1YP7A

Van der waals interactions dominate hydrophobic association in a protein binding site occluded from solvent water
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
157
structure length
157
Chain Sequence
b'EEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLEKSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLFGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAJOR URINARY PROTEIN 1
publication title Van der Waals Interactions Dominate Ligand-Protein Association in a Protein Binding Site Occluded from Solvent Water
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligand binding protein
total genus 45
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2005-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 1yp7A00
2P8GA 2A13A 4ODDA 2POAA 5L8NA 4EFGA 3B2LA 1SXXA 5B29A 5HZQA 3UEUA 4ZGUA 1QY1A 1QY2A 3JSQA 5KIDA 1IIUA 3KFFA 3BSZE 3F8AA 1SXWA 5HZ6A 2IFBA 2K62A 3FA6A 1LIBA 1HN2A 4BOEA 1GX9A 4ZFXA 1D2UA 5H8TA 4YCEA 3APVA 1HMRA 4I3BA 4RUNA 3FELA 3WJBA 2QO5A 1GM6A 3BY0A 3FA7A 4ZHGA 5EPQA 3B2JA 4IB7A 2A3FX 1ADLA 4XMFA 3C78X 4WBKA 4NNSA 1R0UA 2NP1A 1GT4A 4Y0RA 1JJJA 1YWAA 4TJZA 1A18A 3RZYA 1QG5A 5F7GA 1LKEA 1QY0A 2MJIA 1EPBA 3FEKA 5DG4A 3ELZA 5HBSA 3APUA 4GH7A 3FA9A 5FENA 3BX8A 3FLLA 2XKLA 1O1VA 1Z24A 3DSZA 1P6PA 1ZNEA 1B0OA 4NYQA 4WFVA 1EIIA 5HZ8A 4HFOA 4YGZA 4XMDA 4YMYA 4IMNA 1A57A 1OPBA 3NX1A 3NPOA 1OPAA 1FENA 4BQUA 1S44A 1FELA 5D45A 4YDAA 1DZMA 2OVAA 2FS7A 3Q6LA 2JU3A 5EDBA 1UZ2X 2LB6A 4AYHA 2OFMX 3B2IA 4YBPA 4YH0A 3KZAA 4AZOA 5HAEA 1KOIA 3STNA 5IO5A 3U03A 3HWGA 4RUUA 1LF7A 2NNEA 1X71A 3EYCA 3P6CA 1I05A 4TQ2A 3PP6A 1QWDA 1SA8A 1L6MA 3WJEA 3WBGA 1IKEA 2L67A 3PEDA 3P6GA 4OMXA 4IAWA 5LJGA 4HPCA 2RCQA 3VG2A 2MO5A 4ES7A 1HBQA 2JOZA 2X45A 1MVGA 2PY1A 5KHPA 4AZQA 3EMMA 3UEWA 4DQ3A 1BRPA 2HMBA 4ORXA 3WJDA 5HCCC 2QOSC 5F58A 4AZMA 4TKBA 4I3CA 1GT1A 3BU1A 4NP1A 2R74A 1KQWA 3PH5A 4IAXA 2Q9SA 2NNDA 2CM9A 3U9PC 4ALBA 4Y0SA 4ZR2A 5H9NA 1YP6A 1KT7A 3HWEA 3HWDA 1E02A 2MM3A 4ARHA 5HZ5A 1EUOA 4MVLA 2ACPX 4PSQA 1QQSA 2NNQA 1EIOA 2OFRX 2F73A 3PECA 1SY0A 2A0AA 2JU7A 5LKEA 2A2GA 1E06A 1E00A 3SAOA 1HQPA 1D3SA 1ERBA 1DC9A 2Q2PA 2XSTA 1A2DA 1S2PA 2YG2A 3QKGA 4HPBA 1XKIA 1MUPA 2W2BA 3P6FA 5LJEA 1QFTA 3PH6A 1T68X 2ALLX 4HPDA 3VG7A 1SXUA 3VG4A 1S7DA 4O9SA 3WXQA 5LJDA 1SXYA 1DV9A 1U18A 4A1YA 3PPTA 4NNTA 1ZNLA 2OVDA 1BSYA 1KZXA 1DZKA 2N93A 2QO4A 3F9DA 3U0DA 3TF6A 2ASNX 5LJBA 4LKPA 1HMTA 1DFVA 4MVIA 1B56A 3FENA 2RA6A 3FR5A 3DTQA 2JN3A 1IFCA 1ZNDA 3OJYC 3FW5A 4I3DA 3BRNA 3ZUOA 5KICA 3I17A 3L4RA 2W2FA 1ZNHA 2AT0X 4LZUA 4XMEA 2GC9A 1JBHA 4YCHA 1VPRA 3BU9A 5HCDC 1BJ7A 2CBRA 3K3LA 4I9RA 2ACOA 1GGLA 3FMZA 5F6BA 3FA8A 4KIIA 5L8OA 4GRJA 5HA0A 2O62A 1GT5A 4GNWA 1YWBA 4ALOA 5H9AA 3FEPA 1T8VA 5HZ9A 2GJ5A 1JYJA 1NGLA 1YIVA 4ZHHA 1EXSA 1KGLA 1NP1A 2W2AA 2R56A 1KT3A 5EDCA 1GKAA 1LIDA 1AB0A 1IFBA 1KT4A 5LJHA 2R73A 2L5PA 5HTDA 4YDBA 3S26A 2CZUA 1OBPA 3D96A 1DZJA 4EDEA 4YFQA 1SY2A 3O22A 3CMPA 1CJ5A 2AL0X 1LIFA 2G7BA 4Y0QA 1VYGA 3EM0A 1MX7A 3I0AA 4IB8A 4NLIA 2Q39A 4GETA 3AKNA 3ELXA 4UU3A 3TGCA 4D6BA 1G74A 4ZHDA 2HNXA 3FIQA 4GKCA 4AZRA 3BDRA 1KQXA 1EQDA 1KXOA 1PBOA 1GX8A 5HWZA 2Q2MA 5B27A 4NLJA 2WUTA 1PEEA 5C0NA 1ALBA 4ORUA 5HA1A 3STMX 3RSWA 1BRQA 1ICNA 1O1UA 2WSJA 2L68A 1OEEA 1XCAA 3WJFA 3IFBA 5FAZA 4ZH9A 2FTBA 1LPJA 4QZUA 3NP1A 4GE1A 1BLRA 3UEXA 4N7DA 2FLJA 3P6EA 3CQNA 4YKMA 1TXLA 3C76X 1OBUA 3CR6A 4ZH6A 3EBKA 4M6SA 5H9KA 1ERXA 2AT8X 3KFGA 2AH7X 2G79A 1RBPA 1FE3A 3JS1A 1SY1A 1EW3A 1GKAB 4QZTA 3MBTA 1YP7A 5CE4A 4TKJA 2AKQA 4AW8A 2OZQA 1MDCA 5F1EA 4QGXA 2RQ0A 2JU8A 3STKA 1EALA 3EBWA 1U17A 2RCTA 4UU2A 2LBVA 2WQ9A 5DPQA 3TGBA 2KT4B 3VG6A 3D95A 1OEJA 1ZNGA 1SY3A 1U0XA 1BM5A 4NYRA 1MX8A 5D8JA 3FR4A 4ZCBA 2WR6A 3FR2A 1JV4A 4EXZA 5LKFA 1HBPA 1PM1X 2X46A 4ORWA 1O8VA 2RD7C 4ZHFA 3B2HA 4A60A 5F6ZA 1X8OA 2FS6A 1X8UA 1TOUA 2K23A 2HYSA 5EEEA 1G5WA 5D4AA 2AT5X 3CQRA 2G78A 2AT3X 3O2YA 4DQ4A 1YWCA 4OS8A 3CBCA 3O19A 4YBUA 4EEJA 4TLJA 1UREA 3VG5A 4D6AA 1E5PA 5EEDA 3B2KA 1QABE 5BVSA 4ORRA 1I04A 5LJCA 4QYPA 1X8NA 3VG3A 2QM9A 1CBIA 3MVFA 1NP4A 4I9SA 4ORSA 5H9LA 4HPAA 5K06A 4CK4A 3CWKA 3WJCA 2GTFX 3BS2A 2DM5A 1X89A 1VYFA 3C77X 2OVEA 4OMWA 3FW4A 3WVMA 3CBSA 1RLBE 1JJXA 1AVGI 4ORYA 3WJGA 4IBAA 2CBSA 3KFIA 1ACDA 2AT6X 1BWYA 1ML7A 1FDQA 3AKMA 1CBRA 1I06A 1BEBA 5D48A 1YWDA 1N0SA 2WQAE 4OS3A 4YGGA 5FFHA 1LIEA 3APWA 4LZVA 1TVQA 2WEXA 1B8EA 1OEKA 2E4JA 4A8ZA 1AQBA 1A3YA 3KFHA 4LKTA 4XMHA 2FRSA 3IA8A 2CM4A 2WEWA 4TNNA 2HZRA 4YFPA 3T1DA 3TGAA 1CBQA 1DZPA 4IMOA 5IO6A 3P6HA 1AELA 4QYNA 5D47A 3NX2A 1DF3A 1ICMA 4K19A 5BVTA 1ZRYA 1JZUA 2LKKA 5JR8A 1ZNKA 1GT3A 4IB9A 1X8PA 5HCEC 2L9CA 5IO7A 1T0VA 1KT5A 5HTEA 1CBSA 3NQ9A 4TKHA 1FTPA 4N7CA 5BVQA 4YGHA 4IB6A 3KQ0A 2LFOA 1OBQA 3NQ3A 4Y0PA 3D97A 4AZNA 2QO6A 2KTDA 3BLGA 2WWPA 1CRBA 2Q4NA 3G7XA 1FEMA 1BBPA 2A2UA 2HZQA 4GNYA 1TW4A 1PMPA 3ZUIA 1BSOA 4ZJ0A 1HMSA 4BVMA 1EPAA 3GAQA 1LNMA 2BLGA 3ZQ3A 2FR2A 2AMMX 2HLVA 4WFUA 1IW2A 1YUPA 3NADA 3UEVA 4ZHCA 4R0BA 1IKJA 5EZ2A 1KT6A 2EU7X 2CZTA 2FWVA 1G7NA 2LBAA 4YKOA 1H91A 4QGVA 1TOWA 1G85A 4OS0A 1KZWA 3HWFA 5AQ6A 1LFOA 3HK1A 3TZSA 1GXAA 4A1HA 5L8IA 4AZPA 5LJKA 3P6DA 1B4MA 1QFVA 2FR3A 1BSQA 4YFRA 1JYDA 1LICA 3APXA 4M7MA 4QAEA 1X8QA 3BX7A 4XMGA 2FT9A 2ANSA 4QGWA 3NR3A 1I4UA 4MVKA 4XMCA
chains in the Genus database with same CATH superfamily
2P8GA 1VWRB 2A13A 4ODDA 4BX5B 4CPIA 2POAA 5L8NA 3GE2A 4CDFA 3B2LA 4EFGA 2RTMA 1SXXA 5B29A 4I60A 5HZQA 4GK9A 2CAMA 3UEUA 4ZGUA 1QY1A 1QY2A 3JSQA 5KIDA 1IIUA 3HPEA 3KFFA 1OSPO 1Y53X 1SXWA 3BSZE 3F8AA 4Z28A 2IFBA 2OY7A 5HZ6A 3X00A 2K62A 3FA6A 4EKVA 1LIBA 4U8UM 2X4MA 1HN2A 4BOEA 1GX9A 3N91A 4ZFXA 1D2UA 4O3XB 5H8TA 4YCEA 3APVA 5IRUA 1HMRA 4I3BA 1LDOA 3FYFA 4RUNA 1JJUA 3FELA 2ZAGA 3OE3A 3PQUA 2QO5A 1GM6A 3WJBA 3LTWA 2RTRB 3BY0A 3FA7A 1VWKB 2OFBA 1RAVA 4JHQA 4ZHGA 1PBYA 2BS5A 5EPQA 3B2JA 1HXZA 2A3FX 4IB7A 3VE1A 2OL8O 1ADLA 1SWEA 1VWDB 2GTLO 4XMFA 1RXKA 3C78X 4JO6A 4WBKA 1NQMA 4NNSA 1R0UA 2NP1A 1GT4A 2IZGB 4Y0RA 1YWAA 1JJJA 1VWPB 2RTAA 4TJZA 1A18A 4CPHB 3RZYA 1QG5A 5F7GA 5LJEA 2OY8A 1LKEA 1QY0A 2MJIA 1EPBA 3FEKA 5DG4A 4KH8A 3ELZA 5HBSA 3APUA 4GH7A 2C1SA 3FA9A 3BX8A 3FLLA 5FENA 1KL3A 2XKLA 1SLGB 1O1VA 1SWHA 4KC8A 1Z24A 4QNIA 3DSZA 3F6ZB 1P6PA 1ZNEA 1B0OA 4NYQA 1RSUB 4WFVA 3RDQA 1SLDB 3ZW1B 1STRB 2VFBA 1JMXA 4HFOA 5HZ8A 1EIIA 4YGZA 5B11O 4XMDA 2UZ2A 4U8UN 4YMYA 1SWAA 4IMNA 1MEPA 1STPA 1A57A 1OPBA 3NX1A 3KVNA 3NPOA 1OPAA 1FENA 5FQ7E 4BQUA 1S44A 4FBRA 1FELA 5D45A 4YDAA 2OYBO 3VU1A 1DZMA 2OVAA 2FS7A 2X56A 3RY1A 1SWPA 3Q6LA 2JU3A 2A5BA 5EDBA 1UZ2X 2LB6A 3VPJE 3AEHA 4AYHA 1SWGA 2OFMX 4C5PA 3B2IA 4YBPA 4YH0A 3KZAA 3RDXA 1LCWA 4AZOA 5HAEA 2AVIA 1KOIA 3STNA 5IO5A 3U03A 1UYOX 1AVEA 1WUBA 3HWGA 3WYQA 4RUUA 1E2TA 1LF7A 2NNEA 2RTLA 1X71A 2Z4HA 3EYCA 3WYPA 3P6CA 1I05A 5CSEA 3PP6A 3T2XA 3ZI8A 5CYBA 4TQ2A 1QWDA 3WZNA 1SA8A 1L6MA 3WJEA 2QCBA 4O4OA 3WBGA 1IKEA 2L67A 3PEDA 3PK2A 3MX7A 3P6GA 4OMXA 4IAWA 4U46A 5B5GA 5LJGA 3UAQA 4HPCA 2RCQA 4KC7A 3VG2A 3VHHA 2MO5A 4MEEA 4ES7A 1HBQA 5B3MO 2JOZA 2X45A 1MOYA 1MVGA 2PY1A 5KHPA 4GGRA 2BHVA 2OFAA 4AZQA 3EMMA 3UEWA 4BGFA 1BRPA 2HMBA 4ORXA 3WJDA 4DQ3A 4ZGFA 5HCCC 2QOSC 5F58A 1LUQA 4AZMA 1JIWI 3SZHA 4TKBA 1LCZA 4I3CA 1GT1A 3BU1A 4NP1A 1SRHA 1NC9A 5IRAA 2R74A 1KQWA 3PH5A 4IAXA 3VE2A 1Y55X 2CM9A 2NNDA 2Q9SA 3U9PC 4ALBA 4CSBA 3WZPA 1STSB 2GTLN 4Y0SA 4ZR2A 5H9NA 1YP6A 1KT7A 3HWEA 3HWDA 5F2BA 3WOVA 1E02A 2MM3A 4ARHA 2OL6O 5HZ5A 1EUOA 4MVLA 2ACPX 2X55A 4PSQA 3SZJA 1QQSA 2NNQA 1K3BA 2OFRX 1EIOA 2F73A 3PECA 1SY0A 1SWFA 4O4UA 4OELA 3P24A 2A0AA 1SWSA 2Y3EA 2IZLB 1RXHA 4NV8A 4U9CA 2JU7A 5LKEA 2A2GA 1E06A 1E00A 3SAOA 1HQPA 2QOMA 3EW2A 1D3SA 1ERBA 1DC9A 2Q2PA 2XSTA 2RTOB 1A2DA 1S2PA 2YG2A 3QKGA 4Z2VA 4HPBA 1XKIA 3OD9A 1W5RA 4Z6JA 2YMSA 3MG5A 1MUPA 2W2BA 3P6FA 5JD2A 3SLJA 4I6SA 3OBLA 1N43A 1QFTA 1WBIA 3PH6A 3RDSA 4CDEA 1T68X 2ALLX 4HPDA 3VG7A 1SXUA 3VG4A 1S7DA 1VWNB 4O9SA 5LJDA 1SXYA 3WXQA 4JNJA 5FQ6E 1DV9A 2RTBB 1U18A 2KD2A 4A1YA 3PPTA 4NNTA 1ZNLA 2IZKA 4O3YA 2WPUA 2OVDA 1BSYA 1N9MA 1DZKA 1EI5A 1N4JA 2N93A 2QO4A 3F9DA 4QRLA 3U0DA 1KZXA 3TF6A 1HXLA 2VDFA 2ASNX 5LJBA 4LKPA 1HMTA 2Y32A 5L3YA 1DFVA 4MISA 4MVIA 1B56A 3FENA 1KL4A 2RA6A 3FR5A 3DTQA 2JN3A 2RN4A 1IFCA 2X34A 1VWCB 1ZNDA 3OJYC 3FW5A 4I3DA 3BRNA 4CV7A 4L1NA 3ZUOA 5KICA 3I17A 3L4RA 3ZW0A 2W2FA 1ZNHA 2AT0X 4LZUA 3ZZVA 5IXGA 4XMEA 2GC9A 2QMIA 2RTKA 1JBHA 4YCHA 1VPRA 3BU9A 5HCDC 1BJ7A 4O4XA 2CBRA 1GX3A 3K3LA 4GGTA 4I9RA 2ACOA 3MM0A 4ON1A 1GGLA 3FMZA 5F6BA 3FA8A 4KIIA 4WHIA 5B10O 5L8OA 4GRJA 4I95A 5HA0A 1N9YA 2O62A 1N7YA 1GT5A 2OY1O 4GNWA 1YWBA 2DJGA 4CDDA 1W4TA 5H9AA 4ALOA 4Y59A 3FEPA 1T8VA 5HZ9A 2GJ5A 1JYJA 1NGLA 2IZHB 2X32A 3HTYA 1YIVA 4ZHHA 1EXSA 1KGLA 4CDCA 1NP1A 2W2AA 4KT5A 2R56A 1KT3A 5EDCA 5FQ8E 1GKAA 1KFFA 1LIDA 1AB0A 1JQPA 2I5VO 1K24A 1SWJA 2AF5A 2IZFB 1IFBA 1KT4A 2RTCB 5LJHA 2R73A 2L5PA 5HTDA 4YDBA 1VYOA 3S26A 2CZUA 2C4IA 1OBPA 2FHNX 2X8SA 3D96A 1SRIA 2RTEB 1DZJA 4EDEA 4YFQA 1SY2A 3O22A 1SWQA 2RTDB 3LHNA 3CMPA 3EC5A 1CJ5A 2AL0X 4Z27A 1LIFA 2G7BA 4Y0QA 1VYGA 2FKGA 3EM0A 1MX7A 3I0AA 1SWCA 4IB8A 4NLIA 3T2WA 2Q39A 4GETA 3AKNA 3ELXA 4O3WA 4UU3A 3TGCA 2G5LA 4D6BA 1PTSA 1G74A 3VGWA 4ZHDA 3PDFA 1MM9A 1SWOA 2HNXA 3FIQA 2KTSA 4GKCA 4AZRA 2RTPB 3BDRA 1KQXA 1EQDA 1KXOA 1PBOA 1GX8A 1VWMB 1VWJB 5HWZA 2Q2MA 5B27A 4NLJA 1I78A 2WUTA 4COTA 1PEEA 5K68A 4GDZA 5C0NA 2DJFA 1ALBA 4ORUA 5HA1A 3STMX 3RSWA 2F01A 1BRQA 1ICNA 4INNA 1O1UA 2WSJA 2OVSA 2L68A 3NBXX 1OEEA 1XCAA 3WJFA 2C1QA 4BX7A 3IFBA 5FAZA 4ZH9A 2FTBA 4GGZA 1DF8A 3JQOA 4GJVA 1LPJA 4QZUA 3NP1A 4GE1A 1BLRA 3UEXA 4N7DA 2FLJA 3P6EA 3CQNA 4MVEA 4BBOA 4GZVA 4YKMA 4YVBA 1KL5A 3S5XA 4PJ2A 2KW1A 1TXLA 3C76X 1VWHB 1OBUA 3CR6A 3HOLA 3EBKA 4M6SA 5H9KA 1ERXA 2AT8X 3KFGA 4ZH6A 2AH7X 2G79A 4Z2OA 1RBPA 1FE3A 3JS1A 1SY1A 1EW3A 1GKAB 4QZTA 3MBTA 1YP7A 5CE4A 2PI3O 3FIDA 4TKJA 1VWQB 2AKQA 4U3QA 2OZQA 4AW8A 1MDCA 5F1EA 4QGXA 2RQ0A 2RTJA 4BX6A 2JU8A 4BJ8A 4O3ZA 1I9HA 3STKA 1EALA 3RDUA 2A5CA 3EBWA 1U17A 2RCTA 3H3IA 4DCBA 4UU2A 1VWLB 1AVDA 2LBVA 2WQ9A 4FQBB 5DPQA 3TGBA 2KT4B 4NV7A 3VG6A 4CPHA 3D95A 4O49A 1VWGB 1OEJA 4FBOA 1ZNGA 1SY3A 1U0XA 2GH7A 2ZAIA 4GJSA 4OEMA 1BM5A 4NYRA 1SLEB 4QQ1A 1MX8A 5D8JA 3FR4A 4ZCBA 5BYPA 2WR6A 3FR2A 4LQZA 1JV4A 4EXZA 5LKFA 1HBPA 2BT9A 4GDAA 1PM1X 2X46A 1SLFB 1JMZA 4ORWA 1O8VA 3LV4A 2RD7C 1VWIB 4GUZA 4ZHFA 3B2HA 4A60A 5F6ZA 1X8OA 2FS6A 1X8UA 2FHLA 1LCVA 1TOUA 2K23A 2HYSA 5EEEA 4B55A 1G5WA 2X8FA 2MWHA 5D4AA 2AT5X 3CQRA 2G78A 4CPEA 2IZJA 2AT3X 3O2YA 1VWAB 4GU8A 2OY5O 4DQ4A 1YWCA 2JGSA 4OS8A 3P02A 1NQNA 3D9WA 3CBCA 3O19A 4YBUA 4EEJA 2M4LA 1UREA 4TLJA 3VG5A 1E5PA 5EEDA 2JMBA 3B2KA 1QABE 2IZDB 4D6AA 4BX7B 4Y5DA 3CKGA 2Y3FA 5BVSA 4ORRA 1I04A 2UYWA 2BSZA 5LJCA 4QYPA 1X8NA 1SRFA 3VG3A 2QM9A 1CBIA 3MVFA 1NP4A 4I9SA 4ORSA 5H9LA 4HPAA 5K06A 4CK4A 3CWKA 3WJCA 2GTFX 3BS2A 2DM5A 1X89A 1VYFA 3C77X 2OVEA 4OMWA 2MF6A 3FW4A 2ZSCA 3EW1A 3WVMA 3CBSA 4IRWA 1RLBE 3WZQA 1JJXA 1AVGI 2RTNB 3SLOA 4ORYA 3WJGA 1VWFB 4IBAA 2CBSA 3KFIA 4GD9A 4BCSA 1ACDA 2AT6X 1BWYA 1SWNA 1ML7A 1FDQA 1HY2A 2RTQB 3RBYA 3AKMA 2OL7A 3T6LA 4BX6B 1CBRA 1I06A 1BEBA 5D48A 3T6FA 1YWDA 1N0SA 2WQAE 4OS3A 3SOTA 5IRWA 4ID2A 4YGGA 2VFCA 1NBXA 3RWXA 5FFHA 1RSTB 4NW4A 1LIEA 3APWA 5B5FA 4LZVA 1Y52X 2HKDA 4FGIB 4KCAA 2RTIB 1TVQA 2WEXA 4IABA 1B8EA 1SRGA 1VWBB 4ML7B 1OEKA 2E4JA 2IZCB 3S60A 2OF8A 4A8ZA 1AQBA 1A3YA 3KFHA 4LKTA 4XMHA 2JW1A 4FBVA 2FRSA 3IA8A 2IZIA 2CM4A 2WEWA 4TNNA 2HZRA 4YFPA 3T1DA 3TGAA 1CBQA 3RY2A 3VHIA 1DZPA 5CHKA 4IMOA 5IO6A 3P6HA 1SWDA 1AELA 1SREA 3RDMA 3QQ2A 2BC3A 4QYNA 5D47A 3NX2A 1DF3A 3ZWEA 1ICMA 4K19A 5BVTA 1ZRYA 2RTGB 4L3RA 1SMPI 2GTLM 1IJ8A 5K67A 1JZUA 2LKKA 1HQQA 3V8UA 1ZNKA 5JR8A 1GT3A 4IB9A 1SWUA 1X8PA 5HCEC 2BS6A 3ZW0B 4Z2PA 2L9CA 5IO7A 1T0VA 3HOEA 1KT5A 1SRJA 1VWEB 5HTEA 4BX5A 1CBSA 3PQSA 2FGSA 2X8TA 3NQ9A 4TKHA 2LA7A 2IZEB 1FTPA 4N7CA 5BVQA 3RDOA 4YGHA 4IB6A 3KQ0A 3NQKA 3SZIA 2IZBA 2LFOA 1OBQA 3NQ3A 4Y0PA 4MIRA 4DNEA 3D97A 4AZNA 3WZOA 2QO6A 2A8GA 3FDCA 3ZW2A 2I5ZO 1LDQA 2KTDA 1SWKA 3D4RA 1UYNX 4EQAC 2RTHB 3BLGA 4O4SA 2WWPA 1CRBA 2Q4NA 3E3CA 3G7XA 3SLTA 1FEMA 1BBPA 2A2UA 3RE6A 2HZQA 1MK5A 4GNYA 1TW4A 1PMPA 2Z4IA 1BSOA 3RKGA 3ZUIA 4CPFA 1HMSA 4ZJ0A 4BVMA 1EPAA 3GAQA 1LNMA 2BLGA 2MHDA 3ZQ3A 2FR2A 2IZAA 2AMMX 2HLVA 4WFUA 1IW2A 1YUPA 3NADA 3CKFA 3UEVA 4ZHCA 4R0BA 1IKJA 1SWTA 5EZ2A 1KT6A 1SWBA 1W6FA 2CZTA 2EU7X 1NDJA 2FWVA 1G7NA 4OKAA 2LBAA 1SWRA 4YKOA 1H91A 4QGVA 1TOWA 1G85A 1RXJA 4U8UO 3S5VA 4HWMA 1Y9TA 4OS0A 2RTFB 1KZWA 2FKJA 3HWFA 4JGLA 3VHMA 5AJCA 5AQ6A 1LFOA 3HK1A 3TZSA 1GXAA 1SWLA 5L8IA 4A1HA 3RE5A 4AZPA 1Y0GA 5LJKA 3P6DA 1B4MA 1QFVA 1LELA 1VWOB 1BSQA 2FR3A 2G8CO 2F09A 2OF9A 4YFRA 1JYDA 1LICA 3APXA 4M7MA 4QAEA 5AJBA 3AUMO 5B2AO 5AEOA 3ZW1A 1Y9LA 1X8QA 3BX7A 4XMGA 2FT9A 1FJ1E 2ANSA 4QGWA 3NR3A 3Q34A 1I4UA 4MVKA 4XMCA
chains in the Genus database with same CATH topology
2P8GA 2A13A 4ODDA 2POAA 5L8NA 3GE2A 4EFGA 3B2LA 1SXXA 5B29A 5HZQA 4GK9A 3UEUA 4ZGUA 1QY1A 1QY2A 3JSQA 5KIDA 1IIUA 3KFFA 3BSZE 3F8AA 1SXWA 5HZ6A 2IFBA 2K62A 3FA6A 1LIBA 4U8UM 1HN2A 4BOEA 1GX9A 3N91A 4ZFXA 1D2UA 4O3XB 5H8TA 4YCEA 3APVA 1HMRA 4I3BA 3FYFA 4RUNA 3OE3A 3FELA 2ZAGA 3PQUA 3WJBA 2QO5A 1GM6A 3BY0A 3FA7A 4ZHGA 2BS5A 5EPQA 3B2JA 4IB7A 2A3FX 3VE1A 1ADLA 2GTLO 4XMFA 3C78X 4WBKA 4NNSA 1R0UA 2NP1A 1GT4A 4Y0RA 1JJJA 1YWAA 4TJZA 1A18A 3RZYA 1QG5A 5F7GA 1LKEA 1QY0A 2MJIA 1EPBA 3FEKA 5DG4A 4KH8A 3ELZA 5HBSA 3APUA 4GH7A 3FA9A 5FENA 3BX8A 3FLLA 2XKLA 1O1VA 4KC8A 1Z24A 4QNIA 3DSZA 3F6ZB 1P6PA 1ZNEA 1B0OA 4NYQA 4WFVA 3ZW1B 1EIIA 5HZ8A 4HFOA 4YGZA 4XMDA 4U8UN 4YMYA 4IMNA 1A57A 1OPBA 3NX1A 3NPOA 1OPAA 1FENA 5FQ7E 4BQUA 1S44A 4FBRA 1FELA 5D45A 4YDAA 3VU1A 1DZMA 2OVAA 2FS7A 3Q6LA 2JU3A 5EDBA 1UZ2X 2LB6A 3VPJE 4AYHA 2OFMX 3B2IA 4YBPA 4YH0A 3KZAA 4AZOA 5HAEA 1KOIA 3STNA 5IO5A 3U03A 3HWGA 4RUUA 1LF7A 2NNEA 2Z4HA 1X71A 3EYCA 3P6CA 1I05A 3ZI8A 3PP6A 4TQ2A 5CYBA 1QWDA 1SA8A 1L6MA 3WJEA 4O4OA 3WBGA 1IKEA 2L67A 3PEDA 3MX7A 3P6GA 4OMXA 4IAWA 5LJGA 3UAQA 4HPCA 2RCQA 4KC7A 3VG2A 2MO5A 4ES7A 1HBQA 2JOZA 2X45A 1MVGA 2PY1A 5KHPA 2BHVA 4AZQA 3EMMA 3UEWA 4DQ3A 1BRPA 2HMBA 4ORXA 3WJDA 4ZGFA 5HCCC 2QOSC 5F58A 4AZMA 1JIWI 4TKBA 4I3CA 1GT1A 3BU1A 4NP1A 2R74A 1KQWA 3PH5A 4IAXA 3VE2A 2CM9A 2NNDA 2Q9SA 3U9PC 4ALBA 4CSBA 2GTLN 4Y0SA 4ZR2A 5H9NA 1YP6A 1KT7A 3HWEA 3HWDA 3WOVA 1E02A 2MM3A 4ARHA 5HZ5A 1EUOA 4MVLA 2ACPX 4PSQA 1QQSA 2NNQA 1EIOA 2OFRX 2F73A 3PECA 1SY0A 4O4UA 3P24A 2A0AA 4U9CA 2JU7A 5LKEA 2A2GA 1E06A 1E00A 3SAOA 1HQPA 1D3SA 1ERBA 1DC9A 2Q2PA 2XSTA 1A2DA 1S2PA 2YG2A 3QKGA 4HPBA 1XKIA 3OD9A 2YMSA 1MUPA 2W2BA 3P6FA 4I6SA 3OBLA 1QFTA 5LJEA 3PH6A 1T68X 2ALLX 4HPDA 3VG7A 1SXUA 3VG4A 1S7DA 4O9SA 3WXQA 5LJDA 1SXYA 5FQ6E 1DV9A 1U18A 2KD2A 4A1YA 3PPTA 4NNTA 1ZNLA 4O3YA 2OVDA 1BSYA 1KZXA 1DZKA 1EI5A 2N93A 2QO4A 3F9DA 4QRLA 3U0DA 3TF6A 2ASNX 5LJBA 4LKPA 1HMTA 1DFVA 4MISA 4MVIA 1B56A 3FENA 2RA6A 3FR5A 3DTQA 2JN3A 2RN4A 1IFCA 1ZNDA 3OJYC 3FW5A 4I3DA 3BRNA 4CV7A 4L1NA 3ZUOA 5KICA 3I17A 3L4RA 3ZW0A 2W2FA 1ZNHA 2AT0X 4LZUA 3ZZVA 4XMEA 2GC9A 2QMIA 1JBHA 4YCHA 1VPRA 3BU9A 5HCDC 1BJ7A 4O4XA 2CBRA 3K3LA 4I9RA 2ACOA 4ON1A 1GGLA 3FMZA 5F6BA 3FA8A 4KIIA 4WHIA 5L8OA 4GRJA 4I95A 5HA0A 2O62A 1GT5A 4GNWA 1YWBA 4ALOA 5H9AA 3FEPA 1T8VA 5HZ9A 2GJ5A 1JYJA 1NGLA 3HTYA 1YIVA 4ZHHA 1EXSA 1KGLA 1NP1A 2W2AA 4KT5A 2R56A 1KT3A 5EDCA 5FQ8E 1GKAA 1LIDA 1AB0A 1IFBA 1KT4A 5LJHA 2R73A 2L5PA 5HTDA 4YDBA 3S26A 2CZUA 1OBPA 2X8SA 3D96A 1DZJA 4EDEA 4YFQA 1SY2A 3O22A 3LHNA 3CMPA 1CJ5A 2AL0X 1LIFA 2G7BA 4Y0QA 1VYGA 3EM0A 1MX7A 3I0AA 4IB8A 4NLIA 2Q39A 4GETA 3AKNA 3ELXA 4O3WA 4UU3A 3TGCA 4D6BA 1G74A 4ZHDA 2HNXA 3FIQA 2KTSA 4GKCA 4AZRA 3BDRA 1KQXA 1EQDA 1KXOA 1PBOA 1GX8A 5HWZA 2Q2MA 5B27A 4NLJA 2WUTA 4COTA 1PEEA 4GDZA 5C0NA 1ALBA 4ORUA 5HA1A 3STMX 3RSWA 4INNA 1BRQA 1ICNA 1O1UA 2WSJA 2OVSA 2L68A 3NBXX 1OEEA 1XCAA 3WJFA 3IFBA 5FAZA 4ZH9A 2FTBA 3JQOA 1LPJA 4QZUA 3NP1A 4GE1A 1BLRA 3UEXA 4N7DA 2FLJA 3P6EA 3CQNA 4MVEA 4GZVA 4YKMA 3S5XA 4PJ2A 2KW1A 1TXLA 3C76X 1OBUA 3CR6A 3HOLA 3EBKA 4M6SA 5H9KA 1ERXA 2AT8X 3KFGA 4ZH6A 2AH7X 2G79A 1RBPA 1FE3A 3JS1A 1SY1A 1EW3A 1GKAB 4QZTA 3MBTA 1YP7A 5CE4A 4U3QA 4TKJA 2AKQA 4AW8A 2OZQA 1MDCA 5F1EA 4QGXA 2RQ0A 2JU8A 4O3ZA 3STKA 1EALA 3EBWA 3H3IA 1U17A 2RCTA 4UU2A 2LBVA 2WQ9A 4FQBB 5DPQA 3TGBA 2KT4B 3VG6A 3D95A 4O49A 1OEJA 4FBOA 1ZNGA 1SY3A 1U0XA 2ZAIA 1BM5A 4NYRA 4QQ1A 1MX8A 5D8JA 3FR4A 4ZCBA 5BYPA 2WR6A 3FR2A 4LQZA 1JV4A 4EXZA 5LKFA 1HBPA 2BT9A 1PM1X 2X46A 4ORWA 1O8VA 3LV4A 2RD7C 4ZHFA 3B2HA 4A60A 5F6ZA 1X8OA 2FS6A 1X8UA 1TOUA 2K23A 2HYSA 5EEEA 1G5WA 2X8FA 2MWHA 5D4AA 2AT5X 3CQRA 2G78A 2AT3X 3O2YA 4GU8A 4DQ4A 1YWCA 4OS8A 3P02A 3CBCA 3O19A 4YBUA 4EEJA 2M4LA 1UREA 4TLJA 3VG5A 1E5PA 5EEDA 2JMBA 3B2KA 1QABE 4D6AA 5BVSA 4ORRA 1I04A 5LJCA 4QYPA 1X8NA 3VG3A 2QM9A 1CBIA 3MVFA 1NP4A 4I9SA 4ORSA 5H9LA 4HPAA 5K06A 4CK4A 3CWKA 3WJCA 2GTFX 3BS2A 2DM5A 1X89A 1VYFA 3C77X 2OVEA 4OMWA 3FW4A 3WVMA 3CBSA 1RLBE 1JJXA 1AVGI 4ORYA 3WJGA 4IBAA 2CBSA 3KFIA 1ACDA 2AT6X 1BWYA 1ML7A 1FDQA 3RBYA 3AKMA 1CBRA 1I06A 1BEBA 5D48A 1YWDA 1N0SA 2WQAE 4OS3A 3SOTA 4ID2A 4YGGA 3RWXA 5FFHA 4NW4A 1LIEA 3APWA 4LZVA 4KCAA 4FGIB 1TVQA 2WEXA 4IABA 1B8EA 4ML7B 1OEKA 2E4JA 3S60A 4A8ZA 1AQBA 1A3YA 3KFHA 4LKTA 4XMHA 2JW1A 4FBVA 2FRSA 3IA8A 2CM4A 2WEWA 4TNNA 2HZRA 4YFPA 3T1DA 3TGAA 1CBQA 1DZPA 4IMOA 5IO6A 3P6HA 1AELA 4QYNA 5D47A 3NX2A 1DF3A 3ZWEA 1ICMA 4K19A 5BVTA 1ZRYA 4L3RA 1SMPI 2GTLM 1JZUA 2LKKA 3V8UA 1ZNKA 5JR8A 1GT3A 4IB9A 1X8PA 5HCEC 2BS6A 3ZW0B 2L9CA 5IO7A 1T0VA 3HOEA 1KT5A 5HTEA 1CBSA 3PQSA 2X8TA 3NQ9A 4TKHA 2LA7A 1FTPA 4N7CA 5BVQA 4YGHA 4IB6A 3KQ0A 3NQKA 2LFOA 1OBQA 3NQ3A 4Y0PA 4MIRA 3D97A 4AZNA 2QO6A 3ZW2A 2KTDA 3D4RA 4EQAC 3BLGA 4O4SA 2WWPA 1CRBA 2Q4NA 3E3CA 3G7XA 1FEMA 1BBPA 2A2UA 2HZQA 4GNYA 1TW4A 1PMPA 2Z4IA 1BSOA 3RKGA 3ZUIA 4ZJ0A 1HMSA 4BVMA 1EPAA 3GAQA 1LNMA 2BLGA 2MHDA 3ZQ3A 2FR2A 2AMMX 2HLVA 4WFUA 1IW2A 1YUPA 3NADA 3UEVA 4ZHCA 4R0BA 1IKJA 5EZ2A 1KT6A 2EU7X 2CZTA 2FWVA 1G7NA 2LBAA 4YKOA 1H91A 4QGVA 1TOWA 1G85A 3S5VA 4U8UO 4HWMA 1Y9TA 4OS0A 1KZWA 3HWFA 4JGLA 5AJCA 5AQ6A 1LFOA 3HK1A 3TZSA 1GXAA 4A1HA 5L8IA 4AZPA 5LJKA 3P6DA 1B4MA 1QFVA 2FR3A 1BSQA 4YFRA 2F09A 1JYDA 1LICA 3APXA 4M7MA 4QAEA 5AJBA 5AEOA 3ZW1A 1Y9LA 1X8QA 3BX7A 4XMGA 2FT9A 2ANSA 4QGWA 3NR3A 1I4UA 4MVKA 4XMCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P8G A;  2A13 A;  4ODD A;  2POA A;  5L8N A;  4EFG A;  3B2L A;  1SXX A;  5B29 A;  5HZQ A;  3UEU A;  4ZGU A;  1QY1 A;  1QY2 A;  3JSQ A;  5KID A;  1IIU A;  3KFF A;  3BSZ E;  3F8A A;  1SXW A;  5HZ6 A;  2IFB A;  2K62 A;  3FA6 A;  1LIB A;  1HN2 A;  4BOE A;  1GX9 A;  4ZFX A;  1D2U A;  5H8T A;  4YCE A;  3APV A;  1HMR A;  4I3B A;  4RUN A;  3FEL A;  3WJB A;  2QO5 A;  1GM6 A;  3BY0 A;  3FA7 A;  4ZHG A;  5EPQ A;  3B2J A;  4IB7 A;  2A3F X;  1ADL A;  4XMF A;  3C78 X;  4WBK A;  4NNS A;  1R0U A;  2NP1 A;  1GT4 A;  4Y0R A;  1JJJ A;  1YWA A;  4TJZ A;  1A18 A;  3RZY A;  1QG5 A;  5F7G A;  1LKE A;  1QY0 A;  2MJI A;  1EPB A;  3FEK A;  5DG4 A;  3ELZ A;  5HBS A;  3APU A;  4GH7 A;  3FA9 A;  5FEN A;  3BX8 A;  3FLL A;  2XKL A;  1O1V A;  1Z24 A;  3DSZ A;  1P6P A;  1ZNE A;  1B0O A;  4NYQ A;  4WFV A;  1EII A;  5HZ8 A;  4HFO A;  4YGZ A;  4XMD A;  4YMY A;  4IMN A;  1A57 A;  1OPB A;  3NX1 A;  3NPO A;  1OPA A;  1FEN A;  4BQU A;  1S44 A;  1FEL A;  5D45 A;  4YDA A;  1DZM A;  2OVA A;  2FS7 A;  3Q6L A;  2JU3 A;  5EDB A;  1UZ2 X;  2LB6 A;  4AYH A;  2OFM X;  3B2I A;  4YBP A;  4YH0 A;  3KZA A;  4AZO A;  5HAE A;  1KOI A;  3STN A;  5IO5 A;  3U03 A;  3HWG A;  4RUU A;  1LF7 A;  2NNE A;  1X71 A;  3EYC A;  3P6C A;  1I05 A;  4TQ2 A;  3PP6 A;  1QWD A;  1SA8 A;  1L6M A;  3WJE A;  3WBG A;  1IKE A;  2L67 A;  3PED A;  3P6G A;  4OMX A;  4IAW A;  5LJG A;  4HPC A;  2RCQ A;  3VG2 A;  2MO5 A;  4ES7 A;  1HBQ A;  2JOZ A;  2X45 A;  1MVG A;  2PY1 A;  5KHP A;  4AZQ A;  3EMM A;  3UEW A;  4DQ3 A;  1BRP A;  2HMB A;  4ORX A;  3WJD A;  5HCC C;  2QOS C;  5F58 A;  4AZM A;  4TKB A;  4I3C A;  1GT1 A;  3BU1 A;  4NP1 A;  2R74 A;  1KQW A;  3PH5 A;  4IAX A;  2Q9S A;  2NND A;  2CM9 A;  3U9P C;  4ALB A;  4Y0S A;  4ZR2 A;  5H9N A;  1YP6 A;  1KT7 A;  3HWE A;  3HWD A;  1E02 A;  2MM3 A;  4ARH A;  5HZ5 A;  1EUO A;  4MVL A;  2ACP X;  4PSQ A;  1QQS A;  2NNQ A;  1EIO A;  2OFR X;  2F73 A;  3PEC A;  1SY0 A;  2A0A A;  2JU7 A;  5LKE A;  2A2G A;  1E06 A;  1E00 A;  3SAO A;  1HQP A;  1D3S A;  1ERB A;  1DC9 A;  2Q2P A;  2XST A;  1A2D A;  1S2P A;  2YG2 A;  3QKG A;  4HPB A;  1XKI A;  1MUP A;  2W2B A;  3P6F A;  5LJE A;  1QFT A;  3PH6 A;  1T68 X;  2ALL X;  4HPD A;  3VG7 A;  1SXU A;  3VG4 A;  1S7D A;  4O9S A;  3WXQ A;  5LJD A;  1SXY A;  1DV9 A;  1U18 A;  4A1Y A;  3PPT A;  4NNT A;  1ZNL A;  2OVD A;  1BSY A;  1KZX A;  1DZK A;  2N93 A;  2QO4 A;  3F9D A;  3U0D A;  3TF6 A;  2ASN X;  5LJB A;  4LKP A;  1HMT A;  1DFV A;  4MVI A;  1B56 A;  3FEN A;  2RA6 A;  3FR5 A;  3DTQ A;  2JN3 A;  1IFC A;  1ZND A;  3OJY C;  3FW5 A;  4I3D A;  3BRN A;  3ZUO A;  5KIC A;  3I17 A;  3L4R A;  2W2F A;  1ZNH A;  2AT0 X;  4LZU A;  4XME A;  2GC9 A;  1JBH A;  4YCH A;  1VPR A;  3BU9 A;  5HCD C;  1BJ7 A;  2CBR A;  3K3L A;  4I9R A;  2ACO A;  1GGL A;  3FMZ A;  5F6B A;  3FA8 A;  4KII A;  5L8O A;  4GRJ A;  5HA0 A;  2O62 A;  1GT5 A;  4GNW A;  1YWB A;  4ALO A;  5H9A A;  3FEP A;  1T8V A;  5HZ9 A;  2GJ5 A;  1JYJ A;  1NGL A;  1YIV A;  4ZHH A;  1EXS A;  1KGL A;  1NP1 A;  2W2A A;  2R56 A;  1KT3 A;  5EDC A;  1GKA A;  1LID A;  1AB0 A;  1IFB A;  1KT4 A;  5LJH A;  2R73 A;  2L5P A;  5HTD A;  4YDB A;  3S26 A;  2CZU A;  1OBP A;  3D96 A;  1DZJ A;  4EDE A;  4YFQ A;  1SY2 A;  3O22 A;  3CMP A;  1CJ5 A;  2AL0 X;  1LIF A;  2G7B A;  4Y0Q A;  1VYG A;  3EM0 A;  1MX7 A;  3I0A A;  4IB8 A;  4NLI A;  2Q39 A;  4GET A;  3AKN A;  3ELX A;  4UU3 A;  3TGC A;  4D6B A;  1G74 A;  4ZHD A;  2HNX A;  3FIQ A;  4GKC A;  4AZR A;  3BDR A;  1KQX A;  1EQD A;  1KXO A;  1PBO A;  1GX8 A;  5HWZ A;  2Q2M A;  5B27 A;  4NLJ A;  2WUT A;  1PEE A;  5C0N A;  1ALB A;  4ORU A;  5HA1 A;  3STM X;  3RSW A;  1BRQ A;  1ICN A;  1O1U A;  2WSJ A;  2L68 A;  1OEE A;  1XCA A;  3WJF A;  3IFB A;  5FAZ A;  4ZH9 A;  2FTB A;  1LPJ A;  4QZU A;  3NP1 A;  4GE1 A;  1BLR A;  3UEX A;  4N7D A;  2FLJ A;  3P6E A;  3CQN A;  4YKM A;  1TXL A;  3C76 X;  1OBU A;  3CR6 A;  4ZH6 A;  3EBK A;  4M6S A;  5H9K A;  1ERX A;  2AT8 X;  3KFG A;  2AH7 X;  2G79 A;  1RBP A;  1FE3 A;  3JS1 A;  1SY1 A;  1EW3 A;  1GKA B;  4QZT A;  3MBT A;  1YP7 A;  5CE4 A;  4TKJ A;  2AKQ A;  4AW8 A;  2OZQ A;  1MDC A;  5F1E A;  4QGX A;  2RQ0 A;  2JU8 A;  3STK A;  1EAL A;  3EBW A;  1U17 A;  2RCT A;  4UU2 A;  2LBV A;  2WQ9 A;  5DPQ A;  3TGB A;  2KT4 B;  3VG6 A;  3D95 A;  1OEJ A;  1ZNG A;  1SY3 A;  1U0X A;  1BM5 A;  4NYR A;  1MX8 A;  5D8J A;  3FR4 A;  4ZCB A;  2WR6 A;  3FR2 A;  1JV4 A;  4EXZ A;  5LKF A;  1HBP A;  1PM1 X;  2X46 A;  4ORW A;  1O8V A;  2RD7 C;  4ZHF A;  3B2H A;  4A60 A;  5F6Z A;  1X8O A;  2FS6 A;  1X8U A;  1TOU A;  2K23 A;  2HYS A;  5EEE A;  1G5W A;  5D4A A;  2AT5 X;  3CQR A;  2G78 A;  2AT3 X;  3O2Y A;  4DQ4 A;  1YWC A;  4OS8 A;  3CBC A;  3O19 A;  4YBU A;  4EEJ A;  4TLJ A;  1URE A;  3VG5 A;  4D6A A;  1E5P A;  5EED A;  3B2K A;  1QAB E;  5BVS A;  4ORR A;  1I04 A;  5LJC A;  4QYP A;  1X8N A;  3VG3 A;  2QM9 A;  1CBI A;  3MVF A;  1NP4 A;  4I9S A;  4ORS A;  5H9L A;  4HPA A;  5K06 A;  4CK4 A;  3CWK A;  3WJC A;  2GTF X;  3BS2 A;  2DM5 A;  1X89 A;  1VYF A;  3C77 X;  2OVE A;  4OMW A;  3FW4 A;  3WVM A;  3CBS A;  1RLB E;  1JJX A;  1AVG I;  4ORY A;  3WJG A;  4IBA A;  2CBS A;  3KFI A;  1ACD A;  2AT6 X;  1BWY A;  1ML7 A;  1FDQ A;  3AKM A;  1CBR A;  1I06 A;  1BEB A;  5D48 A;  1YWD A;  1N0S A;  2WQA E;  4OS3 A;  4YGG A;  5FFH A;  1LIE A;  3APW A;  4LZV A;  1TVQ A;  2WEX A;  1B8E A;  1OEK A;  2E4J A;  4A8Z A;  1AQB A;  1A3Y A;  3KFH A;  4LKT A;  4XMH A;  2FRS A;  3IA8 A;  2CM4 A;  2WEW A;  4TNN A;  2HZR A;  4YFP A;  3T1D A;  3TGA A;  1CBQ A;  1DZP A;  4IMO A;  5IO6 A;  3P6H A;  1AEL A;  4QYN A;  5D47 A;  3NX2 A;  1DF3 A;  1ICM A;  4K19 A;  5BVT A;  1ZRY A;  1JZU A;  2LKK A;  5JR8 A;  1ZNK A;  1GT3 A;  4IB9 A;  1X8P A;  5HCE C;  2L9C A;  5IO7 A;  1T0V A;  1KT5 A;  5HTE A;  1CBS A;  3NQ9 A;  4TKH A;  1FTP A;  4N7C A;  5BVQ A;  4YGH A;  4IB6 A;  3KQ0 A;  2LFO A;  1OBQ A;  3NQ3 A;  4Y0P A;  3D97 A;  4AZN A;  2QO6 A;  2KTD A;  3BLG A;  2WWP A;  1CRB A;  2Q4N A;  3G7X A;  1FEM A;  1BBP A;  2A2U A;  2HZQ A;  4GNY A;  1TW4 A;  1PMP A;  3ZUI A;  1BSO A;  4ZJ0 A;  1HMS A;  4BVM A;  1EPA A;  3GAQ A;  1LNM A;  2BLG A;  3ZQ3 A;  2FR2 A;  2AMM X;  2HLV A;  4WFU A;  1IW2 A;  1YUP A;  3NAD A;  3UEV A;  4ZHC A;  4R0B A;  1IKJ A;  5EZ2 A;  1KT6 A;  2EU7 X;  2CZT A;  2FWV A;  1G7N A;  2LBA A;  4YKO A;  1H91 A;  4QGV A;  1TOW A;  1G85 A;  4OS0 A;  1KZW A;  3HWF A;  5AQ6 A;  1LFO A;  3HK1 A;  3TZS A;  1GXA A;  4A1H A;  5L8I A;  4AZP A;  5LJK A;  3P6D A;  1B4M A;  1QFV A;  2FR3 A;  1BSQ A;  4YFR A;  1JYD A;  1LIC A;  3APX A;  4M7M A;  4QAE A;  1X8Q A;  3BX7 A;  4XMG A;  2FT9 A;  2ANS A;  4QGW A;  3NR3 A;  1I4U A;  4MVK A;  4XMC A; 
#chains in the Genus database with same CATH topology
 2P8G A;  1VWR B;  2A13 A;  4ODD A;  4BX5 B;  4CPI A;  2POA A;  5L8N A;  3GE2 A;  4CDF A;  3B2L A;  4EFG A;  2RTM A;  1SXX A;  5B29 A;  4I60 A;  5HZQ A;  4GK9 A;  2CAM A;  3UEU A;  4ZGU A;  1QY1 A;  1QY2 A;  3JSQ A;  5KID A;  1IIU A;  3HPE A;  3KFF A;  1OSP O;  1Y53 X;  1SXW A;  3BSZ E;  3F8A A;  4Z28 A;  2IFB A;  2OY7 A;  5HZ6 A;  3X00 A;  2K62 A;  3FA6 A;  4EKV A;  1LIB A;  4U8U M;  2X4M A;  1HN2 A;  4BOE A;  1GX9 A;  3N91 A;  4ZFX A;  1D2U A;  4O3X B;  5H8T A;  4YCE A;  3APV A;  5IRU A;  1HMR A;  4I3B A;  1LDO A;  3FYF A;  4RUN A;  1JJU A;  3FEL A;  2ZAG A;  3OE3 A;  3PQU A;  2QO5 A;  1GM6 A;  3WJB A;  3LTW A;  2RTR B;  3BY0 A;  3FA7 A;  1VWK B;  2OFB A;  1RAV A;  4JHQ A;  4ZHG A;  1PBY A;  2BS5 A;  5EPQ A;  3B2J A;  1HXZ A;  2A3F X;  4IB7 A;  3VE1 A;  2OL8 O;  1ADL A;  1SWE A;  1VWD B;  2GTL O;  4XMF A;  1RXK A;  3C78 X;  4JO6 A;  4WBK A;  1NQM A;  4NNS A;  1R0U A;  2NP1 A;  1GT4 A;  2IZG B;  4Y0R A;  1YWA A;  1JJJ A;  1VWP B;  2RTA A;  4TJZ A;  1A18 A;  4CPH B;  3RZY A;  1QG5 A;  5F7G A;  5LJE A;  2OY8 A;  1LKE A;  1QY0 A;  2MJI A;  1EPB A;  3FEK A;  5DG4 A;  4KH8 A;  3ELZ A;  5HBS A;  3APU A;  4GH7 A;  2C1S A;  3FA9 A;  3BX8 A;  3FLL A;  5FEN A;  1KL3 A;  2XKL A;  1SLG B;  1O1V A;  1SWH A;  4KC8 A;  1Z24 A;  4QNI A;  3DSZ A;  3F6Z B;  1P6P A;  1ZNE A;  1B0O A;  4NYQ A;  1RSU B;  4WFV A;  3RDQ A;  1SLD B;  3ZW1 B;  1STR B;  2VFB A;  1JMX A;  4HFO A;  5HZ8 A;  1EII A;  4YGZ A;  5B11 O;  4XMD A;  2UZ2 A;  4U8U N;  4YMY A;  1SWA A;  4IMN A;  1MEP A;  1STP A;  1A57 A;  1OPB A;  3NX1 A;  3KVN A;  3NPO A;  1OPA A;  1FEN A;  5FQ7 E;  4BQU A;  1S44 A;  4FBR A;  1FEL A;  5D45 A;  4YDA A;  2OYB O;  3VU1 A;  1DZM A;  2OVA A;  2FS7 A;  2X56 A;  3RY1 A;  1SWP A;  3Q6L A;  2JU3 A;  2A5B A;  5EDB A;  1UZ2 X;  2LB6 A;  3VPJ E;  3AEH A;  4AYH A;  1SWG A;  2OFM X;  4C5P A;  3B2I A;  4YBP A;  4YH0 A;  3KZA A;  3RDX A;  1LCW A;  4AZO A;  5HAE A;  2AVI A;  1KOI A;  3STN A;  5IO5 A;  3U03 A;  1UYO X;  1AVE A;  1WUB A;  3HWG A;  3WYQ A;  4RUU A;  1E2T A;  1LF7 A;  2NNE A;  2RTL A;  1X71 A;  2Z4H A;  3EYC A;  3WYP A;  3P6C A;  1I05 A;  5CSE A;  3PP6 A;  3T2X A;  3ZI8 A;  5CYB A;  4TQ2 A;  1QWD A;  3WZN A;  1SA8 A;  1L6M A;  3WJE A;  2QCB A;  4O4O A;  3WBG A;  1IKE A;  2L67 A;  3PED A;  3PK2 A;  3MX7 A;  3P6G A;  4OMX A;  4IAW A;  4U46 A;  5B5G A;  5LJG A;  3UAQ A;  4HPC A;  2RCQ A;  4KC7 A;  3VG2 A;  3VHH A;  2MO5 A;  4MEE A;  4ES7 A;  1HBQ A;  5B3M O;  2JOZ A;  2X45 A;  1MOY A;  1MVG A;  2PY1 A;  5KHP A;  4GGR A;  2BHV A;  2OFA A;  4AZQ A;  3EMM A;  3UEW A;  4BGF A;  1BRP A;  2HMB A;  4ORX A;  3WJD A;  4DQ3 A;  4ZGF A;  5HCC C;  2QOS C;  5F58 A;  1LUQ A;  4AZM A;  1JIW I;  3SZH A;  4TKB A;  1LCZ A;  4I3C A;  1GT1 A;  3BU1 A;  4NP1 A;  1SRH A;  1NC9 A;  5IRA A;  2R74 A;  1KQW A;  3PH5 A;  4IAX A;  3VE2 A;  1Y55 X;  2CM9 A;  2NND A;  2Q9S A;  3U9P C;  4ALB A;  4CSB A;  3WZP A;  1STS B;  2GTL N;  4Y0S A;  4ZR2 A;  5H9N A;  1YP6 A;  1KT7 A;  3HWE A;  3HWD A;  5F2B A;  3WOV A;  1E02 A;  2MM3 A;  4ARH A;  2OL6 O;  5HZ5 A;  1EUO A;  4MVL A;  2ACP X;  2X55 A;  4PSQ A;  3SZJ A;  1QQS A;  2NNQ A;  1K3B A;  2OFR X;  1EIO A;  2F73 A;  3PEC A;  1SY0 A;  1SWF A;  4O4U A;  4OEL A;  3P24 A;  2A0A A;  1SWS A;  2Y3E A;  2IZL B;  1RXH A;  4NV8 A;  4U9C A;  2JU7 A;  5LKE A;  2A2G A;  1E06 A;  1E00 A;  3SAO A;  1HQP A;  2QOM A;  3EW2 A;  1D3S A;  1ERB A;  1DC9 A;  2Q2P A;  2XST A;  2RTO B;  1A2D A;  1S2P A;  2YG2 A;  3QKG A;  4Z2V A;  4HPB A;  1XKI A;  3OD9 A;  1W5R A;  4Z6J A;  2YMS A;  3MG5 A;  1MUP A;  2W2B A;  3P6F A;  5JD2 A;  3SLJ A;  4I6S A;  3OBL A;  1N43 A;  1QFT A;  1WBI A;  3PH6 A;  3RDS A;  4CDE A;  1T68 X;  2ALL X;  4HPD A;  3VG7 A;  1SXU A;  3VG4 A;  1S7D A;  1VWN B;  4O9S A;  5LJD A;  1SXY A;  3WXQ A;  4JNJ A;  5FQ6 E;  1DV9 A;  2RTB B;  1U18 A;  2KD2 A;  4A1Y A;  3PPT A;  4NNT A;  1ZNL A;  2IZK A;  4O3Y A;  2WPU A;  2OVD A;  1BSY A;  1N9M A;  1DZK A;  1EI5 A;  1N4J A;  2N93 A;  2QO4 A;  3F9D A;  4QRL A;  3U0D A;  1KZX A;  3TF6 A;  1HXL A;  2VDF A;  2ASN X;  5LJB A;  4LKP A;  1HMT A;  2Y32 A;  5L3Y A;  1DFV A;  4MIS A;  4MVI A;  1B56 A;  3FEN A;  1KL4 A;  2RA6 A;  3FR5 A;  3DTQ A;  2JN3 A;  2RN4 A;  1IFC A;  2X34 A;  1VWC B;  1ZND A;  3OJY C;  3FW5 A;  4I3D A;  3BRN A;  4CV7 A;  4L1N A;  3ZUO A;  5KIC A;  3I17 A;  3L4R A;  3ZW0 A;  2W2F A;  1ZNH A;  2AT0 X;  4LZU A;  3ZZV A;  5IXG A;  4XME A;  2GC9 A;  2QMI A;  2RTK A;  1JBH A;  4YCH A;  1VPR A;  3BU9 A;  5HCD C;  1BJ7 A;  4O4X A;  2CBR A;  1GX3 A;  3K3L A;  4GGT A;  4I9R A;  2ACO A;  3MM0 A;  4ON1 A;  1GGL A;  3FMZ A;  5F6B A;  3FA8 A;  4KII A;  4WHI A;  5B10 O;  5L8O A;  4GRJ A;  4I95 A;  5HA0 A;  1N9Y A;  2O62 A;  1N7Y A;  1GT5 A;  2OY1 O;  4GNW A;  1YWB A;  2DJG A;  4CDD A;  1W4T A;  5H9A A;  4ALO A;  4Y59 A;  3FEP A;  1T8V A;  5HZ9 A;  2GJ5 A;  1JYJ A;  1NGL A;  2IZH B;  2X32 A;  3HTY A;  1YIV A;  4ZHH A;  1EXS A;  1KGL A;  4CDC A;  1NP1 A;  2W2A A;  4KT5 A;  2R56 A;  1KT3 A;  5EDC A;  5FQ8 E;  1GKA A;  1KFF A;  1LID A;  1AB0 A;  1JQP A;  2I5V O;  1K24 A;  1SWJ A;  2AF5 A;  2IZF B;  1IFB A;  1KT4 A;  2RTC B;  5LJH A;  2R73 A;  2L5P A;  5HTD A;  4YDB A;  1VYO A;  3S26 A;  2CZU A;  2C4I A;  1OBP A;  2FHN X;  2X8S A;  3D96 A;  1SRI A;  2RTE B;  1DZJ A;  4EDE A;  4YFQ A;  1SY2 A;  3O22 A;  1SWQ A;  2RTD B;  3LHN A;  3CMP A;  3EC5 A;  1CJ5 A;  2AL0 X;  4Z27 A;  1LIF A;  2G7B A;  4Y0Q A;  1VYG A;  2FKG A;  3EM0 A;  1MX7 A;  3I0A A;  1SWC A;  4IB8 A;  4NLI A;  3T2W A;  2Q39 A;  4GET A;  3AKN A;  3ELX A;  4O3W A;  4UU3 A;  3TGC A;  2G5L A;  4D6B A;  1PTS A;  1G74 A;  3VGW A;  4ZHD A;  3PDF A;  1MM9 A;  1SWO A;  2HNX A;  3FIQ A;  2KTS A;  4GKC A;  4AZR A;  2RTP B;  3BDR A;  1KQX A;  1EQD A;  1KXO A;  1PBO A;  1GX8 A;  1VWM B;  1VWJ B;  5HWZ A;  2Q2M A;  5B27 A;  4NLJ A;  1I78 A;  2WUT A;  4COT A;  1PEE A;  5K68 A;  4GDZ A;  5C0N A;  2DJF A;  1ALB A;  4ORU A;  5HA1 A;  3STM X;  3RSW A;  2F01 A;  1BRQ A;  1ICN A;  4INN A;  1O1U A;  2WSJ A;  2OVS A;  2L68 A;  3NBX X;  1OEE A;  1XCA A;  3WJF A;  2C1Q A;  4BX7 A;  3IFB A;  5FAZ A;  4ZH9 A;  2FTB A;  4GGZ A;  1DF8 A;  3JQO A;  4GJV A;  1LPJ A;  4QZU A;  3NP1 A;  4GE1 A;  1BLR A;  3UEX A;  4N7D A;  2FLJ A;  3P6E A;  3CQN A;  4MVE A;  4BBO A;  4GZV A;  4YKM A;  4YVB A;  1KL5 A;  3S5X A;  4PJ2 A;  2KW1 A;  1TXL A;  3C76 X;  1VWH B;  1OBU A;  3CR6 A;  3HOL A;  3EBK A;  4M6S A;  5H9K A;  1ERX A;  2AT8 X;  3KFG A;  4ZH6 A;  2AH7 X;  2G79 A;  4Z2O A;  1RBP A;  1FE3 A;  3JS1 A;  1SY1 A;  1EW3 A;  1GKA B;  4QZT A;  3MBT A;  1YP7 A;  5CE4 A;  2PI3 O;  3FID A;  4TKJ A;  1VWQ B;  2AKQ A;  4U3Q A;  2OZQ A;  4AW8 A;  1MDC A;  5F1E A;  4QGX A;  2RQ0 A;  2RTJ A;  4BX6 A;  2JU8 A;  4BJ8 A;  4O3Z A;  1I9H A;  3STK A;  1EAL A;  3RDU A;  2A5C A;  3EBW A;  1U17 A;  2RCT A;  3H3I A;  4DCB A;  4UU2 A;  1VWL B;  1AVD A;  2LBV A;  2WQ9 A;  4FQB B;  5DPQ A;  3TGB A;  2KT4 B;  4NV7 A;  3VG6 A;  4CPH A;  3D95 A;  4O49 A;  1VWG B;  1OEJ A;  4FBO A;  1ZNG A;  1SY3 A;  1U0X A;  2GH7 A;  2ZAI A;  4GJS A;  4OEM A;  1BM5 A;  4NYR A;  1SLE B;  4QQ1 A;  1MX8 A;  5D8J A;  3FR4 A;  4ZCB A;  5BYP A;  2WR6 A;  3FR2 A;  4LQZ A;  1JV4 A;  4EXZ A;  5LKF A;  1HBP A;  2BT9 A;  4GDA A;  1PM1 X;  2X46 A;  1SLF B;  1JMZ A;  4ORW A;  1O8V A;  3LV4 A;  2RD7 C;  1VWI B;  4GUZ A;  4ZHF A;  3B2H A;  4A60 A;  5F6Z A;  1X8O A;  2FS6 A;  1X8U A;  2FHL A;  1LCV A;  1TOU A;  2K23 A;  2HYS A;  5EEE A;  4B55 A;  1G5W A;  2X8F A;  2MWH A;  5D4A A;  2AT5 X;  3CQR A;  2G78 A;  4CPE A;  2IZJ A;  2AT3 X;  3O2Y A;  1VWA B;  4GU8 A;  2OY5 O;  4DQ4 A;  1YWC A;  2JGS A;  4OS8 A;  3P02 A;  1NQN A;  3D9W A;  3CBC A;  3O19 A;  4YBU A;  4EEJ A;  2M4L A;  1URE A;  4TLJ A;  3VG5 A;  1E5P A;  5EED A;  2JMB A;  3B2K A;  1QAB E;  2IZD B;  4D6A A;  4BX7 B;  4Y5D A;  3CKG A;  2Y3F A;  5BVS A;  4ORR A;  1I04 A;  2UYW A;  2BSZ A;  5LJC A;  4QYP A;  1X8N A;  1SRF A;  3VG3 A;  2QM9 A;  1CBI A;  3MVF A;  1NP4 A;  4I9S A;  4ORS A;  5H9L A;  4HPA A;  5K06 A;  4CK4 A;  3CWK A;  3WJC A;  2GTF X;  3BS2 A;  2DM5 A;  1X89 A;  1VYF A;  3C77 X;  2OVE A;  4OMW A;  2MF6 A;  3FW4 A;  2ZSC A;  3EW1 A;  3WVM A;  3CBS A;  4IRW A;  1RLB E;  3WZQ A;  1JJX A;  1AVG I;  2RTN B;  3SLO A;  4ORY A;  3WJG A;  1VWF B;  4IBA A;  2CBS A;  3KFI A;  4GD9 A;  4BCS A;  1ACD A;  2AT6 X;  1BWY A;  1SWN A;  1ML7 A;  1FDQ A;  1HY2 A;  2RTQ B;  3RBY A;  3AKM A;  2OL7 A;  3T6L A;  4BX6 B;  1CBR A;  1I06 A;  1BEB A;  5D48 A;  3T6F A;  1YWD A;  1N0S A;  2WQA E;  4OS3 A;  3SOT A;  5IRW A;  4ID2 A;  4YGG A;  2VFC A;  1NBX A;  3RWX A;  5FFH A;  1RST B;  4NW4 A;  1LIE A;  3APW A;  5B5F A;  4LZV A;  1Y52 X;  2HKD A;  4FGI B;  4KCA A;  2RTI B;  1TVQ A;  2WEX A;  4IAB A;  1B8E A;  1SRG A;  1VWB B;  4ML7 B;  1OEK A;  2E4J A;  2IZC B;  3S60 A;  2OF8 A;  4A8Z A;  1AQB A;  1A3Y A;  3KFH A;  4LKT A;  4XMH A;  2JW1 A;  4FBV A;  2FRS A;  3IA8 A;  2IZI A;  2CM4 A;  2WEW A;  4TNN A;  2HZR A;  4YFP A;  3T1D A;  3TGA A;  1CBQ A;  3RY2 A;  3VHI A;  1DZP A;  5CHK A;  4IMO A;  5IO6 A;  3P6H A;  1SWD A;  1AEL A;  1SRE A;  3RDM A;  3QQ2 A;  2BC3 A;  4QYN A;  5D47 A;  3NX2 A;  1DF3 A;  3ZWE A;  1ICM A;  4K19 A;  5BVT A;  1ZRY A;  2RTG B;  4L3R A;  1SMP I;  2GTL M;  1IJ8 A;  5K67 A;  1JZU A;  2LKK A;  1HQQ A;  3V8U A;  1ZNK A;  5JR8 A;  1GT3 A;  4IB9 A;  1SWU A;  1X8P A;  5HCE C;  2BS6 A;  3ZW0 B;  4Z2P A;  2L9C A;  5IO7 A;  1T0V A;  3HOE A;  1KT5 A;  1SRJ A;  1VWE B;  5HTE A;  4BX5 A;  1CBS A;  3PQS A;  2FGS A;  2X8T A;  3NQ9 A;  4TKH A;  2LA7 A;  2IZE B;  1FTP A;  4N7C A;  5BVQ A;  3RDO A;  4YGH A;  4IB6 A;  3KQ0 A;  3NQK A;  3SZI A;  2IZB A;  2LFO A;  1OBQ A;  3NQ3 A;  4Y0P A;  4MIR A;  4DNE A;  3D97 A;  4AZN A;  3WZO A;  2QO6 A;  2A8G A;  3FDC A;  3ZW2 A;  2I5Z O;  1LDQ A;  2KTD A;  1SWK A;  3D4R A;  1UYN X;  4EQA C;  2RTH B;  3BLG A;  4O4S A;  2WWP A;  1CRB A;  2Q4N A;  3E3C A;  3G7X A;  3SLT A;  1FEM A;  1BBP A;  2A2U A;  3RE6 A;  2HZQ A;  1MK5 A;  4GNY A;  1TW4 A;  1PMP A;  2Z4I A;  1BSO A;  3RKG A;  3ZUI A;  4CPF A;  1HMS A;  4ZJ0 A;  4BVM A;  1EPA A;  3GAQ A;  1LNM A;  2BLG A;  2MHD A;  3ZQ3 A;  2FR2 A;  2IZA A;  2AMM X;  2HLV A;  4WFU A;  1IW2 A;  1YUP A;  3NAD A;  3CKF A;  3UEV A;  4ZHC A;  4R0B A;  1IKJ A;  1SWT A;  5EZ2 A;  1KT6 A;  1SWB A;  1W6F A;  2CZT A;  2EU7 X;  1NDJ A;  2FWV A;  1G7N A;  4OKA A;  2LBA A;  1SWR A;  4YKO A;  1H91 A;  4QGV A;  1TOW A;  1G85 A;  1RXJ A;  4U8U O;  3S5V A;  4HWM A;  1Y9T A;  4OS0 A;  2RTF B;  1KZW A;  2FKJ A;  3HWF A;  4JGL A;  3VHM A;  5AJC A;  5AQ6 A;  1LFO A;  3HK1 A;  3TZS A;  1GXA A;  1SWL A;  5L8I A;  4A1H A;  3RE5 A;  4AZP A;  1Y0G A;  5LJK A;  3P6D A;  1B4M A;  1QFV A;  1LEL A;  1VWO B;  1BSQ A;  2FR3 A;  2G8C O;  2F09 A;  2OF9 A;  4YFR A;  1JYD A;  1LIC A;  3APX A;  4M7M A;  4QAE A;  5AJB A;  3AUM O;  5B2A O;  5AEO A;  3ZW1 A;  1Y9L A;  1X8Q A;  3BX7 A;  4XMG A;  2FT9 A;  1FJ1 E;  2ANS A;  4QGW A;  3NR3 A;  3Q34 A;  1I4U A;  4MVK A;  4XMC A; 
#chains in the Genus database with same CATH homology
 2P8G A;  2A13 A;  4ODD A;  2POA A;  5L8N A;  3GE2 A;  4EFG A;  3B2L A;  1SXX A;  5B29 A;  5HZQ A;  4GK9 A;  3UEU A;  4ZGU A;  1QY1 A;  1QY2 A;  3JSQ A;  5KID A;  1IIU A;  3KFF A;  3BSZ E;  3F8A A;  1SXW A;  5HZ6 A;  2IFB A;  2K62 A;  3FA6 A;  1LIB A;  4U8U M;  1HN2 A;  4BOE A;  1GX9 A;  3N91 A;  4ZFX A;  1D2U A;  4O3X B;  5H8T A;  4YCE A;  3APV A;  1HMR A;  4I3B A;  3FYF A;  4RUN A;  3OE3 A;  3FEL A;  2ZAG A;  3PQU A;  3WJB A;  2QO5 A;  1GM6 A;  3BY0 A;  3FA7 A;  4ZHG A;  2BS5 A;  5EPQ A;  3B2J A;  4IB7 A;  2A3F X;  3VE1 A;  1ADL A;  2GTL O;  4XMF A;  3C78 X;  4WBK A;  4NNS A;  1R0U A;  2NP1 A;  1GT4 A;  4Y0R A;  1JJJ A;  1YWA A;  4TJZ A;  1A18 A;  3RZY A;  1QG5 A;  5F7G A;  1LKE A;  1QY0 A;  2MJI A;  1EPB A;  3FEK A;  5DG4 A;  4KH8 A;  3ELZ A;  5HBS A;  3APU A;  4GH7 A;  3FA9 A;  5FEN A;  3BX8 A;  3FLL A;  2XKL A;  1O1V A;  4KC8 A;  1Z24 A;  4QNI A;  3DSZ A;  3F6Z B;  1P6P A;  1ZNE A;  1B0O A;  4NYQ A;  4WFV A;  3ZW1 B;  1EII A;  5HZ8 A;  4HFO A;  4YGZ A;  4XMD A;  4U8U N;  4YMY A;  4IMN A;  1A57 A;  1OPB A;  3NX1 A;  3NPO A;  1OPA A;  1FEN A;  5FQ7 E;  4BQU A;  1S44 A;  4FBR A;  1FEL A;  5D45 A;  4YDA A;  3VU1 A;  1DZM A;  2OVA A;  2FS7 A;  3Q6L A;  2JU3 A;  5EDB A;  1UZ2 X;  2LB6 A;  3VPJ E;  4AYH A;  2OFM X;  3B2I A;  4YBP A;  4YH0 A;  3KZA A;  4AZO A;  5HAE A;  1KOI A;  3STN A;  5IO5 A;  3U03 A;  3HWG A;  4RUU A;  1LF7 A;  2NNE A;  2Z4H A;  1X71 A;  3EYC A;  3P6C A;  1I05 A;  3ZI8 A;  3PP6 A;  4TQ2 A;  5CYB A;  1QWD A;  1SA8 A;  1L6M A;  3WJE A;  4O4O A;  3WBG A;  1IKE A;  2L67 A;  3PED A;  3MX7 A;  3P6G A;  4OMX A;  4IAW A;  5LJG A;  3UAQ A;  4HPC A;  2RCQ A;  4KC7 A;  3VG2 A;  2MO5 A;  4ES7 A;  1HBQ A;  2JOZ A;  2X45 A;  1MVG A;  2PY1 A;  5KHP A;  2BHV A;  4AZQ A;  3EMM A;  3UEW A;  4DQ3 A;  1BRP A;  2HMB A;  4ORX A;  3WJD A;  4ZGF A;  5HCC C;  2QOS C;  5F58 A;  4AZM A;  1JIW I;  4TKB A;  4I3C A;  1GT1 A;  3BU1 A;  4NP1 A;  2R74 A;  1KQW A;  3PH5 A;  4IAX A;  3VE2 A;  2CM9 A;  2NND A;  2Q9S A;  3U9P C;  4ALB A;  4CSB A;  2GTL N;  4Y0S A;  4ZR2 A;  5H9N A;  1YP6 A;  1KT7 A;  3HWE A;  3HWD A;  3WOV A;  1E02 A;  2MM3 A;  4ARH A;  5HZ5 A;  1EUO A;  4MVL A;  2ACP X;  4PSQ A;  1QQS A;  2NNQ A;  1EIO A;  2OFR X;  2F73 A;  3PEC A;  1SY0 A;  4O4U A;  3P24 A;  2A0A A;  4U9C A;  2JU7 A;  5LKE A;  2A2G A;  1E06 A;  1E00 A;  3SAO A;  1HQP A;  1D3S A;  1ERB A;  1DC9 A;  2Q2P A;  2XST A;  1A2D A;  1S2P A;  2YG2 A;  3QKG A;  4HPB A;  1XKI A;  3OD9 A;  2YMS A;  1MUP A;  2W2B A;  3P6F A;  4I6S A;  3OBL A;  1QFT A;  5LJE A;  3PH6 A;  1T68 X;  2ALL X;  4HPD A;  3VG7 A;  1SXU A;  3VG4 A;  1S7D A;  4O9S A;  3WXQ A;  5LJD A;  1SXY A;  5FQ6 E;  1DV9 A;  1U18 A;  2KD2 A;  4A1Y A;  3PPT A;  4NNT A;  1ZNL A;  4O3Y A;  2OVD A;  1BSY A;  1KZX A;  1DZK A;  1EI5 A;  2N93 A;  2QO4 A;  3F9D A;  4QRL A;  3U0D A;  3TF6 A;  2ASN X;  5LJB A;  4LKP A;  1HMT A;  1DFV A;  4MIS A;  4MVI A;  1B56 A;  3FEN A;  2RA6 A;  3FR5 A;  3DTQ A;  2JN3 A;  2RN4 A;  1IFC A;  1ZND A;  3OJY C;  3FW5 A;  4I3D A;  3BRN A;  4CV7 A;  4L1N A;  3ZUO A;  5KIC A;  3I17 A;  3L4R A;  3ZW0 A;  2W2F A;  1ZNH A;  2AT0 X;  4LZU A;  3ZZV A;  4XME A;  2GC9 A;  2QMI A;  1JBH A;  4YCH A;  1VPR A;  3BU9 A;  5HCD C;  1BJ7 A;  4O4X A;  2CBR A;  3K3L A;  4I9R A;  2ACO A;  4ON1 A;  1GGL A;  3FMZ A;  5F6B A;  3FA8 A;  4KII A;  4WHI A;  5L8O A;  4GRJ A;  4I95 A;  5HA0 A;  2O62 A;  1GT5 A;  4GNW A;  1YWB A;  4ALO A;  5H9A A;  3FEP A;  1T8V A;  5HZ9 A;  2GJ5 A;  1JYJ A;  1NGL A;  3HTY A;  1YIV A;  4ZHH A;  1EXS A;  1KGL A;  1NP1 A;  2W2A A;  4KT5 A;  2R56 A;  1KT3 A;  5EDC A;  5FQ8 E;  1GKA A;  1LID A;  1AB0 A;  1IFB A;  1KT4 A;  5LJH A;  2R73 A;  2L5P A;  5HTD A;  4YDB A;  3S26 A;  2CZU A;  1OBP A;  2X8S A;  3D96 A;  1DZJ A;  4EDE A;  4YFQ A;  1SY2 A;  3O22 A;  3LHN A;  3CMP A;  1CJ5 A;  2AL0 X;  1LIF A;  2G7B A;  4Y0Q A;  1VYG A;  3EM0 A;  1MX7 A;  3I0A A;  4IB8 A;  4NLI A;  2Q39 A;  4GET A;  3AKN A;  3ELX A;  4O3W A;  4UU3 A;  3TGC A;  4D6B A;  1G74 A;  4ZHD A;  2HNX A;  3FIQ A;  2KTS A;  4GKC A;  4AZR A;  3BDR A;  1KQX A;  1EQD A;  1KXO A;  1PBO A;  1GX8 A;  5HWZ A;  2Q2M A;  5B27 A;  4NLJ A;  2WUT A;  4COT A;  1PEE A;  4GDZ A;  5C0N A;  1ALB A;  4ORU A;  5HA1 A;  3STM X;  3RSW A;  4INN A;  1BRQ A;  1ICN A;  1O1U A;  2WSJ A;  2OVS A;  2L68 A;  3NBX X;  1OEE A;  1XCA A;  3WJF A;  3IFB A;  5FAZ A;  4ZH9 A;  2FTB A;  3JQO A;  1LPJ A;  4QZU A;  3NP1 A;  4GE1 A;  1BLR A;  3UEX A;  4N7D A;  2FLJ A;  3P6E A;  3CQN A;  4MVE A;  4GZV A;  4YKM A;  3S5X A;  4PJ2 A;  2KW1 A;  1TXL A;  3C76 X;  1OBU A;  3CR6 A;  3HOL A;  3EBK A;  4M6S A;  5H9K A;  1ERX A;  2AT8 X;  3KFG A;  4ZH6 A;  2AH7 X;  2G79 A;  1RBP A;  1FE3 A;  3JS1 A;  1SY1 A;  1EW3 A;  1GKA B;  4QZT A;  3MBT A;  1YP7 A;  5CE4 A;  4U3Q A;  4TKJ A;  2AKQ A;  4AW8 A;  2OZQ A;  1MDC A;  5F1E A;  4QGX A;  2RQ0 A;  2JU8 A;  4O3Z A;  3STK A;  1EAL A;  3EBW A;  3H3I A;  1U17 A;  2RCT A;  4UU2 A;  2LBV A;  2WQ9 A;  4FQB B;  5DPQ A;  3TGB A;  2KT4 B;  3VG6 A;  3D95 A;  4O49 A;  1OEJ A;  4FBO A;  1ZNG A;  1SY3 A;  1U0X A;  2ZAI A;  1BM5 A;  4NYR A;  4QQ1 A;  1MX8 A;  5D8J A;  3FR4 A;  4ZCB A;  5BYP A;  2WR6 A;  3FR2 A;  4LQZ A;  1JV4 A;  4EXZ A;  5LKF A;  1HBP A;  2BT9 A;  1PM1 X;  2X46 A;  4ORW A;  1O8V A;  3LV4 A;  2RD7 C;  4ZHF A;  3B2H A;  4A60 A;  5F6Z A;  1X8O A;  2FS6 A;  1X8U A;  1TOU A;  2K23 A;  2HYS A;  5EEE A;  1G5W A;  2X8F A;  2MWH A;  5D4A A;  2AT5 X;  3CQR A;  2G78 A;  2AT3 X;  3O2Y A;  4GU8 A;  4DQ4 A;  1YWC A;  4OS8 A;  3P02 A;  3CBC A;  3O19 A;  4YBU A;  4EEJ A;  2M4L A;  1URE A;  4TLJ A;  3VG5 A;  1E5P A;  5EED A;  2JMB A;  3B2K A;  1QAB E;  4D6A A;  5BVS A;  4ORR A;  1I04 A;  5LJC A;  4QYP A;  1X8N A;  3VG3 A;  2QM9 A;  1CBI A;  3MVF A;  1NP4 A;  4I9S A;  4ORS A;  5H9L A;  4HPA A;  5K06 A;  4CK4 A;  3CWK A;  3WJC A;  2GTF X;  3BS2 A;  2DM5 A;  1X89 A;  1VYF A;  3C77 X;  2OVE A;  4OMW A;  3FW4 A;  3WVM A;  3CBS A;  1RLB E;  1JJX A;  1AVG I;  4ORY A;  3WJG A;  4IBA A;  2CBS A;  3KFI A;  1ACD A;  2AT6 X;  1BWY A;  1ML7 A;  1FDQ A;  3RBY A;  3AKM A;  1CBR A;  1I06 A;  1BEB A;  5D48 A;  1YWD A;  1N0S A;  2WQA E;  4OS3 A;  3SOT A;  4ID2 A;  4YGG A;  3RWX A;  5FFH A;  4NW4 A;  1LIE A;  3APW A;  4LZV A;  4KCA A;  4FGI B;  1TVQ A;  2WEX A;  4IAB A;  1B8E A;  4ML7 B;  1OEK A;  2E4J A;  3S60 A;  4A8Z A;  1AQB A;  1A3Y A;  3KFH A;  4LKT A;  4XMH A;  2JW1 A;  4FBV A;  2FRS A;  3IA8 A;  2CM4 A;  2WEW A;  4TNN A;  2HZR A;  4YFP A;  3T1D A;  3TGA A;  1CBQ A;  1DZP A;  4IMO A;  5IO6 A;  3P6H A;  1AEL A;  4QYN A;  5D47 A;  3NX2 A;  1DF3 A;  3ZWE A;  1ICM A;  4K19 A;  5BVT A;  1ZRY A;  4L3R A;  1SMP I;  2GTL M;  1JZU A;  2LKK A;  3V8U A;  1ZNK A;  5JR8 A;  1GT3 A;  4IB9 A;  1X8P A;  5HCE C;  2BS6 A;  3ZW0 B;  2L9C A;  5IO7 A;  1T0V A;  3HOE A;  1KT5 A;  5HTE A;  1CBS A;  3PQS A;  2X8T A;  3NQ9 A;  4TKH A;  2LA7 A;  1FTP A;  4N7C A;  5BVQ A;  4YGH A;  4IB6 A;  3KQ0 A;  3NQK A;  2LFO A;  1OBQ A;  3NQ3 A;  4Y0P A;  4MIR A;  3D97 A;  4AZN A;  2QO6 A;  3ZW2 A;  2KTD A;  3D4R A;  4EQA C;  3BLG A;  4O4S A;  2WWP A;  1CRB A;  2Q4N A;  3E3C A;  3G7X A;  1FEM A;  1BBP A;  2A2U A;  2HZQ A;  4GNY A;  1TW4 A;  1PMP A;  2Z4I A;  1BSO A;  3RKG A;  3ZUI A;  4ZJ0 A;  1HMS A;  4BVM A;  1EPA A;  3GAQ A;  1LNM A;  2BLG A;  2MHD A;  3ZQ3 A;  2FR2 A;  2AMM X;  2HLV A;  4WFU A;  1IW2 A;  1YUP A;  3NAD A;  3UEV A;  4ZHC A;  4R0B A;  1IKJ A;  5EZ2 A;  1KT6 A;  2EU7 X;  2CZT A;  2FWV A;  1G7N A;  2LBA A;  4YKO A;  1H91 A;  4QGV A;  1TOW A;  1G85 A;  3S5V A;  4U8U O;  4HWM A;  1Y9T A;  4OS0 A;  1KZW A;  3HWF A;  4JGL A;  5AJC A;  5AQ6 A;  1LFO A;  3HK1 A;  3TZS A;  1GXA A;  4A1H A;  5L8I A;  4AZP A;  5LJK A;  3P6D A;  1B4M A;  1QFV A;  2FR3 A;  1BSQ A;  4YFR A;  2F09 A;  1JYD A;  1LIC A;  3APX A;  4M7M A;  4QAE A;  5AJB A;  5AEO A;  3ZW1 A;  1Y9L A;  1X8Q A;  3BX7 A;  4XMG A;  2FT9 A;  2ANS A;  4QGW A;  3NR3 A;  1I4U A;  4MVK A;  4XMC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...