1YPZE

Immune receptor
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
207
structure length
207
Chain Sequence
GDQVEQSPSALSLHEGTDSALRCNFTTTMRSVQWFRQNSRGSLISLFYLASGTKENGRLKSAFDSKERRYSTLHIRDAQLEDSGTYFCAADTWHISEGYELGTDKLVFGQGTQVTVEPKSQPPAKPSVFIMKNGTNVACLVKDFYPKEVTISLRSSKKIVEFDPAIVISPSGKYSAVKLGQYGDSNSVTCSVQHNSETVHSTDFEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H2-T22 protein
publication title Structure of a gammadelta T cell receptor in complex with the nonclassical MHC T22.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 32
structure length 207
sequence length 207
chains with identical sequence G
ec nomenclature
pdb deposition date 2005-01-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ypzE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ypzE02
1SVCP 4GW1A 5T3ZH 1QRND 1OSZA 4N0UB 1T3FB 1P4IH 2CR3A 4QRRE 4M61A 3M1BB 3VWKB 4LPVA 3MODL 4H1LG 3RP1A 1QSFB 3TA3B 4HWZA 1C5CL 3SDXF 1QPPA 3IU3A 3A6BH 1AXIB 3MLTA 3MRLB 2E7LC 3WFEH 4Y8DC 2QQLH 1WWCA 3MZGB 1EGJA 3WEXB 1KLGA 3T1WA 1BVLA 3FMGH 4MWFA 4JQXA 3K2UH 5DJZA 5EZJA 2RIKA 1P53A 2CKNA 2VC2H 4U6HA 1Z9MA 4MD5B 2P5EB 4X8JB 1U8OB 4YHNA 1KCRL 1ZLWK 1EHLH 2R69L 2VOTA 4J3VA 5DFVD 4OF7A 4LHUG 1X5XA 4HGWA 3FCTA 4XNUL 2UWEA 3MPCA 1V05A 4MHHG 4OZHB 4JFHE 4LSSL 3NACL 4OCRL 1U8MB 2R1WA 3RPIA 1CWVA 2HFGH 5IESH 2DQCH 5ACZA 5C09B 5EN2B 4N0UA 1T3FA 2DS4A 1FGNL 4NP4H 3VWKA 2H8PA 1REIA 1QSFA 3OF6A 5GS0H 4OQTA 3TA3A 5T3ZL 4QKXB 2EDBA 1L9MA 1KB9K 4NNXB 3MRLA 1P4IL 4XX1G 5I6XB 1P5VA 4D0BB 2IFFL 1NKOA 4M7ZB 1UJ3C 5EIIB 4L4TA 4X6BB 1FH5H 4YEFA 4ZAKB 1CZ8L 4MD5A 2P5EA 3LRSB 3WFEL 1A7RH 5HDQL 1XF5B 1YDPB 3UJJH 2QQLL 4APQB 5C3TA 3U7WH 3JV6A 3GKWL 3RU8H 1VERA 4K55A 1CD0A 2IPUK 1J5OH 1P4BH 5TQ0H 3ETBF 3S36H 1VFUA 3L3GB 3BPLB 1P7HL 1BWWA 4YFDB 3QEQD 5IHUH 1KB5H 1FLTX 1QLRB 4U7SA 3W9EB 1LMKA 2HFTA 4U1JB 1EHLL 1NCAH 4OZHA 4R4FH 1PG7X 4JGJA 1U8MA 2BK8A 5D4QA 5C09A 5EN2A 3MRPB 1I1YB 4R2GC 5CILH 5FV2A 4LPWA 2MPAH 2HFGL 5IESL 1CLCA 2DQCL 2AP2A 1A6TA 3V6OC 1JPGA 4NNXA 1G1CA 4NP4L 4D0BA 3PWNB 1ERNA 5GS0L 4Y4FB 1BF2A 5T5NG 4BYHA 1VA9A 3BPOB 5EBWB 5EIIA 1ZGLB 1BOYA 1IAII 3G5ZB 1GGYA 4ZAKA 3IDGB 3LRSA 1JI1A 1XF5A 1YDPA 2FDBP 3WMSA 3G08B 5DVLA 2HVJA 1FH5L 3L3GA 4Y5VC 1EHXA 4M1DH 3CFCH 1QLRA 3TT1H 3W9EA 3OKLB 3RU8L 5BCAA 4Y4KC 1JTPA 4U1JA 1J5OL 1P4BL 1CXIA 5TQ0L 3S36L 1FNSH 4YPJA 4M7LH 2ZUXA 5IHUL 1KB5L 1T89C 4JFFE 3MRPA 3NGBB 1I1YA 1KJMA 3VDAA 2HP4A 1F3JB 3O9WD 4R4FL 5B38G 3AU1B 4PG9B 4M7LT 5F6HJ 1S7VB 5SWZB 4MYWB 5CILL 2Z8WC 3WHXB 3PWNA 3U83A 2H26B 3FT4B 4Q6YA 4Y4FA 2MPAL 3VGHA 3L95B 1ZAGA 4U49A 5EBWA 1ZGLA 3PXHA 5JPMB 1IZKA 3G5ZA 1P9MA 2WBJA 3HG1B 3IDGA 2WANA 4LL9A 4XRCB 5I8OH 5A2IH 3G08A 1HCFX 3GKZA 1U0QA 5GRJH 4RZCB 5FGCB 2V6HA 3BX7C 3Q0HA 1Z6JT 4Y16D 3UX9B 2Z8SA 4FFYL 5IM7B 2CD0A 3OKLA 2V2XB 2XOTA 2PXYC 3E0GA 4KTEH 1PBYA 3TWCH 5C07E 1N5YH 3HAEH 3CFCL 3TT1L 1NUGA 5L0QB 5CD5C 3QB7C 2V5YA 4GRLB 1F3JA 1IM9D 3TBTB 4XCYB 3HI5H 3AU1A 4PG9A 1FNSL 3KS0J 4M7LL 5EOQH 2VWEE 4S1SL 1S7VA 4GXVH 5SWZA 3B43A 4X4XB 3WHXA 3T0XA 4UNVA 2AV7A 3FT4A 3IKKA 3L95A 4WFGD 3EYSH 4GLRI 5JPMA 3HG1A 4L3AA 4XRCA 4ACPA 1RUMH 4RZCA 1J0ZA 3VGEA 1MVFA 4LOUC 2NY2D 1YMME 3MR9B 1JP5A 1C7SA 1Z9OA 5IM7A 3QXDB 4JJ5B 2V2XA 4NQCB 2UWEE 3BN9C 5GRJL 3VGFA 4EDXB 2XY2A 3VFMB 1EVUA 2BZDA 4XZUB 4ZD3H 1T83C 4NKQB 2DQDL 5C6WH 4IDJH 4NSKB 1C1EL 1QFHA 4GRLA 2ZUQB 1I85C 4KTEL 3TBTA 4XCYA 1AGCB 1QSFE 4NHCH 1N5YL 3RBSA 2W60B 5C0NC 4X4XA 3EOAB 2CLRB 3WCYA 1YPZB 1BQHG 5HHME 5IB2B 1MFBH 2P5EE 4WEBH 5F7MC 3P0VH 4E42B 4X9IA 1RZ7H 3IDIB 3T3PF 3EYSL 2DL2A 1BOGB 3MR9A 3S3PA 1OTTD 1R3LB 5DRWB 3QXDA 4JJ5A 4NQCA 1RUML 2APFA 1GAFH 2ADFL 1W72B 4WCYH 3ISWA 4QCIB 3RRQA 2OTWB 3X14A 1I8KB 4XZUA 2EKJA 1T6VN 3KYNB 1TZHB 4NSKA 3J8F7 3MJ9A 2O61B 4M02A 3QDGB 3VH8B 3OAYK 1AFVL 3ULVH 4ZD3L 3WSQL 3ZDZF 4HWEL 1MJ7H 4MJIB 5BV7B 1K8IB 2W60A 4ODHH 3TN0B 3LN5B 4KHTH 2CLRA 1YPZA 2Z93B 4TPRL 4XGZB 5IB2A 2BVUA 3K8MA 4QHUA 4DEPC 4YHML 1SMOA 2H2SC 4DZ8B 4M1CD 4E42A 2P47B 3WDJA 1HKFA 2D7PA 1X5FA 3C5ZB 4NZTH 3RI5F 1BOGA 1OT2A 1R3LA 3BKCH 2LQRA 4WEBL 1J05B 3P0VL 5DRWA 2RBLA 1ZVSB 1T21B 1P84K 2VDRH 3MRRB 3NIDE 1W72A 1RZ7L 1OTUD 3R4DA 1QG3A 4QCIA 2OTWA 5GGRB 1A9BB 1U3HD 1I8KA 3QDHA 5DURB 1Z5LB 2AQ3A 3KYNA 4QEGA 1YEEH 3T0VA 4Y7MA 3O4LB 4P46D 3V52H 1GAFL 2O61A 4LLDA 4WCYL 3QDGA 2AKRB 3DO3A 1UT9A 3VH8A 4K71C 1O5DT 4F37K 1LEIB 5C0CD 4MJIA 5DGRA 3IJYB 4YGVB 4X6EB 3M17B 5DD1L 3TN0A 3LN5A 1II4E 1AR1D 2Z93A 4XGZA 1MNUH 3ULVL 1G1YA 1MJ7L 1NDGA 3SOBH 4KMQA 5TJWK 3L1OL 3ARWA 4ODHL 5DZLA 1VESA 3QO0B 5IROA 4R90H 1NUDA 1LHZA 2VE6B 4NPYB 3TBSB 2YUZA 4PJ9A 1WEJH 1J05A 1P5UA 4DN4L 2H2PC 1AHWB 1T21A 1ZVSA 3UTSD 3MRRA 2YR3A 1A14L 1G7JB 5GGRA 1A9BA 3BKCL 4JLRB 3AM8C 3BHBB 3O4LA 3JWDH 3SO3B 4C83B 4LLAA 3V5DA 4XPGH 5EWIH 2AKRA 3SBWC 4C56E 4JFEB 1J87A 1YEEL 3IJYA 1YZZA 4YGVA 4X6EA 1CFTB 3M17A 5SWZE 3ZYOA 1HK6A 3C9NB 2KUTA 4HKBA 3PV6B 4O2EB 2ZG1A 5IHBA 3GDBA 3FQTB 2ICES 2PYEE 1HXMB 3LH2L 3HG1E 1WFNA 3EUUA 4XTRC 1QBLH 1QEWB 1OQOA 4GXUN 3QO0A 4P4KD 5F9JA 1XAUA 2VE6A 4NPYA 4WTXA 2VIRB 4XP6H 3TBSA 1MNUL 3SOBL 3C08H 4WV1B 2PUQT 4QOKD 2J6EL 5ITBH 3IVKA 1L7TL 4ZXBB 3V4VH 1G7JA 2D31B 1WEJL 2NXZC 4JLRA 2HMIC 2AEWA 3BHBA 3BH9B 1V7NH 2EEBA 4XNZC 5HI5D 1WF5A 4C83A 4RAUB 1OF2B 1WICA 3DPBA 5FOJA 4WFHE 1ZWIB 3QSKB 1T80A 4JFEA 1CFTA 3JWDL 3C9NA 3BAEH 1UWGL 4NRZA 3PV6A 4O2EA 1E4KA 4XPGL 2Y7QB 2ZCKL 3FQTA 3LPFA 1KLUB 1R5WB 5FCSH 3CZFB 4NKMB 4OZHF 1KTLB 3UO1H 1KB5B 4X6CF 3LQZB 3VRIB 4OGYL 1RPQA 1EEYB 1QBLL 3I3BA 4Z0BH 1ACYH 1RU9H 2EDXA 3L3OB 3PV7A 4XP6L 3TP4A 4ZXBA 3OL2A 2AERT 5C0AE 5CD3B 4JO3H 5A2FA 2D31A 3C08L 4NQEB 2NY3B 2V5TA 4NQTA 4NOFA 2PNDA 4YC2B 2WQRA 3CDCA 1YYLH 3V4VL 4RAUA 1U8IB 3NIGE 5DK0B 1OF2A 2D7NA 5F93C 2YRZA 2HTKC 1ZWIA 1V7NL 1JUFB 2R4RL 2FRGP 1BJ1H 2Y7QA 1YPZE 4P2QE 3CFIC 4M7JH 1KLUA 2V5SA 2VLRD 2AJSH 3AY4C 4UV4L 1R5WA 3HCVB 4NKMA 1KTLA 5IG7B 4DUVA 1GCFA 3W39B 4YHIA 3LQZA 3VRIA 5F7WC 1EEYA 5I16B 4K7PY 5F7YC 4OGAC 2DM7A 3TJEL 3K81A 3QDMB 1IE5A 3UO1L 4H1LH 3KXFD 2BHUA 3DI3B 1K3ZA 5JHDD 2ZUWA 5IVXE 2VLJD 4NQEA 4OCNC 4Z0BL 1PVHA 3B8YA 4CMHC 1NCCH 1ACYL 1RU9L 1BVZA 4EBQL 4HWNA 3NA4A 5T1LB 2ORBH 3PNWA 3BH8B 1F58L 1U8IA 5DK0A 4YX2H 1TQCC 3PWJB 2Q6WB 5A3IC 5DMGC 1JUFA 4UNTA 4M6AA 4ZDHB 4TQEH 3S35H 4TULL 4XH2B 4EXPX 1QFPA 5D5MB 3EDFA 4GBXB 4JO1H 3CD4A 3QQ3B 3RWHB 4K8RC 3HCVA 3DX8B 3MUGA 3RWCB 1KCUH 2QADC 5IG7A 3W39A 5DT1H 3NIFE 1YY9D 3VXUD 4YHYB 5I16A 4K94C 2AJSL 1HYSC 4NQVB 1N6VA 3HAEB 5AYUH 1R6VA 3QDMA 2XG5A 1UEMA 4AL8H 3Q6FB 5E94B 2IBGA 4PREB 2EDFA 2IQAB 1MCFA 1MCRA 4G6KH 4PLKC 3HS0B 1U42A 2QSVA 3V9FA 2I9TB 4MB5A 1S78D 2Q6WA 3SE3A 3EOYG 3Q2CA 1D5IH 1MFNA 3N0PB 4KI1A 3VMPA 4DVRL 3DTXB 3TESA 4ZDHA 2ORBL 1WJ3A 4HFUH 4XH2A 4YX2L 5D5MA 5DS8B 1ROWA 4GBXA 2CDFB 3D6GA 1UA6H 1IGIH 3QQ3A 3RWHA 4MMZC 3DX8A 1S7TB 5DRZB 1YEDA 4GO6B 3S35L 4R97B 4KI5C 3DETC 4JO1L 3U79A 1BREA 3FFCB 1R3IH 5DJ2B 4NQVA 5CIPH 3QIUB 1KCUL 3MV7E 1S3KL 4HS8H 5T3ZE 4OFKA 5CJ5A 5IHZB 1CLZL 1MAMH 1CE1H 5E94A 4PREA 1TVBB 2IQAA 5AYUL 3RGVB 4E41E 5JW4R 3TBYB 3HS0A 3S88H 3MLWH 5DGQA 5F1NB 5T1KD 2WP3O 4AL8L 2I9TA 4UNUA 1I8LC 2FEDD 1E4XH 4G6KL 1QFWI 4NCC1 4YGAB 4OGZA 5TH2B 4YDKH 1CICC 3DTXA 3UPRA 1EA9C 4OZFG 2HKFH 5DS8A 5J6HB 2X9YA 2CDFA 4XCEB 2Z8RA 3EOBB 3A0OA 4I0CC 3DURB 2VR9A 5DRZA 1S7TA 4U1SB 3WUWB 1RY7B 5EZOL 2YD6A 3U30C 4LDLB 2MFNA 2WBWB 3LEVH 3KPTA 1KN4H 2NXYC 4MQXC 1IGIL 4V1DB 2Y72A 1PAMA 3FFCA 5DJ2A 5L6YH 3TVMC 4QY8B 4WTZG 3QIUA 1N4XH 1UJTA 5IHZA 3VE0A 4TUOB 4L29B 3AXLA 1G0YR 3GSXB 3RX8A 1TVBA 4QHKJ 3RGVA 4P2RE 4Y5VA 3TBYA 1VFAB 5F1NA 1YEHH 1OSPH 3DBXB 5ANMA 2MQCA 1MAML 1CE1L 5AZEL 1GGIH 4KRNA 3S88L 5JW3H 3MLWL 1U8QB 4GT7A 1T89A 3UXFA 1OPGH 3REVB 1LK2B 5J6HA 3H0TB 1CFNB 4XCEA 5CEXB 3EOBA 4OCMC 3C60B 3DURA 3EIFA 4U1SA 3WUWA 1WSST 4OCLC 4UOW1 5F71A 2HKFL 4EN3B 3MV8D 3QFJB 4URTB 4PJDB 4QY8A 4XC1L 4R6UA 5GRXG 4FG6C 5GSVB 4TUOA 1FZOB 4L29A 1KN4L 4NQDD 3GSXA 5KZCD 5L6YL 2XG4A 4OZ4B 3ULSB 2F15A 3OJDB 1N4XL 1T1WB 4JB9L 4OIBA 1C08B 1DVFB 4RDQF 4XHJD 3MFGB 2MCG1 3OG4B 1VFAA 4GQ9H 3DBXA 4KJYB 3EJYD 5E8EB 5HGAA 3VXOB 4PJFF 4G80B 4W6YB 3U0TB 3WO3B 3RFZC 3QZWG 2VQUA 3FN9A 5E4EB 2BNUB 4PJ7E 3HNTL 1U8QA 4Z95H 1OSPL 1CR9H 1BGXL 1D5MB 3REVA 4PP1D 3WE6B 3UBXI 1GGIL 1CFNA 5CEXA 1H5BB 1TLKA 1QKZH 3PL6B 5JW3L 4G5ZH 3MRNB 3GO1H 5ICXB 3OKMB 4BUHA 1OPGL 3QEUB 3MZTA 3TT3H 4EN3A 1JL8A 3ELAT 1KYOK 1F2QA 3QFJA 4HCRA 2BFVH 4PJDA 5CBEB 1HOCB 3QDME 2OX5A 4D9RD 4XNXH 2OYPA 5GSVA 2SEBB 1KCLA 1TETH 4HGKC 5LVEA 2P42B 1EAPB 4NOBA 5KOVC 4OZ4A 3ULSA 3K8KA 1T1WA 1C08A 3OG6B 4GRWH 4UTAL 4KJWC 4G6FB 4KJYA 3VXOA 3SEPA 4BZ1H 2L7UA 4G80A 1UYWH 3U0TA 2X9XA 4MNQB 5CEZH 4Z7WE 5C9KA 4UV7H 2BNUA 4OLVH 4PJ8C 1F6FB 4NM4H 4GQ9L 1OW0C 2XWBB 1CDUA 1U8JB 3WS6C 1D5MA 5D5ME 3WE6A 2C4XA 2BCKB 1I85A 2R8SH 5FM5O 1H5BA 1CVRA 1XZ0B 3JUZA 3W5NA 3PL6A 3QIBB 1AO7B 1V5JA 4J3TA 3MRNA 1CR9L 5ICXA 3OKMA 4IRJC 3QEUA 2B4CL 5SV4A 1CDJA 3T3MF 4OF3A 2QHRL 2EIDA 1QKZL 5CBEA 1AR2A 1FVDA 4U1KB 1RJZB 4G5ZL 1HOCA 3GO1L 3KPPB 3NFSH 3NAAH 1S7XB 1OP3K 3TT3L 2FWOB 1U3JA 2SEBA 1JWSA 3T65B 5JIHA 1FC2D 1EAPA 1TXKA 4UT6H 4OGXH 3TH2T 1L4IA 2J8HA 3V79C 4XNXL 2IPKB 4OKVB 3JVGC 2FJFB 3MV9B 3O11B 1DQTA 3BPCB 4MNQA 1INQB 3VFRB 1QNZH 4QF1B 2W38A 2AXGB 2XWBA 1U8JA 4LSDA 4H26B 3GFUA 3EO0B 4S1QH 3OR6B 2BCKA 4H5SB 3TIEB 1UYWL 1MF2H 5E4IA 5CEZL 4MDJB 5I8KH 3SO5A 5SWQB 1XZ0A 4OCXH 3DVNB 5F89B 3QIBA 5F7FA 1AO7A 4AY0A 1P84J 4NM4L 2VSDA 2DLIA 4Y5YB 1FYHB 2R8SL 3MRGB 3G9VA 1T04A 4U1KA 1RJZA 3D87B 3HRZB 4O02H 4X5XB 1TPXB 5JZ7C 2CMRH 3KPPA 2YRPA 1R3JA 1S7XA 1NC2B 2FWOA 3H3PH 3T65A 3V0WH 4WEMB 5FF6B 2J7LA 4Q9BA 3RTQC 5C0FB 4WFEE 5KTEH 4ALAL 1CFVH 5I8CB 3NFSL 1N3NB 5F7LB 3PF2A 2HJKA 2FJFA 3MV9A 1DBMH 3AVEA 3O11A 2HA1A 3BPCA 1INQA 3VFRA 4UT6L 4QF1A 4OGXL 5IBUB 2AXGA 4Y1AE 4OCYL 2AV1B 2FX9L 4F33B 2DKSA 4ENED 4H26A 3EO0A 3OWEA 3OR6A 3UTOA 4LQFH 5SWQA 2Q20A 4MDJA 1QNZL 1H3WM 1NCBL 5F89A 3C6LC 3L3KB 2Q87A 4U1NB 4N1HB 1KEGH 1MCQA 4S1QL 2HFEB 3K80A 1FPTL 1MF2L 4M43H 4P9HC 4V1DE 5F9DC 1X4YA 3MRGA 4OCXL 5JMOC 4ONFH 4UDTB 2JTDA 3HRZA 4X5XA 1HKLL 3AAZB 4R7NA 1NC2A 1QP1A 4HKZB 5FF6A 2I5YH 5C0FA 4O02L 3ULVE 5KW9H 2WM0A 3V7MA 5I8CA 3HMXA 3FQRB 3HA0A 1N3NA 1BLNB 3H3PL 3V0WL 1JRHI 4YLQT 1S9KC 4NKDB 2JJVA 3QG7H 5KTEL 2AV1A 3KPSB 4FZEH 4F33A 1DBML 4HWUA 2IBBA 4RFOH 2DM4A 3SQOH 1UG9A 3L3KA 4U1NA 1U8NB 4XP1L 2UZXB 4LPUA 2NY2C 4LQFL 4UBDC 3DXAB 4PJDE 4RMWA 4UDTA 1EFQA 4I0PC 5IKCB 4JY5H 5KVDH 1SBSH 4OQ1A 4PRBB 5DVOA 4CU6A 1CDBA 3AAZA 3WN5B 3ARRA 2Z31D 1KGCD 1YNKL 3H9YA 2EH8H 4M43L 4HKZA 3GIZH 4ONFL 1BWMA 5FM8A 2G5BB 2VLKE 5J9PB 3FQRA 3HN3A 1BLNA 4HUKB 4AEIL 2X4QB 4QNPF 3TYGH 3VI4F 1WWBX 2RFXB 4QWWC 4WDIB 4NKDA 2IAND 2I5YL 2R0KH 4U2ZA 5KW9L 3WFCH 3MRIB 1TVDA 4JRXD 4M7KH 3ARVA 2XPGB 2XZZA 4F9LA 3KPSA 4PIRF 4IIQB 1J8HB 3I02B 5CJXC 3KJ4C 3RVWD 3QHFH 3QDJB 2HTLD 1DQQB 4FZEL 3ULUD 4JRYE 4KVCH 3HE7B 4P3CH 3MRMB 3BQUB 4NZJA 4RFOL 4XCFH 2XRAH 3LB6D 3SQOL 3DXAA 3E3QC 2ZCHH 1YQVL 4FQIL 5IFHH 1T0MB 1ZSDB 4EOWH 1M05B 2C3HA 2G5BA 4JY5L 5KVDL 1U2HA 4Q0XH 1JNNH 1T5WB 5J9PA 5J89A 2X4QA 2J3SA 4RBPH 3AROA 2RFXA 4WDIA 1NSNL 2EYRB 4H0IA 3WFDL 4MNQE 1NDMA 1MHHB 3MRIA 2XPGA 1XT5A 1WBYB 4LCWB 5IP4A 5JOPD 5D1ZD 1L0YA 5GJSH 4IIQA 4MB4A 1TQCB 3QDJA 4ZUSB 1AO7E 1MQKH 4DGVH 1AH1A 1DQQA 2J5LC 4YHPB 3HE7A 1EHAA 1I7RB 3MRMA 3BQUA 3DROB 4FFZH 4TNWK 4TTGA 5F7KC 1I3GH 3QHFL 1WT5A 5CKGA 1E4WH 4KVCL 4YHZH 4P3CL 3AY4A 1T0MA 2K3TA 1IAOB 1ZSDA 4WY7H 5TE4H 1J8KA 4NHUB 1BQUA 2ZCHL 1M05A 4JG0L 5IFHL 4P5MB 1NGPL 1T5WA 4QRRD 3G5VB 4CL7A 4EOWL 1NEZG 2EYRA 5CP3A 1MSPA 5KS9B 4M03A 4Q0XL 1MHHA 3O8XC 1JNNL 1AR1C 3QXAA 1WBYA 4LCWA 3EZJB 4UILH 2OL3H 3CIQA 3C8HA 3UTTB 2ZCLL 1IAIH 4NWUH 1A21A 1XGQA 3RWJB 1DZBA 4ZUSA 2UY6A 4OI9A 1HHIB 4OLUH 2XYCA 4R8WH 4YHPA 1I7RA 5GJSL 3MLXH 3DROA 1WISA 1A1NA 2MTPA 1J1OH 4DJMA 1MQKL 4DGVL 4HD9A 1IAOA 4FFZL 5CZVH 2H1PH 1HIMH 1HSBB 1WUNT 1FYTB 2VDQH 4G3YH 3S3JA 1Z3GH 4G7YL 4M9PA 5DC0A 5EUOF 4P5MA 1I7ZB 4PLNC 5C0JB 1JNLL 1F2XK 3ZE0F 3G5VA 1C5BH 3AUVA 4WY7L 3ZDZE 3DRTB 2NNAB 1LD9B 1FBIL 5KS9A 4CN6A 4HZAA 4P23D 3ZTJH 3U0PB 2E9JA 5GS1C 4FS0A 1BFVH 1DN2A 3UTTA 4TRPL 1NGZB 3RWJA 4LSQH 5HY9B 3LRGA 1HHIA 4AYFA 4IJ3C 3D2UB 2OL3L 4M6ML 1CICB 1EJOH 4WI6A 4NWUL 4I9WE 2O5XH 3RY6A 1KULA 1P1ZA 2HT4D 1B3JA 3K0WA 3CH1B 4R8WL 3MLXL 1JHKH 1M7DB 2C3GA 4GRWB 1HSBA 1BQHB 4ZTOH 5J3HD 5TPWH 1FYTA 1J1OL 5HI5C 2NXYB 1I7ZA 2DYPD 5BW7C 5C0JA 2JJWA 4OZFH 3TVMB 4OFYA 1MUJB 3RVTD 5CZVL 2FB4L 1HIML 3DRTA 2NNAA 2BY0A 4G3YL 1LD9A 3GRWL 4KTDH 1PGRB 1Z3GL 4R26H 5I1DB 1LO2H 3U0PA 3KPSE 3S5LG 1KC5H 2P49B 4B5EA 2YOCA 2P5WB 2H45A 4GLRH 3GBMH 3I2CH 4KRMB 4WWID 1NGZA 2FJHB 3T4AB 1S7RB 1I1RA 3BZFB 4LLYB 1DQMH 4XPHL 3QEGH 2AEQH 1MCWM 1I8LA 4JFQB 2VQ1B 1X5JA 3D2UA 4JHAH 3QUXC 5EO9B 5HI4C 1CICA 5I30H 3DYPA 5AAMA 3UBXG 2ZNWA 1VGEL 3TLRA 1OGAB 5F1IB 3F58H 4XMKL 3F6LA 4XX1E 4HUUB 5D2NC 1UWEH 3CH1A 4YIQB 4OIAA 3X13B 1M7DA 5DK2B 1EJOL 3KVQA 4XPAL 3UJTH 1DE4B 3OKYA 1BQHA 2O5XL 3OB0K 5EZLB 1QACA 4JFFD 3EO1B 1JHKL 4XVSH 5FKAB 3TVMA 3BW9B 1W2KT 3PP4L 5TPWL 4MXWH 2FJGB 1QRNB 1MJ8H 2MHAB 2CUMA 1F4AA 3GSWB 2VUYA 5GGSY 1J8HE 2P5WA 5CLTA 1Q94B 2F8OA 2YD4A 5C0BD 1J0IA 1ZHBB 4KTDL 3RIFK 4R26L 5FHBH 3T4AA 1LO2L 1BIIB 1S7RA 4MMXC 3BZFA 4LLYA 1OB1B 3VFSA 4JFQA 1DSFH 4B7LA 5DUPH 5IF0B 5EO9A 4KKBD 4XP5H 2WP3T 3GBML 4GSDH 5DDHB 4NWTH 3V5HB 4X7SH 1OGAA 1WK0A 2VDPH 5F1IA 3QEGL 2AEQL 3TGXA 4HUUA 4YIQA 4JHAL 2E8YA 5DK2A 3IT8D 5LGHH 1DE4A 2BVQB 1OTSC 4TSCH 5EZLA 3ARSA 4HWBH 3EO1A 4M00A 5FKAA 3BW9A 4JGUA 4JFPB 4C4KT 1T20B 3QI9D 4NRXA 2B20A 1JZ7A 1B4JH 3UTQA 2FJGA 3W2DL 1QRNA 3ILQD 3VD3A 5C0GB 5GIRB 2CR6A 2BHYA 4JRWA 3GSWA 1Y0LB 1NUNB 2R1XB 3B5TA 1KYOJ 1Q94A 1A4JB 3HZVB 1ZHBA 5D6CB 5IMLB 2R9HD 1FNGB 1JWUB 1BIIA 1MJ8L 1CT8B 1OB1A 3SDAD 5IF0A 4PGDB 3LQAH 1IEBB 2AJXL 2V9TA 5DDHA 3V5HA 5FHBL 3O6FD 1YMMD 1VEPA 4NNPH 4Z78B 1DSFL 5DUPL 2W9EH 4XP5L 4N0CD 4PRHE 4GSDL 3NCYP 4NWTL 1EFXD 4J3XA 2VDPL 4HMEA 4X7SL 5MHSD 4Y19D 5DZNA 3B2VH 2VTFA 1BD2D 2XKNB 3QEQB 4YR6B 4NO3A 4JFPA 5LGHL 1T20A 5C08D 4LGRB 4TSCL 1MFEH 4WRLA 4HWBL 3PJSB 1U6AH 2DM3A 1K6QH 3OPZL 2CDEB 2FH6A 1CFBA 5C0GA 5GIRA 2DICA 4GJTB 3P2TA 5KANI 1Y0LA 2R1XA 4PJHB 3O0RH 5E1AB 1A4JA 1B4JL 3HZVA 5D6CA 5IMLA 1CVSC 2LVEA 5HHMD 1FNGA 1JWUA 4LASL 4OLZH 4ZO8A 1MCSA 2G9HB 1CT8A 2V2TB 4O4YH 7CGTA 4NRYB 2QQKH 1YEKL 2CLZB 1IEBA 4FXGA 4NCC2 1H0DB 4MJ5B 2FO1A 3WS6A 3EFDL 1CLOH 4MCYA 3G6JB 2HVKB 3NZHH 4HZLB 4KK6D 1XIWC 2HYMA 5EU3B 3ILPA 4LCYB 3ZDYE 3HB3D 2ERJB 3IFPB 2BC4B 1FYTE 2UVEA 4U3HA 1I75A 3VWJD 1CF8L 4N68A 4TNVF 4NNPL 2XKNA 3JWNC 3QEQA 4YR6A 4M1GH 4NBYB 2W9EL 1F6AB 4EI6B 1Q9WB 4X9FA 2FEDC 4LNVA 4UQ3B 5C0RH 4WU7B 3PJSA 4C59B 1Q38A 4AZ8A 1L0XA 2CDEA 5DR5H 5E56A 43C9B 1U58B 3OKDB 1CL7I 3O9WB 2X4SB 2OJEB 1MRFH 4PJHA 5E1AA 1MFEL 1KT2B 3JVGA 3TNNB 4L9LB 1U6AL 1K6QL 1JV5B 4KY1H 2G9HA 5DA4A 3TBVB 5DHYB 5I1EL 4APQD 2CLZA 1NC4B 3NCEB 1HHKB 3O0RL 1J7VR 3T08A 4UIKH 1H0DA 5D1XD 5FIEA 4MJ5A 4OFDA 1FIEA 1JZ3A 4OLZL 5TGBB 3G6JA 4UTBH 1AKJA 1G9NH 1RSFA 2QQKL 2HVKA 4JCMA 4HZLA 4P49A 4YZFE 1X5ZA 4GRWE 4TTDC 5EU3A 4G6MH 4YBQD 3IFPA 2BC4A 2A74B 1OAUL 4U1IA 3MCG1 1J12A 4Y16B 4QT5A 5CEZE 4P4RA 3DUHA 4AEHL 1AGDB 4EI6A 1Q9WA 4NBZB 4RCAA 3PGCB 1TNMA 4UQ3A 4WU7A 1KLFA 1CFSB 1EV2E 2CSPA 43C9A 3OKDA 4GG6B 1ZGLM 3O9WA 1IM9B 2X4SA 2OJEA 2P5WE 3SHSA 4MVBC 5C0RL 1KT2A 3EJZD 3TNNA 4L9LA 5M7QA 5DR5L 1JV5A 2DTML 3TBVA 1OP9A 5DHYA 4MDIB 3BGFC 1MRFL 1A7PH 2QR0B 4ZPVB 3SE4C 1JPTH 4O9HH 1A6AB 2Y5TB 1BJ1J 2YZ1A 3O45B 5TGBA 3DMMC 4RBPK 4UAOB 5HVWA 3E8UL 4RRPG 5JORB 2FYYB 1J0JA 3P9LB 1QRKA 2E5EA 3SCMD 2A74A 3KNBB 1GZQB 4XHJC 4UTBL 4Y16A 5CUSH 1JNJA 3EJYC 4D9LH 5HVFB 1AGDA 3HPLB 4G6ML 4N9GB 1CGYA 3PGCA 2EYTB 4N1EA 2PO6D 1F5WA 3H9SB 3N1QC 4C56D 5J7CC 1A7QL 3BP6B 2UUDH 1CFSA 1QRNE 4CADB 5DMIH 1S9XB 4GG6A 3JV0A 4PP1C 1IM9A 2VZ1A 2X4TA 5JA8B 5HYSG 3BWAB 5JXED 4MJ6B 2IF7A 1HYRC 2PYED 2MJWA 2OMNA 2B8OT 1NGXB 4JREC 5L8LB 2A1WH 4MQSB 4OM0H 1UWXH 4MDIA 4RMTA 1T66D 4OF5A 3CNKA 2QR0A 4ZPVA 3P3YA 5AAWA 3PE9A 1V3MA 3MC0A 3O45A 1HNGA 2QL1A 2XACC 1NANI 3ZL4H 2IADB 4KUZH 3Q5YA 4G42B 1A7PL 5JORA 3TYFB 2FYYA 4O9HL 5D2LB 3WLWC 3P9LA 2YD7A 1XH3A 1JMXA 3KNBA 1GZQA 3D25B 5F3HA 3QPQD 3MXWH 2EDHA 4HJGB 5DRNA 4FRWA 4WI5A 2VZOA 1T1ZB 4AQOA 3HPLA 4Q6IC 3V4PH 2EYTA 1QYGH 1VACA 1I9JH 5HD8D 4WFHD 4BSWA 4CADA 5CUSL 1DL7H 3BE1H 5I73B 1S9XA 2IH3B 3QNZA 3BWAA 1J0HA 1CI5A 1EPFA 3JWOC 4MJ6A 3VFWB 3MJGX 4U4BA 4OZGE 4C58B 4FNLH 4F7EB 4BZ2H 1NGXA 5AG8A 4YDIH 2YD2A 5E70A 3IKCB 4KI5F 3G04B 5CJXA 4PJAE 2A1WL 4BFIB 2APWA 5AUMB 2GITB 2IADA 4S0SD 4G42A 5T3XL 3TYFA 3QHTC 3NMEA 4OZFB 5D2LA 2J5LB 4ZYKB 2PTUA 5C0AD 5FM4A 4XB7A 1A6ZA 3D25A 1JZ8A 1B9ZA 5DJCB 4NGHH 5I1AB 4HJGA 5F8RC 2CDGA 3QEQE 4EJ1C 4PJFE 3ARUA 1I1AC 1T1ZA 2YPLD 2IMMA 5H94B 2ZJSH 3SDCD 3FO1B 5DEFB 1GGTA 1U3HB 3HUJF 4LAQL 3ZDXE 3T0ED 1A6WH 2IH3A 4HC1H 4P46B 5DF0A 4D3CH 4P2QD 1GPOH 1T2QH 3VFWA 4XVUD 2KKQA 4F7EA 1T03H 5C0CB 3BE1L 5DD5H 4DGIH 3T1FB 1KXVC 3VW3H 3HMWH 25C8H 1HHHB 2GAZB 3BIBX 3KHQA 3IKCA 5DD6B 3G04A 1FRGH 4BFIA 5AUMA 5E5MA 1MI5E 4X6DB 1VADB 1KOAA 4ZYKA 1MJUH 1HZHH 3PXJA 2YUXA 2A83B 4YK4C 5I1AA 4UMGA 3IJHB 4KKAC 5EU6E 2A2QT 3UTSB 2ATPB 5H94A 4JKWA 2Y06H 3FO1A 5DEFA 2VR5A 3TZVC 3OKEB 1INDH 1U3HA 4NGHL 1QFWH 5DQJB 4WTZA 3GJEB 3QFDB 2NW3A 3RIFF 4P46A 1ZLSL 4KQ3L 1KNOB 2ZJSL 4HIIA 4BK4A 1JGDB 2HRLA 2FHFA 1EO5A 3MNZB 5C0CA 5D1QD 3MACL 3T1FA 2XICA 4HC1L 1HHHA 5IR1B 3VG9B 3P30H 4D3CL 5E8DH 3RL1B 4L8SC 2GAZA 2BERA 1LNUB 1GPOL 4X4ZA 3C5ZD 1JZ5A 1ZS8A 1T03L 4GMSH 3QZWB 3VW3L 3FHQA 3HMWL 2H3NB 4P4KB 3IETB 4X6DA 1VADA 4G8GD 3LKRB 4YPGA 1FRGL 2J8UA 5F7DB 3HHRB 3QO1A 4X5WB 5DURD 2A83A 4QOKB 3ZTNL 3IJHA 3QQ4B 3UTSA 3VG0H 2ATPA 4PJXB 2RQ8A 1HZHL 3OKEA 3N9GH 3RVXD 1NFDE 5DQJA 2VKXA 3GJEA 5LWYH 3QFDA 4NNYB 4RWYH 4U6YB 1KNOA 1Y6NR 2Y06L 1INDL 1JGDA 3QIWC 1QFWL 5F44A 3MNZA 4ZSOB 5IR1A 1MCLA 1TTGA 3RL1A 4JN2B 4PR5B 1LNUA 3BP5A 4KGLA 3U7YH 1CS6A 2O5YL 5CINL 3O3EB 5DMKB 1M4KA 1EERB 3GBLA 4GS7C 4HPOH 1DBKH 5JW4M 9CGTA 2Z31C 2H3NA 3MV7D 5E8DL 5T3ZD 1IJ9A 4P4KA 3IETA 2YPVL 4BELD 1RUKL 1S7QB 3LKRA 5F1OB 4BH7A 4GMSL 4X5WA 1QO3B 4E41D 4KPHL 4J2XA 4QOKA 2R2CA 3MJ7B 1K2DB 3QQ4A 5D2NB 1MCJA 4MGXA 1TNNA 2DQJH 1KJVB 1M7XA 2BNRD 3H9SE 1V8HA 1FE8H 4MX7A 2AK1H 3MV11 4RQQB 3BDYH 4I77L 5CJOL 4NNYA 1U92B 3RVWC 3UDWC 4HQQH 4U6YA 1ZTXL 5C2BH 4HBCH 3N9GL 4X7TB 3T0BA 2HTLC 1J18A 2YD3A 1K5NB 3MRDB 3O2DL 4ZSOA 3REWB 4ELKB 3ULUC 1FAIH 4RWYL 1IGJB 5DSCB 2OK0H 4PR5A 3ZYZA 5J8OA 3MLYH 1WWAX 3DV6B 5DMKA 4MD4B 2VLRB 3H7LA 3B8SA 3WJJC 4MAUL 5JLZB 4JGMA 4XNQB 2JCCB 4PGZA 4AG4H 2YMXH 3C2AH 1S7QA 3U7YL 5D96C 1OY3B 5GS0D 1QO3A 4HPOL 1DBKL 1IC4H 3KGRA 5E8PB 4P2RD 3TO2B 2HKHL 5EPMB 4JR9H 4K94L 3BOVA 1VFBA 3MJ7A 1KEMH 3RNKB 5IB1B 5D2NA 5JHDB 3K4DA 4F80A 1OAXH 2VLJB 3K46A 4RQQA 32C2B 4S1DD 5D1ZC 1HQRB 5B3NA 1U92A 4JDTL 5GZND 1DANU 1RZKH 4FZ8H 4KDWA 2Q7NA 4N1CA 2DQJL 3RKDC 1JHTB 3G6JF 1FE8L 5H35B 2DQIH 1K8DB 3BDYL 3REWA 3MRDA 1K5NA 4ELKA 3V2AR 2WINB 1IGJA 5DSCA 4HQQL 5KANG 4AM0B 3D9AL 5C2BL 4PLOB 4HBCL 4ORGB 1D6EB 4MD4A 2VLRA 5E6IC 3KAAA 2PW1B 2OK0L 5F6HI 5JLZA 2Y36H 3ARGD 4XNQA 2JCCA 3VXUB 3WDHA 3MLYL 1IGMH 2M1KA 4GW4B 5I66B 1BBDH 3TO2A 3VI4E 5EPMA 4ELMB 2EDDA 3IXTB 3LPGA 2F58H 3KXFA 3RNKA 2YMXL 3C2AL 5IB1A 5JHDA 3TV3H 3DARA 1WIPA 5J12B 2VLJA 4HJJH 1ZMYA 32C2A 4IEFB 3EDEA 3VFPB 1HQRA 3QXTA 1UCBH 4JQIH 3TEUA 4BQ8A 5CFHA 1OAXL 5F1KC 1JHTA 4X0KB 3W81A 5H35A 1K8DA 2X4UA 2WINA 1HWGB 3FZUC 4FZ8L 1PX3A 4AM0A 3QXVA 1TMCB 3F65A 4ORGA 1D6EA 3S37X 3OGOE 1AIFB 2PW1A 2EXYD 3LKPB 3VXUA 4GW4A 4P59H 5KSBB 4DGYH 4Z77B 4Z7UE 4ELMA 5EU5B 3IXTA 3UTSE 4YFLF 5T1LD 1IGML 3B6SB 5F9WC 2DLEA 3DX7B 3KWWB 2BXYA 3CFBB 5E00B 3FB6B 3VFVB 4FQ1H 4OFPA 5F70A 2Z35A 3VFPA 3F6IA 2F58L 4HT1L 4N5UA 1LO3L 5T1KB 4HS3B 3TV3L 3OBAA 3WHE0 4X0KA 1WVZA 1TCMA 4HJJL 4CU8A 1BP3B 2QSTA 1UCBL 3VGAC 4JQIL 4C57C 2W0FB 4DZBB 4G6AC 3GEWB 3H7BB 4K9EC 1AIFA 3EYQD 2IGFH 2UUDK 4U6VH 5HYQB 1FFOB 2H41A 5KSBA 1NFKA 4Z77A 1PKOA 3F7PC 4DFHA 1AQDB 4QOKE 5EU5A 2VDNH 4TN9A 3RVTC 5D7JD 3SE8L 1JRHH 1DLFL 3QUZC 5CGYC 5EOCH 2V9RA 4U1GB 4PJXE 3EZ8A 4P59L 3RPKA 3DX7A 3KWWA 2HFFB 5E00A 3FB6A 4DGYL 3VFVA 3S35X 3TPUB 2K7PA 3KLHD 4RMVA 3SY0B 5T1KA 4HS3A 3ARBD 5E2VL 4OLWL 4FQ1L 4WIQA 4L1HA 4TUJB 4KJQC 3BDXA 1VGKB 2NTFB 5D2LF 5C1MB 4IRZH 4FMFA 5E08H 2W0FA 4L3EE 1KCSL 3BJLA 2CLVB 4DZBA 1X5HA 3SQBA 4PGBB 4HW6A 3H7BA 4AIZA 3NCMA 2IPTL 1MCEA 5EBMB 1EXUB 4LARL 3KPOB 4O2FB 3O2VH 4RGOH 5DJ8B 5HYQA 1FFOA 1B0RB 2WIIB 2QKIB 3FN0L 3MV8B 1UM4H 4FP8L 2BVPA 4WFED 1AQDA 5JHLH 2NLJB 1AD9B 4POUB 4NQDB 4GFTB 4OCWH 5KZCB 2HFFA 3I6LE 3HZYB 3TPUA 2VDNL 2CJUH 4Y1AD 5IUSA 1SJXA 3SY0A 4BM7A 5HXMA 1AP2B 5EOCL 1OL0A 5KJRL 4WFFD 3P11H 4EQ2A 3EDKA 3GI9H 1G0DA 4JVWA 3SJVD 4TUJA 4JZOB 1HH6B 2R0LH 4NKIH 1VGKA 2NTFA 4KKBC 3BMWA 4HH8A 4HUMB 1NEZB 2GJ6E 4KZDH 4WI8A 2CLVA 5FA3B 3H2WA 4V1DD 1MCOL 4PGBA 3GSVA 4YAQB 2VLRE 3EDJA 5EBMA 3MSPA 3KPOA 3Q5OA 3C8KB 4O2FA 5DJ8A 2JCCE 5HDLA 2WIIA 3L7EB 5TE7H 2QKIA 3MV8A 3N50A 2X09A 3SE4A 5D93C 4K23H 1RJYB 3ULVD 3QI9C 1T7WA 2NLJA 4RGOL 4JCLA 5JHDE 1EDQA 1PY4A 2VWEC 3IB4A 1AD9A 2FGWH 4NQDA 2CQVA 2FLRT 4Z7QE 4PTUB 3HZYA 5DJXA 2VXQL 5JHLL 5FV1L 2VABB 1IC5L 1AP2A 4JQXC 1LEGB 2R9HC 2ITDA 4PJCB 3SGDI 4OCWL 3Q6GH 3MCKB 4Q6IB 2OXGA 1F11B 4JZOA 2CJUL 1HH6A 3C60D 4JQVA 4X6DF 1FFNB 1RUAH 3P11L 4QRUB 1NEZA 3GI9L 3SKJH 3O6FC 2J8UF 5ISZE 4LP5A 5FA3A 3EO9H 5L2JB 2R0LL 4NKIL 4YAQA 3LV3B 3C09C 5I71C 5EULV 3C8KA 1IAMA 3RY5A 3VXUE 1YJDH 3L7EA 3V95A 1JE6A 4UUJB 1MWAB 2NY7H 2VLKD 2KBGA 3VWKC 4WO4D 4ZUWB 3H42H 3CLEL 5TE7L 3U46A 5CBAA 3JV4B 4K23L 3C8DA 4Z7OF 4PTUA 2AEPH 4PJGB 5C0IB 3FJTA 2VABA 1LEGA 5I1IH 1F4WH 4ISVB 2BVYA 2FGWL 4PJCA 4CJ0A 2EDJA 4D9QE 4H8WH 4TUKH 3T2NL 3MCKA 4Q6IA 1F11A 4YFEA 3BEVB 5BO1L 1FFNA 4XBGB 4JRYD 3WV0A 1IFHH 4QRUA 4L8BB 1EEZB 3Q6GL 1K85A 3OJVC 1MRDH 2UVFA 4NUJB 5L2JA 4UT9L 2EDWA 2XZAL 3LV3A 1PDKA 2DLGA 2XTJD 1F8TL 1RUAL 3HB3C 4M9OA 3S5LB 3SKJL 3VWJC 2B39A 2FNBA 3MLZH 4UUJA 1WAAE 1MWAA 5DYOB 1IGYA 2J1KA 5BXFB 4ZUWA 3MOQA 4LPXA 1YJDL 3UBXB 3JV4A 4F3FB 2NY7L 2XN9D 5I6XC 3U2SB 4KRPD 3T0AA 1ZXQA 4PJGA 5C0IA 4LHQB 4M7ZC 2MQ3A 3CMOH 3H42L 1UB5A 1E4JA 2AW2A 3PWVB 4DW2L 4ISVA 2VUOA 5DJYB 3DWTA 4ZAKC 4OLYH 2AEPL 4OZIA 1CXHA 3BEVA 4APQC 2DJUA 3V4UH 1C16B 2YXMA 4XBGA 1F4WL 5I1IL 1AQKH 3BPLC 4L8BA 4QO1A 4TUKL 1EEZA 1NAMH 2A9ML 3GJFB 4NUJA 1G7LB 4XP9L 4L8DB 2WUCH 3T2QA 4YXKH 1IFHL 5L9DL 5KVGL 5JQHC 5GRVK 4M6OH 4L8SB 4KV5E 1MRDL 1ZV5A 3RIAK 5DYOA 5BXFA 4ZUVB 5F7NC 2VDOH 4D8PA 5A2JH 3MOBH 3MLZL 3UBXA 4F3FA 5DJAB 4OB5L 1JGVH 1RZFH 3U2SA 1E27B 4PJBB 1H8SA 3UZEA 4Y4FC 2FBJH 3MUY1 3BPOC 3EJZC 3PWVA 3PHOB 4U1HB 4U0RC 5DJYA 3I3DA 3W82A 2ID5A 2I26N 3GJFK 5CP7B 1C16A 1JZ6A 1D9KD 2KQNA 3MA7B 5GRWA 4OLYL 3GJFA 3D39D 3MJ6A 1D7FA 4NO0D 1G7LA 1EMTL 2NY5H 5GGRY 4CU7A 3I85A 5ESVB 5IIEB 2XQYG 3G6DH 4BSVB 2DAVA 3T04D 2ZUUA 1QLFB 1H3VA 4L8SA 3NGBC 3B9DA 5SX5K 3V6ZB 3IJSB 4YXKL 4MS8D 3LEYH 2BNQE 4A6YB 4OFIA 3ARXA 1IKNC 2Z31B 1J0KA 4EZMA 2OP4H 4NQDE 4MA3B 3IFNH 4OUOA 3W0WD 4KZEH 4PJBA 4K7FB 5HYJD 3MOBL 3MRKB 3VRLE 3VDCA 1QPXA 3PG2A 3JUYA 3O6KH 1S9YB 3PHOA 4QGYA 4U1HA 1AI1H 2FD6H 1JGVL 2IANB 4IHOB 2W59A 1J1PL 1CGVA 4JRXB 4L5FH 2FBJL 3VXMD 5CP7A 3MA7A 2Y25A 4H88H 3GI8H 4CKVX 3V0VB 4ELMF 5CSZB 1A7NH 5IIEA 1JJUA 4BSVA 2ZPKL 5IJVB 3JSSA 3QPQC 1QLFA 2CIIB 3ARED 3V6ZA 3IJSA 3RA7H 4F57H 3G6DL 3QAZC 4D9RE 1Q8MA 3IAGC 4A6YA 2Q8AH 2X1PA 2Z31A 5I8EB 3LZFH 3IDJB 4MA3A 2CGRH 4LHUD 4RGND 4HFWA 5TDPB 4K7FA 3IU4H 3HE6D 3MRKA 4LSUL 2ADJB 1HSAA 2OP4L 1S9YA 4PJCE 3IFNL 2IANA 4IHOA 5D72L 3CVIH 4KZEL 4HS6B 5CMAB 4JRXA 1GH7A 5D7IF 5D1ZB 3ZE2E 3O6LH 3O6KL 5KSBF 1AI1L 1WBZB 2FD6L 4OLXH 3V0VA 3FRUB 5CSZA 4L5FL 4N5EC 2C4FT 1G9MC 3FHAA 3DJ9A 1BJMA 5IJVA 4H88L 3O3AB 3ECBB 1KUMA 3GI8L 4OAWB 2CIIA 4P2OD 5C7XH 1A7NL 1P4LA 2FECL 2C1OB 5F9OL 2ZUQC 1V7MH 5KAQF 4OD2B 3SDCC 3WJLA 3CSPA 3S34L 3WJJA 5I8EA 4ZNEA 4C55A 3IDJA 1UFUA 1FNEB 4CN1A 2I25N 3RUGE 4F57L 3RA7L 4PJGE 1MELA 1XGUA 3OXSB 4QRRB 1UKQA 2ADJA 2I9LB 3LZFL 3RX5A 2CGRL 1J86A 5T1DH 3TC9A 4OD1L 5CMAA 3IU4L 1PYWB 5D1ZA 2BRQA 3NFPB 3F7QA 5GGQH 2AJ3B 1MH5B 3WBDA 3FRUA 2A6DB 3ABZA 5CCKH 1S7WB 2UYLB 1MPAH 2D7TH 3O3AA 4OAWA 4OLXL 3CC5A 2CRIA 3OZ9L 4W68A 1CD8A 1PZUB 5DEGB 4OD2A 1PG7L 3AMLA 1M7IB 1OLZA 1H3XA 1FNEA 5C7XL 2F8XC 3TN0C 1JI2A 1GGUA 5L8KB 1CL7H 1V7ML 4QXWA 4WI3A 5IK3B 4R9HA 3OXSA 4QRRA 3WHE1 2I9LA 4Q9QH 5F9WB 4P23B 1DBAL 4YBLC 3C5ZC 3NFPA 1MH5A 4IRSD 3WXVH 1VPOH 2P48B 2A6DA 2JJUA 1S7WA 2QEJA 1FGVL 1D6VL 5HYSB 4PRHD 2BXZA 4CNIB 5HDOA 3B9KD 2R39A 5I9QB 5T5FH 2HLFD 3UZQA 1MPAL 4KQ4H 2D7TL 4Y4HD 1M7IA 1KV3A 5CZXD 3SGKA 4HUVB 3ES6B 5SX4I 3CLFL 5CZKA 2PR4L 2WNGA 4LPTA 2DYPB 4ERSH 5IK3A 3NH7H 4GAYA 4HIXH 4RRPA 2FO4B 1QVOB 5BOZG 2W91A 3SGEH 3RZCD 1CL7L 4P23A 4MAYD 4B7IA 3HC4H 3L3HB 2VISB 2HT3D 1XCTA 5ITFB 5T1MB 4Q9QL 2F8VA 1AE6L 1BFSA 1Y6KR 1DLHB 1KIQB 1AHWC 4JE4B 1MCKA 2CXKA 3ZZ1A 3GMNB 3Q48A 2CH8A 5DI8B 3RWEB 4CNIA 4P48A 1FNFA 3FAWA 3QXUA 1KGCE 1GC1H 4TVSa 15C8H 5T5FL 1HWHB 3ES6A 4HUVA 3VFNB 4Y89A 2H32H 4JFFB 4KQ4L 2DYPA 5HGGS 3U4AA 1T22B 1A6VL 2FO4A 1QVOA 1UZ8B 3CU7A 3MQIA 4NCDA 3BRFA 3QRGH 3D1MC 3I3EA 4JRXE 4ERSL 3LQMA 3NH7L 4HIXL 5IMKA 4JY4B 1RZGB 5FEBA 2VAJA 3ESVF 2VISA 1MREH 1B0GA 2OTUB 4WV1C 5C0BB 5ITFA 5T1MA 2ZOKB 3GM0A 1DLHA 1NANH 5EH1A 1KIQA 4LSPL 3BRDA 5DWUH 4ZXBC 3HC4L 4CDHA 2P44B 3VA2C 4HIHA 2EH7H 5GS0C 3GMNA 5DI8A 3RWEA 3QCTH 4YWGH 2VZ3A 5CEZD 4NUGH 5KVMC 4OZIF 4WUKL 3NCJH 5F7HA 4IS6B 3VFNA 4JFFA 5D93B 1T22A 2ICEB 1RULL 1TCRB 1GC1L 3QI9B 3BIAX 5I17B 1U8LB 1UZ8A 15C8L 1H3TA 2XY1A 1NAMB 2GEEA 4CW1B 1HH9B 4WGWB 3DUSA 5E2TL 1HQ4B 2KDGA 1TTUA 4JY4A 5JOPE 3CFJB 3SKOB 2DIJA 2OTUA 3QRGL 5C0BA 2A6KB 5MEPB 2R69H 2ZOKA 3TF7C 5F3BB 3IDNB 2XNAB 3SDAB 2BVOB 3D3VE 4J3UA 1T0PB 3CSYB 3QH3B 5C6TL 2NY3C 1W8NA 3NCCB 3NACH 5HHXH 4YC2C 5DWUL 3GMQB 3FRPG 3MYJB 3FKUS 4WWKD 2V2WB 5HHVL 1R0AH 1EFXB 5C71A 4Y19B 4IS6A 1BD2B 1XGRB 4NUGL 3QUMH 2ICEA 1TCRA 1GOHA 3QI9A 2IFFH 5C08B 1U8LA 5I17A 4H20L 4XVJL 3NCJL 5IB4B 1G7HB 1NAMA 3O2WH 4CW1A 2AXHA 1HH9A 3UP1A 5DHVB 2DBLH 3I84A 1CZ8H 4HG4K 1UACH 3K4AA 4ZFZB 1HQ4A 5HDQH 3CFJA 3NPSC 3GKWH 3SKOA 3OGCB 2A6KA 5MEPA 5HHMB 4F7CB 5F3BA 3IDNA 1SEQH 3ARPA 2XNAA 3SDAA 2BVOA 1A8JH 5E8OA 4GUPB 2HJFB 3EGSB 2C9AA 2EDRA 4RA0C 1RJCA 5JXAH 3VXPB 4PJBF 3O6FA 1CDYA 1F90H 1YMMA 3V7AG 3GMQA 3DI2B 1IILE 3MYJA 3ZSTA 3HLAB 3SE3C 2NTSP 5HHXL 2V2WA 4PBVC 1EFXA 4Y19A 2I27N 3VWJB 2YBRB 4PGEB 1BD2A 4F7MB 3WFZA 1XGRA 2W92A 4DK6A 4GBXC 3M1BA 2CKBB 4DTGH 5C08A 3GMOB 1R0AL 2V5RA 4L3CB 4HAGA 5DHVA 3BP7B 4AQ1B 2XKSA 3QUML 4ZFZA 4YHYC 3WEXA 4R96B 2HT2D 1P6FA 4F7CA 3O2WL 4K3DL 1MLCB 2MNUA 2IALB 3EYQC 1KTKE 5IBLD 2DBLL 1UACL 4X8JA 1U8OA 3L9RB 2HJFA 4GUPA 3VMOA 3ZKMD 1MRCH 4P9MH 4PJEB 5D1XB 3MBED 1X4XA 3VXPA 1NL0H 1SEQL 3I6GB 4UDUB 4NYLB 5D7JC 5I1GL 3MJ8B 5FFLA 3P77B 1M6OB 2EE3A 4YDLB 2DWEB 3L5JA 5E24E 5C0DB 5JXAL 4MNGB 1F90L 3VWJA 4KKLD 1CDGA 3QNXB 1UC6A 2YBRA 4PGEA 2EICA 1H3UA 1A7OL 2CKBA 5MERB 4LCUB 1FFPB 3VFGL 1ZHLB 5EUKB 2GT9B 5GXBB 3ULUF 4L3CA 4LKXB 4R97C 5IB3B 4DTGL 4R96A 3QIUC 4X6BA 1MLCA 2IALA 4U0RB 4RGMC 4JM2D 3ZT7A 3IDYC 3PABB 1TENA 1GXEA 5FYLH 1MI5D 2DI9A 2JJTA 2X1WL 4FFYH 4APQA 3L9RA 5F8QC 4PJEA 1F3RB 5D1XA 3RGVC 3B5HA 2L7JA 4UDUA 1NLBH 4NYLA 2JLLA 3ZYJA 3MJ8A 3P77A 1M6OA 1CE6B 5EU6D 2DWEA 1MRCL 4P9ML 2FLBT 5C0DA 4G6JH 3SCMB 3HC0B 4ZODA 5AZ2L 1NL0L 3BZDA 4S1SH 1F3DJ 2BDNH 3QCUH 4L4VD 5MERA 2B1AH 4AENB 5FO8B 5EUKA 2PO6B 3K1DA 4C56B 2GT9A 1A5FH 5EB9A 3RVUD 3WUZA 1HI6B 3IDXH 2DQUL 2Z4QB 5IB3A 2GYSA 1NC4D 3QUYD 4P99A 5C0BE 4XCCH 1FO0L 2PYEB 3JWOL 3PABA 4YXLH 5SWSD 3ALXA 2DJ4A 2VZUA 2HN7B 4BA8A 4WNQB 4NN6B 1OD9A 1EO7A 4FQXD 3ULVC 5ERWB 1A3RH 2XV6B 5FYLL 2F9BT 4AK1A 4M8VA 3EHBD 4Z7VE 2DQDH 2NY4D 2VR4A 1C1EH 1CE6A 5FYJU 4AH2B 3DVGB 3SKUD 1IGFL 2MMXA 4MXQD 3SCMA 3HC0A 5EC1B 5CEYB 2W0PA 1NLBL 1Z2KA 1P2CB 3TM6A 3UC0H 4Z18A 3CFKB 4P3WA 4AENA 5CSBA 2W9DH 3QAZB 4G6JL 4PJ5E 3RJDA 2Z92B 5JR1H 2PO6A 3C60C 4C56A 4JFDE 5IGXH 5JMRA 1IKNA 2VLMD 4ZS6D 3TO4B 1HI6A 1IMHC 2BDNL 3QCUL 5HHOD 2Z4QA 2B1AL 4EN3C 1WCQA 4NFCA 2H26A 4FQHB 1T7XA 5JW5B 3N1GC 3QEHB 1A5FL 5JXEA 2PYEA 1FNHA 4PTTB 2YKLH 3IDXL 1N6QH 2ARWA 4MZ3A 5AG9A 1MHPH 2NYYD 1UM5H 4WNQA 4XCCL 1ZA3B 2ADFH 1KJ2L 2FHBA 1DVFC 4WO4C 5ERWA 1U3ZA 3BPNC 4YXLL 3H8NA 4XNYH 5CGTA 4KK5C 5CWSB 1IAIM 2KQMA 5A16B 6FABH 4AH2A 4HXBL 5C0AB 3H9SD 5AWNH 5E4EC 5EC1A 5MHSE 5CEYA 1A3RL 2J8OA 4Y19E 4PY7B 1AFVH 4Q58C 3WSQH 4HWEH 1BD2E 3MUJA 1P2CA 2NY0D 1RZIB 3CFKA 2YPLB 3S3SA 5C08E 5E95B 1H5BC 3SDCB 2EC9T 4TPRH 3PL6C 3SE9H 4Z7NE 2DQHH 3J7HA 3UC0L 2BSED 5JDSB 1CDIA 3T0EB 4YHMH 1I3UA 5D7LB 2W9DL 4FQHA 4U2YA 5JW5A 5JR1L 4P2QB 3V5KB 5IGXL 3QEHA 1NPUA 3KS0H 4PTTA 2P8PB 2MOVA 4QHLB 2B0SH 2YD9A 4Y0GA 3JWDC 4X5LA 4PJIE 2IMNA 1ZA3A 2XI9A 2IFGA 5LKNA 2XWTB 2HLAB 2YKLL 1QTYT 3STZB 1N6QL 1MY7A 2H32B 5CWSA 1WGOA 1MHPL 4RSVA 1UM5L 5IVZB 5A16A 2DQEL 5EO1B 2D03L 35C8H 4D0DB 4KRPC 5C0AA 5IVXB 4EDXA 5J11B 2DB8A 3VFMA 2VZTA 1S5IL 4M48H 2QHLA 4XNYL 1BFOB 1ADQH 2AEIT 3PDGA 1RZIA 4A2MA 5K59E 5DD1H 6FABL 2YPLA 1AGCA 5DD3L 5AWNL 3SDCA 4R0LB 3QIBC 4AT6B 1T4KB 5D7KE 3L1OH 2APBA 4LVOC 5JDSA 3T0EA 1K9TA 3EOAA 1TJGH 3NN8B 2D7QA 2DQTH 4DN3L 4P2QA 2PTVA 4X6FB 3K74B 3BO8B 3SE9L 2DQHL 2P8PA 1MIEH 2EDTA 2E7BA 4WI7A 5D1QB 1R3KB 4I2XE 4JJHA 4Y2OA 3L7FB 4DN4H 4MCZB 4YBLB 4PJEE 3IDIA 1A14H 2XWTA 1UCTA 2AQ1A 1AXSB 2WW8A 3NOIA 2B0SL 3STZA 4DOHB 2H32A 4XAWL 5IVZA 3KLSA 5EO1A 5F7EH 5FDWB 1MCBA 4POZC 4XHQA 4G8GB 2EIZB 4JHWH 5GRUL 3KPRD 4D0DA 4MNGE 5IVXA 4NC0B 4GG8B 3MX0A 1EO8L 1TZHA 1BFOA 3BESR 3MLRL 2PKDA 2Q8BH 2B1HH 3QQ9C 35C8L 3GK8H 2D9CA 4R0LA 4AT6A 4M48L 1Q72L 5EU7E 3LH2H 1T4KA 3E2HC 1ADQL 1K8IA 2ZOLB 4Y5YC 3DSNA 3NN8A 1T7YA 2GKIA 3LD8C 2ITCB 4X6FA 3BO8A 3U36B 1TPXC 5D1QA 2L4OA 1R3KA 1YN7B 1TJGL 3N1PC 1U93B 2ZG2A 1MCHA 4JKPH 3KYOB 2J6EH 5J1SC 2CPCA 2QV2A 3L7FA 1H3PH 4DZ8A 2DQTL 4MCZA 1L7TH 4JG1H 3C5ZA 1MIEL 1AXSA 2EEAA 4R2GD 5IW6B 4F15B 4PRPD 3MV7B 3VXQB 3U4BH 1N26A 3S4SB 3WLBB 3QUMB 5FDWA 4G8GA 2EIZA 3BD4A 4CRPA 3WIHH 1Z5LA 3KYAA 4E41B 4WW2B 4XMPH 4XNMB 4Y5XB 3WNLA 1CXFA 5F7EL 2OM5A 1UWGH 4JHWL 3BKML 2VNCA 2BNRB 2CO7B 3G5XB 2ZCKH 1P7QB 1LEIA 2EDQA 5B3JE 3CU1A 4L8CB 2F53B 2Q8BL 2B1HL 3GK8L 3U48A 4G7VL 2ITCA 4P2YA 4OGYH 4RDQG 3U36A 3WXWH 4Y4KD 1YN7A 2UWEF 4J8RB 4CJ1A 1U93A 4JPWL 1VB9A 3KYOA 3T8XB 4GAGH 5FYJH 4N9OB 1RIHH 3JTTB 1OAKH 2RGSA 4U7MA 1XGPB 4JKPL 3MV7A 3QPXH 3VXQA 1H3PL 1AHWA 3WNNA 3S4SA 3WLBA 3QUMA 4BFGA 4JG1L 4DCQB 5GGVH 1ACZA 4KMTH 1Q0YH 2DLHA 4F9LC 4P2RB 5SV3A 4E41A 5J0BA 1JTTA 4WW2A 4X80L 4AIXA 3U4BL 4B0MM 3AB0B 3MREB 1HHGB 4RAHA 2R4RH 2K9UA 3SGDH 4ZQKB 2BNRA 3WIHL 5J6GB 3GZKA 1YUHB 3TIDB 4XMPL 4HPYH 4UV4H 4L8CA 4ZFFB 2BVEA 4RMSA 2F54B 1F4XH 3TPKA 2DN7A 4L3ED 4I3SH 2GSGB 4KAQL 2NZ9C 3B3IB 3F7YB 4WHYG 1JN6B 1FC1A 1HXMA 2XWJB 4LLMB 4Z5RB 3F12B 1QEWA 2PXYD 3WN5C 1U3YA 4J8RA 3QRFM 3TJEH 4X4MA 3T8XA 4P2OC 2VIRA 3JTTA 1DCLA 3EAKA 2VLLB 3KR3L 3WXWL 4WV1A 4GKSB 3LDBB 3DO7B 1XGPA 3MROB 3AC0A 3U4EB 4GAGL 3ARGB 5FYJL 4EBQH 1GHFL 1RIHL 4NQSB 4DCQA 1OAKL 1F58H 4BQ6A 2BRRH 3I6LD 2FR4B 4P2RA 3QPXL 2EXWC 3BH9A 4P5KB 4IIQC 3MREA 2ATKB 2YPLE 1WLHA 5GGVL 4XI5C 4KMTL 4TULH 1Q0YL 4ZQKA 5J6GA 1NH6A 1YUHA 3TIDA 5IBTL 2EDNA 3HE7C 3BQUC 4PJ7B 3T0EE 4ZFFA 1NMAL 4UINL 5D7LE 3ZSSA 4LOUD 2GJ6D 1WT5C 2GSGA 4S2SB 3N85L 5M94B 2O93L 3OR7B 3F7YA 1JN6A 2XWJA 1K4DB 2EIBA 4LLMA 4Z5RA 3BN9D 3F12A 4HPYL 1VFMA 3CZFA 1N2RB 3NIDF 1F4XL 5EORL 1KB5A 1CK0H 4I3SL 4GRMB 1F4HA 1BIHA 3VXRE 3NPSB 2VLLA 4JO2H 4GKSA 3DO7A 1IQDB 1FNAA 3MROA 3U4EA 1U95B 3ARGA 3L3OA 4NQSA 3ROOB 4OI7A 2PETA 1TFHA 5CD3A 2YUWA 3VXNB 5C0ND 4HG4J 2VXVH 3OKKB 3ZKSD 4P5KA 2BP3A 4JFXB 2ATKA 4DVRH 4LVHB 2XA8H 1KXQE 2BRRL 4HSQA 3M45A 1TZIB 3V8CA 4Z7WB 3CZJA 1TJHH 1NBVH 2EDEA 4PJ7A 5DHXB 3O3UN 5ISZD 4S2SA 1BVKB 1K4DA 5HPOA 3GNML 1NCDH 4PFEA 3X3GH 4DKEH 1N2RA 1KIUA 1S3KH 3B9KC 5E6ZA 3MLUL 1CLZH 4GRMA 4NN5B 4UU9B 5C70A 1IQDA 1DUZB 4QRPD 4DOHE 4WHCA 1U91B 1U95A 1CK0L 2XQYK 2AGJH 4M6NL 3KPMB 3IGAB 4LCIH 4PYHA 3ROOA 4G8GE 1UXSB 1XR9B 2WBKA 4JO2L 1KB9J 3VXNA 1RMFL 5HI3D 1LDPH 3MNWB 2FHCA 3OKKA 4WUUE 4DVBB 4FQPA 4JFXA 5D7JB 3UZVB 5I76B 1FAKT 5T1LA 2XFXB 3BH8A 3EDDA 3RZCC 4TYUA 4D9QD 4MAYC 3PWJA 4H0HB 1MY5A 5BRZD 1UH3A 2H2SD 2VXVL 4G43B 4Z7WA 2ZUSA 2K1MA 2COQA 2HT3C 4JDVB 3ARBB 5EZOH 2ZSVB 3RY6C 2XA8L 4FQLL 4D2NA 4NQUA 2VXSH 2KZWA 4LVEA 1TJHL 1NBVL 1ZOXA 5EOTB 5LG1A 5I1HL 1BQSA 2A6JB 3RWCA 3ZTJG 3B9AA 4ONHB 4LIQH 2LAAA 5C2UB 4UU9A 1UQSB 1YC7A 1NCDL 3X3GL 5I75B 3DVFA 3HAEA 4DKEL 1DUZA 5JIKA 4RGMB 4NC1E 1MFDH 1U91A 3DYMA 3IDYB 4FABH 2OJZL 3KPMA 3IGAA 1H8OA 1UXSA 1XR9A 3Q6FA 4OQTH 2DF3A 2KPNA 3IYLW 5JNYB 4LKCB 5AZEH 5E9DE 3MNWA 5EFIB 4DVBA 3OHXB 5D7JA 5I76A 2AGJL 4LCIL 3OB8A 3FQUB 2XFXA 4WHTB 4FTVE 1L6XA 3BFOA 5T3XD 2BNRE 3D85B 1FG2B 1LDPL 4G43A 3GHEH 4Y1AB 3VFUB 2F53E 4JDVA 3ZE1E 3QHZH 1TZGL 4GXUM 1EGJL 3ARBA 2ZSVA 3MCLH 4DKFH 1JZ4A 4JM4H 1DP0A 2H2PD 3SJVB 5EOTA 4XC1H 1QHOA 3WNKA 2A6JA 1B90A 4X4ME 2XZCL 4ONHA 2GUOB 4M62L 5HDBE 2VXSL 5JO5B 5DTFB 4PUBL 2HG5B 4JB9H 2E9BA 3NIGF 4LIQL 4HKXB 4OF8A 1JCKA 3DUUB 2E7CA 4LKCA 5IHLB 4JZJC 3UCRA 5DXWA 5EFIA 1BFTA 4WJ5B 1YMHB 1MFDL 3OHXA 1I1FB 1YPZF 4FABL 1TQBC 3HNTH 3FQUA 4WHTA 1BGXH 4OQTL 4HK3J 1FG2A 2D9QB 3IDUA 2CK2A 3RBGA 3U0WL 1U8HB 4Y1AA 5L2KB 5TH2A 1SYVB 3VFUA 2I60H 2F54E 4LHJB 3O41B 3IXAB 3SJVA 3GHEL 2WZPD 3WDIA 3KYKH 2WQ8A 3QHZL 5IVXF 3MCLL 4FQ2H 1T7ZA 4DKFL 4XP4H 2GUOA 4JM4L 1CBVL 4XBEH 4V1DA 5DMJB 5JO5A 4RMUA 5DTFA 3RX7A 1N5AB 2HG5A 2BNQD 4UTAH 1ADQA 1SMAA 5I1JH 5ABDE 4HKXA 3DUUA 4Q9RH 2X44D 2VLKB 2WWMD 3PWPE 4WJ5A 1YMHA 4WO4B 1I1FA 2GY5A 3BPNB 5KSAB 3WD5H 4F37F 3BGAA 5D6DC 1SHMA 1U8HA 3NIFF 1N59B 4NJAH 1SYVA 5FYLE 4P5TD 5MEOB 3QULB 1FFQA 2VITB 5E03A 2B4CH 3MLPA 1T2JA 1CG9B 1LK2A 3IXAA 1FFRA 1QD0A 1OVZA 3H0TA 3UPAA 2QHRH 4KDTC 3EFFB 3C60A 1JWMB 2I60L 2ZSWB 4JRYB 5DFVC 5EO0B 1HHJB 1QFWM 3WUWG 3GUTB 1G6VK 3QNYB 4RISH 1J1XH 1N5AA 4QHMB 3KYKL 2XTJB 4FQ2L 3V6BR 4B53A 1FZOA 4MSWB 4XP4L 4XBEL 5GGUB 1VDGA 2RR3A 2VLKA 4JHBA 3OJDA 1DVFA 3B9EA 4WO4A 1OT1A 1R5IB 4K2UH 4B41A 5I1JL 2X4NB 3HZKB 2G2RB 5E8EA 1MEXH 4Q9RL 4FFVD 1R3HB 2XN9B 3AGVA 4KRPB 4NBXB 1N59A 1X5YA 1JYNA 1P69B 3WD5L 3RHWK 5CKAA 3BUTA 3LSOB 4ODTH 3QULA 2J6EA 5MEOA 12E8H 1RJLB 1V3JA 5IBLC 1LP9E 4KXZH 4PBWD 3EFFA 4NJAL 2FBOJ 1JWMA 3ET9F 3RZWA 3T4YB 2ZSWA 4JRYA 2ICWI 3MBEC 5EO0A 4LVOB 1HHJA 4HMDA 3N1FC 4J4PD 3GUTA 3QNYA 5KVEH 2VXTH 5H37G 1I7TB 4QHMA 4LU5H 1X4ZA 4LLVB 1PLGL 4ALAH 1X5AA 3NA9L 4MSWA 5HVGB 3M07A 5SX4H 5GGUA 4RISL 1IARB 1J1XL 3S6CA 2DKMA 1UADC 4OCYH 1R5IA 3SDXE 2X4NA 3CX5K 2FX9H 1NGYB 2QLVB 1CDCA 1ZE3C 2P4AB 5EZIH 4W81A 3EYUH 1R3HA 2XN9A 2QADD 4KFZC 1AGBB 2QSCH 5JQ6H 1NCBH 5DJ0B 3KPNB 4K2UL 3LSOA 1MEXL 1KXTB 4JM2C 1MCDA 1RJLA 3RJQB 1FPTH 4DQOH 1XF4B 2ARJQ 3OMZA 5IMOB 2X1QA 3T4YA 2PF6A 4PRIE 2ERJC 4ODTL 1HKLH 5CJQH 3E2HB 5D7SH 12E8L 1D9KB 2N56A 1GOGA 3D39B 3QWOB 5JTWA 3LD8B 4PLKD 4NO0B 5HVHB 3CH8A 1I7TA 3N06B 1VENA 2GSIB 1BHGA 4LLVA 2VDML 3MJ9H 1ZT4B 3LN4B 5KVEL 1X5IA 2VXTL 3EKCA 3BGMB 4WENB 1AGEB 1MAJA 3O9WC 1GOFA 4LU5L 4MQ7B 1P6AB 3UYPA 3FOMB 2IPKA 2ILLA 2DBJA 4OKVA 1JPST 4L9LC 1NGYA 3MRQB 3T09A 3OAYH 5BOPA 2R29L 1AGBA 4RFNC 3W0WB 4NFDA 5HYJB 2FIRT 3KPNA 5KSUB 1BQLH 4FHBD 5E8NB 2GQHA 4P2CG 4WFFE 1CU4L 4XP1H 5EZIL 1LO5B 1RZJH 4H5SA 3EYUL 4M93B 3TIEA 4JZNB 1XF4A 3RDTD 1GYAA 4ODVH 2WLZA 2ZKHH 4JFYB 4K3JH 2QSCL 3SJVE 5JQ6L 1QOKA 3DVNA 5IMOA 5DJ6B 3VXMB 4F2MB 4FQXC 4H1LB 1C12B 1D9KA 4Y5YA 5I2IB 1W72H 4DQOL 4PLJD 1YNKH 4Y16C 1SY6H 3QWOA 1IC1A 4DKDC 2CRMA 2NY4C 4NO0A 2XXCB 1UZ6F 5BS0B 2GSIA 5CJQL 5D7SL 4PG2A 1ZT4A 4AEIH 3LN4A 1NBZB 1MHEB 1NFIB 2YC1B 3BGMA 4PJ7F 2OLDA 3AREB 4X7CC 4MQ7A 3VXSD 3EYVB 5BV7H 3FOMA 3MJ9L 4E9LA 3F62A 3MRQA 2F19H 1JPSL 1ZVYA 1DEDA 4LHUB 4RGNB 4HJ0D 4PPTA 3GMMB 4W6WB 3W0WA 3GM8A 3FRPA 3PQYD 5ETUB 5L2KE 1G84A 5HYJA 4LPYA 3WNOA 3HE6B 5KSUA 5E8NA 2EDLA 1EEQA 3RI5K 1LO5A 4CVZB 2B7DT 5IQ9B 4UAOC 4JFYA 1M71B 1YQVH 4FQIH 5DJ6A 2NYYC 3UYRH 3VXMA 4F2MA 3A6CL 3IFOB 1BQLL 4GW1B 1BJ8A 4H1LA 1RZJL 2HFEA 5I2IA 3P9MB 3LS5L 4ODVL 2ZKHL 2P8MB 4K3JL 4NFBA 5FUCE 4CVUA 3EJJX 4J23A 2VDKH 1QSVA 2LFGA 1W72L 1NBZA 1MHEA 1SY6L 1NFIA 4Z7WF 5GZOD 4P2OB 2YC1A 1JZ2A 4LDOB 1NSNH 5FB8B 3AREA 3WFDH 5DJZB 3BISA 4PV8B 5BZWB 2ENSA 5D5MF 1NGWB 3WNPA 4WHYH 4JPKH 3I75B 4LHUA 1M1SA 3GMMA 1RZ8B 2FZ3B 3U82B 5BV7L 5ETUA 4NZDA 3HE6A 5BJTB 2X2YA 1KJ3L 2F19L 2P46B 3FCTB 4CVZA 3DV4B 5IQ9A 2VH5L 2M2DA 1M71A 2R1WB 4HDIB 1XF2B 5CIPB 5ACZB 3IFOA 1SQ2N 3HPJB 4Y8AA 1U8NA 2E7HA 1OTTC 3P9MA 2H8PB 2P8MA 2BJML 1NLDH 4JG0H 5IKCA 3OV6A 2RHEA 2D4FA 5I18L 5J13B 3UYRL 2E6PA 2XTJE 4PRBA 5IVOA 1NGPH 3WN5A 2MSPA 3OTTA 2JELH 2WUBH 4M4PA 4P2OA 5I73C 5FB8A 2VDKL 4L4TB 4BK5A 4PV8A 5BZWA 2ZUTA 1NGWA 4NQXB 4ZFOL 3HNVH 3JV6B 1NCNA 3I75A 2ZCLH 2XN9E 5EA0H 1H9VA 4R7DB 1RZ8A 2AAVA 2FZ3A 1DEEB 4RMRA 1MIMH 4RWHA 5BJTA 1ITCA 1J8HA 3I02A 4JPKL 4I1NB 3NCBB 4N0FB 5FYJE 5HSFA 3DV4A 4X6CB 4M1CC 4HDIA 2A6IB 1XF2A 3D3VD 5CIPA 4KK9D 3HPJA 2F74B 5B38B 4PGCB 4IRSB 1GIGH 2IAMD 4KJWD 4G7YH 2QJDA 2JB5H 1A6TB 1PX4A 1OTUC 3CUPB 1JNLH 1JPGB 4ODSH 4PRHB 1U3HC 4KTYA 1NLDL 3B9KB 1FZMB 1FN4B 4PJ8D 1OOAA 1FBIH 4P46C 3RWFB 5IVNA 2EDYA 4PGJA 3A6BL 1BBJB 2JELL 2WUBL 4G8EB 4NQXA 4PRAB 4Y4HB 3UTPE 2DWDB 2IEPA 2HVJB 3RWGB 3FMGL 4TRPH 3WFBH 3K2UL 4R7DA 1QLEH 4YFLI 4IRJD 5I19H 1DEEA 2E27H 2VC2L 3HNVL 3FO0H 2V7NB 4M6MH 4N0FA 5EA0L 2OR9H 2OQJB 2Z8VC 3RZCB 3T2PA 4MAYB 2JK5B 4X6CA 1MIML 4I18C 2A6IA 2Z9TA 2AK4E 2DIAA 4V2BA 3T3PE 2FX7H 4RNRB 1RV6X 1KJMB 3KDMB 2F74A 5B38A 2F5AH 4CGTA 1RQ5A 1EK3A 3D39E 4IRSA 4PGCA 4RX4D 3ULVF 5FUOH 5ICZB 2IC2A 8CGTA 3CUPA 1ULVA 5FYKU 4PRHA 2FB4H 3HNSH 1GIGL 3B9KA 4NHUA 1FZMA 1FN4A 3GRWH 4PY8J 3RWFA 2JB5L 2NMSA 4M8QB 2WBJB 2IH1B 1BBJA 1ZK9A 1AKJD 4G8EA 4ODSL 4PRAA 4Y4HA 2DWDA 3RWGA 5B8CB 4EUPG 3GBNH 3VG9C 2NY1D 3W0WE 4XPHH 4LP4A 1U41A 4FA8A 5HYJE 2AVGA 1WTGT 4ZOEA 1A7RL 3UJJL 2LU4A 2V7NA 3U7WL 4LEOB 3FB8B 1JVKA 4PJDF 3WFBL 2OQJA 1QLEL 5JZ7D 3RZCA 5I19L 1IKFH 1VGEH 2E27L 1GSMA 2JK5A 4MAYA 4P4KC 4XMKH 1GZPB 3L6FB 4WW1B 2X1OA 3VGDA 3VXME 1S7UB 4RNRA 4WVRA 3FO0L 3KDMA 2NCMA 4XPAH 1KIPB 3RTQD 1KPUB 1NCAL 2OR9L 5ICZA 5DO2D 1HILB 5BS0E 3LKOB 2FX7L 1X5LA 3C5JB 2F5AL 1OM3H 3PP4H 5FUOL 2AV7B 4WGVB 1LE9B 4M8QA 2PN5A 2IH1A 3LQAC 1ZANH 2V5MA 3HNSL 2X4OB 3C6LD 5B8CA 1HNFA 2E7MA 4RGNE 3RHWF 3V7AE 2VJXA 3ZLQC 4JZJB 4ZFGH 3BRGC 1TQBB 3MLSH 4LEOA 3FB8A 4Q97A 3GBNL 5TDNB 2OMBA 3BJ91 5HY9A 5E6YA 1GZPA 3L6FA 4WW1A 3T77B 4M1DL 1S7UA 3HTLX 3Q3GB 4LRIA 1KIPA 1KPUA 3R0MA 1IKFL 1IM3B 1HILA 4CVWA 4KUCD 4OSUH 5HJ3B 3LKOA 4ODBD 3C5JA 2VL4A 5DQDH 4G9DB 4J3SA 2JJSC 3MMEB 5M95B 3EYOB 1LE9A 3W2DH 2D7MA 5JOFB 1VFOA 2EIEA 1MUJA 1OM3L 3TH3T 1MCIA 4WWKB 3QUKB 2X4OA 4F7PB 3VMNA 4UOW0 4ETYA 5I1DA 4JZJA 4UBDD 1BF8A 1ZANL 2ED7A 4L9DA 5I8OL 4I0PD 2AJXH 3FQNB 4HUNB 4LIQE 1FZJB 1RK0B 4WU5B 5TDNA 2FJHA 5CS7A 3S97C 2WV3A 3X14B 5C8JB 3T77A 4ZFGL 2VQ1A 3Q3GA 3KPLB 3BP4B 4N0UE 3MLSL 3OJMB 4Z8FH 3TWCL 4IMLB 1IM3A 1V3KA 2D4DA 2YA1A 2FECI 3SDDD 3QWRD 5HJ3A 4QWWD 3BWUC 3X13A 1JIBA 2LTQB 5F1SA 3HI5L 1KTRL 4G9DA 4R4ND 3MMEA 5TF0A 1ZHNB 3EYOA 3JTSB 5EOQL 4OSUL 4L4TE 5JOFA 3QWQB 3OPZH 4LFHD 1T6WA 3MTRA 4GXVL 4Q2ZB 2J88H 4QHUB 4ZNCD 5DQDL 4PJ5D 4XWOD 4WWKA 3QUKA 4F7PA 4CAGA 1RIUH 4JFDD 4HIEB 4TVPD 1G9NC 2E3VA 4LASH 3MO1B 1A7BA 2MHAA 4YBHA 1YEKH 2VSCA 1WITA 3FQNA 1FZJA 1RK0A 4OZHE 4WU5A 4XVTH 4OZGB 2Z91B 3EFDH 3ORJA 4X6CE 3FQWB 1YY9C 5C8JA 5D6DA 2Q3AA 5DD0H 5C09E 3KPLA 1EJ6A 3BP4A 4PS4H 1FNLA 2NR6D 5J57B 4LLDB 4IMLA 4PJAB 1CF8H 2MKWA 2DOCA 3BI9X 4KDTA 4IDJL 3DOSA 5J12C 3LCYA 4Z8FL 2BVQA 5HI3C 4OBRA 4QRSB 3WIFB 3MBEB 2D3VA 4NHCL 1A6PA 1ZHNA 3JTSA 2ZZUT 4JANB 1NDGB 4PJFB 3DNKA 2E6QA 4Q2ZA 4OV5B 2X5PA 1S78C 4I3GA 4HIEA 1X5GA 3L3IB 4X9HA 3MO1A 1Z0NA 1MFBL 4LLWB 4PJ9B 4HGMA 5I1EH 2J88L 1ZA6B 1GJIA 5H37H 1RIUL 3DRQB 5K93A 4OZGA 2Z91A 1YNTB 4HCRH 1SY6A 2YWYA 3FQWA 4BFEA 4HHAB 1AXTH 1PEWA 2CXGA 4K3GA 4PGDA 5FYKH 1YEGH 2A0LD 4XVTL 4ZFOB 3V5DB 1OAUH 2BSTB 2K7QA 4PJAA 4JM2B 4X7DC 3CMGA 1H3GA 4Z78A 5DD0L 1MI5B 3CX5J 4PS4L 3BVNB 1ES0B 4AEHH 3FOLB 3O8XD 4HKBB 4QRSA 3WIFA 3MBEA 1WTLA 1T7VA 4JANA 4ZO9A 5EDXA 4PJFA 2D7OA 5EU6B 4OV5A 2HRPH 2WSKA 5LJYH 2FEEL 3OJ2C 4KHTL 3L5WB 3WKNA 5F9JB 2LAGB 1CGWA 4LPCA 1RUQH 3L3IA 1KPVB 2DTMH 4LLWA 4PYGA 5D7KD 3TCXA 1ZA6A 4L4VB 4G9FD 1A64A 1YN6B 3IVKB 3DRQA 1WV7T 2VAAB 1YNTA 2X10A 4NZTL 3CSGA 2NZIA 4HHAA 2V2TA 1YEJH 4NRYA 4RFNB 4EDWH 3E8UH 3QUYB 1G7QB 1CXLA 2VDRL 5I1KH 4ZFOA 4HCRL 4QGTA 5IJKC 2BSTA 4JM2A 1QSED 5DVMA 1MI5A 1AXTL 2MQ0A 5SWSB 4U1GC 1OP3H 5FYKL 3BVNA 1ES0A 1YEGL 4OV6F 3V52L 3LS4H 3FOLA 4LCYA 4FQXB 4NRZB 3BYTA 1KPRB 1A7QH 4NO5B 2WAHA 2BSRB 2NY4B 5EU6A 1F6AA 3PGFH 3L5WA 1FL3B 1NFDB 5FGCE 4P3DB 4JVPA 1KPVA 3RY4A 1U58A 2YUVA 4L4VA 2HRPL 2IWGA 5JPNB 4R90L 1YN6A 2X4PB 3MA9H 1RUQL 2VAAA 3GSRB 1MOEA 3LIZH 3SGEI 4TNWF 3S36X 5HHOB 3FL7A 3QDAA 3D48R 5T5NF 5BQ7B 1NC4A 3QUYA 1G7QA 1HHKA 4FXKB 2GJJA 1PZ5B 1YEJL 3STLB 5SWSA 4EDWL 3BD3A 5EBLB 4O51B 3WIIH 3BSZH 5I1KL 2JB6B 4FQXA 2WWMC 5EWIL 1KPRA 4BH8B 1GVIA 4NO5A 5MEND 2BSRA 5DVNA 3D69B 3LS4L 5DA0B 4PV9B 3O4OC 4HLZG 1NMBH 4J1UB 2OL3B 4JQVC 4YHIB 1IEAB 1FL3A 3DSFH 1NFDA 2XA3A 4Z0XB 3QUXD 4P3DA 5HI4D 4P5TC 1WFTA 1KIRB 4AEFA 2NY0B 1KBGH 2W0KA 3PGFL 3D18B 5JPNA 2X4PA 3S37H 4NQCE 4ODXB 1RD6A 4BSJA 1A2YB 4CMMB 3GSRA 5E0QA 2CRZA 2NPLX 5HHOA