1YPZE

Immune receptor
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
207
structure length
207
Chain Sequence
GDQVEQSPSALSLHEGTDSALRCNFTTTMRSVQWFRQNSRGSLISLFYLASGTKENGRLKSAFDSKERRYSTLHIRDAQLEDSGTYFCAADTWHISEGYELGTDKLVFGQGTQVTVEPKSQPPAKPSVFIMKNGTNVACLVKDFYPKEVTISLRSSKKIVEFDPAIVISPSGKYSAVKLGQYGDSNSVTCSVQHNSETVHSTDFEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H2-T22 protein
publication title Structure of a gammadelta T cell receptor in complex with the nonclassical MHC T22.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 32
structure length 207
sequence length 207
chains with identical sequence G
ec nomenclature
pdb deposition date 2005-01-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ypzE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ypzE02
3BQUA 4Z7WA 3WL9A 4NPYB 2BJMH 3HN3A 5JXEC 2CMRL 1PY4A 2LABA 5KVGH 4HPOL 5HJ3B 1S9YA 5HSFA 1F4YL 4KRPB 1S9KC 2E7CA 2XWBA 4G8FA 3T4YA 1E4JA 4RCAA 1L0YA 5JOPE 5F72S 3TA3B 3WO4B 3DRTB 3O4LE 2HFEA 3ARVA 1I9RH 3KPSD 4PD4K 3RZCA 4I0KA 4OBRA 1HH9A 4YDLB 4Z7NE 3ULUF 1WWAX 4KTDL 1MAMH 3TFKC 1PBYA 1RVFH 5DJ6B 3ULSB 3VXRA 4NO2B 1KTLB 1RZFH 4WI3A 2DLFH 3RX7A 1SYVB 4XMKL 4OD2B 3UAJD 4B5EA 4Y5VA 3IKCA 4OIAA 4XVSL 1NAKL 3DX8A 2EYRB 3F7YB 2YZ8A 2EE9A 2WUCH 4JDTL 2HFTA 4QGTA 4N1HB 4FFZL 1S7VA 5GISL 1A7PH 3QNXA 4X4YB 3S3JA 1QEWA 2MTPA 3VFMA 4KJYB 1K5NA 3TIDB 4RZCA 1V7ML 1MJUH 1KTKE 4H88H 1DE4B 3SDAD 2XRAL 4X9HA 4K7PL 2WUBL 4XXDA 4MA7H 4UAOB 1F58L 4MXWL 2YKLH 4M5YL 5CSZA 4JDZA 4WW2F 4WI6A 4R7DA 5E2WL 2MQ0A 2V9QA 4M00A 3QDMA 5F7DA 4ZTPH 4XH2B 2WINA 2CUHA 3RWHA 1CDHA 3QUYC 5IKCA 1XIWA 3IFNH 3SDYH 4OGXH 2AI0L 2YRPA 4NDMB 1IM9B 4L4VB 1CYGA 4BH8B 1KCVL 1IAMA 1EEQA 5T3ZD 2YN5A 1U2HA 2C5DC 3BWAB 3OB8A 3O8XD 4IS6A 2CLVB 5F88A 2L7JA 3O4OB 1FVCA 4MCYA 1N3NA 3D6GA 4U7SA 4YHML 3BE1H 3RHWK 4HWUA 5D7JA 3GSUA 1RHHA 2FZ3A 1W8NA 2CK0L 1TDQA 3OPZL 3U1SH 1JNHB 2DIBA 1HKFA 1IQWL 4RRPA 2NY0D 4LHUA 5ACZA 4H26B 1EVUA 4OCSL 5IB1B 4PJFF 3IB4A 3UTTE 3PHOA 4FFYL 5DUML 5JOFB 5JIIA 3PWPB 2XZQH 1IL1A 5E6ZA 3DSFL 4GXVL 4K9EL 2HN7B 1HINH 1WUNT 5D6DC 3BKMH 4G8GA 5J7CC 3GSOA 3REWA 2V5YA 5IB2A 5JPMB 3L3OB 3S35H 3B9DA 1NSNH 2P5WA 2DYPB 5F9WB 4GS7C 2AK4A 3P0YL 4N90D 3H9SA 3RX5A 5A40E 2DQGL 2YPKB 3QHFH 5TH2B 4DJMA 5I0ZA 3QDAA 4XWGL 1G7PA 5GGRA 5CBEB 1G0XA 4FFWC 4G9FB 4QRRB 5CJOL 3SOBL 3NIGE 1REIA 4AQ1B 2ZUSA 5I1EH 1FLTX 3CFCL 1F6LL 1MWAB 2DRUA 1MCIA 2DQEL 2NY3B 1L0QA 2F53B 5C09E 2X89A 5F6HJ 3PIQB 1JWSA 1A7QH 35C8H 2ZUQC 3I3EA 3OXRB 2DQTH 4F8QA 2PN5A 3GBNL 3SKUD 3OKDB 4KMTH 4C56B 2KZ1B 4GW4B 2DKMA 1AKJB 3QEUB 3MR9B 1EMTH 3FT4B 1FC1A 2A9ML 1Y6KR 4OM0L 5LCVH 3RRQA 2QHRH 3D69B 5C08B 1P4LA 3WDIA 5HPMB 3AFLA 2J1KA 5GJTL 1HHHB 3JWOH 2QTEA 3L5JA 1DUZB 1KEGL 4K71B 4ODWB 1JI1A 4WO4D 4IMLB 4NWUH 1ZS8A 2HA1A 4MNGB 4ZQKA 2RCSH 3P3YA 3G5VA 2B7DT 4R9HA 1TJGL 3IDNB 5T1MB 5DDHB 4Z77B 4JN2B 3H9ZA 4QO1A 5C0FB 1E4KA 5F6IC 1OSPL 3CZJA 1HH6A 2AXFA 3BIAX 3ULVH 1F4XH 5TF1L 3QSKB 3BZDA 3RIAK 1GIGL 1GGYA 3OAZH 3TEUA 3ROOB 3DGCR 3VD7A 1C1EL 4QNPE 5ID0A 4Y19A 4KK6D 4NM4L 1I1YA 4PV8A 3VFTB 3BJLA 1CGSH 4QY8B 4KV5E 5J13B 15C8H 1FJ1A 3NAAL 4NBYB 2VUOA 3FHAA 4MD5A 3TO2A 1T1XB 1WQVT 2R23A 3MJGX 5M7QA 4X6DF 5EIQA 3CFDA 4AL8H 5DR5H 3FB8B 1VENA 2HRPL 4YHKH 2CO6B 5HY9B 4ONHA 3W11C 1OY3B 1AIFA 3OZ9H 5ALCL 5H35B 5EZOH 1UM6H 3SE4C 1D5XB 4FHBD 5ESQA 4DGYH 4NYLB 4P9ML 2BY0A 5FO9B 5B39A 1BVLB 3QAZB 2DLTA 4ZXBC 2HH0L 2ZCKH 4KK5D 2PO6B 2NQCA 1KIPA 5C0BE 3AXLB 1GC1L 2DQCH 3REVB 1SJEA 1Y18B 3QUKA 5TFSL 3ULUC 1V3MA 5DWUH 2E9WA 5TGBA 5I1KL 43C9B 5EU6A 3AUVA 3QJFB 1FLRH 3PP3K 4DZBB 1F8TL 3BSZL 1T21A 2HT4C 3D85B 4N0FA 4RBPH 1G7HA 1AE6L 4XCFL 3GHBH 1KPUA 2H6PA 3BGAA 3RNKB 1NGZA 3ZE0E 3OXSB 4LVHC 2YA0A 2PNDA 3O3AA 1UJ3A 2C4FT 4MZ2A 5GSRA 5I75B 2OXGA 4JKWA 1J8HB 3SE3C 3QPQD 3RI5K 3DVFA 4WFED 5EOQH 3SPVB 5GS0H 4LARH 4TNWK 3RVTD 3S4SB 5C6TH 3VXMA 3ZKXB 2EDHA 3VD9A 4MMXC 4HEPG 5TE6H 2X09A 4QRPA 3DX9A 4WW2C 1JRHH 1NGXA 5D2LE 4WWKB 1YDPB 3VXUE 3S36H 1K3IA 5C92A 4P2QB 4XAKD 4XVUC 3WUZA 4NQSB 2X10A 2LAGB 2P8MB 1OP3H 5I18L 1E0OB 5FYKH 5FEBA 4NRXA 1P5VA 2AJZB 1NL0L 5SWQA 1JF5A 4JKMA 4HBCH 2PR4L 2A74A 3HC4L 3MPCA 5B22A 3I9GH 2R0ZH 3RTQC 5GGVH 5SWSE 3GNML 1A7NH 3I6LE 2R8SL 1JE6A 1A1NB 3PWLA 3QQ9D 4LSUL 5I8EA 1OGAD 5HHNA 1PYWB 3LQAH 3CVHH 3QNZB 4L3ED 2FJHA 5HPOA 4GG8A 3TH2T 3LN4B 5IHUH 3TH3T 3RWEB 5T3XD 1BM3L 3VXNB 5FGSA 3GSXB 4BFGA 3JSSA 5MERB 3MUGA 4LOUD 4NZTH 2GFBA 3L3JA 1I8MB 1WITA 4JREB 3O2WL 1M7IA 5DRZB 2CKBB 1RZ8B 3JUYA 1CD1A 3K4DA 3TT3H 1Q9WA 5GRWA 3S4SG 5EO1A 1YY9C 3MRGB 1K6QL 4PRIE 1BZ9B 2IAND 2VZ3A 4KVNH 4EXPX 3MRBB 2R69H 1BP3B 3EYSH 5HJ3A 3FQXB 2PCPB 2E7MA 2ICEB 3O3EB 1JN6A 4NN7B 4XNMA 2H1PL 2JB5L 5B4MD 3BP6A 4Q2ZB 1YN6B 3RY5A 2PXYD 4ZS7L 2X4RB 2APFA 4G6FB 2X1PA 4NQDB 2Z4QA 1S7SB 4LQFL 2QADB 4PJHB 3CLFH 5DEGB 5DJ6A 1CXFA 3ULSA 5F7MC 4ZUSA 5KSAA 3SGKC 4X6CE 4NO2A 1KTLA 2VC2H 5EUOA 3R8QA 3FZUC 3WLBB 5IGXH 4QEGA 1XZ0A 4PJ5B 5K93A 2EYRA 1UWXK 1NUDA 2NZ9C 5HHXH 1OCWL 3VXQA 3VGHA 3W9DA 1W0WB 5E0QA 3UP1A 2CJUH 3LKSA 4XCCL 5DF0A 2F54D 4OF6A 4J3SA 3K8MA 4HC1H 2Z9TA 3WNMA 1YYLH 1UCBH 3CMOH 2VZVA 3VGAC 4G6KH 2DJ4A 1JPTH 4U6YA 5D93B 5KVFH 1QRND 1FNEB 2P42B 4FFVD 4Y5XA 3LSOB 4PJIF 4YDVB 5LAXB 4HGMA 4L3CB 4WTZG 3IVKA 1BIHA 5KZCD 3QQNA 3NFNB 3NZHH 3MLUL 4KH2A 4W4NA 4BQBA 4H8WC 3RUGB 1FPTH 5IEKB 5FM4A 5CZVH 4ZUUA 3CSBA 2YRLA 1D5BA 3MRLB 4Y2OA 1XGRA 3RWDA 5GGTH 4LCWE 4E9LA 4DUXA 2XYCA 4FTVD 1R3KB 1NCTA 4PGBB 3GMRB 4G5ZH 5BVJA 4JFEB 5C0JA 1UENA 3T2OA 5ILTL 4IRJC 2XNAB 5ISZD 3JTTA 1RZKC 3PGCB 4L8SA 3MBEC 1UB6B 4PGEB 1ORQB 4YEFA 5J11B 1A0QH 2BK8A 3KPRE 1LMKA 2F74A 4Y7MA 3WUWA 5BOZG 1J12A 3MLYL 4KHXH 4XXCA 2IG2H 3T77B 5MENB 3NA9H 3GO1L 4D9QE 1I3UA 1R5VA 2Z31A 3KLHC 5DRNA 3P77A 3DYMA 4GH7B 2X44D 5JO5B 3NACL 1GGIL 3UBXI 2VABB 4Z7WE 5K9OB 5KG9B 5E5MA 1I1AA 1S5IL 3BP7A 4LSQL 4KDTA 3T4AB 2HJLB 1EUUA 1C16A 4BJLA 5D9SB 3LEVH 3CD4A 5F9OL 3C6LB 4EUPB 3WKNA 4CDGC 1WFTA 3BKCL 4JY5L 4B0MM 4PR5B 1MY5A 4CMHB 3IJHA 3B4NA 5BS0B 2F15A 2FATL 1EBPA 3DVGA 5EIVA 4NQED 2KH2B 3VXRE 2VLRD 2VXUH 4KK9D 4Z76B 4K3DH 5CHNB 3GBMH 1ZT4A 4KDVA 3OXRA 1QBMH 5DEFA 3MROB 1EPFA 1IC5H 1MHPH 4HS8H 4C56A 4XPFH 1AKJA 1N59B 2CDGB 2XWTB 5DD6B 1JIBA 1NMCB 4J12A 5J1AB 1LK2B 4Z95H 3D69A 5EIIB 3HPLA 4RSVA 2LU7A 2ESVA 3P9LA 5EC1A 4L8CA 1MFBL 5FYLH 3TPUA 4ODWA 4NO0B 5D96C 5HHVL 4NN6C 1X44A 1QVOA 4OZFH 4TSAL 3FCTA 1ZT1B 2JE8A 4JPIB 1QA9A 3ZDYE 4JZJA 2EEAA 4KJQD 5JMRA 1L6ZA 5DSCA 3QDME 2WBJB 4S1RL 1ERNA 5FGCE 2NY1B 3QG7H 5BMFL 3BXNA 2P8LA 1J1XL 1KENH 3D3VE 3VFTA 2IF7A 2KBGA 5JORA 3OF6A 4KKBC 4N1EA 4OD1H 5DD5H 2JJWA 3ZE2F 2R29L 1FP5A 3Q6FB 1OF2B 3DROA 2W38A 1T1XA 2BNRB 2ZPKH 3QDJA 4QRTA 2B20A 3UTZA 3O6LL 1BAFL 5LGJB 3TJEH 4M6OL 1OPGH 3X12B 5IMLB 1O5DT 2VH5L 3GJFH 1NMBL 5H35A 4JRXB 1U92B 3MMEB 3ZKMD 4OLZL 2YA2A 4NYLA 3ARBC 3W2DL 1BVLA 3P0VH 1OAQL 1I7TB 1U8LB 1ZSDB 2CDEB 4PS4L 4QHUA 3B8YA 1INEL 2XQBL 5A43C 1N6QH 3W0WD 1RUQH 1RURL 3AXLA 5I1DB 3REVA 4G8GE 2A6IA 2JIXB 1QO3B 43C9A 1BHGA 4MNHB 4JQVC 4WU7B 4DZBA 4YXHH 2P5WE 2RQ8A 2DS4A 3D85A 3TBVA 1IGTB 4K2UH 5JXED 4FQIL 1QNZH 4JB9L 1HN1A 4Z7QE 1UH2A 3MCLL 4URTB 5GS1C 2E6QA 3BESR 3ZHLA 4D8PB 2AK4E 4R90H 1B9ZA 3H9SE 5C3TA 2DWDA 2E27H 1U8QA 5HI3C 2NW2A 4FQXA 4A6YL 1MNUH 4JRYB 3BP5A 5EBMA 4UTBH 3NZ8B 4OQ1A 5BZWB 2HJFB 5EA0H 1MLCB 3TFKD 1YNTA 1W72B 1JZ8A 5FKPB 2ORBL 4TRPL 3FFCB 3SY0B 4JM2C 5CUSL 4UIKH 5CD5C 4M8QB 4KI5F 3B43A 1IAIM 1NAMB 2ZKHH 2C4XA 3ES6B 4ZFGL 3HE7B 4NNXA 1YDPA 5FGBA 5FM5M 1NC4D 1XR9B 2VDOH 3ZE1F 1D9KA 2X4PA 4OCYL 1DQQA 3E6HA 1VFBA 3TC9A 1J05A 1C7SA 2J5LB 4A6YA 2R4RH 3NFSH 4PTUB 4LSPL 4V1DD 1H3TA 5FDYA 2VDKH 5EOCJ 1V3LA 1TVHB 2CKBL 3MRNA 3RL1A 3EFFA 5T33L 5JUEH 1B2WH 1PG7L 4MB3A 2D31B 4QRUB 3RZWA 1PYWA 3MNWB 1BLNB 3X11A 1U58A 2AERT 2WNGA 3QCVH 4V2CB 5JIPA 4L1HA 3FO0H 3THML 5KSVB 3VXNA 3GSXA 4QCIB 3QUYD 4Y19E 1EK3A 2B5IB 1FYTA 3S97C 3LQMA 1MHEB 4OUOA 1NCNA 4YHPA 5JA9A 3N06B 4NQTA 4HFWB 4C83A 3ZZ1A 4ZYKB 2E9BA 4ZUVB 4WFHD 4DW2H 2CKBA 1FGNH 4J23A 3T0EC 1P1ZB 4Y1AA 4YHIA 4ZSOB 4ZFFA 3WDHA 1JJUA 2B0SH 3FRUB 1IM3B 4HLZH 4F37K 5E8PA 5FKAB 4A2LA 4JG1H 1VEMA 2GJJA 3FQXA 4HGWA 2ICEA 5LBSH 5TPWH 3DECA 4E5XA 1NBYB 3C6SA 4Q2ZA 5JHDD 3E3QE 4AK1A 4BK4A 1SM3L 4PP2B 1U8OB 1EXUA 3PABB 1FFOB 1AXIB 1NEUA 4JFPA 4K07A 1WBYB 4PJHA 3FMGH 1JGLL 4M9OA 5EU6E 3MODH 2YHGA 4N9GB 3U36A 4XC3L 3HNVL 1NBQA 3EZJB 3ZL4L 4QXUH 4QHMA 4NKDB 1AC6A 3KNBB 3NPSB 2E9IA 1DQTA 3FQNA 2W9LA 3B3IA 4U1LB 1WEJH 2YD1A 5HGHA 5B21A 3MGOB 1LP9B 4MAUH 3K4AA 4FFWD 1R5WB 3I6KB 2A6JB 2CUMA 1OWWA 4N8VB 3W5MA 5HD8C 1L7TL 1HXMB 1HCVA 1CXHA 4M7KL 2HWZL 2AJYL 2W9EL 1B0WA 4XVTL 3VXME 2JF1A 1XGQB 3L5WB 4JFHE 2FX9H 2NY6B 3JV4B 3LEYL 3TBWA 4QRPE 1S9WB 3CSYB 3TVMB 1ED3A 1FNEA 3F12A 3HR5B 4L4TA 3LSOA 3QQ3B 4LHQB 4PRNB 5F1NB 3VRIB 1WBZB 5FUOL 4L3CA 1IGCL 1W0VA 1JPFA 5FO8A 3QDGD 1YQVH 4JFXA 2UWEA 3T8XB 5IWLA 5IR1A 1KG0A 4XCNA 1T83A 1LO3H 2E7HA 5CJBA 2Z91B 1D5ZA 1DDHA 5E9DA 2PTUA 1P7HL 5EH1A 5DC9B 4HSQA 1NMAL 5IFHH 5KN5B 4HUNB 5I1LB 4WVRA 5JR1L 1WTGT 5H37G 3PWUB 5JTWA 4UT6L 4LSRL 1G6RL 4O5LH 4Z7NF 1NEZB 1LO0L 1Z9MA 4NIKB 2FBJH 1IGIH 5F3BB 3L3DB 2X1QA 3L95B 1TVDA 5I71C 1ORQA 2DOCA 4JFYB 2DQDH 3SKMB 4F7MB 1MI5D 3OGOE 3LQZA 2Q86B 4M5ZL 3OX8B 3T77A 5MENA 4PJCB 2A6KB 3MV9B 1K8DB 3WN5A 2VN7A 1LK3L 1BQLL 4P9HH 4TVPD 3F6IA 4MJ6A 3X14B 4WEUD 5SX5K 5D7LB 1MRDH 4OQTH 1H5BB 2VABA 3QIUB 2J8UB 1WTLA 4O2CB 3W11D 1X5IA 4N1CA 3K74B 2BRRH 3IDIB 1Z5LB 5IMMB 1G6RA 3GMMA 4JY6A 2BDNH 4UILH 4GAFB 3ZDXE 5C0RH 4I2XB 4ZXBD 1CFNA 5FECB 4EUPA 2ZG1A 2XI9A 3HI6L 2MQ3A 2D03H 3ULUD 3V7MA 3DURB 2E8YA 3WNNA 3CVIH 4TNVK 1SYSA 3QXDA 2HT4D 3RGVC 3VDCA 1T4KA 4Z76A 5EUOE 4KI5C 4WW1B 2C3HA 3PHSA 5CHNA 5D1ZA 1FE8L 3TT1H 1BZ7B 3MV01 4EN3C 2YC1A 5L0QB 3V5DB 32C2B 3H42H 2NXYB 1FCCA 4WHYG 1OTUC 1B4JL 4N0CC 5E2TH 5IG7B 3NGBC 1A47A 4XNZB 1HYSC 3SJVA 2XKUA 3LZFL 3VMPA 5EIIA 3F6LA 1S78C 3U2SA 3B83A 5E08H 4NO0A 3N85L 1YUHA 4KJPC 4OZIA 4UQ3A 2OTWB 3V0WH 4WY7L 1E4XL 2NYYC 1PAMA 5E8DL 3DV6B 4WUKL 2WP3T 3KLAB 4JPIA 3BKYL 4JPWL 4E41D 3PQYA 3ILPA 4XVUD 3C2SA 5ICXB 5DC0A 2Y5TA 2OQJB 5F8RC 4PLKC 2V7HB 1DUYB 1WVZA 1XGPB 3KR3H 3U7WL 4Z5RB 3P4OB 1ZHBB 5HHOD 4YHOH 5A2LH 4MJID 4JLRB 3RTQD 3SQBA 4LIQL 3Q6FA 4YK4C 2BNRA 5FDWA 2F5AH 1NUGA 2VE6B 3NIGF 5IVNA 4D9RE 4U1KB 4P23C 4AM0B 3T04D 4U7MA 5IMLA 3L3GA 4K8RL 1WBXA 3PV6B 3PG2A 1U8NA 2V5TA 2YMXH 4JHWL 4JRXA 2NY5C 4OFDA 4GBXC 5TDNB 1R0AH 4FS0A 4MAYA 2VSDA 1OAXH 1CVRA 2PTTB 1TENA 2CDEA 1U8LA 4GMTH 4XPTL 4WRLA 2R2EB 1HKLL 1QFUL 4J4PC 4WHDA 5LGHL 4EQ2A 4B50A 3MA7A 4OLVL 4MD0B 4EI5C 4FABL 4ODXB 1BD2A 2XA8L 4HDIB 1XFPA 5GSVA 1YY9D 3MLSH 5CSGA 1X5ZA 3JZ7A 4RFNC 5D1XB 3G5XB 2R0KL 3LV3B 4M61B 4HKBA 3WNPA 1LO4H 3N1MC 1VFMA 3QG6A 4XX1G 2XXMB 5KBNC 1ZLVK 4UOW0 4I3RH 1ZWIB 3VH8B 3QQ4B 1P5UA 3AU1A 4XP1H 2D2OA 3NZ8A 3D5OF 1JGVL 1VFUA 1AQDB 4TOYH 2D4DA 1MCWM 4QNPF 1MLCA 4YIQA 5F7KC 2Y5EA 1DSFL 3LS4L 3RY6A 4Y4HB 1YYML 3FFCA 3UJJH 4KV5F 3FZUD 1U91B 5CZXC 4JO4L 5L2KD 3HE7A 2BERA 2NZ9D 3VD4A 3OKOB 1AXSB 4C56E 3OB0K 4HS6B 1KJ3H 4YAQB 3ZKSD 3BHBA 4GLRH 5EBWB 1VEOA 1D6EA 4CVZB 4X4XB 5E8EA 1H8NA 2EIDA 4X7TB 1RUMH 4R0LC 5C2UB 4HX1B 3BH8A 1FL6A 4I13B 3FOMB 1TVHA 2ESVE 3RVUC 1QR1B 1FH5H 4MJ5B 4XVJL 5FUCE 4HK0B 3T65A 3A6BH 4PB0H 2YSSA 4QRUA 4CGTA 4P46A 1K4DB 4HWBH 4D3CH 2NLJB 3CK0L 5F9JA 3Q5OA 1UG9A 4LLMA 3GEWB 4NCC2 3H3KA 1BIIA 4Y4KA 3VFVB 3ARPA 3DVNB 3D0VB 3RWCB 1FVEA 2FSEA 1TCMA 4IMKC 3VH8G 5H94B 4DK3A 3MRQB 1C8PA 1BEYH 1HCFX 4LHJB 4EI6B 4KZDH 4YXLL 4ZUVA 1KTRL 4PJGB 1YJDH 4OIBA 2NPLX 3QDJE 5T5FH 1WC7A 2P4AB 3UTSB 3V8OA 3ARFB 4IRJD 5GS2H 2HVKA 4P9HC 5T1LB 2I9TA 3QCTH 1HQRA 4MNQD 5JDSB 3MBED 5GRYA 4F9LA 4NRYA 3BPLB 5TQ0L 2RR3A 1WIOA 1FG9C 1A6WH 2VDML 5D2LF 4ONGL 3HMXH 3UYPA 4Q6YA 4G7YL 1Q9LA 5F7HA 1S5HB 5LQBH 4UDUA 3ZKQD 3FQTB 4LPCA 2AXJA 4HKXB 4JVUA 4M6AA 4YEEA 1GL4B 1WBYA 2V2XB 4TULL 3QBTB 4N9GA 1PQZA 1NFDB 2D0GA 5CFHA 1PEWA 3C5ZC 4HUMB 1KC5H 1YN7A 3BPOC 4DWHA 3VCLA 1FN4A 3V6BR 5DJ8A 4YGAB 3U0TA 2FJGB 4FN0A 1MRCL 2FJFA 1LP9A 4HJGA 1RZ7H 5J8OA 4R8WL 5SWZA 4K23L 3VWJA 5HBBA 1HXMA 3T2NL 2GITB 3MQIA 2OZ4L 1AGBA 3KPSB 3JV4A 3C8KB 4JO3H 3WSQL 1NDGB 2P7TA 4Z0XA 3VXSA 4DVBB 4Q9RH 4O51B 4KVCL 4HGKC 4JG0L 1U8JA 3X3GL 1V8HA 3MV7D 2AW2A 1YNKH 2I9LB 5JPNA 1U8MA 3D2UD 5AYUL 3MOBH 1Q1JL 5ANMB 4OZGB 4PJBB 2FX7L 3UDWA 3LKRB 2LTQC 5GJSH 3IYLW 5E00A 2EDQA 4AT6B 2CXKA 4TYUA 5KN5A 2WBKA 2OZ4A 1CFVL 2DJSA 4JN1L 4NHCH 4Q0XL 2BFVL 2GCYB 2PYFB 4WJ5B 3QFDA 4Q6IC 4QHKJ 1NEZA 3F5WA 1VEPA 5DJZA 1CTNA 3L3DA 4X6CF 2ZG2A 5DQDL 3L95A 4K7PX 1FNSL 5DMKA 2A77L 4LVNB 4HWEH 4KKBD 4RGNE 3ZHDA 4EOWH 1TMCB 2A6KA 2I60H 1FYTE 3HTLX 3AROA 1ACYH 3D39A 2YEZA 4WI5A 2BVPA 4Z7UA 1P4BL 1UC6A 5CJQL 4OKVA 5I1AB 4XBEL 4ZO7A 4IBLT 4XP4H 3WKMH 3WNLA 1M71A 5B8CA 1H5BA 4I18B 2VKWA 3DJ9A 3QIUA 4XC1L 3O8XB 1A9BA 2BVUA 3VG9C 5HGBA 1U8IA 4MA1C 3OG6B 1JYNA 2OR9L 4UV4L 2BVOA 4Y8DC 5AWNH 4AH2A 3OKKB 1KYOJ 3IF1A 3ARBD 3DO7B 3KXFD 4NC0B 2NY0B 3LS5H 2W65B 4ISVB 2GTZB 1IMHC 2IH1B 3NCJH 5ID1B 4PJHE 2C1OB 3KGRA 2B1AH 2IAMC 2Z92B 1T1ZA 1XGTB 3O6MH 4PRHD 4WW1A 1KJMB 3IU3A 4AEIH 4JFDD 5LJYH 32C2A 5H2BB 1AGCB 3O45B 1MEXL 3OKEB 5HI3D 3QULB 1CDIA 4DEPC 5J12C 3L3KB 5E6YA 4NBXB 4XNYL 4W68A 3OJDB 3QWRA 1KCLA 5DYOB 4CN4A 3MGTA 1CGXA 1AH1A 5GXBB 2C3GA 3O11B 2DI9A 4MDIB 5C0DA 1HILB 2WAHA 4M93C 4NC1E 5JW3H 1MCDA 3U6RA 4JM2D 5DJYB 3JVGC 3JTSB 1MCBA 5CD5D 1MCKA 3BH9B 5CIPA 1IEHA 4L4TE 4F2MB 4OD3H 4X7SH 4ODTL 1Z0MA 5BOPA 1RK0A 2CK2A 2IWGA 4Z7WF 3CFJB 2ZG3A 4LCUA 4HIEB 5DJAB 5KVGL 1FORH 2UWEE 2V7HA 4ELKB 3LKNA 1C5DB 3P4OA 3OKLA 5E1AB 4P49A 2BOBB 2ZZUT 1JRHI 4YDIH 4YE4H 2NXZC 5E9DE 3CXHJ 1CGWA 3TV3H 4MXQC 2Y7QA 1I9RL 2EDJA 2CRYA 4PY8I 1CL7I 1KB5B 3WHXB 1MCOH 1LEIA 1QUNA 1T3FB 2VQ1A 4PJDB 4QYOB 1R24A 3QO1B 1RVFL 1PZ5A 2P5EA 4O2EA 4WO4B 1YJDC 1P7KB 3VW3H 1RZFL 1LHZA 1JMXA 2DLFL 4PJXA 2OJEA 4HPOH 3CDCA 1F4YH 1RSFA 2EKSA 5MENE 1T6WA 3MJ9H 4U1GB 2R2EA 3QA3A 3I3BA 3MNVB 3T0ED 4BSVA 2FYYA 3TIEB 1A7PL 3B5GA 4HDIA 3FFDA 4KTDH 5F96H 2ZUXA 5HGDA 2DF3A 1WFUA 1FRGL 1MJUL 1E4WH 4H88L 5D1XA 3LV3A 4M61A 4U1SB 1WCBB 4AG4H 3ARQA 3P9WB 4MA7L 4BA8A 4RBPK 4NUJB 1AO7A 1GGCL 5E99H 3FT2B 2XICA 3QQ4A 4OLXH 5C0CA 3ZDYF 2XN9D 1CE6B 2C7UA 3X3FH 5FYJD 4ZTPL 3LN9A 3LPGA 4LNRB 4HUVA 5ESVA 1ES0A 4OB5H 4J2XA 3IFNL 3SDYL 4RAVA 5IB5A 1KBGH 2EE2A 3LEXB 2Q7YB 4Y4HA 2AEIT 4UV7H 3TO4A 1A2YB 1ZLUH 2VR4A 4IRZH 5EU5B 3GMOB 2XRAH 3BE1L 1U91A 4FXKA 5EZIH 4YNYB 3W9EB 3GI9L 1CGTA 1NPUA 4L9LA 1CFQB 1CD9B 1FV1A 4HS6A 2ZOLA 2EIZB 1N0LA 5EBWA 1QLRB 1WWWX 3FB7A 4QOKD 5F21B 4WEMB 3SJVE 4CVZA 2OL3H 3CFBB 1T1WA 5HD8D 1SMAA 2V6HA 3AS1A 4NO3B 5J0BA 3MOAL 1HEZB 3BZFB 1EHLL 4FQHA 2XZQL 3WNKA 1IFHL 1HINL 4HK0A 3G5ZB 2ADJB 2HLAA 3IJSB 4X8JA 5GRVK 3LDBB 4OZIE 3VJ6B 3V0VB 4G6AC 3KPPB 1NSNL 5EULV 4OZHB 4AIXA 4BZ2L 3PQYE 1UYWL 2EEDA 4OCSH 3VFVA 5K9JH 1G7QB 4PJEA 1RV6X 4Z7QF 3HS0A 4IOSD 3DSFH 4GXVH 1AHWB 5JHLH 4OLYH 4U1NA 3V8CA 1LNUB 2BSRA 4GW1B 1D5MB 1HWGB 3PWJA 4ODUA 4YXKH 2BNRE 4J3OC 4PJGA 4RMRA 4G42A 5I1EL 2HVJA 2VERN 3AS3A 4G43A 2X4SB 4JZOB 1B90A 5ERWB 3BD4A 5BV7B 2OK0H 4JPKH 1V05A 1M7DA 2G9HA 5JDSA 2BSSB 1OGAB 2BXZA 2LU4A 4JRXE 1J18A 1A7QL 35C8L 2DQTL 5D6CA 3QI9A 4L3EB 1RD6A 2LVCA 4KMTL 2CLRA 5T5NG 1BJ1J 4I4WB 3V6ZA 1EMTL 1WT5C 5LCVL 3UC0H 1F6AB 2QHRL 5DJ0B 4LKCB 4M02A 5K33A 1TZGL 1DZBA 3UBXB 1EHXA 3CFCH 3KPMB 4LIQE 1BD2E 4EQ3A 3JWOL 2NW3B 3V7AE 1IZJA 1CDCA 4P2RD 5F93C 2AKRB 1N6UA 4NWUL 4PJ9C 2RCSL 2CUIA 1MCHA 4HH9A 4HF5H 3PF2A 5ITFB 3RBGA 1YEHH 3ULVL 43CAB 1F4XL 4IIQC 5IESH 1GZQB 1Y6NR 2A9MH 4R6UA 1PEZA 1DLFL 1QRKA 5IROA 1P2CA 5F3HA 4XBPB 3FHQA 2WLYA 3DWTA 1CGSL 1FO0B 1YMMA 2VZSA 5MEPB 3RGVD 15C8L 2VZ1A 3FFCE 2PXYB 5J6HB 4KI5D 1KJ2H 4YR6B 3SGEH 4EN3D 5GGSB 4ODVH 3C8KA 3HE6C 4DZ8B 1HDMA 1RI8A 4LRIC 1NDGA 4AL8L 4NQXA 1OTUD 3CFEB 5KTEH 3VFUA 1WAAA 4YHKL 4N0CD 5TF1H 3BQUC 2KKQA 4LLDB 1ZHNA 1HYSD 2R9HC 5IB3B 1I9JL 1BBDH 1KN2H 3I02A 1UM6L 1EEZA 4W4OA 3T0AA 4APQA 1TETL 1S78D 2V5MA 4NM4H 3ALXA 4DGYL 3SDXA 2XT1B 5TE4L 4RQQB 1AC0A 4OZGA 5E95B 2ZCKL 3NAAH 4KJPD 5CMAA 4DGVH 1S7UB 3QRGH 2NYYD 4OTXH 1X5HA 3UBXG 2MJWA 3RZCC 2F54B 2OP4L 3PV7A 5A16A 1FLRL 3ZT5A 2PYFA 1J8KA 2F8XC 3P73A 3MRCA 1CXIA 3DHMA 4I5BB 4OSUH 4P5KB 3RNQA 1CIUA 2YPLD 5HGAA 2J8OA 5ALCH 4Z78A 2ATPA 1ODAA 3GHBL 4PLKD 3QEQD 5EFIB 1QRNB 1S7TA 4Y5VC 5FYJU 2H8PB 2EZ0C 5KZCB 1QSFD 2ICWB 1TCRB 5F7YC 5IMOB 3ARRA 2BNQA 4R97B 1MJ7L 5CSBA 1JYWA 4M7LT 2YBRB 5TFSH 5EOQL 5I1KH 3QUMB 5GS0L 3GZKA 1OW0A 3KLSA 4FXGB 2AXGA 1F8TH 1JYXA 2R1WA 5FOBA 2F58H 4FTVB 1H3WM 1FNFA 2IBGA 2K7PA 4Z7OE 4GBXD 5A2IH 3OKKA 4MD4A 5ISZB 3S36L 4G8IB 1A7OL 2W65A 5BQ7B 4J4PD 2VZOA 3WJJC 1Y6MR 4PY7B 3TNMB 5FYKL 1NC2A 2Q87A 4EI5D 1QQDB 4HBCL 3ARGA 4DTGL 5C71A 3S5LB 4F7EB 1KSRA 3FO1B 2R0ZL 2Z92A 5EO0B 3PNWB 5E94B 4IEFB 1A5FH 1KJMA 5GGVL 3RL2B 5CJXA 1A7NL 5DVNA 3V2AR 3M1BB 5D7JC 4ENED 4LBEB 5BXFB 3CC5A 3LQAL 4X0KB 3O45A 5KSBA 1RZIB 2Q76B 1RHFA 3CVHL 3QULA 2VXQH 1PLGH 3GMLB 5ABDE 4O00A 4MQXC 1PG7W 1TZIB 5I18H 1LP9E 3HZVB 4DN3H 3U82B 3FRPG 3SDCC 5SWZE 3IRPX 1KOAA 4KQ4H 5GGUB 4NQUA 3CZFB 1VADA 3MCKB 3V4UL 4MDIA 1HILA 1CLZH 5CWSA 4NZTL 5C0AA 4WCYH 1T0NB 3JTSA 2JCCA 5KOMC 4LSUH 1QP1A 5CZXD 2WWKO 4GXUN 3TT3L 4NQEB 4PGZA 3PDOA 5DHXB 3VXSE 2ID5A 4AY0A 5K9KB 2VLRB 2AJ3B 5JIHA 4KVNL 3RVVC 5D2NB 3CVHA 1BM3H 2YUVA 4JFFA 3RA7H 1G84A 5CILH 5E1AA 3RVUD 5JOPD 1RIHH 1BOGB 4YGVB 3ZDXF 2HRLA 3GM0A 3O4LD 4ZD3H 1V3KA 5INCB 1R3JB 4LGSB 1OVZA 1U2CA 4K9EC 3S5LG 2JB6B 1HHGA 1T3FA 4TVSa 3V5HB 4WO4A 4WWID 5CP7A 3LKOA 4YO0A 4PJ8A 1T1YA 3RP1A 1IE5A 5JW4Q 4OZ4A 5EUOF 3NABL 1IGYA 3QEHA 3TCLA 3QUZA 3GJFK 3EFDH 3QIBC 3D39E 3MV9E 4PP1C 4IOFC 4XWOC 1HQ4A 2ZSWB 3S96B 2CJUL 3EOAA 3SKNB 3TIEA 3IETB 1AP2B 4CU8A 1CDGA 2C9AA 5E8OB 3AB0B 1WCQA 1K4CB 2GJ6A 4OAWB 1YYLL 4G6MH 5C0IA 3S3PA 3CMOL 1WCBA 1XF3B 4G6KL 1KELH 1FNGB 5AEAA 2APXA 3OG4B 4U6XA 1JPTL 5KVFL 1E4KC 4NUJA 4I2XE 1OCWH 2EYSB 1ORSB 5J4MA 4EEEA 3NZHL 1CE6A 2A6DB 3KS0J 1FPTL 2KPNA 5CZVL 3A6OA 4XCCH 2NCMA 2DQIH 1VB9A 2IALB 2FCBA 4LPUA 2O5XL 3IDXH 3W0WB 5IVOA 3GHEL 4JKLA 3C5ZD 3KWWB 3EYFB 3E0GA 3WS3B 4YNYA 3KJ4C 4P57A 3G08A 1CFQA 2FR4A 2EIZA 5AAWA 3MLUH 1X5LA 4P3WA 1YEDB 4ZOAA 1RULH 1CN4A 3D87B 3GMPA 4KHXL 3NA9L 3JUZA 3G9VA 3B9KA 4N0UA 1UEYA 3GUTA 3CIQA 3E3QC 4Y89A 1QLFA 2AJVH 4ONFL 3SCMA 1TTGA 3VJ6A 5B3NA 3V0VA 4GKNA 3DUUB 4HKJA 2VLJA 1Q72L 4OZHA 3WD5L 2B8OT 5DVMA 2XKNA 1INQB 4JEGB 3IFLH 1NC4B 3WIFA 4KKCC 3HZKA 4QF1B 3ZKNC 5DJDA 1SBSL 2IBBA 1UJ3C 1KPRB 1MCLA 2V9TA 1SJXA 4GW1A 1C08A 4Y4FA 1MWAH 1MFCL 2UVEA 4LLVA 3FONB 1J0JA 4I9WE 4ELMA 3F7VA 4V1DB 2PW1A 3BGFC 1CD0A 4NKIL 5DVLA 3S88H 1GC1C 3DHJA 5ERWA 2P5EE 3DX7A 3BGMB 1HXYA 2W0KA 3BP4B 1S5IH 2VXUL 1OT1A 4K3DL 4PJXE 1A6TA 2BSSA 2H9GA 4ZPVB 1X4YA 5ESAB 3SE8H 1EGJL 4L3EA 4MWFB 1IC5L 4YDKL 3QO0B 4HS8L 4XPFL 4I4WA 1EO7A 2CRMA 2UVFA 3OGCB 4Z95L 1FHGA 4N5UA 5DJ0A 1Z6JT 2XWJB 4PREB 3I2CH 1YEJH 4WDIB 5FYLL 2MFNA 1N5AB 4NM8L 4JGUA 1UKTA 5DTFA 3RWGB 3RPKA 5J1TC 3MJ8A 4QTHA 1MIMH 4LLYB 3U4EA 1TLKA 5L7XH 1EGJA 4KUZH 5CEXA 2VITB 2HT2C 4UZGA 1A02N 4PJAB 3QG7L 4CVWA 4M6NH 1MCRA 1H9VA 2IAMD 5JW4R 5MEPA 1MFBH 4OD1L 1JK8B 5DD5L 5JHDB 2D7PA 4K55A 2FECL 5HHVH 4YR6A 4CW1A 4TSAH 2ZPKL 1HYRC 3R06B 3T1WA 4HG4J 3CFEA 1G7MB 4NRZA 5AYQA 4LKXA 1TQBC 3F7QA 4OZFA 1OPGL 1XCQB 2X05A 5BJTA 4LLDA 1XEDA 3NCFB 4GS7B 2H32B 3DV4A 5BMFH 1ZANL 3H3PH 4I0PA 2W07A 3VRJB 3P0VL 3UEZA 1XF4B 2AJUH 1N6QL 5C0BD 1GCFA 2DIJA 1RUQL 3MLTB 3WO4C 1WFOA 1H3PH 1S7UA 5IK3B 3TBSA 4B7IA 5L88H 2PUQT 1HSAA 3O6LH 1BAFH 3L6FA 2XXCB 3HRZB 4I5BA 2IH3A 3DBXA 4JJ5B 1B3JA 1FFNB 5KSAC 4JM4H 2A38A 3GIVB 4K2UL 5DK0B 1OB1B 3CH8A 1QNZL 1NMBH 2ZUQB 3MRHA 3BDYH 3G6JB 4HUUB 4OLZH 4R4NC 4D0DB 2MHAB 1M1SA 3W2DH 2H8PA 2E27L 1JWUA 4PS4H 2ICWA 5ENWB 2NXZD 1MNUL 1RURH 5IMOA 4EDWH 2J88H 3QDGB 5DJCB 4MXQD 4NHUB 3PL6A 2YBRA 2GYSA 3GKWL 4PJGE 5HDQL 2VAJA 3FO9A 1BF2A 1A6AB 4FXGA 1A4KB 1SVCP 4PGCB 4YBHA 4FQIH 3LRGA 4JB9H 4QXGH 3MCLH 4XNUL 5ETUA 1VKXA 4NZJA 2ZKHL 5F6IB 2MWCA 2R1YB 4UAOC 4HUXA 5ISZA 4GG6A 3VXUD 1BWMA 5I16B 4Y5XC 2VDOL 3AAZB 1EHAA 1E6JL 1J1PL 1AR1C 5BQ7A 1EIBA 5E4EB 3EO1A 4CVUA 5CKGA 4RIRA 1J0KA 2WIMA 1MI5B 2GK2A 2R4RL 4FQLL 4M6MH 5DD1H 1UVQB 3OMZA 3NFSL 5EC2B 4F7EA 2H26B 2ZCHL 4M62H 5KAQG 4HPYL 4TRPH 4L4JA 1U6AH 3LVEA 1S7RB 5SWSD 5JUEL 4UDTB 1B2WL 3I6LD 1BWWA 5E56A 2HJKB 1Q9KB 3GMQB 4X0KA 3GMLA 3O41B 1UQSA 1BJ1H 1U3HA 5HYQB 4L8SC 4C57C 4H0IA 1YECH 4HFUH 4ZXBB 4JDVA 3MV11 4M4PA 1YMME 2WWMC 3DUSB 4XXCC 2WMPA 3MV8D 2CKBH 2D0FA 1XCTB 2Z31C 3G04B 1T0NA 5ICZA 1PG7H 3KPSE 4DW2L 2BC4B 3ECBB 1FGNL 4N68A 4NN5C 2CR6A 4JFOB 3GSWA 4PRID 2AJ3A 3TYFB 4J8RB 1ZVSA 3HLAA 4BKLA 4JG1L 1I1AC 2ADIA 3UJIL 3ULVE 4JKPH 4X99A 4F7CA 4LVHB 1ZT7B 3MO1B 5LBSL 5TPWL 3SDXE 1O0VA 4OZGE 5ANME 3LAFA 4I48A 4Q58C 1QYGL 3MRFB 1LWRA 3C9NA 4K3EL 1R3JA 4I3SH 3EJZC 4G6AD 4GLRI 5GZOC 1X5YA 2Y36H 4L1DA 3MODL 1E28A 5KS9B 5EUKA 4PJHF 2V9RA 1JGEA 2G5BB 2N7AA 4RA0C 4WW2B 2P44B 4FQ1H 4QXUL 5IMKB 2OI9C 3SKJL 3WLWC 3PXHA 3QDHA 1JPSL 3RBSA 4CNIA 1SM3H 4MAUL 2AEQH 5AZ2H 5I17A 1DVFA 2BNQE 3S96A 4JZNB 4UMGA 4ZS6C 3IETA 2ITDB 1P9MA 5HHOB 2HFFB 4MJIB 1JHLH 1B0RB 1HWHB 3RTQB 3WYRA 4KI1A 4KMQA 3MXWL 4K71C 3P4MB 4OI8A 1TVBA 2PYEA 3ZL4H 3U4BH 5HVWA 2CH8A 5KSUA 2ARJA 1JGDA 5I30H 2X4QA 2HYMA 1I4FB 2I26N 4EIGB 3ORJA 2EYSA 1BQSA 1RPQA 1U93B 1S3KL 4JZJC 3VFNA 2A6DA 1AGFB 5DK2A 4D0CA 3DARA 1QPPA 3EKCA 2Y07H 3CCHB 1T03H 1UWGH 3EDKA 3SKOA 1LO3L 2UWEF 3KYNB 1OQXA 4LLQA 4PJ9D 4LCWD 3KWWA 1F02I 3EYFA 1QSVA 3WS3A 3I3DA 1NCCH 1UADC 5D7IA 5KSBE 5F8QC 4O5LL 3TBTA 5DRWA 2FBJL 1IGIL 2JK5A 4PTTA 1LO5B 2DQDL 4R4FH 2ITCB 5EPMA 2X9YA 5FYKE 3T0BA 4FZ8H 1TZHB 1EFXA 4D9QD 5C0AE 4JVPA 3QXAB 4U1JB 4NT6A 5IIEB 4RNRB 3HE6D 5DO2C 2JCCE 3NFPA 1RUAH 4U1HA 3SGDH 5JR1H 4MJ4A 4O58H 1JF6A 4PIRF 3O0RH 1A6VL 4LK4A 1W2KT 4P5MB 3BQUD 3IXTA 4BZYA 4V2BA 5ADOL 1T0MA 2R9HD 3JWDC 3DPBA 2BRRL 2X4NB 4WGWB 3VE0A 4F7TA 5T1KA 2O61B 5L2KB 2YR3A 4JFFE 1U9KA 3W39B 4EUPH 2BDNL 2EH8H 4FQXC 3H7BB 3I75B 5I75C 2D03L 4TUJA 3HZYB 5IF0B 3OR7B 1CCZA 2ADGA 4X5XB 4PJDE 1JP5A 1OGTB 2ZUWA 4GJTB 4Q97A 1HI6A 3O3DB 1H0DA 2WIIB 3VXRD 3VGAB 5I8OH 3HC0A 5FM8A 2VISA 3MOQA 1R5IA 3TT1L 2UYLB 3H42L 5FGBC 3MRJA 2EZ0D 3QO0A 3P4LA 5E2TL 1D9KC 3HI6H 3UCRA 2VAAB 1HOCB 4D9LH 1KT2B 5EOTB 5ALBH 3LKQA 4WUUA 3FAXA 4EDXA 3EGSA 5E08L 1CT8B 2GJ6E 4X6DB 1RZJH 2YWYA 5AZEH 2NTSP 3IGAB 3RWGA 1QSEA 1KLUB 4J6RH 3V0WL 4YFLF 1NCBL 4IRJB 4OZIF 4LLYA 4XMLH 2EDBA 2ZOKB 4M3JA 4MNQB 2X7LB 1KACB 1OD7A 4QTIH 3U9UA 5F89B 3MBEB 5I1IL 5C9JA 3QDMD 1NGYA 2VITA 3LZFH 3B8SA 1A6ZA 2AXHA 4KAQH 1RIVH 3KR3L 4ZUWA 5DA0B 3LKPB 4RGNC 3TP4A 2IMNA 1JK8A 5I1HH 4MDJB 3KPNB 4NJAH 4RAUB 4K3GA 4Z0BH 1JHTA 2NR6C 2F5AL 1E4XH 3BT2H 4WY7H 1FFPB 1V7NH 5D7JD 5E8DH 3IS1X 4HAFA 1GHFH 1LILA 2IQAB 3HI1B 1ZGLP 1ZHKB 3NCBB 3WNOA 5F71A 1IKNA 1T5WB 4WFGD 5EU4A 4MQXD 4XI5C 3E2HC 4LHUD 4WNQA 3SDCD 4GKSB 3STLB 2YMXL 3H2WA 3KS0H 4P4RB 2H32A 1R0AL 5J06A 4XPHL 3STZB 1ZMYA 1X5KA 3U7WH 1TJIH 1OAXL 3BEWA 1HHIA 4GMTL 4N0UE 5EN2A 4Y16A 1A1OA 4XCEA 2VTFA 1CDUA 3G5YB 4G8GD 5EZLB 5IK3A 1AGEB 4K3HA 3DXAA 4RMWA 1HHKB 4CVXB 1BBJA 2VLJE 2P5WD 2R39A 3HRZA 4OZHE 1N7MH 3RVVD 5I2IB 4F7PA 3P4NB 1F11A 2FEDC 4DCQA 1IAKA 2AK4D 3H9SD 4OFYA 2HG5A 5IVZB 3FO2B 1EZVY 4I3RL 1I7UB 4GW5B 2HAZA 1QFUH 3MV7B 4U6TA 4JPVH 3H0TA 4NHUA 1W72H 1CE1H 4FMFA 3ARDB 4TOYL 2QR0A 3D2UB 2G2RA 4OLVH 3RVWC 3ARWA 4ELME 1Q9OB 1FYHB 4TVPL 2XA8H 1CXEA 1P7QB 5D96B 4CN6A 4KKAC 1NAMH 3UJJL 4NN6B 1CQKA 2X89D 3OV6A 2EECA 3V6FB 5C07A 5E1HB 4L3EE 3HAEB 3U46B 5HHPA 5EO9B 1U8PA 3QIBD 1AQKH 5I76A 4NQVB 1ZEAH 1Y0LB 1VERA 4G7VL 1KJ3L 4PP1D 4IOFD 4XWOD 5T3XE 4UINH 1JGVH 2W0FA 5IWLC 4YDJB 4ESKA 1BX2A 3GK8L 5EC2A 1T83C 1N2RA 2H26A 1A7RH 5C6PB 4KZEL 1NANH 5DRXB 1FH5L 4GOSA 3OKNB 4YBLC 4O9HH 4X9IA 3I6GB 4PB0L 2CDFB 1UKSA 3VFRA 2XZZA 4HWBL 4RGMC 4H25B 3PJSB 4PRAB 3K1DA 3LRSB 3TZVC 3SE4A 3BPCB 5HYQA 5CEYB 2CD0A 5B38B 1I1FB 3ARBB 4Y19D 3KJ6L 4ZXBA 3K0WA 4R3SB 5CJ5A 3DUSA 1V3JA 5I1CH 1BEYL 1N4XH 1XCTA 1J9CT 3WN5C 4KZDL 1QACA 5FK9A 4HKZA 5JIKA 1ONQB 4X6FB 2BC4A 1X5FA 3IDJA 5FYLE 5T5FL 2M1KA 4JFOA 3FQWA 3FT3B 1DBJL 3QCTL 4PRHB 3TYFA 2R1XA 2UY7A 4XCYB 4HWBA 2VLKA 4JFDB 5J9PB 4XBGB 1VACA 4EBQH 1R3HB 1EAPA 3HAEG 1SY6L 3MO1A 3QJHA 4Z7OF 4QRSA 2X41A 3HMXL 3TBYA 3MRFA 1ZA6A 2OM5A 3AS2A 1DTUA 3ZYIA 3ME0A 4K7FB 5EU6D 1ZHLA 1PX4A 5DD3H 1GGBH 4BQCA 5KS9A 4JM2B 2Z93A 2VL5B 3MRDB 1KC5L 5D1ZC 4JFQA 1NCWH 5TQ0H 4Y88A 5FIEA 4KKCD 2X4OA 2WP3O 4KGLA 2VDMH 4ZOEA 3ZKND 4ONGH 2HT3C 3C5JA 5IQ9B 2OMBA 1SY6A 3FAWA 1XF5A 5B38G 4FQQB 1RZ7L 4JZNA 3P30L 4PRDB 3G9AB 3HMXA 1LP9F 2AV1A 3QFJA 2HFFA 4TULH 1UXSA 3RTQA 2NX5A 1JF1B 1J0IA 5I8KH 4JFHD 4BSWA 5HYSB 1XGUB 3ABZA 4YQXH 5DQJA 3V5KB 1OARH 3T3ME 3QUXA 1BQHG 3WHE1 5C86A 1HZHL 5ISZE 3ZYOA 3QZWG 4NOBA 5MEOA 3G6DH 1I4FA 5JZ7C 3R4DA 4YZFE 1JZ2A 1U93A 5DS8A 4DOHB 2GJZB 3GSQB 4KMLB 5BRZA 4AEHH 5E6IB 1ND0A 5DJXB 1YNKL 5HYFA 1H15B 3MOBL 4N9OB 4RDQG 4WHTB 3T2NH 5ICYA 4PRPA 3NTCL 4H1LB 1UZ8B 5GJSL 1QFWH 3MRPA 4Z7VA 3T0EB 4Q9BA 3WSQH 3P9MB 3DGGA 2AAVA 3HC3H 1ZLUK 3GGWA 1OLZA 4WGVB 2DN7A 1WWBX 4C58B 3JV6A 2ZWLT 3X3GH 4IRSA 1JL8A 2WV3A 2HT2D 3MRKB 3WE6B 3QHTC 1AGDB 4YLQT 3MREB 4HWEL 3BPNB 5AYUH 4MAYC 4G8EB 2I60L 2H2PC 1TZHA 2XN9B 2YPVH 5IM7A 4LL9A 3WHE0 2Y72A 4Z7UF 1DBBH 5BVPL 3L7EB 3Q6GH 4XP4L 4GRLA 3WKML 4YPGB 3BZ4B 3WXWH 2BFVH 1U8KA 1OP9A 1Z9SA 1S7XB 3DX6A 4ZFOL 4LAQL 5DQDH 1NLBH 3H9HB 5HVHC 1FNSH 3W39A 1WZLA 3K81A 3MYJA 5I15H 3SGEI 3C08H 4K8RC 1G7JA 3CMGA 1FBIL 1P4BH 5CJQH 3QNYB 4QOKB 5F1IB 3I75A 4XBEH 5TDPB 3NCJL 1L9MA 3FB6B 1KUMA 1ITCA 1RK1B 1RU9L 1U95A 4U3CA 4H1LG 3O3DA 3RY6C 5KSAD 4ZTOL 1YEGH 3O6ML 4AEIL 3WCYA 2YXFA 4ZFOA 5J56B 4R4ND 3U7YH 1CLYH 1GZPA 3HE7C 3V4VH 3S35X 3BW9B 1G9MC 4P3DB 3MRRB 5GGQH 1J0YA 2Q1EA 2C3VB 4HULB 3R0MA 2J5LC 3EYUH 3TCXA 1S7QB 4P2CG 1R3LB 5JW3L 4NUGH 4TN9A 3KYOA 2J3SA 3IGAA 2PYEE 1IGFH 2OSLB 4NKOA 1I3RA 2BVTA 4PJ7A 5D7SL 2IFFH 4IRJA 2LV4A 1CICB 4P46C 1M6OA 2ZOKA 4OD3L 4EVNB 4LU5L 2X4TB 4X7SL 1AD9B 1AR1D 5CCKH 1ZKAA 2ARWA 1SJHB 2GAZB 3VG0H 5I71B 4M03A 4AENA 5EB9A 4Y4KC 1K85A 1XR8A 3KPRA 2E7LA 3PHQB 5C0NC 1PKQB 2EDFA 1SQ2N 3KPNA 5D7KE 4RAUA 4YE4L 2R15A 3BX7C 4UUJB 2DDQH 4KQ3L 2A9NH 2V2TA 4IDLA 4JFZL 2GUOB 2IQAA 1ZGLM 3VWKA 4D9RD 4NKMB 5D7IE 5MEQA 2RB8A 4PYHA 4P2RB 4ODTH 5C0GA 5IOPB 3VW3L 4LPXA 1K9TA 1URLA 4GKSA 3STLA 4F9LC 4P4RA 4PJXF 2ZJSH 5INDB 5SX4H 1IGJB 1H8SA 2WWMD 3MJ9L 5IEHA 1XH3B 2EEBA 2Z31D 3KYMB 3DRQA 3O3BB 5LVEA 3LN5B 3MX0A 4MMZC 4HQQL 1HHJB 2GT9B 1S8DB 1YEIH 1HHKA 1KPVB 4NWTL 1YY8A 5F96L 3MLWH 4JANB 2FHFA 1HSBB 4XPGH 1E4WL 3CAFA 1I1AD 4EN3B 5CGTA 4AG4L 1A4JB 3EYVB 5IW1B 3UPRA 2YD5A 3DIFB 3MLPA 2YD2A 2MCPL 2AVGA 4QT5B 2V17H 1I7UA 5E99L 2XPGB 1Q0XL 3NGBB 1GVIA 4EXKA 4OLXL 2VUYA 2YD4A 3V6OC 3X3FL 1T22B 2RIKA 4JY4A 3RWIA 3VXOB 3EJZD 3BWUC 3MJ9A 3ARDA 2E6JA 5I9QC 5HDOA 1OAYH 4OB5L 5GZOD 3VWJC 2V2WA 2VLLA 2JJTA 1P7QA 1RMFH 4QHLB 1KBGL 4HJ0C 3HR6A 2MCG1 4UV7L 1FRGH 1JUFB 4GKZA 4IRZL 2VWEE 3ARYA 3BEVA 1NJ9B 1A9EB 4OCLC 5EZIL 4L3AA 4CMMB 3U46A 1GGCH 5EO9A 2ENSA 4PGDB 1AKJD 2YPLB 4NQVA 3WLWD 3U7AA 1MH5A 3MACL 2ICWJ 2OL3L 4ZS6D 1ZA3B 4YDJA 1I8LC 3D3VA 5MI0C 4BSJA 4WUUE 1QSFB 2ESVD 3FB5A 5DUBB 4YK4B 4C55A 1YEKL 3UDWC 2I24N 3W81A 1QSEE 3I6GA 4X4ZA 4GAJH 2MMXA 1GGUA 1M05B 3BKJH 2P47B 3GI9H 3DTXB 4ORGA 4PRAA 5LWYH 5C8JB 2L0DA 3K2MC 4NQCB 4P99A 3DMMA 1G7LA 1OSZB 4GBXB 5K9JL 1JV5A 3CNKA 3MOAH 3O9WA 1EHLH 4R3SA 5DVKA 4PJEF 1IFHH 3OF6D 2OL3A 5F97E 3D0LA 5JLZB 3JBG7 3MFGB 1IC4L 1MHCA 4U1MB 5JHLL 2QQKH 4OLYL 4LPTA 2O26U 3B2VH 5EORH 4QXTB 4YXKL 4EI5B 3LD8C 1L6XA 3QDJD 1JMZA 4FNLL 4PG9B 4PJGF 3D25B 5B8CC 2Q6WB 3S37H 4RFNB 4HZAA 4HD9A 4BZ2H 3MRIB 5IB4A 2OK0L 1UYWH 4JPKL 4JR9H 2EDOA 2G60H 3GSRB 2X2YA 4XBGA 5FHBH 5F7EL 1G9NH 5IHZB 2FLRT 1CFSA 3PGFH 3IFPA 2EIBA 3EJYC 4JGJA 3RIFK 3UC0L 5DO2D 2F19L 4BH7B 3FL7A 4HWZA 3DXAE 5KVEL 5KJRH 2GSGB 1JWMA 3L9RA 4CADB 5GS3A 4JM2A 1YPZA 4NNYA 4DVRH 3C60A 4MX7B 1A6UL 5BO1L 3LPWA 1IT9H 4HF5L 5HHMB 2YUZA 1IAOA 3OL2A 1YEHL 2RGSA 5IESL 4FQXD 1GYAA 3IXAB 1QBLH 2GEEA 4POZC 2W92A 1X7QB 1MFNA 3LRHA 1TZGH 4KGJA 4XZUB 4O2FB 1RJZB 3OKMA 1JF1A 4UQ2B 2FWOA 4OUUB 3PP3H 4ETYA 3O4LB 2OX5A 4XNQA 5E8NA 1KJ2L 3BZEA 4U6HA 4ODVL 5IP4A 2Y25A 5C07E 5KTEL 5IVXB 5EU3A 4HMCA 1U8HA 3TN0B 5TQ2H 1D9KD 3CH1A 1I7RB 1WAAF 2FH6A 3EJJX 2X9XA 3GJEB 3OJMB 1DLFH 1BBDL 3GSQA 1KN2L 4S11A 5E6IA 4J3WA 2SEBA 4ZNCD 2R2CA 5ELIA 3UPCA 3ULVF 4WHTA 3UTOA 4PLJC 1SEBA 4MCZB 4BFBD 1KTDB 1R3IL 3SDXF 1UZ8A 4OZGF 4TVPE 1JHKH 4WV1A 2MPAH 4DGVL 3QRGL 4OTXL 1G6VK 1S9VA 1VPOH 4U3HA 4HIHA 4MLIA 1KJ2A 1FL5B 5F9AC 4MSWA 1A1MB 4OSUL 5DMGC 5A1AA 1U41A 1I9JH 3LOWA 4WFFE 3HG1A 5DA4A 1TETH 4LDEB 3RJDA 3UO1H 4RGND 4HUWB 1DLHB 5TE4H 1FYTD 4HV8B 4BFIB 3ARZA 3PGDA 4WI8A 3UXFA 5T3ZH 3N1PC 2NR6D 3OTTA 4IHOB 2UY6A 1KFAL 5HYJA 2G5RA 2OP4H 4Y1AD 3MSPA 4J3XA 4XI5D 3C5ZB 5J57B 2F58L 3BPOB 5F1KC 4MQ7A 5EZJB 2VLKE 3H9HA 2COQA 3ESVF 3X13B 5FF6B 1ZLWH 2V5SA 4OM1H 4LEOA 2OCFD 2DTMH 3E6FA 5GIRA 4CJ0A 4HMDA 4ZNEA 1MJ7H 4LF3A 1JNNH 4QHNB 3GB7B 4LPVA 2P8PA 5KS9E 3VI4E 3SDDA 4HAGA 3TO4C 1B0GB 1JPGA 1A5FL 4XHJC 2MSPA 3GSNB 3RPIA 2FEDD 2XY1A 2I07B 3OKYA 1CG9B 3BIKB 1T7WA 3ARUA 1IKFH 7FABL 2VXQL 1A7OH 1PLGL 4L9LC 4P3DA 5KSBF 1EERB 2YK1L 3L7FB 4PRBA 4R4BA 4DN3L 2AJXH 3FN3A 4MVBC 3FQRB 1AFVH 3RVWD 4YHLH 4KQ4L 3QFJE 1HE7A 3WEXA 4DTGH 4MJIE 5HVGB 4OLWH 2LTQB 1R3LA 2NX5E 1CLZL 3CXHK 4KKAD 3HUJA 5HDLA 4WCYL 4ZFZB 3HZMA 1YNLH 1S7WB 4RMTA 2JCCF 1CICA 4Q6IB 5CEZD 4L4TD 2RHEA 4EVNA 2X4TA 1FG2B 2GI7A 4LVEA 4E0RA 3AREA 2NMSA 1EO5A 4PV9A 3GSVB 3M17A 5BRZE 4ZAKA 4K7PY 3CDGA 3RA7L 3NPZB 5CILL 1XF2B 3V4UH 2W59A 4KROC 1RIHL 3VFWA 3SBWA 4H5SA 4FG6C 5J6GA 4PRPE 5E9DD 4ZD3L 4Z7VE 1UB5B 2VXTH 4LGRB 4WTXA 5I19L 2GUOA 3OHXB 1VESA 3CPLA 5HHQB 3VG9B 4NKMA 2EXYC 4HLJA 4MA1B 4IM8A 4ZO9A 3TZVD 4NPYA 4Z18A 4KXZI 3QP3A 3EOYG 1BVKB 1QFPA 2EDKA 3Q0HA 5INDA 3QI9C 5MEND 2R2BB 5IJVB 3EFDL 1I9EA 1XH3A 3TA3A 3DRTA 3LN5A 1IJ9A 3CX5J 5EDXA 5DGQA 1FL3B 5DD0H 1EX0A 1MREH 1M4KA 2IAMB 3RGHA 1KNOB 4HXAH 5GGRY 3DNKA 4P5TC 3VFOB 1TTUA 1HSBA 4G6ML 1RJYB 2ZSVB 1SYVA 5DJ2B 1KELL 2IADB 4OD2A 3NABH 4XGZB 2NTFB 4KPHH 1VFAB 3F7YA 4QT5A 4DEPB 5J12B 2ADFL 3NH7H 2FIKB 2BVQB 3WFEH 3LHPH 4CRPA 3L5XH 1T22A 3VXOA 5JW5B 4RDQF 5IROC 3ARXA 5D1QC 3T0DA 2DQIL 4X4YA 4M93B 4R26L 4KJYA 5E7FA 3TIDA 5C0BB 2KDGA 3IDXL 4QRQB 4NCC1 1FNLA 1FAKT 5K9QI 1DE4A 3MJ7B 5GHWH 3JWOC 5D1ZD 1NJ9A 3TM6A 3MCG1 4X7DC 2XZAH 2HT3D 4PGDA 1KXTB 2IPKB 3SJVD 4XH2A 4AMKL 3ISWA 3ULVC 2VDPL 1RULL 4W4OC 3T1FB 4APQC 4NDMA 4IJ3C 1IM9A 4L4VA 4ZDHB 4BH8A 1DEEB 2NXZB 3BWAA 5DUBA 2O5XH 2VNCA 2FBOJ 2CLVA 3GHEH 1MIEL 1LE9B 3RDTB 4C4KO 2AJVL 4PJ7E 2DLHA 3DTXA 1JNHA 4ZPTB 3VMNA 5JZ7D 3PQYD 4MNQE 4UNTA 1MCCA 4UNVA 4LEXL 4HH8A 4NQCA 2DWEB 3O3UN 4H26A 4OZHF 5IB1A 5BZDB 2BOCB 4HEME 5L8LB 5D2LB 3IFLL 5M94B 5JOFA 3VDAA 3VXUB 1GH7A 3PWPA 4F15C 2UZIH 5JLZA 4U1MA 2HN7A 1MWAL 4QXTA 4WU5B 2Y06H 4ONFH 5BV7H 4BFEA 5JPMA 1ITBB 1N0XH 3LCYA 3L3OA 4U2ZA 1NKOA 1OW0C 4ELMF 3S88L 1Q72H 5DZLA 3WD5H 2LE9A 1DQDL 5SWSB 1FNHA 1T66C 2DYPA 4P2YA 3BVNB 1KJVB 4JRXD 1RJLB 3QB7C 5FCSH 5T3XH 3SE8L 4MAYD 2YPKA 5TH2A 1LD9B 2H2PD 3VD3A 1SBSH 3UJTH 5I74C 1MFCH 5CBEA 4G9FA 4QRRA 1OTSC 1OQOA 3I2CL 1YEJL 4OBSA 2R4SH 1BD2D 4NKIH 5B3JE 2GSGA 1MWAA 3ARGC 4HIXH 3MV8B 1MJ8H 1CI5A 3KPOB 1KGCD 4P2OB 2F53A 4YC2C 5GS0C 1GAFH 3IFOB 3EOBB 3PIQA 5CJXC 4MX7A 3VFSB 5AUMB 1A14H 1MIML 1EGJH 1EZVX 4DK6A 4K8RD 4L8DB 4PRIB 5FOJA 3OKDA 4YDKH 4GW4A 2DMCA 3QEUA 3MR9A 4OFIA 1F00I 3FT4A 1F42A 2ICCA 5L7XL 5DI8B 4KUZL 1FO0H 1E6OH 5C08A 1X7QA 5HPMA 1RQ5A 4M6NL 1HHHA 1DUZA 1C12B 4OUUA 3FFCD 1JTPA 1F13A 4IMLA 4NM8H 4MNGA 1NCAL 2AABH 3IDNA 5T1MA 4Z77A 5DDHA 4JN2A 5C0FA 2NY4C 1QZ1A 4K94H 3HE7D 5IVXA 12E8H 3TESA 2DQFB 1O7VA 3TN0A 2IBZY 1I7RA 4DQOL 5DMJB 3LQAC 5CBAB 5CLTA 3ROOA 1N64H 3MNZB 4KRLB 1T6VN 1YC7A 3H3PL 3LMJH 3CDYA 4QY8A 4F3FB 5HXMA 1KTDA 4NNPH 2CRIA 1SBBA 5GRJH 2AJUL 4DFIA 3K1KC 3OSKA 3GMNB 1NFIB 3HHRB 1H3PL 1UACL 2IFGA 5DEZA 5L88L 5ITBH 2EDDA 1P84J 3FB8A 5DK3A 4P46D 6FABH 1FL5A 5C6WH 2C26A 5HY9A 1JGUL 1UM4H 3MTRA 4YFLI 4JM4L 4PJ8C 2BY1A 4Y4KD 5JA8B 1D5XA 3AY4A 3BDYL 1ZANH 5C0ND 3QXTA 2CPCA 5FO9A 3U30C 1D6VH 3QUZC 2PO6A 4U1GC 3QUMH 4BFIA 1P4IH 4EDWL 2J88L 1OAUH 1I8IB 1Y18A 4IHOA 5I8CB 4HIIB 3QJFA 1QFOA 2VZTA 1AI1H 3OAUH 4PRHE 1MLBB 1OAKH 3IDYC 4QXGL 1IQDB 4Y5YC 3LIZL 3RNKA 1EVTC 1WZ1H 3T3MF 3OXSA 4IIQB 1E4XI 3R8BB 1I8KB 1JZ7A 1OTTC 2VDNH 2EICA 4GG6F 4YWGL 4U33A 1YC8A 3D1MC 3BO8B 4YZFF 1J8HA 3GKWH 4M6ML 3GB7A 4HJJL 3SPVA 5DD1L 5JNYB 3MRMB 2G75B 5HDQH 5L9DL 1CDJA 1RUPH 4M62L 3S4SA 3U9PH 1U6AL 1CD8A 1YPZE 3HE6B 1MUJB 3D18B 4XNUH 4LSVH 4MLSA 1K3ZA 2X9WA 4WWKA 1TNMA 4X6BB 1X6NA 4IDJH 3BQUB 4Z7WB 3PDDA 4P2QA 1E6JH 5FO7B 1J1PH 2VDQH 4NQSA 3LH2H 2P8MA 2BSTB 3UTQB 4X9BA 2HKFL 3FQRA 5SWZD 2AJZA 5D5MB 4FQLH 2XWBB 3VWJD 2BNUB 1YECL 4G8FB 4HFUL 2J6EH 4HJ0D 1W0YT 2ZCHH 4HPYH 3B9KC 1TPXB 2HFEB 3S98A 2MKLC 4U0RB 1A1NA 3SCMC 3HKFA 3VDBA 3QNZA 3VXSD 1FG2A 1BJMA 3LN4A 1NCDL 3UX9B 3RWEA 3C2AH 1FFRA 2J7LA 4JKPL 3IKCB 4Y5VB 3DX8B 1G1YA 1I9IH 1XF2A 4S1QH 5MERA 1OAZH 4RISH 1I8MA 3S9DB 4Y4FC 1UB5A 1XMWA 4I3SL 2IPTH 5DRZA 3QNXB 3GRWH 1RZ8A 2M26A 4N8PA 5A3IC 2Y36L 5HHQA 3VFMB 1KB9K 3MRGA 1BZ9A 2ICES 3PXJA 4LCIH 4GQPH 3MRBA 4WTZA 2X40A 5E2UL 3SGJA 1BGXH 3UJIH 1MY7A 1BVKA 1CR9H 3HG1E 3QQ9C 4FQ1L 4GRWB 2K1MA 4X5LA 2VLME 4JDZB 5CSZB 1NANI 2OR8A 2PCPA 4R7DB 3O3EA 1UZ6E 1MCJA 3D39D 3O6FB 4RX4A 4HCRH 1QYGH 3QDMB 3QH3B 5F7DB 4NKQB 1YN6A 2AEQL 5AZ2L 4K3EH 1YEFH 2X4RA 3RWHB 4NQDA 4XHQA 1S7SA 5IKCB 5HYJE 4XMPH 1JHLL 5DEGA 4IS6B 2BY3A 5IFAH 5F88B 3V4PL 4MCYB 1N3NB 3VFOA 5CZKA 2CIIB 4OT1H 4KFZC 4MHHI 2VDRH 3EDFA 5D7JB 2EDNA 2DIAA 1RHHB 2EDTA 3GSUB 5DJ2A 5T1DL 3U4BL 3WLBA 4PJ5A 4FMKA 3WBDA 4JO1H 5I30L 3HI5H 1QPXA 4S1SH 3PP4H 4LHUB 3SKJH 5ACZB 1W0WA 3KYKL 2Z35B 1JPSH 3EJYD 3SDCB 4R2GB 3PHOB 4ZUTB 4DUVA 4ZNEE 5ADPH 2Y07L 1T03L 1UWGL 1IL1B 4OKDA 4M43H 3MXWH 2F5BH 4G8GB 4YFEA 3GSOB 3BFOA 4KC3B 3KDMB 5IB2B 1DN0B 2UZYB 4MB5A 4S0TD 3MZGB 25C8L 2B4CL 1NCCL 4LSSH 2P5WB 4YDVA 5LAXA 3J8F7 1CZ8L 5D7IF 1S3KH 1KEML 3NFNA 4POZD 3RUGA 3BUYB 5IEKA 4BZ1H 2AK4B 3QWRD 2Z0BA 4R4FL 3H9SB 4I0PC 3MRLA 1J87A 1MVUB 4PY8J 4FZ8L 3HUJE 1NFKA 3RDTA 5GGRB 1C7TA 4J3VA 5FCUH 1R3KA 1RUAL 4PGBA 4YHZH 3GMRA 2JJUA 1ZK9A 2MOVA 4U1IB 4O58L 4JFEA 4GT7A 2XNAA 3O0RL 4ZPTA 4DN4L 4NC2B 2P46B 5KVMC 2EDRA 3S34H 3PGCA 2X70B 3TGXA 2QSVA 1UB6A 2BOCA 1JWSB 4PGEA 3A67H 3ZTJH 1BQUA 4FQJL 4RRPG 3V0AC 3KAAA 3QIBB 4LHUG 4PLJD 2XTJE 2AQ2A 2ZUVA 2EH8L 4X7FC 5DURD 5L2JB 4I9WD 3GFUA 3PL6C 3ZSTA 5JO5A 5IBLC 4PLOB 3PE9A 5FHAL 1A6VH 3MUJA 1GOHA 1MAJA 2P5ED 4P2RE 4JQXC 5K9OA 5KG9A 1Q94B 5DMGD 1ZS8B 2W91A 3T0VA 2X4UB 2XY2A 5C7XH 5ADOH 5I8OL 3V52H 3G5VB 3EDDA 4TPRH 3T4AA 2HJLA 1RIUL 5D9SA 1D3CA 1HH6B 1AY1H 2WK2A 4TTGA 1TQCC 3C6LA 3B9VA 1UFUA 1QG3A 1QKZL 1X5GA 5ID0B 4D9LL 4PR5A 1T7ZA 3UYRL 5BS0A 5ALBL 1Q0YH 3MV8A 1ULVA 3WJLA 4P2OA 4PBVC 1SEQL 1RZJL 4MD5B 3E8UL 3TO2B 5AZEL 3IFOA 1CK0H 3EOBA 2R23B 1YZZA 4J6RL 4HG4K 3KJ4B 5AUMA 1YEEH 3MROA 4L8DA 1WZKA 3PWNB 4XMLL 1AO7D 4ONHB 1GRWA 1N59A 2CDGA 2XWTA 4QTIL 5DD6A 5J1AA 1AIFB 4YH6A 5C0CD 1LK2A 1U3HC 5DI8A 2GY5A 2W0PA 3KHOA 1LDPH 3AMKA 4O02H 2P43B 5ESQB 2N56A 4KAQL 1RIVL 2VB5A 1S9XB 1NCUA 5B39B 3WXVH 4F57H 1KIPB 5I1HL 3TO4D 4NJAL 2D4FA 4Z0BL 4XHJD 3MUZ1 2BY2A 3BT2L 1V7NL 1ZT1A 5TGBB 2F8OA 3TLRA 1NCBH 1DL7H 1GHFL 2V7NB 5EU6B 1T89A 2F9BT 1T7XA 3B6SB 2EDXA 4N0FB 1G7HB 2H32H 2W9DH 1ZLVH 3VFGH 2DMBA 5I1IH 5JDJA 2WBJA 2EE6A 4MVBD 5CBAA 1KPUB 1IEAB 2H6PB 3MNZA 1NGZB 1EEUA 1TJIL 4L4VE 3O3AB 1UJ3B 1G9EA 4AYFA 4CUCA 3GMNA 1HK6A 1OF2A 4U7KA 1NFIA 3BGFB 2GK0B 5LGJA 1JBJA 3K8LA 3M07A 3GI8H 3MLRH 3K46A 3X12A 1BZQK 1D5IL 1N7ML 1ZVYA 3VXTB 3OB0H 4NQCE 1I3VA 2RFXB 1NGXB 1U92A 3MMEA 4XPHH 4KROD 3PWPE 3AM8A 1I7TA 1ZSDA 2N7BA 2QQQA 4KJWC 3IJYB 5I1DA 4JPVL 4NRXB 1DVFC 2FB4H 1W72L 4LAJH 4LCYB 5SWQB 1CE1L 2JIXA 1X5AA 4L29B 5B39G 1QO3A 1N6VA 4MNHA 2EXYD 5I73C 4WU7A 3AB0C 3ZT7A 1NAML 1IGTA 1MLBA 3PWLB 4NCDA 1F3JB 5HHNB 1JTTA 4D8PA 1FGVH 3QI9D 4YBQC 1L7IH 2FJHB 4IIQA 3IAPA 4GG8B 3S7GA 2YD8A 1AQKL 1ZEAL 4HXBH 4HT1L 4JRYA 2E3VA 4UINL 2B1HH 4G9FE 4QRRE 5F1SA 1KCRH 5BZWA 2DICA 4CL7A 1WIPA 2HJFA 3MUGB 4TVPH 4U2YA 3QRFM 5JOEA 2AEPL 1X5JA 1CTOA 1W72A 3MYZA 5FKPA 1A7RL 2GFBB 4P5TD 2R0LH 2QV2A 1V5JA 2F53E 3L3JB 3SY0A 1I85C 5SX4I 4UB0H 1M7IB 4O9HL 3T0XA 4YHYC 4M8QA 1CD1B 1NAMA 3CU1A 3ES6A 1Q9WB 1TQBB 4X6BA 5HHME 5EO1B 5D72H 1XR9A 2QKIB 5FO7A 4G7VH 2D7QA 2BSTA 3UTQA 5L8KB 5F1OB 5C08E 5D5MA 5D1QD 2BNUA 1JN6B 3GK8H 4P4KC 4PTUA 1ZXQA 1YMMD 2A0LC 4XNMB 3ULUH 5I1CL 1I3GL 3BP6B 3F65A 2K7QA 1N4XL 5DVOA 1J86A 4KZEH 4MNGE 2Z4QB 1P6AB 1DANU 2PTVA 5MHSD 2D31A 5TE7H 3WIIH 3MNWA 4JHAH 5IW3A 1BLNA 2P45B 5F9DC 4ZUSB 5IVXE 5KSAB 2VN4A 5EUOB 1JFQL 5KSVA 4ZODA 3OBAA 3ULVD 4EBQL 1XZ0B 4QCIA 1MFEH 4APQD 1T80A 4JQIH 3KJ6H 1CFBA 4JVWA 1JNJA 1QFHA 2R2HB 3VXQB 3W9DB 2BVEA 1MHEA 3ZE0F 1H3XA 4HFWA 3FN0L 4JKKA 4ZYKA 5DC4B 4J7RA 3LKSB 3CSGA 1P1ZA 2D7TL 3B9EA 4ZSOA 2J12B 3RWFB 4L8BB 5DD3L 1DBJH 1OL0A 3FRUA 1IM3A 1GGBL 3BJ91 5FKAA 5KS9F 4S1DC 3VI4F 4Y2DB 2VWEC 5DQ9B 4Z8FL 5F7UA 1NCWL 1LO2H 4U6YB 1SY6H 4Y5XB 2GHWB 4RWHA 4A2MA 3EDEA 3IVKB 1NBYA 3O6FA 1QR4A 4GKOA 4HK3J 3WJJA 1XAUA 3KLHD 3QH3A 4PP2A 1U8OA 2BNQD 4ZUUB 3PABA 1FFOA 3SEPA 3DYOA 1D5BB 1XGRB 3RWDB 2Q8BH 3BAEL 1T66D 5I8KL 3WMSA 2CIIA 1XGYL 4PBWD 1CDBA 4YQXL 4LCCB 1OARL 4NKDA 5BVJB 3KNBA 5C0JB 3G6DL 4OF0A 4G3YH 4U1LA 3VGEA 3JTTB 5F7NC 2Z35A 3MGOA 4L8SB 3SDCA 4ZUTA 1OTSD 4JO2L 3I6KA 1R5WA 3P30H 1NC2D 4AEHL 1J8HE 2A6JA 2F74B 3WUWB 3VXPB 4N8VA 4WEBL 1TIUA 1CWVA 1PW3A 3AVEA 3TYGH 3ARGD 3EIFA 1KCUH 2AV7B 1KIRB 1R5VB 2Z31B 5DRNB 1XGQA 3L5WA 3P77B 4LSDA 1QFWL 1FIGH 5GS0D 4NN5B 3KDMA 5JXAH 1DN0A 3QPXL 2AQ1A 1S9WA 4Z7VF 3CSYA 1UWEH 3TVMA 4PGJA 4J3UA 1HZHH 3HR5A 1MFDH 3HC3L 3VRIA 3QQ3A 4X9GA 4PRNA 5F1NA 2WZPD 1PZUB 1WBZA 1IKNC 4P2QE 5E5MB 2YS4A 1I1AB 3DETC 1CU4L 3BP7B 2OJZL 1GSMA 3PUCA 3BUYA 1C16B 5GRXG 4UOJA 4KHTL 2QBWA 1RUKL 3T8XA 3DUHA 4QXWA 1MVUA 2CQVA 5FYKD 1UXWB 5I6XC 2Z91A 1C5CH 3NTCH 4QKXB 5C0AD 2A2QT 2YPVL 2O5ZL 3P40A 4Y16C 4X80L 2WWKT 4M7LH 1DBBL 4MA8H 3IJHB 5I1LA 1DFBH 2NY4D 4E42B 4U1IA 3Q6GL 5I1JL 2VQTA 3MXVL 3PWUA 3DVGB 3WXWL 1OP5H 2X42A 4YHNB 3SDAB 5F3BA 2X70A 1ZT4B 1NLBL 2OI9B 2Z8WC 4JFFD 4JFYA 5DEFB 3SKMA 4F7MA 1NBZB 5LG1A 2Q86A 3QIWC 1NLDL 3OX8A 3QIBA 5I15L 3C08L 4WHCA 4PJCA 3MV9A 1BF8A 2I5YH 1K8DA 2I25N 4DAGH 3C09C 3WUWG 4JAMB 3X14A 5L2JA 3HPLB 5BVPH 3OAYH 5D7LA 2ESVB 3P9LB 5EC1B 4L8CB 2J8UA 3F58L 4M7JH 3TPUB 1FZKB 4O2CA 1Q94A 1YEGL 2X4UA 2Z8RA 4LAQH 3U83A 1QVOB 3IDIA 4PJ8D 3FCTB 1Z5LA 4NZDA 5IMMA 4BQ6A 4YJZL 4H8WH 1QA9B 3U7YL 1Q8MA 1B4RA 3CXDH 1CLYL 3V4VL 4I2XA 3QUZD 4JZJB 1FBIH 5FECA 5GGQL 5DSCB 3JV0A 3L1OH 5E4EC 3BXNB 2P8LB 4NQDE 3DURA 5JORB 3EYUL 1RU9H 3B9AA 1N8ZB 4X4MA 4NUGL 2GJ6D 3DO3A 4ZTOH 1JZ6A 3DROB 2J4WH 1CXLA 1FSKC 3QDJB 1RJCA 1LQSR 4QRTB 3UTZB 1BZ7A 1IGFL 1RZKH 3V5DA 1IC1A 4G6JH 2VDLH 2IFFL 3EO9H 4PJ5E 4UU9B 4LP4A 3PWNA 4PJ7F 1OTTD 1P6FA 4D94A 5D70H 5CCKL 5IG7A 3Q48A 3VG0L 3WFZA 5IT2H 5J3HC 2IPUK 1F4HA 2JJVA 5ECJE 5GRUH 1S9XA 1OM3L 4QHUB 1AJ7H 4FP8L 2O5YH 2PKDA 4KTYA 2HTLC 2QJDA 3SO3C 2MQCA 4OCWL 2A6IB 2OTWA 2DDQL 2A9NL 1NH6A 3DV6A 5D7SH 2V7NA 3KLAA 3B6SA 3VMOA 5C0EB 4LU5H 3TBVB 4DKDC 2E7BA 1H8OA 3QXWA 5ICXA 5F44A 1VCAA 2DM4A 3RUGE 5K59E 4U49A 1NUNB 4XRCB 2OQJA 2FRGP 1AXTL 1IEAA 1DUYA 2ZJSL 1XGPA 2DWDB 5GRZA 4Z5RA 1U8QB 2DQJL 1ZHBA 2NW2B 4BQ8A 4FQXB 3I50H 4JLRA 2GTWB 3OAZK 2BZDA 3B9KD 3BP5B 4KY1H 5EBMB 2AGJH 4KQ3H 3SCMD 2GK0A 1FIEA 4JFZH 4GMSH 9CGTA 4GUPB 1YEIL 1YNTB 2VE6A 4JFEE 5L6YH 4U1KA 4AM0A 2VLJD 3MLWL 2CXGA 5B3JF 4FQCL 4XPGL 4LFHD 3VXTA 3PV6A 2RFXA 1PX3A 1ZE3C 4NNXB 5TDNA 5BCAA 3D9AL 2ILLA 2V17L 2PTTA 1D9KB 4EJ1C 1CL7H 2X4PB 2FL5B 5AAMA 1DQQB 3E6HB 1VFBB 5E7BA 1J05B 3IJYA 4Y4FD 3WFBH 2Z8VC 1ETZB 4HQQH 4LCYA 4A6YB 2PW2B 4L29A 1OAYL 4MD0A 5F7LB 4ODXA 3S3SA 5A3ID 4OCXH 4NWTH 2B39A 1RMFL 1ZLSL 3MRNB 3RL1B 2BVYA 3EFFB 1VHPA 3G5XA 3HAEH 5KVDH 4I1NB 1F3JA 5IFJB 2ZUYA 3X11B 1U58B 3QUXC 2MCPH 5D71L 1MSPA 2EO9A 1ZWIA 1Q0XH 3VH8A 1ZLWK 5FYKU 4AZ8A 1I1CA 2WSKA 1AQDA 3P2TA 4PG2A 4RGNB 2Q3AA 5BS0E 1FYTB 2Z8SA 3QHZH 4YHPB 3MV8E 2VXSL 4OI7A 4C83B 2DL9A 2HMIC 1ZVHA 2YUWA 2FHCA 3O2DH 4GAJL 4Y1AB 3AMLA 4YHIB 3RAJH 3BKJL 4ZFFB 4LMQE 2QKIA 2A1WH 2DB8A 5IJKA 3E2HB 5E8PB 3OKOA 1AXSA 5LWYL 4YAQA 1TTFA 3MGAA 1JNLH 1H3GA 5DHYB 3MACH 4F9PA 4IRSC 4X4XA 4HGWB 4X7TA 1KIUA 3MA9H 4HX1A 1QBAA 4E5XB 1OP3K 3C6SB 3FOMA 1HNGA 4PUBH 1QR1A 5HYIA 1YEKH 5CD3B 2QQKL 1EXUB 2C3WA 4MJ5A 3B2VL 5EORL 1DANT 2OR7A 2JLLA 4JFPB 4Q74A 5FYLD 3HPJB 1NUFA 1EJOH 1K4DA 4GRLC 5E2VH 3U36B 1TJHH 3S37L 2NLJA 2IBZX 3K2UH 4XP6H 4JR9L 3N1FC 5JMOC 3EHBC 2G60L 4QHMB 1OD9A 3DVNA 2FGZA 3D0VA 3RWCA 5FHBL 3RJQB 1G9NL 4I0PD 3FQNB 5H94A 3MRQA 3OR6B 2R2HA 3B3IB 4W81A 3SN6N 4JCMA 5HGHB 4XP5H 1IC4H 3PGFL 4EI6A 4D2NA 1T04B 4W6WB 5GPRA 5DMIL 2BHUA 4FNLH 3UTSA 1MQKL 5CAYB 3ARFA 3RWFA 4L8BA 5KJRL 4UT9H 5LXGH 1Z0NA 5T1LA 4M7ZC 4RFOL 4DVRL 4Y2DA 4JM2F 3TBWB 5DQ9A 1NGWB 3RQ3A 1YPZF 1IT9L 1ED3B 5F7EH 3F12B 4L4TB 1CLOL 1W0VB 1JPFB 1S5HA 1AR2A 5FO8B 1QBLL 2C1PB 3FQTA 4JFXB 2UWEB 2F19H 3PL6D 5IR1B 4OFVA 1KG0B 4HKXA 5IBLD 4XCNB 2R56H 4OCRH 2V2XA 4RMQA 5KVEH 4NSKB 5IUSA 1QD0A 2VMFA 2VOTA 5K9QG 2VQUA 1D5ZB 1DDHB 1PVHA 2XZCH 5E9DB 3SQOH 4YBLB 1NFDA 2EH7L 1A6UH 4LCCA 5BO1H 2A83B 4RGMB 1C5BL 4CN1A 4NGHH 3B2UC 4XTRC