chains in the Genus database with same CATH superfamily
2XMCA 1E92A 5C51B 1GQYA 4C30A 2C04A 2IW3A 5CB4A 2I4IA 1RRMA 4HTFA 3GLIE 3HJUA 1E5TA 4JZYA 3SC6A 2DG2A 3OD5A 1PTKA 4YRNA 3ENZA 3U6BA 5IM4F 4ZP1A 3HCCA 4JJFA 5H5JA 4RF3A 2O1EA 2QVCA 3C5HA 2GYWA 3BPSA 3I83A 3ROQA 4F8EA 4DSNA 1VIYA 3ZZMA 2ZBPA 3BDAA 4RK4A 3RJZA 3C43A 3UJ7A 3K9NA 2AN1A 2GR9A 4CFYA 4NXMB 3ZKWA 1EK1A 4W8OA 4J0KA 4G8BA 1KJYA 2CEAA 4ZQIA 1G7RA 3FMGA 4ZOLF 1UMBA 4L1KA 1CVIA 1BH2A 2ES4A 4R31A 4Z9BA 3C39A 3C74A 3PHBE 1COWA 1XMIA 2RHBA 1SCAA 2IPNA 1GDDA 4HUQB 4MW7A 1YIAA 4C4RA 4EG7A 3U4CA 4FU0A 1RAAA 2EGUA 1JZQA 3ICOA 3T5PA 1VCOA 2SECE 4JC4A 5C3UA 4NENA 3PVCA 4Y2JA 1B0AA 2ZREA 1YOBA 5CVJA 4H1VA 3W78A 2G40A 3CEJA 4NONA 2PLFA 2GD1O 4WESA 1KVQA 1DOZA 4LY9A 2PUDA 4MLDA 2DECA 1JTFA 3HVRA 1TNDA 1YE8A 2O3RA 2C77A 4IHJA 3ZW9A 2H7VA 1TVKA 3AHGA 3I2FA 3H86A 4ZDKA 4U2KA 4PN3A 5IXSA 2H0AA 1P2SA 1XAIA 3ZNPA 2NT3A 1NW9B 1R0ZA 3GXBA 4JWKA 5FBQB 3PQ5A 2GWRA 4AN0A 4YY3B 5D85A 3NWEA 1Z2AA 5EP1A 1H2EA 1WOYA 2LP4Y 4PC1A 2E1PA 1R9JA 2JNWA 1VJDA 3NKVA 4M1SA 2PX0A 3WNZA 3QVTA 2H8KA 4AYTA 4DLZA 1OFUA 1KI8A 4K2HA 2GD6A 1Y6JA 2C4NA 3JATB 2IEZA 1ZIDA 3IQEA 4ER5A 5JI2E 2HNKA 2Y1DA 1PVVA 3RHZA 1IXYA 1N5OX 4BEWA 2O8BA 1QIKA 1ZHHA 3ZG6A 5F4BA 3PJRA 3CLUC 3ZDQA 3ZBUA 3NAQA 3K9FC 5H70A 2WI8A 4GM4A 2V74B 4RVUA 5H80A 3UANA 1GOTA 3RDPA 5IWAB 3WGZA 1SOWA 2E9SA 5JNTA 3D8BA 1R3DA 2B25A 3B3GA 3C8DA 4OP3A 4PZ9A 3FAKA 4WBSA 5J2TF 4MKZA 5CDTA 2RCYA 2X1MA 4OI0A 1LVUA 3DL7A 5JZSA 3KB1A 4IJ6A 4DLKA 3G0HA 4LQLA 4OLAA 1D9XA 2R9VA 2NO5A 3BJZA 2O7RA 3PENA 4JOCA 5IH3A 3AYZB 2WB2A 4NF2A 4OQDA 3TTTA 5BY2A 1C9KA 2EU8A 2PA3A 3WB2A 3QLVC 2IF0A 4PAMA 3I4FA 2W6ZA 3KOWA 3NHJA 2L17A 4FMPA 1RQPA 4QUBA 4R3NA 3MFQA 1JDSA 3MWDB 2O20A 3N07A 3PUXA 4AM8A 4EG0A 1R8SA 4Z99A 1QDEA 4BX3A 4JJKA 2WMOB 4Q18A 4YK7A 4PX2A 5ANRB 1SG0A 3GCZA 1HTTA 5CT4A 3SYLA 6GPBA 4Q6BA 3AF2A 5FUMA 2IHVA 4HGPA 2LTAA 3E61A 3R3VA 3JWGA 1XEWY 4B43A 2W8ZA 3TIGA 3CX6A 4YRPA 5K03A 3LVRE 4R54A 2FZWA 5KVQA 2CN1A 3WDKA 1TUGA 1PVDA 3AJ8A 2OBYA 3HS3A 2XNJA 4ZHQF 4NU8X 1LPBB 1ADGA 2GK7A 4MWZA 4UJ3A 1KFBB 1U2PA 4MW5A 4P9NA 4JOBA 4URHA 5DZSA 2R7KA 4FMDF 4LNAA 1G8FA 3R7WB 1CJVC 2JRLA 4DLUA 1UIMA 3VKHA 4UC0A 3GJ5A 5AOCA 4C5CA 4DB2A 2HQSA 4NFLA 4O2RA 4KRFA 2FSVA 1UMBB 3G0CA 1O57A 3GJ0A 4WECA 4B3BA 5K3SA 4OO3A 2FCAA 3W2EA 1N2CE 1PZGA 4KIWA 4CF6A 4BQFA 1XLVA 1R5BA 1YZTA 2P5UA 1ZHOA 1RQ7A 1W1WA 4WNAA 1ONNA 1POWA 3AEZA 3CNNA 3D7SA 5JQGA 1L9KA 1XQVA 3HJCA 2A78A 4IDEA 5C1IA 4Y18A 5ALJA 5D7NA 3EDQA 2Z43A 3OEHA 3K0BA 2WWRA 4L4UA 3SBDA 1HE2A 2QGFA 2PMFA 3ADKA 1H5UA 3JASA 4GMXA 4TV9B 4Z4FA 1NP7A 3LHKA 1FBNA 3CMMA 2HWWA 1S9HA 4FS8A 4YAOA 2C99A 2IELA 2RG1A 3BILA 3KR2A 5JBQA 3G9XA 2HLNA 3CNHA 3G2NA 4OGGA 4PGHA 5B55A 1PNRA 1KYTA 3SJUA 4EB8A 1ZU4A 4YMGA 6LDHA 1OD6A 2I7XA 3GDGA 1Q19A 5ETJA 4RQUA 2GBLC 1Z4JA 2W2VA 4B6OA 4EHHA 2GERA 1CYEA 2OR3A 2GPAA 2R6R1 3KZXA 2CVOA 1ID1A 4FOOA 4R8VA 1HRDA 1JAZA 1MNQA 3CO0S 3LOUA 4KXWA 4BNMA 2P69A 1GTSA 4D25A 1A5BB 1V6AA 1WXXA 1Y6GA 5TIIA 3NRCA 1GR0A 4KXYA 2QM0A 1MVOA 1Z7WA 4F2GA 1KY4A 4EP1A 3VDQA 2DFNA 2XD4A 3NAZA 4Y8VA 3RVPA 1C4XA 5HKBA 5H16A 5FLEX 3WRYC 3W05A 3PFHA 2D5AA 3ZGLA 2Z8YA 4XFJA 3HBMA 4ZDJA 3CYFA 4QBKA 1EIZA 3WL7A 3TSYA 1W0CA 4AS3A 1YJCA 1LLQA 4W6QA 4X1KA 1XJWA 4EY8A 5ITZB 1ZX1A 3KT8A 1Y7TA 1XKQA 3ER6A 2NUAB 3I6YA 3P9CA 2D5IA 2B21A 2HDWA 2UUBB 3WQSB 4C08A 3TRIA 1JZSA 3GVIA 4NBVA 1B8OA 4ECEA 1EVLA 5EMLA 3T1YB 1PFKA 3EBLA 4G1MB 4AZ0A 3FW1A 1J1IA 2BGTA 3VA7A 1N6OA 2H4ZA 4F2DA 3PQFA 3HV0A 4JT4A 3ORSA 4QVKA 5KSPA 3D6HA 3P0IA 3RS9A 3HB9A 3FNIA 2H07A 2I8CA 3GBVA 2Z95A 1DDOA 4R1QA 3V42A 2RD2A 1L7QA 3WSVA 3ZPXA 4ZMBA 3S81A 5IKXA 2Q4DA 1FCJA 1M1YE 2D2VA 3FNRA 3W4IA 3EY4A 2Q21A 3KXKA 1UPTA 4EUEA 5F2NA 2VTEA 4DJEC 1DT3A 2X23A 3UTDA 2PGJA 1YIOA 4QPNA 4Z6KA 1CZKA 5IJ0B 4D82A 1ESEA 5ERGB 1ABFA 4FQ7A 2YUTA 3QV1A 4G26A 3GFVA 4G1VA 4PQEA 3TZHA 1KSFX 1K0FA 4KQGA 1UBSB 3LPAA 1EFRA 2I1QA 4P6VF 4RADA 4Z0HO 2ZLBA 3E9DA 3E35A 5IM4A 1A8SA 1DSSG 1AY0A 4Y6GB 2HOQA 3QE3A 1F7VA 2ZS7A 4LWPA 4EYQA 3OT1A 1GL7A 4MHTA 4V3BA 3D8HA 1K88A 3A2LA 2VC2B 4JXJA 4ER3A 3GZTB 1EFVA 3T1NA 3AVVA 4W5QA 4JGGA 4E5SA 2YCLA 1HLDA 4OTZA 5LMZA 4E94A 4AMVA 2CKMA 1VKHA 4PTZA 4ZOLA 3IDQA 5A1TA 1PG5A 4GOJA 4V39A 1VLJA 1C4KA 1T5LA 4WNAB 5BQ5A 5GV8A 5LZ8A 2PJDA 2HDNB 2QA5A 3B1JA 2GHQA 3CPHA 4L51A 2GTPA 5HKKA 5KTOA 5L7TA 1RPTA 3I53A 1S6YA 1AXEA 3F4LA 1FFYA 2FSIA 5DHRA 4YCSA 2HPAA 4DRXA 5BUCA 3JYQA 2BMAA 4FNGA 4B09A 2EG5A 4CFSA 1KKMA 1W88B 2FMKA 2C8KA 3HO1A 2VDUE 4B9AA 1Z2CA 3RTAA 4DNFA 4OQEA 3SJBA 1L7VC 1KKLA 1PZHA 5ESDA 1XRPA 1H6DA 1XDZA 1Z73A 3V8MA 1R8QA 3BH0A 4KO4S 3BJIC 1XQ1A 3WA6A 2VSXA 3CKLA 4JUDX 3W5JA 2OGZA 2AI2A 5H83A 4ZTZB 2R1UA 1FVHA 4KWIA 2PGDA 5ILGA 4EO4A 1IQ0A 4R98A 1DC3A 4ENWA 5CXUA 4IOJA 3CW9A 5KWIA 1LGYA 1G3QA 2KHZA 2OK8A 2GJSA 2QF7A 3CH5A 3NC4A 3VXKA 2ATXA 3LRXA 5G41A 1V9SA 3V7WA 4Z9FA 2IHTA 4H0NA 1NPTO 3G8BA 1SUCA 4S1PA 3QF4A 2J46A 3OZBA 1FRZA 1YL6A 2LR0A 1K06A 4FCWA 4KSBA 3SC2B 5TT1A 2H9IA 3GAAA 2G0TA 2YJ6A 3O0DA 1DARA 2V7BA 2WDZA 4QHTA 2XYVA 5CJPA 5AICA 3FYSA 4X1KB 3RUHA 5MGBA 2Q1YA 4LW8A 1QCZA 1X74A 2Z2XA 4DPKA 5T67A 1J5PA 3VO9A 3BA6A 2GZRA 1TJNA 3TJZA 2ID9A 3A9WA 1EDDA 2P7HA 3NEJA 1ZIPA 2OZLB 2L82A 4H27A 4HL6A 2XUHA 4P3PA 2L19A 4XGRA 5LWHA 3OMWA 2FDCA 1YFZA 3NEAA 1MO2A 2MDTA 3NBQA 2QM7A 3GLFB 3UWMA 4RTLA 5DF1A 5I9IA 4B2YA 3CR3C 3ZHUA 4I1YA 4MUMA 5BURA 3FKJA 4Z9YA 2JBHA 4A8JA 4D3YA 1LQ2A 1I51A 1OWLA 4ESOA 4XA8A 1DQSA 2CW5A 3WQRA 2PBLA 4LF6B 2X4GA 3R77A 5JH7A 5DTJA 4UMEA 1MX3A 1L5SA 2A30A 2GLXA 1BCSA 2NO1A 4MIYA 5EKDA 3ZGXA 4XZ3A 4EPVA 2QT1A 2R6GA 3G8AA 2BR3A 3CKYA 1SUDA 1USUA 3GCWA 3ZCPA 3F73A 2JB9A 5I7UA 3OLWA 5EJAA 4JI8B 1UJ6A 5B5SA 2VTBA 2JFWA 1K7SN 1DNPA 1T9HA 2VDRB 1QIIA 3AHJA 2QR2A 3DP7A 3FIUA 3GUZA 3JQPA 4S1OA 5DU2A 5BV7A 4H1TA 4QJIA 3Q7EA 5EQFA 4MKHA 4ZHQA 3C7DB 3V6MA 2VWHA 1N6HA 3ESQA 1C8LA 3K4QA 3IYLW 1EWVA 4YALA 3D43A 4M0PA 5KKAA 3R75A 3BEOA 1JKMA 1VLVA 1B0PA 2GK3A 2PV0A 1IQPA 1DT5A 4ZOLB 3VMMA 2VXBA 4QVGA 5K4AA 3ZXUB 4BN5A 4C4XA 4OPMA 3THYA 1D8AA 2GKOA 3KUXA 5AHWA 3BXHA 1P8JA 1EK5A 3H5LA 3RG2A 1F8XA 4UASA 3IR7A 4N8EA 4LYGA 4P0QB 4FJ2A 4BCBA 1WKBA 3GC6A 4JX9A 4R83A 2HFJA 3KVNA 3NOQA 4QSHA 4UVIA 1Z7YA 2YQZA 4OBEA 3PX2A 1JIUA 5EPEA 1N57A 3P2KA 2PKYX 3HLKA 3SHFA 1MRSA 2G9RA 1ANKA 1YA4A 2Q99A 2IW1A 3GFSA 3PFCA 1U9CA 4ZCQA 5HP4A 3ZIUA 1OU0A 3E23A 3CZMA 3B2NA 3G2PA 2PEYA 5FBLB 4FSDA 1JDJA 3ZE7A 2ONJA 1ZBDA 2Z5VA 4YCMA 5HIMA 1XAJA 4D0RA 2F6RA 2DEUA 2MCFA 1UBKS 1NNLA 2OCBA 4Z4GA 1YOVA 5ALKA 1ZCAA 3WIUA 4ISBA 1EXNA 4W5HA 1IB0A 3WYEA 1QF7A 3UB2A 1YK0A 1IBLB 3D7NA 1Y6QA 1FRQA 4QOEA 4E14A 4CMIB 4UHEA 2IOQA 2PTHA 1T2AA 3MCVA 1WB5A 2FQ1A 5ICSA 3WBFA 1T3LA 1E2NA 4R2JA 1FTWA 4KZKA 5FL3A 2H2FA 4ALMA 4D9IA 2Y93A 4WK6A 5DSTA 1LTHR 3OIDA 1WU8A 3COZA 5THQA 4A27A 4BFXA 5IASA 1AGNA 1Z4LA 2B6NA 2I7CA 3DKIA 3MG9A 4JELA 3TNJA 3KZ1E 2C8LA 4ZT2A 3WIEA 2D54A 1AO3A 3QMPA 4ENPA 2EYQA 4D5GA 3KQMA 3U9TA 5J2TB 2DH5A 3LQ1A 4HADA 5C8YB 3V33A 3I3SR 4QXOA 5FQOA 2EAUA 2CLMB 3UMVA 2OG2A 4I1SA 2F43A 1LF5A 2GA9A 3S4YA 4BMCA 1N33B 5HX7A 1A0OA 4N8SA 4O08A 5L4SA 2V6BA 5TE9A 3MTJA 3YASA 3HK2A 3TLEA 3HFGA 3IIEA 1WBBA 4O2BB 4KR6A 1WL8A 4ZZ2A 4DG8A 1ETUA 3LT0A 2A67A 4E30A 3Q3CA 4RM2A 1WX1A 1SVWA 5DM70 1MU0A 3MZ0A 1X7XB 4YRQA 1NXQA 3KKOA 1QQ6A 3CKKA 1MC1A 3MGCA 4IFBA 4QARA 3CF2A 3FNBA 3ELUA 4LKOA 1QHYA 2NU6B 4MV5A 4QDUA 5AHKA 4MICA 2N75A 1YZHA 5HTKA 3OU7A 4ARSA 2DHDA 2VTBB 2ZIXA 4O6VA 2KE5A 2QXTA 3RU9A 4M8KA 1W73A 2WNHA 3FDFA 1J22A 1P1JA 1QR6A 1HURA 1Y8RA 1YMUA 3TR0A 3ASYA 4ZHQB 1U7XA 4NZZA 3LXMA 4QUHA 5B2EA 2FZVA 1G8JA 3KR9A 1QBKC 2O2HA 2IS1A 3BERA 3IVGA 5JSQA 2FK7A 1J9ZA 1Q0HA 2I99A 1J24A 2YWCA 1JJIA 4JP2A 4U2FA 1A8HA 3GVCA 3PV0A 3WMEA 4Y1FA 4XWYA 3SR3A 3ADCA 3LQYA 3QVVA 3PZBA 4EDFA 1IM5A 3DP9A 4LJ4A 1PWEA 5AK4A 1Q1EA 4V02A 3RIXA 1LDBA 2RIRA 3THYB 4RCYA 1MX1A 1NR7A 3KKNA 2YHIB 3K71B 1X8JA 2WHRA 1UDAA 4IF6A 4KPUA 2Q7DA 3ILXA 2LCFA 3VJRA 2CJYA 1BNCA 3L1JA 4CI9A 4C6RA 1JU4A 4YJ3F 2QPLA 5B37A 4G84A 1LS1A 1W9HA 5DXAA 3UYKA 5H9VA 3I5UA 5B57C 1R4NA 1J20A 3R7DA 1EX1A 2MIIA 5BSHA 1AB6A 1ZNWA 1YWGO 1E2PA 4K46A 4O4JA 3A1WA 3PFNA 3ULKA 2O8CA 5JBNA 5EKTA 2ZAIA 2GUGA 3A4NA 4UXJA 2FE4A 1JFFA 4GRDA 2XYGA 4O1IA 5ELLA 4ZT4A 4ZVSA 3WRXC 3FUVA 4EA7A 2OC9A 1E5VA 2QIOA 4BZPA 1MRZA 3DV2A 3O5AA 1NQUA 2VRCD 1REQA 3C3DA 1XVAA 3P0HA 5AKGA 1BA3A 3TW0A 3L6OO 4OGFA 1G17A 3PQ3A 1DC6A 2IIVA 3P2EA 1ZWLA 4GKBA 2AUTA 3KAPA 4JWTA 1ODLA 3GUYA 4CG0A 1VLLA 4FEYA 2H1HA 2WWVD 3AB3A 1Z07A 1BMTA 3M1IA 2BI8A 3AM4A 3FAZA 4JMPA 4PNEA 1D2MA 2EG9A 3QA9A 3VYVA 5BQXA 1JEQA 3D1LA 2W22A 4NCAA 1PS0A 5CVTA 4XQ9A 1D6NA 2QRMA 4OU5A 5IAEA 1U81A 1GPWB 1ILEA 2OT3B 3KEQA 4EY3A 3NYWA 3WIOA 3ELBA 1Z4MA 2VI5A 4P2BA 3DZKA 2PRZA 3UPUA 1VXRA 5BQPA 1TJ4A 1ZVKA 3I32A 4C9BA 5JD5A 4E33A 3AM1A 3Q6IA 5ER9A 3GNLA 1VLZA 2QW1A 1M76A 2F43B 4X20B 5J4VA 4JVSB 2BCEA 4QFDA 2Y1XA 1KXJA 2M1ZA 3GD7A 3UB4A 3ITKA 3ZGYA 1NV8A 4D3DA 4QJ5A 5ICEA 4WVFA 3IVAA 1L7RA 2QW0X 2VDMB 4OXYA 3W8EA 3T7TA 4QU8A 3X1WA 4MZXA 4REQB 3D6VA 3ZV3A 3G9QA 4PLPA 4FHEA 1FFDA 3S28A 4CEIA 5CX1A 2XTNA 4EMTA 5F76A 1E32A 3JQEA 5EJEA 4LOJA 3WHPA 3PK0A 1G64A 1KJ8A 3KYIB 3GUVA 4NCHA 4YUVA 4GGOA 2ZIXB 2F3UA 4TLMB 4UUBA 4XYMA 1Z4PX 1XYVA 2DH6A 2PUWA 5KOYA 2G7MC 4WY2A 1Z4KA 1IEVA 3VPHA 4GMKA 1J70A 4F9FA 4I1PA 2Z1NA 3OQ6A 4II2A 3LYLA 5CPFA 5FI0B 5AW5A 1JMVA 4KAJA 4N65A 3JVVA 4AZ3A 4JL6A 1Y3DE 4FCCA 5K6AC 4L5AA 2PK3A 3NNSA 1YV9A 1R1DA 1VLHA 2EDAA 3HUFA 1R9NA 1XTQA 2JF0A 2J3KA 3RYHA 3T15A 1XGKA 4JD5A 4MQ6A 3GI1A 5IBRA 5BMOA 1NYTA 4MINA 4CGYA 1KSHA 1OI2A 2P7IA 2AMLA 1USGA 2PXCA 1SO8A 4BOYA 2Z08A 2E0IA 4YXFA 2NAPA 3AHDA 4IR7A 3C24A 3N0VA 1W29A 4KO3S 4GF5A 1AKTA 5H68A 3O2SB 5CNIA 2IH5A 2DUUA 5TMDA 4IO0A 2JFPA 4D44A 2Q4OA 4DCMA 1T6XA 2FUNB 3TE7A 4BMZA 1R6BX 4DM3A 1C9EA 2FW1A 3RV4A 3NHLA 2DR2A 1KWKA 4PRLA 4LFBB 4UTZA 1RJFA 3HUUA 3VQTA 3KJEA 4EVQA 2Z4TA 1S2MA 2CFSA 1HZZC 2VP4A 3UF0A 3GJXC 3MM4A 1BJTA 2J85A 3HBNA 3BG5A 1CUDA 4L15A 5KYVA 3M83A 4ARIA 2GJAA 4PXYA 1TADA 1UFRA 3GYBA 4KFUA 1REQB 2P2YA 2JEOA 3VRHA 1I4LD 1DB3A 1QCDA 4NLLA 5D00A 3GROA 3GBPA 2NU8A 3IQIX 2RGUA 4CDRA 5DSZA 4GI7A 1RXUA 3IOEA 3KZOA 3GPDG 4X61A 4QLOA 5ICMA 4TUYF 1G8KA 4OMDA 3OZWA 3FFBA 2FFAA 2YJ5A 3M6VA 1O6CA 2EFJA 3M33A 5AH0A 3UMJA 1MAWA 1RFGE 3IP7A 4C43A 4YRBA 4HF7A 3RFUA 1LXCA 4J7AA 1XTVA 2VJMB 3KVVA 4AMGA 5E2IA 3TOVA 3AVUA 2FWAA 1XDGA 2D1YA 1GQSA 1Z2DA 1CERA 2J0UB 4DM7A 3AESB 1MN6A 5IZCC 5D3MA 2P1DA 3IOBA 2CCKA 3W3AH 5EJ4A 1IK4A 2HU8A 1X1SA 3KDPA 3I23A 4QLBA 5LP6A 1DE0A 2WZDA 1DDIA 3TI7A 4Y6PA 3IR6A 3E82A 5FIUA 2AFIA 2XKBA 5C5IA 2VWGA 3H42B 5B7PA 4YLEA 2X8WA 2RHMA 3RSFA 2V7PA 4HFMA 4JGBA 4NY1A 4DZTA 1E0AA 4D98A 3BWVA 4O4HA 1MIOA 1PIWA 2VTVA 3OOWA 3Q4GA 4EOGA 4FB4A 1I7LA 2YMLA 5KNDD 1YFLA 4GE0A 4CEIB 2HJGA 1T4BA 2TMYA 5FTNA 4XDYA 3K2BA 3TTWA 2JJ2D 4WD3A 3K8YA 2QTCA 5BNTA 2ZSJA 1Z0UA 1EX9A 4B3RB 4OI1A 2YR0A 1YB7A 1ICIA 1IBSA 2FMXA 4YFVA 5JNSA 1XG5A 3IERA 1GNQA 3MRTA 1P4GA 3PYLA 3QOWA 1ZOPA 3NIGB 5JHGB 1DV1A 3CV3A 3UXEA 3HCBA 2MYTA 3MBKA 4FD2A 4ZQFA 4C7VA 3H8JA 1O96A 2C78A 2CJWA 2AQIA 4DHWA 4Q1FA 3K5WA 4I4CA 1GIAA 2R1ZA 4AZ3B 4UU1A 3NEYA 3COPA 3RFVA 2ODAA 3ZY2A 2V6JA 5K4GA 2BE9A 1G20E 2CMKA 1U94A 4JB3A 1OV4A 5A6SB 3U3RA 3ZHBA 4Z4CA 3RYHB 1VCIA 2O05A 3RKSA 2C7QA 3IPRA 3GLRA 4HG2A 2LCIA 2O0LA 4JB8A 5JHHB 1FJXA 1JIIA 1CU1A 1CY1A 4IG9A 4GM1A 1YZYA 4NBRA 2Y8EA 2BJVA 3HPQA 3X1MA 3ETCA 3FTFA 4HRYA 1SULA 3N0WA 1Z29A 2GZ1A 3OZTA 3I6IA 1KMQA 4G4GA 5EUCA 2C2YA 2QG6A 1XRMA 3VR2A 4XTCS 5A2GA 1WTAA 1YR9A 3Q2KA 3WB0A 1YZVA 2OV1A 2DCMA 4Y6RA 3ZE8A 1XCGB 3OZGA 2B3DA 3OZAA 4M9QA 4N0PA 2Q5OA 2IPMA 3LDUA 2Q5HA 4PYOA 4YJ3A 3QMVA 2X7XA 1W4AA 4TL8A 2BH2A 3K5IA 3CUSA 4G0PA 3P0EA 2GM4A 2J3EA 3QOXA 2XAAA 2HNBA 4MYRA 4AKTA 1LLDA 1XZHA 2WZBA 4P53A 4IMPA 2G8NA 1UANA 2ANBA 2VO1A 3CZ5A 4ECAA 1ZK2A 2YHSA 5ADHA 3I5AA 2C5GA 2ZR9A 2ZYWX 5G0TA 3L7KA 1G6HA 2QRZA 4F5ZA 2JI4A 2HSDA 2DPGA 5CFMA 4Q3OA 4AJ4A 5HQJA 4YJKA 4OOEA 2C5AA 2ZDQA 5I3CA 3A27A 1E6LA 1G1MA 3AP1A 3QX8A 4KE9A 4JC5A 4X1IB 1HNXB 1JT2A 4Z51A 2G0AA 4L5CA 4UBIA 1G66A 5FI1B 2G25A 2ZRAA 3OVMA 3I62A 1RE1A 4N18A 2ZXFA 3A4LA 4MRPA 3KHKA 4IZ6A 4CLEA 4DZZA 5GZ6A 3LQ2A 4R9NA 4KR7A 5FWNA 1U5BB 2JVJA 1VP3A 4C14A 4AS1A 2BFFA 3A28A 4NE2A 4NG5A 2KBEA 2O5EA 3I0MA 3IP6A 3RC3A 1SJ9A 1IG0A 2XPCA 2XUDA 1XBTA 1EVEA 5D3MB 4N49A 1EHYA 1DJOA 1PJSA 2W58A 4MYDA 4QHYA 3VR4H 1IJBA 2Y05A 2JIPA 4LRWA 1L5OA 1XPJA 2AFIB 2BFNA 2GNPA 4LA4A 3HJNA 1YVRA 5BW8A 2C8VA 4PEVA 5TR9A 4S24A 4JLKA 2NQTA 2BSAA 2R8BA 2X8JA 3UENA 2V8OA 2VEOA 3DVAA 4K87A 3Q7TA 4M9RA 1MIOB 4GOND 4L16A 4ZAFA 4YWHA 3LWDA 3M9LA 3SX0A 5BMVB 3VU9B 3H05A 4MVWA 5JRZA 3U09A 4OIFA 2IGTA 3DDSA 4JUBA 1L4BA 3BTSA 4D2IA 4MQBA 1I80A 4OUKX 3UOAB 1D1PA 3DT8A 4Z7JA 1YC2A 3AH8A 5L40A 2ABWA 5JAQA 3O4GA 1XZCA 3VU3A 2C59A 2NG1A 3C16C 3DD5A 3PWTA 4X54A 2Z2ZA 4FE3A 2BUCA 2NVWA 3P2JA 2WTUA 5EUMA 3SQLA 3WJ1A 1R5OA 1ZD3A 2VK8A 2W4IA 1F12A 2QRQA 4MA5A 1O96B 1IXZA 1ZK0A 5E6RA 3BE6A 1FSZA 3VYRB 3RV3A 1PU2A 2AE2A 1E0SA 2REQA 1N2CA 2X0KA 4J1TC 2BFDA 1R9MA 4PSAA 1C1XB 3SXPA 1OLSA 3QJYA 4H31A 2QVGA 2D0IA 4LC0A 5TQ2A 1NDUA 1JXOA 1PV2A 5FBHA 3EIQA 4ZAWA 3WJAA 1HTWA 1RACA 4GC9A 3UCXA 4EKGA 2ZVQX 4WCFC 4V0KA 3HO8A 4A0RA 2CXOA 1GZHB 2PS9A 4H77A 3BS4A 3GLQA 1L4LA 3DEIA 3IEXA 1FL9A 1WZUA 1N8NA 2AYYA 2FJPA 2GNAA 2RG7A 2X42A 3NTXA 4C1NA 4R3WA 2XRZA 2XB4A 3TR5A 1JVNA 2OLJA 2JDID 2O5RA 2P0YA 4DCSA 4ZI3A 2QTZA 4INJA 3STUA 3BTUA 3RH0A 4X45A 5FJJA 5CA0F 7MDHA 1M72A 4YJ3B 3L1KA 5HFNA 1NQVA 3OOYA 5KYUA 5AHRA 2BC9A 4KMMA 1EM6A 1T5TA 2QT9A 2JGMA 1X1AA 1MUUA 2GAOA 3LY7A 4UCXA 5CDFE 4F45A 2QX9A 5J58A 3F8TA 1YRWA 5BUSA 1NVVR 2DR0A 1QB8A 1T6ZA 1U1GA 2WTNA 3FNFA 4OB8A 3DL4A 1ZC4A 2W83A 3T9DA 1WR8A 3KYBA 4I1RA 4ZDIA 1GPAA 3PDUA 4Y0AA 9LDTA 2PN1A 2AG5A 1A3CA 1RHQA 2WWIA 1KY2A 2Y99A 3FHCB 1QIMA 3HABA 3LE8A 1V5WA 3EZXA 2WJ3A 4J75A 3PGKA 3KSZO 3L7JA 3E9CA 4PPGA 3RJ5A 1MJGA 2PSSA 3L0SA 4Q37A 4IGFA 2BKXA 1AOXA 1R6DA 1TT5A 5G4LA 1JX6A 3ZEAA 4TUYA 3FPEA 3WI7A 1Z38A 2EQ5A 3H2SA 3I9JA 5BWBA 1OXXK 3FFAA 4JEMA 4BB5A 5I4BA 3GBSA 2BFFB 5AM4A 2PRJA 3NBMA 2C2WA 4OFXA 3SFVA 1GPKA 1RWOA 1BGXT 1J2YA 4AMBA 1HF3A 3H13A 4G86A 5IBQA 1RCTE 2IDKA 1QKKA 3OQMA 2RAUA 1XD9A 3IVCA 3IJEB 4R1PA 4WY5A 1UP7A 5LB4A 1T0JB 3HWX1 4DC1A 3LRPA 2AA3A 4IDOA 1DG3A 2GHRA 5CDSA 2JIQA 1BE8A 1L1QA 4BKUA 3DVAB 2W6QA 5CTJA 1U0GA 2YN2A 4TL9A 1M1YA 1YCGA 1V41E 2NTYC 2XYRA 3MEQA 5SYMA 4QFBA 4KQ1A 3OLYA 4FEAA 4DJTA 4DUGD 3OU2A 3KTAA 3ABSB 1U3DA 1R8YA 4HAOA 1N5DA 4HH3C 1R9GA 1IWBB 1V39A 1WMAA 3TH5A 3WGNA 1GPMA 5HGJA 1CWUA 2TSYB 2KLHA 1U8EA 3UUEA 4FFRA 4C01A 4F60A 4C6SA 3AYXB 3AEQB 3P4XA 4R9VA 1RQXA 4YREA 2HK6A 1ZIXA 4U5QA 1W5BA 3FSGD 1WMBA 3M6AA 4MVXA 4X97A 4XLZA 5E4JA 1S1MA 1TRHA 4P2GA 4W6ZA 3IQZA 5TS3A 1K27A 1ZCFA 4B82A 4CLHA 4E88A 1Z2EA 3TLYA 3AGPA 3ZV4A 4MV3A 1ARZA 2B82A 3V8QA 2A9QA 2WAXA 4NNOA 3W5SA 1P61B 2JLZA 3HB0A 2REQB 1N2CB 3FPFA 1QO7A 2BFDB 3KVOA 3CG0A 1MW9X 3KUDA 4D96A 4E4YA 1YU9A 1OLSB 5CIQA 3IC5A 4P0TA 4X8OA 1OXBB 3QBEA 5IUJC 5JU6A 1RP7A 2H1VA 5GGYA 1SVUA 3AFHA 5A9SB 5TVKA 4MUYA 3A1TA 1ZMRA 3LKVA 1VI5A 1HFJA 3DW1X 1CIJA 5IS2A 2DBQA 3M9WA 2DX7A 1VA5A 1KBZA 2X9VA 3DS8A 4IRXA 3V4OA 2WPDD 4RDHA 3C6YA 5HQ3B 4CR8A 1DC8A 4F11A 4A5OA 4EB3A 2QAGC 4NESA 3WGIA 4J6FA 1FLNA 4LXHA 3CHYA 3SSAA 1NXWA 3C45A 3I1YA 5E7QA 1YCHA 1JSLA 1I1OA 2HQRA 2W0SA 1OR8A 4G89A 4U7HA 4DGSA 3QEMA 5KYUB 1G7SA 3QI2A 4HGQA 4C1BA 3V9AA 2MINB 3LX8A 3WX0A 3WYNA 1LW6E 2WJ6A 3NOVA 2XUIA 3ROPA 4C3UA 3QG1A 2Q2QA 3G49A 4L74A 3BF8A 4YRZA 4L5YA 4WK4B 4Q9DA 3FDZB 1V35A 1A98A 2BAGA 3C5CA 4WCFB 5ALFA 5HJ2A 4BEJA 1VE6A 1Y9ZA 2RAFA 1XMOB 4L9RA 4EG5A 3HP4A 1VRWA 4AY2A 4DA8A 1QU3A 3PUYA 2ODTX 5COBA 3BGVA 1VMIA 2OG1A 1PSZA 2B83A 1FS4A 3G1WA 3NBZC 3R3SA 1OTXA 5KNCD 2J0VA 1WUKS 2A0FA 3EQ9A 3IFSA 1ADCA 3MT7A 3TD2A 1M2VA 3UT6A 3BGIA 3OKCA 4QOSA 1M0WA 3WGHA 1QIGA 4PBRA 2VTDA 1VPVA 3GZNA 3PICA 3W2FA 1G16A 5E1BA 1JYEA 4TUYB 1JKJA 1O97D 1QHSA 3P45A 4Q3KA 3CW8X 3PC2A 4V3CA 3I9KA 3O7WA 3EGXA 4LHYA 2W37A 2OHXA 1J7KA 3BIFA 4G37A 1YB4A 3WL8A 4HH4A 2VFAA 3ZHVA 1CY6A 3LKBA 4M1TA 2QX7A 2V4ZA 3GRAA 3BIWA 3K6SB 1EDEA 2DERA 3C8UA 2Q9BA 4V1CB 1CDDA 3DR5A 1KDZA 4R5MA 2Q6LA 4HJRA 2FW6A 4UOQA 4CYMA 3AJ9A 5IARA 3U40A 2RGXA 4XD7D 3F6SA 3H2HA 3KJIA 1JV2B 5E4TA 2BBWA 3LQRA 1A5SB 3A7EA 4C05A 1M1YB 2NUPA 4RTSA 3SKXA 3EPHA 4FUTA 2O3TA 2NP6A 1CS0A 1JVSA 1WSBA 1VYTA 5H02A 5IFLA 1RWPA 1KQFA 2BKAA 3KTAB 3CUVA 2AR7A 2AS0A 4R68A 3CINA 5TJHA 3UZUA 1A2QA 5F4ZA 3V7NA 1J6UA 3P97A 3ZIAD 2ZJ3A 3OPXA 5KQPA 1NXVA 3HEAA 4OHFA 3N2KB 4ARCA 2UKDA 3BKXA 4KVAA 4K1LA 4XIIA 3ZI4A 3H83A 1KO1A 2AEMA 4DRYA 3DVRX 4ODIA 2OXEA 1OBHA 5EZ5A 3FLEA 1WHTA 5I5EA 3ZU6A 3B48A 1AQUA 5I7AA 2OP0A 3RK1A 3KZCA 3DJFA 2C9OA 4W7SA 4ZVUA 1C8BA 1EXWA 2BLNA 5JFTA 4UUQA 1M2EA 3PFWO 2DPMA 4FFSA 3TLGA 4DDTA 2FSGA 4AQYB 3BHJA 1D04A 2OMKA 2OHOA 3FCCA 3CVWA 5AJWA 3KC2A 2Z2KA 5BSMA 1BKYA 4K9MA 4TPKA 5EWJB 5H3HA 4F84A 2FMIA 3CPEA 4ZVVA 4D9FA 1M1XB 1YMQA 1TKCA 2WSSA 1W6RA 2A4MA 4F4HA 5DW0A 4Q03A 3GLKA 4JODA 4OM8A 3O8BA 3ZD9A 3BXZA 4WZZA 4H16A 4EHFA 5JAZA 3V7UA 4R9RA 3QE0A 1HQCA 3AUJB 3QEMB 1U2GA 3JYOA 3N2LA 3K9WA 3JRNA 1NG1A 3ZDAA 5CA0A 2J0QA 3D8TA 1U28C 4A26A 1W5SA 4FMCF 5DJ5A 4TSKA 2BV3A 5AR1A 3W5HA 3ETJA 2QTWB 1HDIA 1RWKA 2A6PA 1RJGA 4J4BA 5CP8A 1N7GA 2GD2A 2JJ1D 2V7QA 2WE7A 2BGWA 4DA0A 5FDFA 1QH8A 1U3UA 1SM4A 2AFRA 4G4IA 2A9OA 2X0DA 5JROA 2A1UB 1L4FA 3WA7A 2R4TA 4JP5A 5CR9A 2VH2A 1Y6ZA 3DMNA 5J5VA 3VU1A 4DNXA 3SQXA 1KI4A 4WAUA 2FJUA 5IC4A 2BP7A 4L4YA 3UJ9A 1E6UA 3BWYA 5L6MB 4KL8S 1GY8A 1ZA1A 2QXUA 5IABA 3QLJA 3VNQA 1FDOA 1JKJB 1N75A 3B6ZA 5KZMB 1OB5A 1BQEA 1A96A 1UWLA 2FZ5A 3EGXB 2P9CA 3PQ6A 4U9IS 3EQ7A 1K2WA 2IZ5A 3FOCA 1U28A 3IEKA 2OP1A 3F1KA 2ZJ1A 4DG9A 5KPDA 1JHZA 1QFJA 4PANA 2I91A 1UINA 1Q16A 4EM6A 3IHKA 1HA3A 1PTJC 4CNQA 1DHRA 4I4NA 5EXTA 1C4WA 1RRKA 1RCUA 1Z8FA 2C7GA 3GT4A 4IH9A 4NOMA 4C7OA 4M21A 4DLRA 4EF4A 2ANCA 2H17A 2I2CA 3NH9A 1VI6A 5K3FB 4C7KA 3W2TA 4BU0A 4WCDA 3WKCA 1ZYUA 4EH1A 1NMZA 5C18A 3ZZNA 1SKBA 2IOFA 3U80A 2I2XB 4YUAA 4G85A 1GGJA 2IYNA 5E7JA 3EFBA 3SZLA 1AQ6A 2WE8A 4YP6A 1UBEA 3OM0A 3R24A 5JWRA 4F8JA 5LSAA 4AKGA 1XCPA 1NW4A 2IA5A 3OCVA 2VUUA 1CZOA 2BSQA 3V4SA 3K53A 3U4HA 1TM4E 5LOVA 2DE0X 1BRMA 3MFYA 1OBOA 2HNAA 2WA2A 1VHLA 5DV9A 2RC5A 4MI6A 2P6PA 2P41A 1MCZA 2AEFA 1CVRA 2I29A 4MV6A 1CB7A 2WIBA 2ZJAA 3IEVA 4EUFA 2VJCA 5FOTA 2OMEA 1R3UA 3L7YA 5AO9A 3QX7A 1CRQA 2WZQA 2V6GA 1NY6A 2FHSA 2I9PA 1KJ9A 2RKBA 2V3VA 4JROA 5IAKA 1BFUA 3EEQA 3K20A 3TLGB 1NF9A 1GRNA 3BXGA 2YJ3A 2WLTA 3H3JA 5HE9A 3VZSA 4YT4A 2PA0A 4C7MA 4CF3A 4F91B 5LQCA 1ACMA 4IWYA 3I28A 4GXQA 4JZKA 4HNGA 2IKSA 2NXJA 3GRUA 5T4HA 2D5LA 1B4DA 2MU1A 1ZD8A 3E18A 3WNCA 5CCXA 4B6GA 3DYBA 1MG0A 1UM9A 2IXFA 3BXXA 3L8YA 1V8BA 1VCMA 3ROTA 4BBJA 4J3FA 1JH8A 1U6JA 2XQGA 4YPVA 4I8XA 4OQLA 4RO0A 1EYZA 2OCYC 3DDHA 1QVVA 3U9SA 5KDLA 4ZHSA 5JJIA 2J3JA 3K0AA 1GZ7A 4D4HA 1Z62A 7REQB 1Y42X 4ONEA 3FI0A 2Y68A 2YIMA 3DOEA 4R1NA 5CA0B 1DWOA 5KYTA 2HMUA 1QFXA 1YFKA 3BXFA 4H3HB 4OUDA 4F5DA 4IMJB 4JB0A 1JR3E 2F3RA 5FKJA 4AY3A 4B6FA 3E1SA 3A6LA 5IYZF 4DLBA 1MJHA 4RPKA 1BDIA 1F3OA 2J0EA 2I8LA 4L8FA 4CQMD 5HJ5A 3WMFA 4MWCA 4A0GA 4MKFA 1XZLA 1W6UA 2JFZA 2PLWA 5CDYA 1N77A 1QTNA 2G0NA 1QHNA 2AE1A 2K5UA 3QELB 1E7YA 3N7UA 3OZRA 2WIGA 5EHXA 2YASA 2JCVA 1W35A 1RRPA 4LSMA 1MHPA 1M6VA 1VP9A 1W8IA 1V3TA 1VE7A 3D5EA 2BP7B 2I4RA 2WDPA 1AK9A 3E3NA 4G5YA 3S2EA 5BN3A 4X65B 3VZBA 5H9WA 3TIIA 2EJVA 1ZGZA 5BN4A 1USIA 2XGJA 2BTQB 2OHJA 3GUCA 1ZJWA 2ZRGA 4M1OA 5J43A 1ZM4A 4YRCA 4P3NA 2H9YA 1GKYA 3V55A 4OXXA 3DCIA 4DLWA 2PWYA 4NBSA 5ALWA 1A50B 3LNCA 1U2ZA 2ASEA 5L53A 1XCOA 4GYYA 2PCLA 1AN0A 4D6PA 5D84A 4R3UC 3UK7A 2RHJA 1PYDA 4D4LA 4UD6A 1FUEA 1RWVA 4C7OB 5KYXA 2ZG6A 5KTRA 1N5MA 5LLSA 4AX4A 4RZIA 1E7MA 1Z7GA 3IJ5A 4K6MA 3LDGA 3UAYA 2IK8A 3E0QA 4K6HA 2OV6A 2I0FA 1SWWA 4AG3A 3C3XA 5AXAA 4JDUA 5FXMA 2G1KA 2NO7A 2XVXA 1I10A 5ECWA 3U5TA 4GR4A 3QEJA 1KU0A 2BCGY 1E8MA 2C3MA 3FXAA 1IJEA 1FJGB 4PHFA 4KAXA 3PQDA 4DDKA 1XP5A 4ZN6A 4GL2A 3I76A 1P2BA 2I34A 3RIEA 1O3YA 4RNCA 1L7DA 2ZR8A 3IVMA 1FF9A 2IE8A 5D51S 2FMUA 3QMMA 2JGDB 3MGKA 5F7OA 2GF0A 5DEOA 1CJTC 4ZEOA 1E9DA 5KJCA 1DKUA 2PQ6A 2OM6A 5ALIA 2ATIA 3U5ZB 4FFNA 4B85A 3TDKA 4AZWA 2GHTA 1N6IA 2GB4A 1YJAA 3MCUA 2C82A 3OJOA 3O4FA 1M2GA 4EY6A 4L6CA 5AI8A 3FCXA 4XSHA 1BC5A 1DAIA 3TJMA 1S4QA 1UM9B 1A95A 3NU1A 5ALOA 1QE0A 3IAHA 5BN5A 3DM5A 4PSDA 3WGGA 2WD8A 4CIAA 1QVWA 3AWIA 2F4NA 3QYFA 1OREA 4M83A 1GZUA 4A36A 3G59A 4EY5A 1M6YA 1QUFA 1SXJC 2X4IA 1NN5A 2V4MA 3IAS1 3AJRA 2JKYA 3MLEA 3N75A 3OPYI 4EGCB 5L3QB 3MSCA 1A7AA 4BAZA 5FP0A 3T52A 3OQ1A 1OFGA 3GJ6A 1EE1A 1LBIA 1G5RA 4K81B 1Z6GA 4OUDB 4BO9A 3JRWA 5GJVC 2QL5A 3URKA 5DNAA 3N2EA 4KWTA 4C2UA 4TTPA 2VUIB 1L5WA 3GG2A 5AOVA 1SCUB 1CHDA 1GFZA 2D7CA 2ZBVA 4YPOA 4OX9B 2AN4A 5KINB 1SQ0A 1U0FA 1YH3A 2ZUCA 4RYLA 4X85A 4NI5A 3WKBA 2D3WA 2X7JA 4MVJI 1ONSA 4IAOA 1XMJA 4BJ5A 4NCKA 4D8TA 2QSUA 4BDTA 1CR1A 1TU4A 1G5IA 1M6VB 3AU9A 2ZQYA 1RHKA 3PNYA 1U3CA 4WPGA 3O2JA 5BN3B 1I7QB 2H3HA 1V26A 3BOSA 2O3SA 3C5WP 4EL5A 1JPNA 2QGZA 4JX8A 3HSKA 1E4EA 1SUWA 1N3BA 3ND9A 3CEMA 3AOEA 5TARA 1H5NA 1W49A 2Y2VA 2GJKA 4F21A 4ZJPA 5B64A 1PL7A 1QV6A 5I9MA 5KSYA 1H2BA 4B3MB 3PPVA 5FLKA 1KK2A 1J99A 4LF4B 1AT1A 3EDYA 5AXDA 3F7TA 4PLFA 4RWZA 1D0SA 2QNBA 3R0ZA 4KYIB 1DZ3A 1KI2A 4QBTA 2WWFA 2X4DA 5IDWA 4ADSG 1AF4A 1VE3A 1CHNA 1P45A 2VZ0A 4YJFA 4JEIA 5IT4A 1H4TA 1I7DA 3BD9A 1AX9A 3BM5A 3QF7A 4I5DA 1G5FA 4RJLA 5F2EA 3L8EA 4A92A 3U60B 4FW9A 3H5VA 4IFTA 5AVXA 5KYXB 3HJRA 2PMEA 1ZICA 2YWDA 4NARA 3VSEA 1OB2A 3AKYA 1BMDA 1X7YA 5AJYA 1J90A 4EUKA 4CT5A 1UDRA 1SKAA 4FNAA 1HNZB 1KDRA 1XCLA 1QRRA 3IHTA 4TYMA 5GADl 2IVZA 3INNA 1PR9A 1K6IA 2M6RA 4U39A 5L51A 1AH2A 1EK6A 4DL9A 3ZWNA 1JHUA 2K2WA 1JLSA 1YZLA 1KJJA 4IL5A 4KKXB 1XHFA 2PFKA 3QUBA 3WFIA 3H1FA 3N9IA 2XVYA 1NUUA 4LF7B 4JJZA 4MW0A 1MRNA 4EB6A 1SCNE 1D1QA 3O1LA 3UGTA 1QVZA 2IYXA 2AT1A 2V6FA 1QP7A 4B7AA 3CZ9A 3QSGA 3TZBA 2GKGA 1LPPA 3VBEA 1T9AA 2W6MA 2Z3WA 1PNVA 1P5HA 3HYTA 3G23A 4KLRA 3WQBA 1GZ3A 3N39C 2AI1A 2DT8A 4IO1A 3C3CA 4RGBA 2Z6AA 2N42A 1B1AA 5A3JA 1BCRA 3C1TA 3ETHA 3GGSA 1G20A 4K9RA 2IXAA 2IYQA 4QRIA 3E3LA 2IS2A 4BKMA 3HACA 2XTZA 4UEKA 1UAYA 1X15A 1AQYA 1RKQA 3F1LA 4B76A 2YOGA 3E4CA 1M0SA 3CT4A 4FDUA 5EINA 2OD2A 4YP5A 4E15A 1JFVA 2I2AA 2W6PA 3CR8A 1N5IA 3Q6MA 4NOKA 4WA8A 4M53A 4CIYA 3O4IA 1H0RA 4L9SA 5T64A 2AN5A 3Q7IA 1C1YA 4GKJB 1ZCZA 3ILSA 2V8BA 3G5AA 5CH5A 3WP1B 1DJQA 1I24A 3TNDA 4K86A 4M49A 1F0PA 1G9XA 3B53X 4PAOA 5LMUB 2OXCA 2EZUA 2P2CA 4I9UA 1KGDA 4OB7A 3GMDA 3KQUA 2VDPB 4KX5A 4OQMA 3B5JA 2BOVA 1GQQA 2RHTA 1X70A 3IX7A 1SUIA 1FLDA 1OIVA 3QW4B 2UYYA 5ARCA 3WYAA 2VEDA 2C94A 2VJYA 3A4VA 3HH8A 3HZRA 1WSWA 4NEGA 3DD1A 1ZBQA 1F06A 4I1IA 2R6DA 5JPDA 1M2JA 1AGXA 2VDOB 2WVAA 2FMHA 1FFEA 1MX9A 3L05A 1V6SA 3RUPA 2DF8A 3T12A 3V8BA 3BE5A 2XNCA 4GRIA 3ZWMA 5IYZA 2FPSA 3ZLUA 2DR3A 2F3TA 4L76A 1FMJA 4YRJA 1FMTA 3CZPA 1IHDA 1TYEB 1VA4A 2FR1A 2VNHA 1M5TA 5EVCA 5FBRB 2B4YA 2IYYA 1ADYA 3VNBA 2QE7D 3SKVA 3RFFA 1QZ3A 1QLHA 4PYNA 5D7BA 1Z5OA 1E4EB 4IFEA 4TTJA 1SXJB 4AQ7A 2C83A 2GFHA 1SNYA 4PZEA 5JCPA 1Z36A 3HCNA 1FXSA 1SMKA 3G85A 4GZ3A 4EX6A 5KOJA 1NX9A 3ENQA 1ISGA 1XRRA 3GVPA 4M8NE 4AD8A 4H1WA 3DMTA 2VJKA 2J4DA 3OOEA 4QOGA 4EGQA 5I7EA 1U1IA 4O3FA 1D6SA 4RVNA 5ELMA 3WNQA 4EL0A 3EXFA 1OTHA 1PQWA 2WG0A 4OA5A 1VL6A 3DGFC 2ZCJA 2AOXA 2G07A 2KLBA 2DKOA 5ECDA 5E9JA 3I2HA 3IKJA 1X7YB 3PTZA 3QLTA 3RIHA 2JBAB 1T5DX 2JAWA 1U99A 1MC5A 3QX9A 1PL8A 3MWLA 4KK3A 2P9GA 4GG1A 3CT6A 4U02A 2FQQA 2YL2A 4TRJA 4MIOA 4YQYA 3PR3A 4Q9AA 1EP9A 1HKUA 4LZOA 4RL4A 1QPGA 3QI7A 3OX1A 1DS6A 4JKOA 1OYWA 4CM3A 1BHJA 3KM0A 1SUAA 2NO9A 1BTOA 4P5DA 1MOZA 4XX0A 1N6NA 2G7ZA 2HMYB 1DKPA 1KRHA 2IZZA 3P9SA 2RKWA 3JQ8A 1WETA 2OGUA 4DQVA 2WOJA 4EB6B 5GOZA 1QAQA 1Y7HA 3ZXSA 3GAMA 1RZVA 2JG3A 2J09A 2AI3A 3ACBA 5CFNA 1QFZA 3ZCQA 3KKKA 1N2SA 4ZO6A 1P19A 1YGYA 1RWWA 1S2IA 2DHEA 2QWXA 3VPGA 4E2ZA 1GQRA 3L7CA 2XI4A 1G20B 2C4KA 3K2IA 3PIDA 4PYLA 5TY0A 3TXAA 2RGDA 1PT8A 4QVIA 3ZJUA 2IYUA 3FHJA 1H6AA 2C1EA 3L0IB 3PR2B 4XUGB 1CXZA 2FAXA 4OHPA 4KQHA 3VVBA 2WT8A 2C31A 4JI5B 3RROA 1GPBA 2JFVA 1IH8A 3NHKA 4IS2A 4RGVA 1NNEA 1VIVA 2Q3HA 3S29A 4WW0A 4FQ5A 1CF4A 3VZRA 2BFCA 4AW9A 1RBZA 4HPXB 3WSWA 2FQWA 3CTMA 4XWWA 2X0RA 5DB4A 2QZPA 1QRSA 3K2EA 1DPGA 4URZR 3O82A 3JVIA 4UMDA 2GF2A 2HGSA 3BWDD 3L41A 3VH2A 3F6YA 2CBZA 3VTKA 5TEWA 3AVXA 2GKSA 3D0QA 4M8SA 3M6WA 5CDFA 5A5VA 3S0JA 3MRSA 1VJCA 4ZCIA 2EKLA 1OYVA 3G2MA 3A3NA 1NFFA 2PH7A 1ZFNA 2PPVA 3JYHA 1M8FA 1DAFA 4J76A 5MFPA 5A06A 3ED5A 4QU0A 5JJCA 4KR9A 3TOZA 3NVMB 1YC5A 1F51E 2NU9A 5BNZA 4NHOA 1U1EA 5KYWA 3S8YA 5AKKA 5H81A 3PEFA 4XCQA 5B58T 2Y0EA 3RC2A 2CC2A 5CNJA 4RUKA 3S55A 1TCCA 1ZM7A 1CQIA 5DHUA 5B2FA 3OQJA 4KLZA 4A2CA 5ADWA 3VKVA 3LRTA 4PX5A 3R74A 2EOAA 2JLBA 3FYTA 1G5HA 2IYPA 4UTXA 2GN6A 1Z12A 2G88A 2GX6A 1RR6A 1KPIA 3RS2A 3KWFA 2XDQB 4URUR 1OI3A 1JHOA 3BQ9A 3FDIA 3PUKA 1Y5RA 3A1SA 3C6KA 4LXQA 3HL0A 4EHBA 5BRJA 1A9XB 2CFCA 2YZKA 3HE3A 3W90A 4F3TA 1KC3A 4B4WA 3PWSA 2VF4X 4IIJA 3EXFB 3OAAD 4HMQA 4Q9JA 2DP4E 2P77A 1JZTA 3IUJA 4O33A 5DP2A 5FNVF 3V4FA 4U7TB 4EUNA 5C5CA 1P3Y1 4DCTA 4MA4A 2WMNB 4MYUA 2G1JA 2IU4A 3IAUA 4PONA 1YDGA 5DI3B 1Z6YA 2QLLA 2WFAA 4GKAA 3TBFA 2ZITA 2IV2X 5J63A 2F9LA 2JRCA 2QE6A 1LLCA 3FGNA 3P2MA 4O2AF 5CVDA 3WE7A 1AE1A 2ODWA 2AVNA 2IYLD 3EIHA 3HXOA 5DH9A 1RJDA 1YNOA 4RF5A 2EJTA 1R4ZA 2ZJFA 1NLZA 2QKYA 4MS4A 4RULA 3K70D 1GA1A 1G98A 3GA0A 2VHUA 3JQ8B 3TIFA 2P9QA 2IH4A 3GGJA 5KNBA 4XH9B 4W8HA 5FADA 3JZAA 3V7YA 2JCYA 5IMSA 3AEUB 5EGSA 3JVDA 3FTCA 4HVLA 3OIVA 3RLIA 4BQEA 1G7TA 2A0KA 1PHPA 3IKTA 3F6RA 3I9MA 2C3UA 1ECCA 1TZMA 1UOPA 4MNTA 2VSOA 3NTLA 1NM5C 1ULHA 3R5XA 3WLLA 4CZ2A 4TZ0A 4XEUA 1TFRA 4D5EA 3OY2A 3TKLA 4QM7A 1Q1AA 2O2GA 4LOAA 2DPXA 1GCAA 4I6EA 1F3LA 3TLJA 5HR5A 2DGDA 4QUJA 4D9MA 3I58A 1GNSA 5HG0A 3H5NA 4KIGA 4KTVE 1QFYA 5H7XA 5B3JA 1PLLA 1BS1A 4CU5A 3OI7A 3WZ2A 4Q4HA 4WN9B 2BFCB 4G4SP 2HJ9A 1EA7A 4RVGA 1AKMA 1B6RA 3MGAA 3HPRA 3VYSB 1XMQB 3AJDA 2QLTA 3BRQA 5KQLA 1K89A 2ZWOA 1IWPB 2XZPA 4IUYA 2VDLB 1VG1A 4KO1S 4GGPA 4IGAA 3RRFA 1GN8A 5EJ5A 3I9OA 4GP6A 2HWKA 3WJ2A 4Q9LA 3QKSA 2YVKA 1SG6A 3D59A 3QKTA 3U13A 2G9UA 1UBJS 2YCBA 2VHEA 3C4QA 1JQBA 1N7JA 3DONA 3JZMA 3UT5A 4GS5A 4KXLA 1WOMA 4ESVA 4YIHA 1UP6A 3B78A 4M46A 3K9LA 4R1SA 4W1RA 1W0KD 2CDRA 5HCIA 1ZMXA 1WB4A 2FX5A 2OO3A 4DEXA 4A23A 1JHAA 2N1MA 1FK8A 2NU9B 3NWOA 5KYWB 1SHTX 2J5RA 4WY8A 4A3SA 2AMVA 3KDAA 2JIBA 1H9BA 2GBIA 1CQIB 1P75A 1IL0A 2AJLI 2OORA 1FSSA 3NKLA 3I04A 1SD1A 5K8TA 4B46A 1AO0A 4H60A 4KV7A 2JLQA 3AY0A 2GFIA 1A2BA 3AF3A 4MWBA 1CVLA 2E2WA 1Q0PA 2IUFA 4BVFA 3MD9A 4IXDA 4RK0A 3GR6A 5FYDA 1N5JA 2Y71A 3QU9A 4DIFA 2GH1A 4HTAA 1TDJA 1M73E 1QHHA 2VQ3A 1BKSB 2ZBFA 4X66B 1T6YA 1G19A 2Z5LA 3MN1A 3WWZA 5D3KA 2XGGA 4WXEA 5FFFA 2GF9A 3TSAA 3BQNB 3TL3A 3EPKA 2LNDA 4QE3A 3FRHA 3AR3A 3KUKA 2V54A 4TXMA 1MTZA 1BDJA 1MQSA 2PMDA 3HQ4O 3L7IA 2E7ZA 2XB2A 1PWXA 1QH0A 1SXIA 4B4VA 3ONVA 1J25A 5K9ZA 4BNKA 1Q3KA 4MQEB 5AI0A 1UMKA 3FLMA 3GV0A 4P54A 3LHDA 5E6UA 4BLRA 4DVJA 5D01A 2NTJA 1KP2A 4RC9A 4PSVA 1V6CA 5KTNA 2YY7A 2WWTA 4YXWA 2F3PA 2JK0A 1Z3IX 5K0LA 1LW7A 4P3KA 4K6CA 3M2PA 3PSAA 4NJMA 4NU5A 5FTWA 1K1EA 4YJGA 4A0FA 1AZSC 3ZH2A 3LD9A 4DTIA 4I1VA 3RCBA 4CTKA 3D3QA 2XHEA 1PFYA 2R7AA 3IO5A 3ET5A 4QZVA 5IX8A 3C4JA 3D3JA 4GIBA 4OJNA 4OJTA 2WYIA 1JA9A 1V8OA 3NIBA 3HWSA 1DAEA 1Q14A 4EA6A 3C7CB 3CVYA 4KDFA 2FWMX 4K6KA 3WIDA 2G5PA 3HCDA 3LS2A 4DMCA 3DTTA 3H18A 1JLKA 1YHYA 4NPCA 4S1WA 3BMQA 3DE5X 1HETA 3HUDA 3QPAA 1RLUA 1UOEA 2HMAA 5BNFA 2X0FA 1M8JA 4ERNA 2P6RA 1TLTA 1QQTA 3OJLA 3QRWA 2IHYA 2P2DA 1GAEO 4KN6A 3ZU3A 4GMGA 1LSSA 3EDOA 5A3RA 3ZY4A 2WUWE 3V8NA 1EGHA 2ZRMA 1L7AA 1CE8A 2VTKA 3TTYA 5HYVA 2FSSA 4WFKA 4ZYTA 1JEOA 3MGGA 3QVSA 4WADA 3V7FA 1NVWQ 1MAUA 1ZNQO 4JH0A 4AL4A 1KWGA 1E20A 4X1YB 5F1KA 3UWSA 1U11A 5BWOA 1U8FO 2WPNA 3F9IA 3MD0A 1UXGA 2O07A 1X3LA 5AI6A 3BIOA 5BSTA 5AJUA 1XC7A 3I9V6 1WXFA 4PO8A 1Q12A 3OUZA 3DZCA 3IALA 2JA2A 3IQXA 2IC5A 2PKWA 2M2IA 3K05A 4KH0A 1RYBA 4XVHA 1LS6A 2IJGX 2POQX 3QWFA 4WN3A 1KPGA 1SU4A 1TCBA 5HE8A 2JPDA 3AHHA 1TM1E 2XB9A 1J2TA 3DA8A 1NI5A 1PFQA 1ZD4A 4I3GA 4I0WB 1B26A 1ZQ1A 1UBGA 4Q1CA 3SDSA 1ULUA 3WLTA 3H4TA 3TBKA 4UU0A 1GZDA 2UZ3A 3HI4A 3PDHA 1B8VA 1X0VA 4AO8A 1G6KA 1KZ1A 3BH6A 4CLOA 3LA6A 3STHA 2GXAA 3WGQA 5DLPA 2V4UA 1WEHA 5JYBA 1K97A 1QM5A 4WGGA 2AMJA 4HGOA 2VT2A 1K86A 1V1RA 1WLYA 3JWEA 2WSIA 5IMBA 3QG5A 4CM9D 4U6SA 4XX1A 4ZMSA 5C37A 2UXDB 4CG2A 2W6OA 2G83A 1WSDA 3BJRA 5DT2A 1KH3A 3W77A 2PYDA 4B6RA 1EBUA 1SVSA 3H99A 2Q9CA 3WJ7A 3BBLA 5JDCA 4ZZ1A 3AUYA 2WHYA 2QN1A 4NDAA 2Q6IA 2QZ9A 1BE1A 2V98A 3Q2IA 3WHLA 1UCFA 1Z8NA 1R10A 1QHHB 1SC3A 2I03A 3ETDA 4BNDA 1JYFA 1YJ8A 4ALIA 5AVRA 3CXRA 3NHAA 4JT9A 4QL3A 3U31A 3QX3A 5ALGA 2IOYA 3ID6C 3OSUA 2QYOA 3PXGA 3U7FB 2DOKA 2C92A 1HORA 1PBNA 3HGTA 5JIBA 1ZN9A 2YRXA 2DTXA 2AC7A 4LMRA 3G1UA 1H69A 4GXTA 3DHYA 1A69A 4M99A 2GBPA 2UYOA 2HN9A 2CDBA 3D8RA 3OFJA 4K5QA 4X71A 5FNVA 2HYDA 4EY7A 3IRUA 2PXHA 2CL7X 2R97A 4R8MA 4YAFA 1A8UA 1T3SA 2B99A 3SYMA 4YJHB 4AJOA 4E7PA 5K99A 3JQBC 2JH8A 4CM5A 2JLRA 4M0MA 2P9BA 3V2HA 5I8WA 1KRXA 4O2AA 2VPYA 4BJHB 3ZOZA 2VATA 1UPFA 3WO0A 1TA0A 4ZC8A 1L5NA 4MVJD 2ZB7A 3OFND 1Q2XA 2W2KA 3PR1A 4N82A 1L5VA 1UEJA 5K01A 1P0PA 5LR6A 1SQSA 1HMYA 1D4OA 1WZ2A 3TJRA 4UMFA 3TZKA 3NRJA 2QM8A 1ZKMA 5CT6A 5IAJA 2A5LA 5HW0A 1N2GA 3HR4A 1V71A 4RVDA 4RWEA 1E3WA 3OESA 2QNRA 2PZGA 3WGOA 5EAIA 3BCHA 1C14A 1QC5A 2BKLA 2WWGA 1YZQA 3LUHA 1T2EA 3A6GA 3B38A 2JAXA 4TLEA 3FF1A 3SR4A 4GVLA 3V1NA 2GEDA 4OHBA 1T5OA 4GBED 4TT8A 1NC3A 2YXNA 5MGNA 4CXMA 4B45A 2WWHA 1HL7A 2MMCA 2JL1A 2HCBA 1HLPA 3HXLA 1YZGA 4RVHA 2PWAA 4EHDA 4RK6A 4HBGA 4MJ7A 2C2ZA 3EC7A 3R9XA 1W4CA 3S27A 1J42A 4M1YA 3H0CA 1EVYA 3T7JA 1LX6A 5E4FA 1U7PA 2LBPA 1GAXA 2COKA 2FZLA 3A7DA 3ZZUA 1MW8X 1JR3A 1R0CA 4QBGB 1ZNZA 3UMBA 5CA1F 3MJEA 1S89A 4DLXA 3VKFA 4AY4A 4NMHA 2O7VA 1L1EA 1LK5A 3JD4A 3VU0A 4J2HA 1KO5A 4IDGA 3MINB 5EYPA 5K0CA 4COKA 5IKPA 1IBCA 4WKOA 2O7NA 2PZLA 1XRNA 3IIKA 4CLOB 1NN0A 1D2HA 4S35A 2AZDA 1YRLA 3OZUA 2XE6A 3HKDB 4KN9S 4XXHA 4ENUA 2G06A 5CEFA 1CJMA 1J8MF 2R2AA 2Y3IA 3FJ1A 4ND3A 5JECA 1MOPA 2VJLA 4Q00A 4UUNA 1X80B 1CUZA 2HO4A 4YASA 5F5XA 4GPAA 4R8SA 1Z6AA 3S5UA 3BDVA 1BW9B 4D6YA 3VV2A 4F1KA 5EMHA 3P9IA 3TLAA 4A91A 2UZ0A 3OWXA 2ZIFA 2AX3A 2F62A 4FN4A 4EYOA 4URXR 1JA1A 4ZK2A 4BNDB 4K6OA 3ZZ0A 1IU9A 1VQ1A 4DMMA 4RFVA 3DV0A 1ZUD1 3RGWS 2JKZA 1A27A 1JQLB 2OAQ1 1HFEL 1C3VA 3UMGA 5IC6A 1CUXA 1I1QB 2LD4A 1COWD 1LI7A 3LECA 5DCUA 3JYLA 3P0FA 2J3IA 5KWJA 2CDNA 4L27A 1T15A 5LCXA 3VFDA 4PRZA 5JAMA 2OFFA 5CITA 2NNWB 4LF9B 5FNVB 1F17A 2A7QA 1DFGA 1UPUA 2P6MA 5AI9A 3IP5A 1XWWA 3D4LA 3IR5A 2Q5JA 5DK6A 4MPRA 4ID3A 1QLWA 3NV7A 1GT91 4C0JA 3A9RA 4O2AB 3VMFA 3RJMA 4NNPA 2AB0A 1H3FA 2R8RA 2OYRA 1QE5A 3VPXA 2WT4A 1OXKB 4Y2XA 3DLIA 2GVDC 1CKEA 1I5OA 4M9ZA 1UKEA 2H51A 3Q88A 5D6OA 1XDSA 3ZD8A 3BZBA 3R7SA 2GASA 3E3OA 1AJEA 4WH0A 1E9FA 1NUPA 3AIKA 1JR4A 3KTDA 3EGIA 1LJ8A 1I0LA 1KZGB 2VDWA 3ESCA 4Q66C 4MHSA 4Q82A 2DXIA 4OQNA 4P84A 4MW4A 1TYZA 1Z8HA 1HQKA 1E3WB 1P3JA 2NXWA 3JALA 5JCOC 3CVOA 2ZULA 3GJRA 2PL1A 1XFDA 3IOCA 4ZZ3A 1GILA 1QC5B 3GFTA 3S2IA 1EMDA 5AVYA 1J0DA 1RHRA 2XE7A 1DEXA 3EXG1 3V2UA 2PD6A 1BXZA 4DBLC 4LFCB 1K6XA 1IY2A 2BMEA 1T91A 2PQ0A 4NULA 3WBBA 4F6RA 1DOAA 1SKYE 5BSUA 4FCVA 4ZZ0A 3IEIA 3Q3VA 3EARA 1ZY2A 3EJWA 1FP2A 3BX1A 2NV6A 2J3LA 3EWIA 3H3XA 2ZIAA 1BU5A 2AW5A 5EC8A 5T8KC 4US0R 4FOPA 4HNSA 4OMCA 1YTLA 1C3XA 2HLPA 4C2BA 2OY0A 4JLPA 5AVKA 3MC1A 3R9XB 4RENA 2J8ZA 5E8RA 1DVRA 3D3NA 1T9GS 1J7JA 1H8HA 3ANXA 2C9YA 4C06A 1PJ4A 4BP1A 3Q5DA 4KSYA 3KJFA 1UK8A 4S12A 1Y1QA 3DXZA 1A4RA 2W90A 2VPXA 3JD1A 4PRKA 1NRJB 4U3JB 4X3OA 3HA7A 3EVEA 2LRHA 4CLRB 2JFUA 3M6LA 1A76A 3ZW8A 5EYPB 3FIJA 5DRYA 1SUPA 4D74A 4MTCA 2AFHE 3WNVA 1G21E 1IAVA 4Y1GA 1J33A 13PKA 2N46A 3K9GA 1G291 4WK0B 3H1PA 2PCJA 2WOOA 3F97A 1G2IA 1DIRA 2J6HA 3KO8A 1Z45A 5FD8A 3LFUA 3PUZA 4WKCA 3S44A 1LWNA 2P9JA 3LX4A 5JAOA 1CUSA 1A4UA 1W2WB 1ZI6A 2DHCA 2R1VA 5IVDA 4EQ6A 5CM8B 1TZCA 3QVGB 5C1OA 3P9ZA 3QFFA 1ZAKA 5FHRA 4NJEA 4RKFA 2ZR0A 5HHTA 4AJLA 5E1MA 1JVBA 3KEFA 1BIFA 1X13A 1XDBA 1E9SA 1KH2A 1M34B 3AERB 3DV0B 4GLFA 4RIIA 2AHRA 5U4XA 2LE0A 1ZD9A 2Q8NA 5C8VA 4YV2A 3NDIA 2ZJZA 3OIUA 5KNDA 1KOLA 3A6HA 1C7QA 2Q9UA 3MA0A 4L9WA 4YRRA 4A1OA 3B52X 2Z2YA 4FYVA 2VP6A 2XWSA 4WOPA 4EYKA 5LVAA 1XO1A 3FVVA 3P2IA 5G0UA 5T3YA 1I4OA 1FS6A 4LE1A 5E0KB 5T57A 1BVUA 2J0SA 5F3DA 3WDMA 1N0IA 2D4AA 2D8MA 4B7UA 4ZYXA 2A5FA 3E70C 2QRLA 3HUEA 3IS3A 1HT0A 3GMTA 3GN2A 4REMA 2GPJA 4H7PA 3NXKA 4GZLA 1NVUQ 4R2HA 1N2ZA 2QD4A 2WKSA 1FP4A 2VYQA 4WSOA 3RHTA 2G72A 2VK1A 5DHPA 5E1OA 3LJKA 5GIPE 1A9YA 1YZUA 2FN7A 3AB7A 1X7WB 2C95A 3B6EA 3STTA 4BNXA 1ISPA 2I8AA 1DC7A 1UJBA 3JV7A 3T8YA 2ISQA 3QPUA 2AK3A 4MKGA 2Q07A 1F0YA 2VDWB 3SAJA 3WISA 4MXDA 1W52X 3P9RA 1N1MA 1AIPA 1ODKA 1UFKA 4JBNA 4FZRA 2P8JA 1Q0SA 3Q8MA 3DAGA 1ESNA 3KJQA 2R3SA 3C6ZA 2AJTA 3LBFA 2F67A 5AJXA 5DO9A 2WQ7A 2JLUA 3RFCA 2I65A 1NJ6A 2WD9A 4F6RB 2VPTA 3RS3A 1SXPA 4IYRA 2BRUC 3GJSA 4YJDA 3PFKA 5H3LA 4GR9A 3QPDA 1EK2A 2FFHA 4X62B 4COOA 3TD6A 5A62A 4EATA 1O94A 4FE4A 5JZMA 1NHWA 5F51A 1JDVA 1W7AA 1PJZA 1SQ6A 2PX2A 3UHPA 5JI3E 2PO7A 3DPUA 1VDZA 3K5HA 3LCVB 3NPAA 3PB3A 4TWAA 3V8VA 4BVLA 3QPWA 5KCZA 1Z7EA 4TWZA 3SZGA 1SIWA 4AJJA 1VJGA 4RTJA 2X7HA 3OWHA 1L7PA 3FTEA 1KZ7B 4JA0A 2H5EA 2J9GA 3UJHA 5CB0A 1K6JA 5AW2A 1I13A 3LVBA 1Z0SA 4G5GA 4MGZR 1NWHA 1NVXQ 4BXOA 3EQ6A 1N2XA 3TEFA 1TEZA 3D4NA 1JHMA 2QZJA 3EA4A 4Q7KA 1RPZA 4C07A 3L6EA 3PXBA 3A6ZA 4Z7QB 3HKEA 3ZU4A 4WACA 3OF3A 4LNUB 1EFKA 1THTA 3RU7A 4NWIA 2P9YA 4D26A 4F5EA 4XDGA 1VPDA 2GN1A 1MTOA 3TZ6A 2R4QA 3HDJA 1ZZGA 1EFRD 1NYLA 2TMDA 2D8AA 3IMCA 4FKBA 1YZFA 5AKZA 3MAAC 4AWAA 3KNZA 1Z6ZA 4AMYA 3LIIA 7YASA 5JCXA 2ZUBA 2G3YA 4MJLA 3P4YA 3C48A 3LQQA 3ZE1B 1W2GA 2ATCA 5ILQA 4QT0A 2C61A 2ZM6B 4IICA 1VBNA 2XMPA 4FHGA 2MSNA 5JXJA 3JZIA 5EHGA 3EIEA 1PFUA 4GSLA 3UMFA 3EMKA 3AVTA 1FJ2A 2EX4A 1TFUA 4XFDA 1G3IA 1C7IA 4HS4A 4F1WA 3A6PC 2OXRA 3SEAA 4UARA 4NK4A 3DLPX 5HKKD 1SB8A 5K6TA 1EXDA 4P83A 5EN4A 4UEOA 5IT5A 3SZ3A 3EPJA 1YA6A 3BTOA 3T94A 2Z5GA 1IJFA 2HZBA 3DZFA 1LBQA 2Q7OE 2WA1A 4NC9A 3TL6A 1M66A 1QGAA 3F6CA 2BW0A 4RESA 3T9BA 1E2FA 2PBFA 1LFDB 5JOQA 3RYCA 1Q1NA 1L5FA 4E07A 2BKVA 3NYRA 4B3XA 4GECA 2C42A 2PZFA 3DFKA 4RJKA 4RA9A 2XJ4A 1Z22A 1HZJA 4IDPA 1ZPDA 2V7TA 1JIVA 1MH1A 1ZK4A 2REXB 4RZ2A 2C2KA 3GA5A 5L3ZA 3RS7A 5KSZA 1RBQA 5IRCD 4YACA 1KAEA 1AN9A 2HREA 2J30A 2W8BB 4Z1OA 4AWXA 3KWLA 1ISJA 1IAQA 3L9XA 1TAGA 1LSUA 2C58A 3KUUA 3PXCX 3IEMA 2GLUA 1PKXA 3A36A 1QRAA 2ZBRA 2YINC 4QQRA 1EJBA 4QWMA 4RMIA 5DYYA 3HCRA 5EUQB 5HM8A 1K3TA 2XQIA 4RZHA 3ZJ5A 5K3BA 5A5EA 1BE0A 1WXQA 3FZEA 3DVSX 2Q45A 1AKRA 4DR2B 2EWMA 2JDIA 2VZ9A 3COYA 1EZ4A 4H4CA 1NMSA 2RHCA 2YRFA 3AVQA 5NLLA 5AM2A 1ULBA 2J5KA 3ZXIA 3FHTA 2DFLA 1OTYA 3HFSA 3W34A 4Q3NA 2QX6A 4E5VA 1Q7RA 3LHFA 3ZWBA 2Q4TA 3DBRA 2CHEA 1QORA 2HF2A 4JL5A 4MARA 3AEKA 2XZTA 1L4UA 2Z83A 4WLEA 1Q1ZA 1T3TA 1FC0A 5GAJA 4BBAA 4KWCA 2BI7A 2FQXA 3HNRA 4QYMA 1C7EA 2NPOA 3ROGA 4DLLA 5C5DA 4YAUA 1OIXA 3G89A 2X9QA 5JAPA 2X9GA 2B7CA 2L42A 2QM3A 1BROA 3NDPA 3O3CA 3QHPA 3RIMA 3S7TA 4NCJA 2WG2A 4NPAA 4EI8A 2WM8A 3BFVA 2G9ZA 4AJPA 1V2GA 2AKAB 1JQ3A 1A4IA 1YDEA 1J5XA 1D1TA 4GHWA 3RD5A 4CQLA 5CA1B 5KOIA 3MELA 5LFAA 2NW6A 3ZWPA 3T3DA 2ZRCA 4OYLA 4BO3A 5FCDA 2UU9B 3HKEB 1D0VA 2PIAA 1V7PC 4QGSA 3L8ZA 3EIFA 1K4MA 2H1FA 2GGSA 1NX6A 5FL7A 1WCIB 4LNHA 4MI9A 3TL2A 1Z5VA 3B2EA 4JLMA 3URMA 3B6IA 1YR7A 4B4OA 2DBYA 1KP9A 3MWKA 3NIFB 4Y9DA 3PHIA 2VP5A 4PLWA 3LTNC 1W48A 7MHTA 1SCBA 4F72A 1JQKA 1SQGA 1KA9H 3DPIA 3CW2A 3MQFA 4OGLA 3CF6R 4UATA 3RVLA 1LKZA 1AQJA 4BO4A 1P1FA 2BH9A 4REOA 1NHGA 4NFHA 1O9GA 3O31A 5DBHX 3IDSA 1I6MA 2QLBA 4DUGA 2BHRA 2ZQZA 1WKCA 4C6TA 3RW9A 4B5LA 4I14A 3UAXA 4HFRA 2EW2A 1O77A 4LYHA 3UWDA 1V47A 4Q0MA 1ELOA 1M2NA 1V1JA 3M34A 1J8VA 1U3GA 4V0NA 1FE8A 2V97A 4YP7A 2BM0A 5BOVA 2PL3A 4RIHA 3T38A 3VKGA 4UVGA 4UE3S 4D80A 1TCVA 4CL8A 5AOAA 4E5UA 4FOSA 5HQTA 4B4DA 2DWCA 2VUTA 4QRHA 4JU8A 3JXEA 3U49A 2Z8ZA 3DE0X 3ZYCA 3B1FA 3DMGA 1UF9A 2XW6A 4M3NA 3PNLA 1VKNA 5THXA 1Y1PA 4E7OA 2IH2A 3KKPA 3D2BA 2ZWIA 4A8PA 5BR4A 3PKZA 3FWPA 1NBME 4JLDA 5ALPA 1JQ5A 2C57A 1VSTA 1U8TA 3L07A 5DCLA 4L08A 1JILA 5KBYA 3EXG2 1DI0A 3EVDA 4DBZA 2G6BA 4RH0A 3HG7A 3KT6A 4MJXA 2PL9A 1UC4B 2I7DA 5DLQC 1VE5A 2ON6A 5IDYA 2Q3FA 1AB5A 3N8DA 4ZOAA 3GFBA 3K1ZA 4FOLA 2FN9A 5C1DA 1M6EX 4GMHA 3RARA 2WPDA 4DYDA 3UW1A 3UNXA 1ESDA 3P2OA 1CFZA 4G5RA 1SUEA 1T3HA 5JZVA 3UBMA 2ZIZA 1ZD1A 3A2NA 1NNSA 3AUFA 3ICEA 1O97C 1US8B 1X9IA 1FMCA 4ETNA 1LX7A 3TI9A 4QAJA 4MCAA 2XB6A 1JL3A 3LUBA 3DBRB 1TQHA 3HJGA 3OSZA 1Q92A 1MB3A 1V5EA 1M0EA 2P0AA 1TTHA 2RI6A 3O73A 3QXHA 4K9DA 4S0ZA 3ZHCA 4CDGA 4CV3A 4BQIA 5IBPA 2R2GA 4IZOA 1GPDG 2KQUA 1H2ZA 3L6DA 4AP9A 1JTEA 4J0HA 4K6FA 5A05A 4HB3A 3RNLA 4R6WA 4Q15A 5LQSA 3VKWA 5HBRA 5JO0A 1GUYA 2PD3A 2MOKA 5KKCA 2CV2A 1XEAA 2GBFA 3QVJA 4BNJA 5BRAA 5CYGA 4C0XA 4CQLB 1VG8A 3ESBA 1IVNA 4Q4AA 3H87A 2A0WA 2HHHB 4EAQA 4BO6A 5A3QA 4S3MA 1EVIA 2BBTA 3MPUA 1ZGHA 1JHVA 5AKJA 1OSNA 3A10A 2NAFA 3WLKX 2BGNA 1VLQA 4CMEC 1RWXA 1LBEA 2SKDA 1JB1A 2XUJA 3CH7A 1XLTC 2X14A 3GRKA 5DTIA 5TDHA 3WTCA 4KITB 5J4KA 1TJYA 1VHDA 2V9ZA 1UP4A 2X58A 2YZMA 2WRZA 4DMFA 3T3OA 3H2ZA 1YUBA 3FFXA 4MRVA 3K9CA 3OCXA 4BV8A 1ISRA 4N5MA 3ZWQA 5ELXA 3LMKA 1QB7A 3U19A 4ZI7F 3K0FA 2D06A 1FTNA 1ZNYA 3ASZA 3RVOA 1SZPA 3NALA 4HC4A 4B6PA 2VDNB 1GYRA 1BHSA 2VHCA 5TQ0A 4C6TB 4DV2B 2V1UA 1Z5PA 1KK1A 3H6KA 2RE8A 4C6HA 4ZU6X 1S01A 3B1WA 2JFBA 1G0OA 4LGMA 5LXTF 5HZHA 1I5RA 1FTGA 6ADHA 1C8KA 2UYGA 1JSXA 3ZU2A 4RQTA 4D6XA 2OKGA 5BUQA 2V55B 4PWZA 1S1CA 3CE6A 3OTOB 1RAIA 2C2BA 4NBLA 2D00A 4OQQA 4Y2UA 1QVAA 4E6EA 4ZJZA 4FYMA 1HH4A 1CUGA 4P3OA 1SBQA 3D9QX 5F21A 2WHPA 3QJ5A 3UPDA 3ZX4A 3DPSA 2PKXA 5E2AA 4UTPA 7AT1A 3PD1A 1OILA 2B8TA 3JQ9C 4XLLA 4AULA 3W9BA 3B1VA 4WFIA 4XYEA 3SQNA 1LDNA 2GZDA 1GRCA 1N2EA 1W9MA 1H85A 2ZJ0A 3HR7A 1MQ8B 2Z9DA 3EHEA 3Q9NA 4V0OA 4BKRA 2E18A 3BD7A 4UDYX 5KSWB 1CRPA 5BSFA 2KSQA 3T5MA 2WV7A 1KAGA 2G5TA 2V7VA 1NMYA 1G63A 1PJLA 4EIWA 3I05A 1KNQA 4FFBA 3SYNA 4BV3A 1H4VB 4XEHA 3TK1A 5KQGA 3HI6A 2QV0A 1KYIA 3IMEA 1QU2A 3WICA 3HKBA 5J4YA 4W5NA 4H08A 3RRNA 2B61A 1Q91A 4LGCA 5K1ZA 3V32A 3ANLA 5ITVA 2F3SA 2PVSA 1NZFA 4KW7A 3AW8A 5KUTA 3DNMA 1T2DA 4JVNA 3SG0A 2X3FA 1A7JA 5FUXA 3FCAA 1F2VA 2HAEA 1JRLA 3JQ9A 4TN5A 2C4UA 2XNDA 3WL5A 3CUUA 1L5MA 2NXCA