1YPZE

Immune receptor
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
207
structure length
207
Chain Sequence
GDQVEQSPSALSLHEGTDSALRCNFTTTMRSVQWFRQNSRGSLISLFYLASGTKENGRLKSAFDSKERRYSTLHIRDAQLEDSGTYFCAADTWHISEGYELGTDKLVFGQGTQVTVEPKSQPPAKPSVFIMKNGTNVACLVKDFYPKEVTISLRSSKKIVEFDPAIVISPSGKYSAVKLGQYGDSNSVTCSVQHNSETVHSTDFEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H2-T22 protein
publication title Structure of a gammadelta T cell receptor in complex with the nonclassical MHC T22.
pubmed doi rcsb
source organism Mus musculus
total genus 32
structure length 207
sequence length 207
chains with identical sequence G
ec nomenclature
pdb deposition date 2005-01-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ypzE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ypzE02
4IRJC 4JFQB 4O9HH 4R8WL 4Y1AB 4JM2C 2KL6A 5DRXB 5CUSH 3GBNL 4GMTH 1WBYB 1ED3B 1EO8H 1EEYA 1OGAB 1ZOXA 4OM1L 1MFEH 3OKLA 1VKXA 2FGWH 1AE6H 3F7YA 1QZ1A 2R0ZL 1SY6L 2WWMD 1HZHL 3MODL 5KSBB 2AXJA 3KG5A 4KJPC 1S9WB 3JV5A 1T1WA 5CEZD 5JIIA 1DBBH 1RULH 5LJYH 3MLVH 3BKCL 4PP2A 5C9KA 2AS5M 3VW3H 1PAMA 1ZHLA 3SE3C 1BGXL 1MJ8L 4ELME 1T7VA 4R90H 3UBXA 2WUBH 2YPLB 3NFPB 3TYGL 2HJKA 4FFYH 1FL5B 3AS3A 4G7VH 4OUUB 4YNYB 5I8KH 2CKBA 2JELL 1CLCA 3JUYA 5F9WC 4MA3A 5DHVB 4JVPA 3DVGB 1I8LA 5DRZA 1ZWIB 3LY6A 4XAWL 4AK1A 3SE9L 1C1EL 4EBQH 3P4MA 1J0IA 1DQQA 4EOWL 3HNTH 3N1QC 4XPFL 3OHXB 4RMRA 3FT2B 1EO7A 4XZUA 5JNYB 3PWPB 3U30B 3CAFA 2JJSC 3LRSA 5I71C 4OLXH 4AY0A 3IRZA 5CSGA 5DD3H 1ZGLP 4RGNE 1OW0A 5I1DB 1YNTB 3VXRE 1BQHA 2VDKH 4AL8L 2QJDA 3I2CL 1KCSH 3MA9L 2D4DA 1S9YA 2E6JA 2Q8AL 4RCAA 5FYJD 3TBTB 4YGVA 3W39A 4S1RL 3DX9A 1FYTE 4POYA 4Y2DD 3MXVL 3BE1L 3TBYB 1W8OA 4XH2B 3TO4C 1VFBB 5E95B 1NH6A 3KYMB 3BO8A 4KI5C 4PGCB 1CE1H 4JDVB 4LKXB 5C0AD 2K3TA 4P0DA 4IOIB 4OIIL 4APQB 4PLJD 4K71B 4Z95L 4GKSB 3PHOA 2YRZA 5MENB 4O5LH 4Z77A 3JZ7A 2XA8L 1X9QA 3ARFD 5CAYB 5TE4L 5EBLA 4WO4D 2XXMB 5ESVA 4KH2A 1NGYB 3GJEB 1ZLWK 3RVUC 1I3UA 4NFCA 5HHXH 1F3RB 1TVBB 1Q72H 3C6LC 3HUJA 2IFFL 3QUKA 5JQ6H 3L3IB 1LP9F 1JPTL 3RTQB 1CL7I 4C57C 3ZTNH 2GFBB 4CGTA 5HHQB 3HRZA 3B5GA 3MRQA 4LHUB 2CJUL 2Y6SD 3OR7B 4OB5L 3S37H 1NCWH 4JPVL 2AP2A 3B43A 2UUDH 3MREB 2EYSA 3OKOB 4M93C 5IF0B 3E6HB 1AKJB 5EOTB 4LQFL 1ZT4A 1JPSH 1EO5A 5ADOH 5I18L 4JJHA 2BVPA 2CMRL 3N9GH 4JVWA 3QCUL 1T1ZA 1HSAA 3GI8L 4IOFC 3VFTB 1MNUH 1L4IA 3WS3B 4CU8A 4UBDC 3M17B 5CIPB 32C2A 4QYOB 5KAQG 1DBMH 1KLUA 4PJGA 2DQUL 4LAJH 5DUBB 3WNPA 3KNBB 4LIQE 2F54A 4UUJB 4BSWA 3BT2L 5C0EB 1F5WA 5B38A 2O5YH 4WV1A 1MCCA 2CDGA 1F90H 2HP4A 5CCKH 1HINL 3S4SB 5IOPA 1PQZB 3EYVB 1W72A 4K23L 2IPKB 3HZKA 5T33H 3KVQA 2EKJA 1NQBA 4M6NH 1FGNL 1CU4H 4F7PB 4TQEH 4PR5A 2YD4A 1N6VA 2VR4A 3SKNB 1Z9LA 4F33B 4POZC 5C0BE 4GKOA 1T66D 4NJ9H 5IWLC 4JKKA 1YN6A 3FO2A 1T7YA 1CLZH 1J05B 3GIZL 3Q48A 1UZ8B 1QFOA 1OARH 4Y4HA 3ZKXB 3TVMD 2F53B 4HHAA 2EIZB 2P45B 4PJGE 3CXHJ 3G5YB 2A1WL 3TZVC 4IRSA 2C4FT 5JA9A 4ZUTA 1QG3A 3D3VA 1FL6B 3UPRA 3L5XH 5E7BA 1J0KA 1AO7D 1UH2A 4V1DA 4I3SL 4EQ2A 4F7MA 3CSYB 2EXWD 4OF5A 1A7QH 5KN5B 2R9HC 5DD0L 3S6CA 1S9VA 3U36A 3QI9A 1QRND 2BCKA 3V0VB 2BNRD 3TV3H 1I8IA 3UZQA 1HWGB 2H8PB 1P7KA 2CR3A 3LKOA 4QHNB 1S78C 1WIPA 1WFTA 5GRVK 2HT4C 4DGVH 3FN0H 3GRWA 3HE6B 2X4QB 3PV6B 1J8KA 4Q2ZB 4ENEC 4AMKH 5T5NG 3UPCA 1MFAH 3UTSB 4N8CL 3HE7A 3S35H 5E08L 1RHFA 5KSVA 1ZHNB 5IW6B 4R97C 3VD9A 3TA3D 3CSPA 2D3VA 3KAAA 3OAZK 4MQXD 4X4XA 5FDWA 1M7XA 1U8NA 4NKDB 2VUOA 2J12B 4ETQA 3Q1SL 5I73C 3HCVA 4F7TA 4K94H 2R2EB 1WCBA 3BDYH 2FJGB 5GGVL 4HS8L 4RGNC 3CCHB 4MAUH 3SJVE 4OJFL 1CICA 1H3WM 3FOMA 1KCRL 4OCWH 4P2RB 4Y4KA 1FFNB 5EUOA 4E42A 3GFUA 2HFTA 4NHCH 4WTWA 3BSZH 2MQ3A 3MLUL 2IJ0C 3O41A 1RUMH 2HG5B 3QDMD 3JTTB 2YC1B 3QQ9C 5D71L 4MWFA 3UZEA 4FQLL 2WIIA 1CL7L 4KZDH 1UCBL 1D5IH 4OUOA 3CPLA 1A7RL 2HTLC 5HPOA 3QISA 2V17H 2VH5L 4L1DA 1DBKL 1ZHBA 4MB3A 2OK0H 3SDDA 4ZO9A 4ZO8A 1U3HC 1BEYL 1FSKB 4O2FA 4YPGB 3TN0D 4PJFB 2ED7A 4P5KA 3VFGH 3D39A 5FIEA 4JR9H 2OSLA 2EE9A 4LGPB 3U4BL 3P0GB 2O5ZL 1D6EB 2NNAA 5TJWK 4YQXL 4Q9BA 3VG0L 1P5UA 3O6ML 2IPTL 2AGJL 1Y0LA 1K5NA 1U9KA 5K9JL 4K7FA 3HG1A 1OF2A 4Y5YC 3REVA 5EO9A 3FB5B 3HPLA 4UT7L 2J88L 3NA4A 3U48A 4FQCL 4MNQD 1FZOB 1UWXH 1JMXA 1BJ1J 3L5WA 1M6OA 2GJ6B 3LS4L 1BD2D 1UVQA 2AJ3B 3MCLH 2QQNL 4M1CC 3VDAA 3WL9B 3B2UD 5D7KD 1T89C 2AK4B 3P4NA 4YEEA 3VD5A 5I8OH 3THML 2X4PA 5T1LD 5GS0C 4RDQF 1P7QD 4PJIB 3D39E 1G9ML 3TIEB 1FVCA 4JZJB 1CXHA 5EC1A 2ZPKH 5IK3A 1AGFB 3FB7A 3LQMA 4EXPX 2NCMA 4WY7L 5ITFA 3GSRB 2V5TA 2CDEA 3V6FB 1M4KA 1KC5L 2V7HA 3D25B 3MLXH 4KK6C 4NO3A 1I8MA 43C9B 2R2BA 2DQEH 3LB6D 4WEBH 2Y4SA 2ID5A 1A7PL 2EYRB 4NQSB 2FBJH 4P4KA 1XF4B 3O4LB 5GSVB 3T4AA 1NAMH 4C56E 3RDTB 3QCTH 1KTRL 3MRIB 3WXWL 4LBEA 1FVDA 4I4WB 1BFVH 3CMGA 2OR9H 1Q9LA 3ESUF 3GIVA 3CFEB 3QA3B 2OYPA 2UZYB 3I75B 5F7MC 2HFGH 3B2VL 3K2MC 4XCEB 5FYLH 2CDFB 1N5YH 3ZSSA 4KPHH 1TXKA 1ZT1A 1AC6A 3QCVL 4JANA 4MLSA 4O02L 3ZE2E 3ZZ1A 4M8VA 1ZKAA 2NYYC 4OLUH 3VWJD 5A2KH 3GSWB 3E8UL 2BHZA 1F6FB 4J3XA 3NH7H 3QXDB 5D4QA 3RVVC 3NTCH 5CJ5A 1Q1JH 3IF1A 3T09A 3H9HA 5IEKA 2BFVH 2QHRL 4MGXA 3SDCA 3WUZA 2VQUA 3MV8D 4PRHD 3KS0H 4P9HL 3V6ZB 3MNWB 4ODSL 4LEXH 4OTXH 1VENA 3I02A 4GBXC 5TDOA 5I19H 4ZS7L 1FN4A 1R3LB 2ICCA 5SX4H 4LVNC 3CFBA 5IVXF 1ORSB 1QP1A 1G9EA 1I7TB 3UTOA 2WV3A 4M43L 4NC1E 4LF3A 2HWZH 3PG2A 4N0UB 5DC9B 4I3RH 4TUOB 1JGEB 4HCRA 3GSNL 2RCSL 5DHXB 5IESH 2VRAA 2JB5H 2W9DL 4U1IA 5JHLH 3QULB 1C5DB 2B2XH 1NANI 2NY5L 3V9FA 4FTVE 2EDXA 2QEJA 5I9QC 3NABL 4HIJA 5C0NC 5L0QB 5TF0A 3KLAB 2I25N 2E6PA 5E2VH 2QSVA 1UEYA 1KPVA 4L29B 5DMKB 2R69L 5EU6D 4JCMA 1IM3A 1XIWC 3TH4T 3Q3GA 1LO3H 2DOCA 1G7PB 3A6OA 2VDRH 1Q94B 1QUNA 1G7HA 1LEKA 3FFDA 1Q9WB 3ARGC 1FE8H 4OZFA 4YIQB 1JVKA 5E6IA 1HYSD 2XI9A 4XCFH 5FUZH 3QNYB 1F6AA 3CDGB 4JLRA 3TCXA 4F2MB 1P84J 2WBKA 5TPWH 1FZMB 2FATH 4K8RH 1G7QB 4DCQB 2Y06L 5GRZA 2YA0A 4ONHB 3UJIH 3NBNA 5DJCA 2R0WH 1BREA 1MHCA 3E3QC 3IDIB 5DMIH 4YDVA 1UEMA 4NQVB 1UWGH 4X6BB 1EERB 4LRNH 1G7JB 2VZ3A 2PO6A 1AD9B 5CJ8A 5C2BH 1J1PL 5J3HC 1SJXA 2NPLX 2DB8A 3GSUA 4WFFE 1IGTA 5I2IA 1NCNA 5E2TH 3C60C 3JVGA 1LGVA 1NLDH 3LV3B 3CC5A 5AYUH 3BWUC 5GSRA 3ILQD 1XGPA 2FX7L 3TH2T 1F45A 4IBLT 4Y2DB 4ZFOB 4LHJB 1IM9A 4OFPA 4G6JH 5DJ2B 5C0FB 3CDYA 2CK0H 5C0AB 3VWKC 4FHBD 1M71B 4TSAH 1B0WA 4XCNB 5JOFB 2ED8A 1JYWA 1F2QA 4Z0XB 1SYVA 2DKSA 4JO4H 1S7UA 4MJ6B 2A6DB 4TVPL 5J56B 3ARFB 1EUUA 1INDL 3DNKA 4WO4B 4TTDD 1GRWA 1Z6JT 3MRNB 3VXQB 2OP4H 1WZLA 3UJJH 1LEIB 3HC3H 4M00A 4NZJA 2WWKO 1T04B 5IB4B 1DQLH 1MRDL 2XTLA 3IDXL 5A3ID 4OLVL 1OB1B 3KLDA 2B8OT 4Q58C 4ZMAT 5M94B 1IC5L 3UBXI 4UU9B 3TWCL 4BM7A 2Y7QA 4YZFF 4LHUG 3VFPB 1QPPA 2FX9H 4WTZG 4ONFL 3B9KD 1BOGB 5HGGS 4N5UA 4S2SA 5HPMB 4WW2A 3WFCH 3NGBB 5DUPL 4YXLH 1MELA 3KPRA 4YUEL 4MQ7B 2P49B 1MJJA 2UY6A 2IEPA 3QEHB 1PZUB 1I7UB 5F9DC 2WMPA 1FIGL 4KRLB 2JKXA 1W2KT 3QSKB 4WW1B 4P2CG 4N0YH 2YA1A 5E8PA 1LO5B 3UO1H 1A2YB 3S3JA 4MCYA 1HILB 1UB6B 4K3DL 1WZ1L 1MAKA 1EDQA 1FCGA 4JRWA 2B1AL 1FLRL 3KYOB 2IH1B 3WFBH 1HHHB 4M7JL 4B7LA 1NJ9B 2YD9A 5DS8A 1FL3A 3SQOL 5DQ9B 4H26B 4PJAA 3ARRA 1AXTL 5IBLC 2ZG1A 4NZRH 5DA4A 2BVQB 1E4XI 4NBXB 2ZSVB 4NWUL 3KPRE 4NC1C 1AR1D 3QG7H 4M9PA 1XT5A 4H25B 5EPMB 4JAMB 3GM8A 2BJMH 4MQTB 1ZVHA 2YMXH 2HVJB 5BW7C 3BDXA 1H15A 1ORQA 3LEYL 4A2LA 1A3QA 4ZNCD 1SEQL 3TVMB 3V7AG 4JN2B 4FABH 3L3DB 4DK3A 4GAGH 1N59A 5I76A 5GISL 5B3NA 5BJTB 4QRRA 3M8OL 1G7MA 4ZPTA 1YMMD 3LN9A 3ZDYE 1DN0B 1KEML 1G6RA 4CN1A 3PGFL 2WBJC 5J11B 1AO7B 4C58B 1YEDA 1LO2H 3FO9A 3FT3A 2CH8A 3P9LB 5T3ZE 1L7IL 25C8H 3BXNA 3D1MC 4WENB 3GSQB 1UJ3C 5LAXB 3VGFA 1RD6A 1QRNB 3DO3A 4QTIL 5E9DA 1YQ2A 4JHWL 1I75A 2BNRB 2HMID 2DIBA 4PJCB 3REWA 5BZDB 4NJAL 5KANI 5EBWB 4KDWA 1T6VN 2IGFL 3TJEH 3PWVB 3NA9L 1LMKA 5AZ2L 3TBWA 4P49A 3WFZA 4BYHA 2IF7A 3D0LB 1VHPA 4M5ZL 1HXYA 2PETA 3BKYH 2GT9B 5DMGC 5I1IL 4OZIB 4OIBA 3P4OA 4QRRE 4DVBB 4WI2A 4MA7H 3CZJA 3TA3B 4PBWD 1U8PB 1LEGB 3NFNA 3VXUE 4WI6A 3QFJD 4YBLB 4K7PL 1RUAH 4F57H 3QNXB 2GHWB 4Y88A 1KLFA 2MMXA 2G5RA 5MP6L 2HLFD 5E2UL 2HN7B 2AERT 2D7TL 1OL0A 4FFWD 1YEJH 1I7RA 5DVKA 3U79A 4NT6B 4K2UH 3DWTA 5HYFA 3CSBA 5L2JA 1UXSB 5EU3B 4X5XB 1A5FL 4XNMA 3QDMB 4RWYL 2W65B 4X6CB 1Z3GL 5A2FA 4ETYA 5DTFA 5JIPA 5DD6B 2EDFA 2R0KH 4NRZA 1UH4A 4UT6L 1QVOA 1ZXQA 4EIZC 3TN0B 3EYOA 3L6FA 1EXUA 4XVUD 4L3EE 4HS3A 4AJ0A 2NTFB 2VLLB 4JDTL 1JNJA 4IRJD 5CZXC 1J1OH 1XGRA 4JM2D 4JY5L 3ARVA 4NRYA 2V9RA 4GOSA 4XMKH 3ROOB 3OKDB 1NBVH 2DF3A 3O8XA 3NCEB 3QJFA 4MNQB 4OCLC 4KK9C 2J8UB 4WWKA 5GGSA 3S34L 1BD2B 4RQQA 5BS0E 1HK6A 2A6JA 2W1NA 2BMKB 3D9AH 1I3GL 3G6DH 3AAZA 4L4JA 1SEBA 3BI9X 5C08A 4NHUA 1TZIA 1YECH 5T1LB 4BQBA 3GMLB 4DOHE 1HHIA 5D1QA 1P7QB 4ZFZB 3WDIA 1A4JB 2BSTA 4L4TA 3M1BB 1E4XL 3RIFF 1B0GB 1YEHL 4OKVA 5DMJB 5EN2A 4JFYA 4UDUA 2FYYB 2UZIH 2CXGA 1R24A 3MRHA 4LSUH 3FOLA 3ARBC 2BY3A 5GIRA 3MRJB 3V0WH 1VACB 3PL6A 1IT9H 3LD8C 1GZPA 2A6IB 5F7DB 5HGAB 3GI9H 2EZ0D 1P1ZB 2D9QB 1S7XB 1EEZB 4HIEA 3HZMB 5E8DL 1AQDA 6FABH 3OXSA 3C6SA 5IBTL 2IH3B 3FMGL 3BKMH 3HR5B 1T0PB 5C08E 4BFEA 3FQXB 1KF9B 3AU1A 4GRMB 4IDJH 1G7IA 2OZ4H 3T0ED 2JCCA 4OBSA 4ZAKA 2FO4B 1JNLL 5D1XA 4L4TE 3SKMB 4OZGF 12E8H 4ZNEA 3MBEC 3VXMD 1UKTA 3T2NL 1Y6NR 3AUVA 3VWJB 4OFDA 2R29L 5ICXB 1PKQB 3BH9B 2X4NA 4KKBC 4UT9L 3TO4D 1RZJL 1FBIL 5TH2A 3SCMC 2OJZL 5IEHB 2PYEA 5HDQH 4KI5D 2NMSA 2VLJD 2VXUH 1NGZA 2UY7A 2XACC 3MV8B 4PRHB 5I66A 4XNZC 2RB8A 4KVNH 5JDSB 2EC9U 1YYLH 4G5ZH 3VRIB 3DYPA 1T3FA 4XCYA 3TBVB 4O9HL 1KJVA 1RI8A 2APFA 2XN9D 1VGEL 1A4KB 2RBLA 3GHBH 1W72L 4Y16A 1EO8L 3B9VA 3O45A 3KPOA 5FA4B 2O5XH 3RVUD 1MFEL 1PSKL 3X14A 2QSCH 5DGQA 4ZNEE 2SEBB 3U6RA 1JYXA 4JZOB 1CDGA 1KB5B 4MMXC 4FQJL 4R7NA 2QLVB 3OKNB 5JPNB 5DXWA 1NL0L 5F7HA 5F1NB 2BC4A 1YY8B 4JREC 2PYEE 1GCFA 1RULL 2XRAH 1OD9A 1YEGH 3HPJA 5D5MB 1FO0B 1CT8B 5EU6B 2FEDC 3V5KB 1MWAB 4GKNA 1G84A 1SBSL 1L6ZA 4Y4FC 2F19H 3TPUA 4G7VL 3BIAX 2VKXA 4OGZA 1DUYA 1XGQB 5DJZA 3X17A 1JGVL 2GSIB 4HAGA 4IOFD 4N0CC 2YD5A 1MQKH 2V2WB 4FZEH 5IG7A 1J0ZA 5EBGA 4X83A 4OFVA 4U1SA 4ZQKA 4XP5L 2HJLA 2NY0D 3O9WC 4JQXA 3LH2L 4PJ9A 2XKSA 3QQ4B 5SWQB 3FHAA 4L9LC 1KB5H 2BSRB 4DEPC 4M3JA 2VISB 1E4WH 2DMCA 3IKKA 3FQNB 3OF6D 4P59H 4R7DB 5J1SC 3W0WA 1DUZA 3L3OA 2W07A 3RP1A 3GRWL 4MJ4A 1GC1L 2PUQT 4ZUWB 3D87B 4ELMF 3D0VA 4CMHB 4HV8A 2H32H 1IKNC 3VH8G 4MD5B 1JWMB 3FRUA 5DHYA 2YKLL 4POZD 5DK3A 5GGQL 4GKZB 2IAMA 3WLBB 1UACH 1TQBC 1C12A 4GSDH 2DQGL 1HN1A 4OZHE 3I85A 2YN3A 3RKDC 4O5LL 1Q0XL 2VL4A 4CJ1A 3O3BB 3PF2A 1G9MC 1QHOA 3TZVD 3IFLH 5IM7B 1K4DB 4CVXA 4M8QA 4YDIH 5EU4A 4EVNA 5EWIL 1R5IA 4OFKA 1HXMB 2UZXB 1Q72L 3UYRL 1RVFL 4I48A 1NBYA 3SO3B 2GY7B 4Z7WA 3F5WB 1NMBH 1T5XB 2L7UA 2R2CA 3DIFB 3BEWB 5DEGB 5DRNA 1E6OH 3BRDA 1UZ6E 5IUSA 4U0QB 2VDQL 1NCCL 1CQYA 3DOSA 3WLWC 2OCFD 3S37L 1BIHA 2HT4D 4PJHE 5D1ZD 4MNHB 3RWEB 4HJ0D 3RVTC 1UM4H 2A83A 4NN7C 1JPSL 4S0SD 1CGUA 3QEGH 3IB4A 1N6QH 5HHVL 1S8DA 1T22B 4I1NB 4YAQA 3MRLB 5F6IC 2V5YA 1A1NB 3B9KB 5HDBE 5H2BB 5HI3C 5HVWA 4KY1L 4LVOB 4XVSL 1ZSDA 1U8HA 3QO0B 3DV4A 4IHOA 4Z7WE 5MI0C 3SGDH 3VGHA 4RGND 4ZFGL 1FAIH 2H1PL 2I24N 1QBLH 3VXRD 5I75B 1F90L 3LDBC 5JXEA 4JFZL 4KKCC 4P9HC 5L88H 1FP5A 3H6JA 3SDAA 1DLHA 1FYTD 3MO1B 4HGMA 4ZTPH 4OD1L 1T0NA 2EH8L 1FIEA 1EIBA 1SM3L 3O4OC 3FQWA 2VC2H 5EZLB 3QQ9D 3QXTA 1QSZA 4PJ7B 3C09C 3IJHB 1A7OH 4NJ9L 2HTLD 2VXQH 4D9LL 4KV5E 3BZ4B 5E5UB 1QFUL 5FF6A 3MV9A 1Q9OB 1U3HD 1A3LH 2NY5C 2YZ1A 1CFNA 3HUJF 1KCVH 2H6PA 4LLQA 2EE6A 2V9QA 1XZ0A 3QDGA 1FHGA 1A1OB 2UVEA 3QUZA 3UTZB 2XWTA 3RIFK 4M7ZC 4MJ5B 4QTHB 1UG9A 1H0DB 3SY0B 5DK0A 5GS1A 4N0FB 1U58A 3QWRD 5EZOH 4R6UA 4RRPG 5CD3A 2Z4QA 3MMEB 3S9DB 1YMHB 3OXRB 2G75A 3LOWA 4XVJH 1YMMB 4DVRL 1MAJA 2VJXA 1P2CA 4WFHE 2IQ9H 4ONGL 3O6KL 3DMMC 5T1MB 4F8QA 4LLWA 2CIKB 3TV3L 1P9MA 3CMOH 2AQ1A 4I3GA 5CZKA 4M1CD 4H88H 5DK2B 3RRQA 4D0BB 1KIRB 2G2RB 1HEZB 4TULH 2HKFH 2J5LB 2ZCKL 4PGEB 4U1MB 1DDHA 2ZUYA 2B4CL 4E41A 1A6UL 3MJ8B 5IJKA 2I07B 1QLFB 5AUMB 4EQ3A 3WIHA 4MLIA 3L3GA 35C8L 4YFDB 1S7TB 2OJEB 4G9FE 1CFSB 1OAUH 3MV7E 2AXGB 3ZKQD 5D2NE 1A1MB 1PG7H 4K94L 4P23C 1FRGH 4P5TA 1KIPA 3MYJA 3QIWC 3WN5A 3S8WA 3NCMA 4NUGH 1CN4A 3QUMH 5TE6L 3V7MA 3PNWA 4BQ8A 4MAUL 4NCC2 1GAFL 5KVEL 5F88A 1UYWL 2VDOL 4NNYA 1NBZB 4LDOB 3QFJB 1VEOA 5ALBH 1A7NH 4I0KA 4U6YB 5GJTH 4Q6YA 4LCYA 4KJWC 1KPRB 4JPWL 1MRCH 3QHFL 1NFDA 3ULVE 1F3JB 5C0BD 4P3WA 2DBJA 1ND0A 3I6GB 2XFXB 4OGXL 4E41E 3GMNA 4KZDL 3IAPA 2EDNA 4EIGB 2V17L 3UTPE 2OK0L 2NX5D 2NYYD 3GUTA 3BWAB 1MLCA 3KPTA 5E8NA 3CFKA 4K55A 3GSXB 5C0GA 3D85A 5B8CB 2ICWB 1T7ZA 1KN4L 3PWJA 4KU1A 4WJ5A 5FKPA 2RAMA 2HFEA 5IIEB 5F1SA 4NC2B 4NO5A 4HIHB 4RIRB 4I0PA 3O3EA 5CP7A 1Q0YL 1ROWA 3OR6B 4JM4H 4KKAD 4GBXD 1J1XH 3FTGA 5C3LD 2IALB 2VERN 2LTQB 3VCLA 1VGKB 1HCVA 2VZUA 4OQTH 4LPXA 4U1JB 5GGTA 4L1HA 4UOJA 1IC1A 3DO7B 1MIEH 1YNKL 1ZLSL 2Q86B 3EHBC 4X7EC 3ARQA 1N8ZA 3ALWA 4JG1H 4KQ3H 4PJXB 5FCUL 4IRJB 3FFCE 4XCCH 4JM2B 2F5AL 5LG1A 2AEPL 4DAGL 5IFAL 3WS6C 3JWOL 4Z9KB 4PRAA 4MA8H 5C0ND 1R3JA 3X11A 5D7JA 5F7WC 4HUVB 2BVOB 3MR9B 2NQCA 3MLYL 2YSSA 8FABA 2ZPKL 4MDJB 1XIWD 1CXIA 1JI2A 2NTSP 2H3NB 2DWEA 2QR0B 3RFZC 3ARGD 4ZXBA 2APWA 3U83A 4EN3D 3LZFH 3SJVD 3EYFA 3QPQC 2DQEL 1WWBX 2XZCL 5EUOF 5F89B 2HKHL 2J8HA 4R4FH 5I15L 2NZIA 4QCIA 1NAML 3T0WA 1JI1A 4X6DE 4L8BA 3QCTL 3O6FC 1BFVL 4GG6B 1TTGA 3HC4L 3MJ9H 1CK0H 1KTKE 4J8RA 5FK9B 3S36X 3IAGC 4ODXB 4W68A 5DD5L 2AEWA 1FNEB 1UC6A 1WFOA 4P57B 3BPLC 4XBEH 1XR8A 1U0QA 1MHPH 4PUBH 4CU7A 3BMVA 5C0RL 3IJSA 3TFKC 2ED9A 3QIBC 2VLKA 5GQBA 4TVSa 3LMJH 4OLUL 5GGVY 4QY8B 3IRPX 5I71B 5J3HD 5ISZA 4NGHH 3RNQB 1GYAA 1GGCH 5A40E 3T0EB 7FABH 3LKQA 5C0DA 1U95A 3O2WL 1A21A 1IVLA 1NAKH 2PKDA 1JPFA 3GK8L 1MCOH 2I9LB 3VFUA 4RDQG 5J13B 4Y4KD 3C60D 4X80L 4QRTB 1FVEB 1GJIA 3VXMB 1A6WH 4LLUB 4X0KB 3ARTA 4JFQA 4OLZH 4Y1AA 4OTXL 5DRXA 3OPZH 5BO1L 5TDNB 3CFCL 1RURH 2CXKA 4LNVA 3TO4B 3BUTA 1GPOL 1IBGL 2X1PA 4KQ4H 1BJ1H 1WBYA 2VLJB 1ED3A 1MCPL 4PJEB 1OGAA 2AJXL 3PABB 3VWKD 1N5AB 1DL7H 5DURD 1S5IL 3C8KB 2HRPH 1QR1B 3SDDD 2B7DT 1U8IB 5EO0B 2VE6B 1KCKA 3ZE2F 1VFUA 2JB5L 3HAEB 4L3CA 2XN9B 2VLKE 1HQRB 3ROLB 3V6OC 5JHLL 5KSBA 5E94B 4DKAA 1S9WA 5D6CB 2JE8A 2CKNA 1H3TA 2A6KB 5LBSH 2YK1L 3F65A 1XGUB 1LO3L 4HF5L 4N8VB 2YPLA 3NFPA 2VDRL 3GHEH 4JFFD 1FL5A 4OUUA 4YNYA 4Y1AE 1K6QL 1GGUA 5DHVA 4POUB 2N4IA 3DVGA 1G0DA 4C56D 5F9OH 4LGSB 4XCFL 4JHZA 3QDJE 1OGAE 1ZWIA 2DLEA 2K1MA 3ZDZF 3OHXA 3FT2A 5JNYA 5KS9E 5HYSB 1KN2H 4K3EL 1UT9A 1YNLL 2NY3C 4KHTH 2R0WL 2FRGP 3WHXB 5I1DA 1YNTA 5EA0H 2UYLB 2X4SB 1E6JH 1K85A 2NY0B 3TBTA 1MJUL 3L3HB 1GZQB 2YPLE 5C2BL 3G6JE 3RX8A 4UILH 3TBYA 4XH2A 2DQCH 1VFBA 4MCZB 3KYMA 3MUHL 1S7SB 4PGCA 4JDVA 4JGJA 4LKXA 4X7DC 5JQHC 4IOIA 4AEHL 2AJSH 4APQA 4C59B 5IBLD 4JQIL 1OLLA 4GKSA 5MENA 5FEBA 1OW0C 4LSQL 5DEZA 3VMOA 2C4XA 1G9NH 1RZKL 1CLOH 5ALCL 1CE6B 2HAZA 4G6JL 2WM0A 1FLTX 2CK0L 3F7VB 1NGYA 2ZSWB 3GJEA 1NCUA 1TVBA 2AJUH 2BVUA 3TO2B 2FO1A 2IBZX 1JUFB 3L3IA 1Q38A 1UADC 4FTVD 5FM4A 3RTQA 3TZVB 4U1NB 2DTMH 2GFBA 3O0RH 2WBJD 2D4FA 5HHQA 3OR7A 1QBMH 3L7FB 4PB0L 1DQLL 3MREA 1EAPB 3H9SE 2W59A 3OKOA 5IF0A 3E6HA 1AKJA 5EOTA 3SBWA 2P8PA 3NFSL 4CDGC 4U0RB 4N68A 2VMFA 3HI5H 3VRJB 3VFTA 1QFWI 3H2WA 2FSEB 3WS3A 3O2DA 3M17A 5CIPA 4PJBB 5D1ZB 4QYOA 1CF8L 4PD4K 5DUBA 2R8SL 3KNBA 4YDJB 4UUJA 5DMGD 5DT1L 5FYKH 5C0EA 3RL2B 2OTUB 2MCPH 3QAZC 4R97B 5JR1H 4W81A 1FNHA 3S4SA 1PQZA 2R23B 3EYVA 4EEEA 5I73B 2IPKA 3UO1L 1OAZH 3GEWB 5IROA 2X9YA 4G6KL 4WFFD 1RZJC 1LWRA 2DQIL 4F7PA 3MSPA 5JIKA 1EK3A 3BN9D 4RGNB 1DCLA 4RMVA 1HIMH 3SKNA 3VXRB 1F4XH 4UV4L 1WVZA 3ESVF 4F33A 3ZYIA 1CVRA 1J05A 1FYTB 1UZ8A 4BZ2L 4XNUH 1W0VB 4OCYH 2Q20A 4NZRL 1NEZB 3U0WL 2EIZA 2Q7NA 4YLQT 4J6RH 5F9AC 4OFIA 3O3DB 1NMAH 3G5YA 2VWEC 5LVEA 4Q9QL 3LPWA 2BDNL 3GMMB 1FL6A 4AEFA 2BJML 1NC2D 1S7WB 2YMXL 3OGCB 3C8HA 4ZG1A 4HK0B 2VQTA 4KHXH 1U3HB 1R5WB 4D0DA 5B3JE 9CGTA 3CSYA 4GAGL 5KN5A 5AD0B 4AQ1B 1N26A 1TJGH 4W4OA 1KCUH 1OSPH 1QKZL 1BQHB 4HUNB 4ODHH 3V0VA 3WJJA 3O2VL 4EI5C 3EJJX 3L5IA 2H8PA 3CNKA 1LO2L 3GBMH 4QHNA 3DX9B 4IRSC 5DWUH 1I1AC 3ECBB 4Y5YB 2ZKHL 4LMQE 3HE6A 1P5VA 3PV6A 1IMHC 4Q2ZA 3MLZH 5CMAB 3I3BA 4HEPG 2J6EH 3BO8B 4HZLB 4N90E 3OGOE 3MYZA 4KK9D 3UTSA 1KACB 1QQDB 4RGMB 1ZHNA 4ZPVB 5IW6A 4U1HB 3TCLB 4NKDA 1R0AH 3PXHA 1I9IH 3QI9C 5M7QA 2R2EA 5JUEL 2YS4A 2EC9T 3MOAH 3VFOB 1IEHA 2FJGA 3T2OA 3CCHA 4ODBD 3LVEA 1KTLB 1IJ9A 3KYAA 1XAUA 1OY3B 4GXUN 3ZKMD 1VFOA 5B22A 4X7SL 5HI5C 4P2RA 4UINH 1FFNA 1JGLL 1RUAL 4F57L 1DFBH 3HR6A 3ARBD 3W5NA 2YRPA 2HG5A 4PJAF 4XGZB 3JTTA 3DSFH 5ADPL 2YC1A 5L8JB 3VRLF 5DD1H 1YEJL 4OCRL 3KLHD 3OAZH 4PRDB 4G6FD 2BRRL 1FH5H 3KPRD 2DLFH 3OJVC 4YPGA 3P11L 5C0BB 4KTDH 2YR3A 2CGRL 4PJFA 1H9VA 5GS0H 3OAUH 1MCHA 2OLDA 1P4IL 2R0KL 4X7CC 1D6EA 1PBYA 2A74B 4OM0L 3MBED 3F58H 3ARXA 3MRKB 4KJYB 2NX5B 1QFWL 4XNQB 3ZSTA 3U9PH 1G7LB 4KKBD 2H2SD 4HQQL 3FB5A 1N7ML 2BSED 2A77H 4DGYH 3ZLQC 1FZOA 1BBJB 3DECA 2GJ6A 2ZOKB 3V52L 4Z7VB 5T3ZD 3B8YA 1G1YA 4LCCC 4C54A 2I60H 4M4RA 4GBXB 4XP4H 4PR5B 3WL9A 4XMKL 2AK4A 4GMSH 4RMUA 5C09E 2Y5TB 4PJFE 4L8DB 4PJIA 3B5HA 5BXFB 4P5MB 3TIEA 4JZJA 4PGZA 4JY6B 1MAMH 3IFPB 4LEOA 2J4WH 2YN5A 3GSRA 3VG9C 1OPGH 4XP1H 1N0XH 3V6FA 3D25A 1F97A 43C9A 5I9QB 2WLZA 4PV8B 5E99L 1MREL 1S7VA 3VXUD 2EYRA 2XKUA 1QYGL 4NQSA 3KYKH 4M62H 4U33A 1XF4A 1U92B 3O4LA 5GSVA 2FB4H 1LDPL 3FAWA 3P0VH 2UZIL 4Y4FD 3RDTA 3T04D 3MRIA 3ARGB 4EN3B 4LAQH 3SJVB 3CFEA 5B39G 4LSUL 4OFYA 5FCSH 1YY9C 2AK4E 3I75A 5FYLE 4N0CD 4XCEA 4UMGA 3IDYC 3UCRA 3IKCB 3I6LE 1P6FA 2CDFA 1T80A 4PB9H 3CFDB 3VA6A 3RGHA 4P4KC 3GSWA 4H5SB 4DTGL 1J0JA 3QXDA 2GK0B 4LLVB 3ARDD 3P0YH 4CRPA 4S11A 12E8L 2KKQA 5DZLA 3O4LE 5D7SH 3V6ZA 3MNWA 5L6YH 1FFOB 4ALAL 1FGVH 4L3ED 2H2PC 4MQSB 2NXYC 5AYQA 4PYGA 1ORSA 1CICB 3TLRA 2D2OA 1I7TA 1CGSL 4Y4KB 3C60B 1QNZL 4N0UA 5E5RB 4LVHC 4TUKH 4TUOA 1JGEA 2ARWA 3U46B 3NIGF 3N1MC 4ZODA 3RKDD 1T0MA 3AMLA 2B4CC 5L8LB 5E2WH 3NIDF 1JZ5A 1C5DA 1BFSA 2DYPD 4XC1H 5BS0D 1MF2L 3Q0HA 3VMPA 3VWKB 2ADIB 3KLAA 1BWMA 5DURB 4L29A 1FG2B 4K94C 4X9FA 2YWZA 3SDDB 5I17B 1G7PA 3TT3H 4NQUA 2VOTA 3MLWL 4RMQA 4MNGB 1Q94A 4OIAA 1Q9WA 5DJYB 3GMRB 5DQJB 3IDGB 2VDML 3WLWD 1NKOA 3NZHH 3QNYA 2ZUVA 3CDGA 1H5BC 4F2MA 1CLYH 4FQIH 3C5ZC 1EMTH 3VGDA 4TOYH 4AEIL 1E4JA 3M45A 3T3ME 4JFFB 1FZMA 1G7QA 1UB5B 4DCQA 3RUGE 5EBMB 2AXFB 4LVEA 2ITDB 4C56B 4UOW1 2PR4H 4JO1H 5FV2A 3EJYD 1IFHL 3IDIA 2CLZA 4UV7H 4XBPB 1A64A 1KXTB 1OAQH 2JCCF 1CDYA 4NQVA 4X6BA 1KELL 1RUQL 4U7SA 2X4PB 3WD5H 3I6KB 1DZBA 5F8RC 5GGRB 1G7JA 4P3CL 1BHGA 3MROB 1WSST 1AD9A 1UA6H 3PWNB 3LQAH 3R4DA 3W9DB 4KKCD 5IK3B 5GS3A 3KPMB 2X9XA 5TDPA 2BXYA 4LSVH 2X89D 2M2DA 5IMKB 3LV3A 1OLZA 4HK3J 3SGEH 2V6HA 2GITB 4YFEA 5F9JB 1S9XB 2A9MH 3IDJB 4Y2DA 4KMTH 4HWZB 2ZWLT 4D3CH 4ZFOA 1T5WB 5DQDH 3Q5TA 4GFTB 5DJ2A 5C0FA 2PO6C 4PLKC 1F2XK 5C0AA 1UACL 1B90A 1RY7B 4MXVE 5F7FA 1M71A 1TZGH 4XCNA 5JOFA 1QSFE 3ZDXE 2OI9C 4Z0XA 4Z8FH 3V4PH 2XZAL 4FOMA 3CX5K 3JWOC 1D6VL 1QTYT 3MXWL 4MJ6A 5MHSE 2A6DA 5ESAB 3FCTB 1AXIB 5J7CC 3ARFA 3HFML 5D1XD 4WO4A 5DSCB 5LGKA 3CLFH 1ACYH 3VXQA 3EOTH 1LEIA 1DSFH 4IMKC 4GW5B 1T04A 5IB4A 1AD0B 1B2WL 5DO2D 1RMFH 1OB1A 4FTVB 3ZL4H 2JJVA 2DQTL 2GUOB 2VDPH 2P8LB 2HH0H 3EW3B 2PYED 4CVWA 5CEXB 4UU9A 3DMMD 2WBJB 2QV2A 4HJJH 4WUUD 3BN3B 3VFPA 1NLBH 3DVNB 5J9PB 1YEKL 5C0AE 4R8WH 2FECL 1BOGA 1TTFA 5HPMA 5BOPA 2GTZB 4L8SB 1FZJB 1I4FA 3GBNH 4GXUM 4MQ7A 1UJ3B 4HS6B 4LPWA 1ZTXH 3QEHA 1Z0NA 3CFJB 1I7UA 4G43B 4OM1H 3A67L 5CBEB 3G5XB 3K81A 4PP1C 2WUCL 4WW1A 2EKSB 4F80A 1ADQA 2R0ZH 1JP5A 1LO5A 1A2YA 2DIJA 4QNPE 5BRZE 3BRGC 4P23D 1HILA 1UB6A 3MODH 2O26U 3C5SB 3D2UD 1RUPL 3VXSD 2IH1A 2JIXD 1HHHA 4LOUC 1NJ9A 1JZ7A 3BKCH 5E5MB 1UZ6F 4JFOB 1BGXH 1MJ8H 5DQ9A 1IEBB 4Y89A 4H26A 2VSDA 2JELH 5C0IB 1DLFL 2BVQA 5C71A 3SQBA 4JO3L 2ZSVA 1U41A 2I5YH 4N1CA 2FHBA 1XF5B 4HUWB 1H3VA 4H25A 4XAWH 5EPMA 4JAMA 1C1EH 2VXQL 5MEPB 1UGNA 1X4YA 2HVJA 4EOWH 2XY1A 3JV4B 4TVPD 4XPFH 2FDBP 1P4LA 1UFUA 1X5AA 4Y8AA 4JN2A 3TVMA 1HCFX 4KAQL 4F9LA 3L3DA 4RRPA 4LSPL 3DROB 3KHQA 1D5MB 1MHCB 1DN0A 4YDVB 4AL8H 6CGTA 1NC2B 2BHYA 3MA9H 3QXUA 3UMTA 3U9UB 1AO7A 2Q8AH 2DMKA 4S1RH 1KULA 3MACL 3ZE0F 3P9LA 3HTLX 3BE1H 3MXVH 1VEPA 1Y6KR 3OKMB 3GSUB 5FOJA 4XVJL 3KPNB 3MRRA 5KAQF 3GSQA 5LAXA 1BQHG 1QRNA 3EHBD 4NBZB 4OIIH 3C2AL 5DF0A 2BNRA 3GM0A 4PJCA 5HVFB 5BZDA 5EBWA 4ZOCA 4K8RC 5FV1L 3C87A 5GSRB 3PWVA 1QFPA 4M1DL 1IAIH 4GUPB 2V2TB 2XA8H 3UDWA 5TE4H 4OZIA 2GT9A 1XGYL 4ISVB 3SDYL 2OL3B 3QIUC 3BRFA 4DVBA 3BIBX 3TA3A 2IFFH 1LEGA 1OAUL 1GGBL 2F8VA 5T5FL 1EZVX 2NZ9C 3QNXA 4Y5XA 3QPQD 1OQXA 1MUJB 4HSQA 4QXWA 4NUGL 4IRZL 3QUML 1MCWM 2JB6B 2HN7A 4KXZH 2CJUH 1ETZB 4OB5H 3BAEL 4CVUA 4JPVH 1QRNE 4PJCE 4NT6A 4ESKA 3VI3E 2EO9A 1RZKC 5GJTL 4PG2A 3O6FD 4LQFH 2XOTA 3ARBB 1MRCL 1I7ZB 1UXSA 5EU3A 4X5XA 4DW2L 5I18H 3LS5L 2CMRH 3QCUH 2W65A 3DUHA 4X6CA 3LD8B 3GI8H 2GY5A 4MD4B 4OZIE 1IILE 5DD6A 1YEEL 4CDHA 4G6FB 3TFKD 3JUZA 2DQUH 3QIBD 3E0GA 3ZO0A 1OP5K 3BT2H 3KPRB 5KANG 1RU9L 1L7TH 1HINH 3VE0B 3EFDL 4K23H 2JJTC 2XXCB 3MBEB 4K9EL 2NTFA 2VLLA 4KTYA 1FGNH 2KZWA 2Z0BA 2QBWA 3FJTA 1RIHL 2EDBA 5B38G 3ROOA 5J6HB 2Z8WC 4XXDB 1P69B 3OKDA 4H8WL 1RZFL 3OAYK 1DANU 3UTTE 5HVGB 3U7AA 4MNQA 3HA0A 2YD3A 5IVOA 2J8UA 4XNZB 1MIEL 3CX2A 3A6BL 2CQVA 2ZP0T 1BD2A 5JZ7C 4JG1L 4R0LB 2BMKA 1EA9C 3QXAB 4XCCL 2YUZA 1LILA 3LCYA 5C6WH 2D31B 5T1LA 2A1WH 2OZ4A 3GMLA 1MVUB 1P7QA 3EUUA 4MA8L 4ZFZA 4MXWL 1A4JA 4G9FD 1EHLL 1PX3A 2P4AB 1FORL 3M1BA 3MV7D 4U6TA 4CN4A 5E4IA 2W0LA 4I3SH 2R39A 1TZHA 3ILPB 3O8XC 2FYYA 3F6LA 5CSBA 1J8HE 1RIVL 3VXPB 1R3KB 5KVGL 3QH3B 5DD0H 5J12C 3L9RB 3UROR 4Z7OE 3MRJA 2J2ZA 1VACA 3QQNA 4YXKL 2I27N 3VXUB 1NFDF 3NCYP 2A6IA 2K7PA 5F7DA 5HGAA 4YFLI 4R4FL 3V4VL 1P1ZA 1S7XA 1EEZA 1QLEL 3HZMA 3X12B 4Y4FB 1J0HA 3ULVD 4KGLA 4QRUB 2VAJA 3DYOA 2I9TA 2IH3A 2GSGB 1CK0L 3FQXA 2YWYA 4N8CH 5D7KE 3WFDL 1XGTB 4GRMA 5E08H 3FONB 2NY3D 3LIZL 4XBEL 2FO4A 4YGAB 1LD9B 3UJTL 3UTPD 3SKMA 1JJUA 1UCTA 1IC7L 3HMXL 3Q1SH 1OSZB 4XP9L 3PL6C 5IBUG 1HHGB 2CRMA 4O2EB 3WIIL 3VWJA 4PJDE 3LMJL 1HXYB 3P73B 1PKQA 5ICXA 5GGVH 4HXBL 4L9LB 3BH9A 4P2OC 1MQ8A 4DEPB 1IC4L 3ARDB 5GRJL 3UZVB 4X4MA 5IEHA 3O2DL 1VDGA 1KCRH 4E9LA 4O4YL 3MV8A 4PRHA 4RBPH 5E24E 1RJCA 4AIOA 5JDSA 3LN5B 3S5LB 3VRIA 4J3UA 3TBVA 1AQKH 3MLUH 1MFDH 3OPZL 4L3EB 5D71H 5KW9L 1EJOL 1A4KA 4FQLH 1CFQB 1CL7H 2Y9RT 1UCBH 1YPZE 3QUXC 5GZNC 1I7RB 3FFCD 2VH5H 5FA4A 2VABB 3VXNB 3R1GL 4FXGB 2NLJA 1RUKL 2P7TB 4ZSOE 4DN4L 2W9EH 1FG9C 2SEBA 3GKZA 4JZOA 3U7YL 1KB5A 4NQEE 5JPNA 2DYPB 2Y1VA 3OKNA 5BS0B 4HFUL 3DUSB 4NRZB 2O5ZH 5F1NA 3HMWL 4YQXH 4X4ME 1BVLB 3VG0H 5C8JB 4I0PD 2IPTH 5EU6A 5D5MA 2AGJH 4PRHE 1B6DA 1CT8A 1FO0A 3NAAL 4QRQA 5LBSL 3V5KA 5AG8A 4DOHB 5K9JH 1MH5B 2BHUA 4YO0B 5K9QI 3RGVC 1KUMA 4UT7H 2J88H 3E6FB 3CX5J 4WTXA 1XGQA 4DZBB 2V5MA 5SX5K 2GSIA 15C8L 3LS4H 5F9OL 3SDXE 1NMCC 2V2WA 1XGRB 4FFVC 1TPXB 1E0OB 4WHYG 3THMH 4NN7B 5C6TL 3QQ4A 5SWQA 4HG4K 1G9MH 2BSRA 1EGJA 4XI5C 4C83A 5F6IB 3DRTB 3FQNA 4R7DA 4HULB 3V4UL 4M02A 4WY7H 5J1TC 2C3XA 2JK5B 1KC5H 1U2CA 4ZUWA 4Y8DC 4F37K 4PLNC 3G5ZB 3WFHB 1A7PH 1MCWW 4MD5A 1JWMA 2VZTA 1ITCA 5JMOC 3G5VA 1WZMA 5H94A 3WLBA 5LGHL 3QNZB 1IZJA 3WXWH 3IU4H 3O4OB 5E4EC 3NMEA 4HLZG 2EXYD 3B2VH 4LGRB 4HIXL 4NZDA 3O3BA 4LSSL 3CDCA 5IM7A 1K4DA 4HIEB 1A22B 3STZB 4JRXD 5KSBF 3QCVH 4O02H 5ACMA 3W2DH 1HXMA 4G3YH 3BIKB 2A9NL 3E8UH 3LPFA 4XPGL 5K9OA 3F5WA 1T5XA 1BM3L 5F7UA 3KR3L 3DIFA 2FIRT 3BEWA 5DEGA 1JZ8A 3DETC 5D1XB 3S36L 2WIMA 5D7IE 1WBZB 4P9HH 4EI5D 2QQLH 5F96L 4ODSH 3AROA 4YK4C 1I1AD 4L5FH 3CVHL 4BFIB 4MNHA 3RWEA 4R96B 4ZS7H 2W38A 4AEEA 5L7XL 3BFOA 5TH2B 2Y5EA 2PYEB 3KPSE 2UWEE 3QDJD 3DMMB 5T3XH 4M43H 4WU7B 1T22A 3HI5L 4NFDA 4LFHG 4WUUB 1OTTC 1K4CB 3MRLA 3HN3A 3GSNH 3B9KA 1CZ8L 5H2BA 2RCSH 2CUMA 2W9DH 2NY5H 3QO0A 5C9JB 5I1KL 5FYKL 3NABH 3I3EA 1EHAA 4XT1C 2XWJB 2P48B 4TUJB 5CD5C 3HC0A 1SBBA 4KFZC 4Z78B 5TF1L 3U6RB 4ZDHB 4P23B 1OAZL 1P4BL 4PRBB 3MO1A 5DVMA 1FCCA 2B20A 3D2UB 2V9TA 1JNNH 3VXSB 4X7FC 2JIXB 5EZLA 1HIML 5DVNA 4PJ7A 3IJHA 2VIRB 2EE3A 2M1KA 1MFBH 4GKNB 5IHZB 4X4ZA 3BZ4A 4JGUA 1Q9OA 4OZFG 4X9BA 5LKNA 2HVKB 3HB3C 1T4KA 3U0PB 1A1OA 3UTZA 2Q6WB 1T1YB 3ETBF 4OZHB 4Q6IC 4Z18A 3JV6B 1F6LL 2YD7A 4QTHA 4JFPB 1S7RB 1H0DA 3ORJA 4JKPL 1WZKA 3BPOB 3SY0A 4YHNB 2ICES 2R0LH 4X9HA 4N0FA 4EUPH 1J1PH 3GNML 4RSVA 4A6YL 2IADA 4LCUB 3MMEA 1QEWB 1YMHA 3OXRA 3ULUL 1YMMA 1KEGL 1MFCL 2PW1B 3W9EA 4HEME 1NSNL 4KRMB 5T1MA 4PJ7E 4U6HB 1BMGA 2CIKA 4KWUA 3H9SD 1V7ML 5CEYB 5IV2B 5DK2A 3QQ3B 1KIRA 4HW6A 1HEZA 2FX7H 4D0BA 5KG9B 5CP3A 2NY1C 2VZVA 4PGEA 1DQDL 1A6TB 4U1MA 3MLZL 1IEAB 2I07A 3V8OA 1QLFA 2J6EL 5AUMA 5GS1C 3TPKA 3ISWA 1EFXD 5IJVB 5D8JH 3LQZB 4PJHB 3RI5F 5F8QC 1S7TA 2OJEA 3V95A 3WUWB 5HYEA 1CFSA 1TJIL 5DC0A 2AXGA 2BK8A 4J3WA 4XAKE 1A1MA 1JTTA 3IXAB 1OM3L 1INDH 1LE9B 2M26A 2BNQE 4TNWF 4DKFL 1Q9KB 3D69A 2Z35B 4D9QE 4IMLB 3VU2A 1MRDH 2QQKL 1NBZA 3IDXH 3VGAB 4EI6B 3QFJA 4UINL 4XWGH 4U6YA 1DQTA 1UKQA 1QBAA 5GRVL 1DFBL 1KPRA 4JJ5B 1U6AL 4NZTL 5DRNB 2X70B 1IC5H 1KENL 1F3JA 1YY9D 4OQTA 2AJZB 3TWCH 3DX7B 5TQ0L 1EX0A 3I6GA 5BMFL 2XFXA 3F7RA 2X7LA 4AT6B 4JB9L 5DD1L 1M7DB 4N5EC 2ICEB 5E1AB 1T83C 4TNVF 5ANMA 5GS2H 1WCQA 1W0YT 3O6FB 2D9CA 4M03A 2A83B 1FH5L 3BWAA 5DUPH 3I9GH 4OGYL 3JTSB 3KHOA 2C1PB 5CEZL 3BPLB 3GSXA 5B8CA 1FIGH 2ICWA 4D8PB 3RZCC 1I9EA 2OXGA 4G8EB 4DQOL 4HC1L 4HIHA 4K3DH 4M6OH 3QIBB 4RIRA 1ZSDB 2JF1A 5E00B 4D9RE 5K59F 3QFJE 5GGSY 2B1AH 3OR6A 3QZWB 1C5CL 2H2PD 5DZOA 3EKCA 2IALA 4M7JH 4N9OB 2NXYD 3U9PL 2F8OA 1VGKA 1UXWB 1NANH 2DI8A 4U1JA 2DLGA 1QRKA 3JWDL 3DO7A 3QHZL 4GQPH 5D93B 4FNLL 2Q86A 4OBRA 3VXOA 3IDMB 4PJXA 1JV5B 1AXTH 4YBQC 4IRJA 1XF2B 4JM2A 2BSSB 4Z0BL 1A6ZB 5ANME 3J7HA 4N90D 3RA7L 2X5PA 1EV2E 4NWUH 4QRPD 5INCB 2VXTL 4GMSL 4HPOH 4KUZL 3HI6L 3JSSA 2BVOA 3MR9A 4HGKC 2P5ED 4MDJA 5T1DL 1NDGB 1SEQH 4MA1C 4ZFOL 1DEEB 2H3NA 4UB0L 1DVFC 5GISH 2QR0A 2YD8A 1UM6L 5K33A 1T6WA 1NGPL 1KEMH 4G9FB 4JPIB 1U8LB 3PGFH 5F89A 1JFQL 3MV7B 4YFLF 5D2NB 5HYIA 1RZ8B 4KK5C 3SE3A 3C5ZD 3U2SA 2O61A 1JYVA 5FYJU 2A73B 2Q87A 1L7IH 5CSZB 4GG6A 4Z7UF 5FK9A 4ODXA 4PTTB 1FNEA 1T1XB 3QPXL 4QTIH 4P57A 4JHWH 4QXUL 1ITBB 4NJAH 4H1LB 4ZXBC 4RWHA 2F8XC 2IGFH 4UNTA 2RFXA 3NA9H 3MLPA 5AZ2H 3T0DA 3RY4A 4M5ZH 4LRIC 2ZNXA 5I1IH 4QY8A 3OBAA 4P3DA 3ABZA 3RNQA 2NY3B 4U49A 1IE5A 3DV6B 4TSCL 3P77B 4WI8A 2IC2A 4MD0B 3ZKND 1WAAE 5J0BA 4QRTA 1FVEA 5F72S 4LLUA 5D7SL 1F11B 2AQ2A 4X0KA 1H8OA 5HD8C 5MP6H 2RHEA 5E2UH 4XHJC 5TDNA 1ZS8B 3KPPB 4ZD3L 4ODVL 2D7TH 3TO4A 5DC4B 4EKXA 4F7CB 3FL7A 4PY8I 2VLJA 4PLKD 1ADQL 4NN5C 4PJEA 5DA0B 3PABA 4OSUL 4PRNB 2F74B 4HG4J 1J0YA 5SV3A 4UQ2B 4PJIF 4B53A 2YA2A 1A5FH 1U8IA 1J7VR 5EO0A 5C09D 2VE6A 1Z3GH 3HAEA 2XN9A 1HQRA 3ROLA 3CSGA 4ZYKB 4PREB 4XC1L 5E94A 2DRUA 4UZGA 3FFCB 3P4LA 3ZTJG 1IGIH 3DYMA 3K1DA 4UT6H 5D6CA 43CAB 2CKBH 4X6EB 5ILTH 3KJ4C 1XGUA 5D96C 4N8VA 3RNKB 3TT3L 1MHHB 2VLMD 2VN7A 2UUDK 5HDOA 2EIBA 3H7LA 1HOCB 2HFEB 3VFMB 5DVLA 1O0VA 5ERWB 5D7LD 4JDTH 5ICZB 4KI5E 3NZHL 4ERSL 4PJEE 4I0PB 2GKIA 5FKAB 4JY5H 4JG0L 4Q7DA 1EMTL 1QR4A 4TOYL 4QKXB 4U1GC 5FYLD 3AMKA 3I6LD 2DJ4A 5HYSA 2R4SL 3S34H 4YHZL 4X6DB 4PP1D 3BZEB 3WHXA 1I3GH 2X4SA 1LVEA 3WD5L 5MEQB 3L3HA 1GZQA 3ARED 4GAFB 2ESVD 5I1LA 3EDFA 1RJZB 1E4XH 3QAZB 3G9AB 4FQ2L 1YEHH 1FNLA 3OF6A 4K9EC 5JPMB 4MCZA 1S7SA 3OJ2C 4HGWB 4XRCB 2P5WE 1SVCP 3U30C 1DQJB 1A8JH 5JW4R 3K2UL 3OB0H 4L3AA 5DJ0B 2B5IC 3AVEA 2HT3C 1CE6A 4P99A 5IWLA 3T4YB 5E8DH 1I9RL 4HUMB 1Z9OA 5GZOD 1UWEL 2LABA 3F7VA 3UYPA 5IBTH 1YA5A 3TO2A 3FMGH 1JUFA 5IMOA 3MRDB 4APQC 5J6GB 3TZVA 4K71C 4U1NA 1JNLH 4TNWK 1WIUA 3BX7C 3OSKA 4JRXB 1ACYL 2NR6C 4UTAL 3T2NH 5ETUB 3IJSB 1OP9A 4ZTOL 3L7FA 4WRLA 2R29H 1NCBL 1R3IL 1EAPA 4TYUA 3QXWA 4UT9H 1J9CT 5EDXA 1RZJH 1FBIH 1EJ6A 2VDPL 2FZ3B 2OJZH 2OMBA 8CGTA 4GH7B 2VL5B 3VRJA 4EI5B 4HJJL 3RTQC 4K8RD 1NLBL 4GW1B 4MXVF 1I1AB 4TNVK 2Z31D 4PJBA 5D1ZA 3VI4F 5ABDE 4YHML 4RFOL 3ZDXF 1VGEH 1W72H 4YDJA 1LQSR 5A16B 1AGDB 1TITA 3QDJB 5FYKE 3WEXB 3RL2A 2OTUA 3QIUD 3FQTB 1ZTXL 4RX4D 1WIOA 1PSKH 5CJBA 2R23A 4XMLL 1DANT 1MY5A 1AGCB 2NZ9D 5KS9B 3U4EB 4GRWB 4L3CB 3L5HA 5IT2L 4FQJH 1J11A 1NL0H 3VXRA 1F3DH 4WU5B 4ZOEA 1MCRA 4BZ1H 1SBSH 1FYTA 4G6ML 4Z76B 1W0VA 3G6JB 5IFHL 1QHPA 2C3HA 1NEZA 4PJBE 3TNMB 4AIZB 4HWBL 1JGVH 4MS8D 4UQ3B 3O3DA 2CLVB 2I5YL 4DZ8B 4R4NC 1X5JA 4XVTL 2CRZA 3NCFB 1QSFD 3GMMA 3GDBA 3BGFB 1S7WA 1FC1A 2BOCB 3OGCA 4XP5H 3RX5A 2QSTA 4R26H 4HK0A 5MHSD 3LH2H 1U3HA 5KTEL 1R5WA 3G04B 3R8QA 1ZEAH 3HNSL 2VUYA 4GRWH 4G6AD 2X05A 1J88A 1A47A 5AD0A 4GJTB 4JN1L 4HDIB 3GMOB 2AI0L 4G8GD 3GRWH 1D9KC 1MOEA 5IGXL 1GC1H 1UWXK 3MA7A 2ARJQ 3QWRA 3ECBA 4Y5YA 5KSAD 2R2HB 2YKLH 4P46D 5GGQH 5CMAA 2VDLL 4J3TA 4HZLA 3QYCA 1QQDA 2DQGH 4ZPVA 3H9SB 5JZ7D 4FQ1L 5C70A 4U1HA 3TCLA 4LCCB 5FO7A 3SGKC 4W4OC 1YYMH 2A0LD 1Q0XH 1T89A 4NO2B 4NOBA 3P30H 5B21A 1IAIL 1EUTA 4OI7A 3VFOA 5C7XL 4LSTL 5EWIH 1VEMA 1EFXB 1KTLA 5BRZD 5HHOE 3K4DA 3UYRH 1RVFH 4Z7NE 4TSBH 3BGAA 3RZWA 4QT5B 1CWVA 2XPGB 2HA1A 5FGSA 2Q7YB 3PQYE 4XGZA 5DJ8A 2VDQH 1NCCH 3QFDB 4X8XA 4QHLB 4NC0B 4NDMB 3EIFA 5F70A 3QG6B 4KTEL 1FZKB 4PRDA 4CW1B 1ZVSB 1KXVC 1G9NC 1VFAB 5FGBC 2P8PB 5C0BA 2Q1EA 5HHVH 3T2PA 1PLGL 2VAAB 3PDDA 1C7SA 3O6LH 3IDYB 2EDHA 1FO0L 3W11C 1MWAL 4PS4L 4KY1H 2A74A 2E9BA 4WHYH 3MRKA 4KJYA 4XVSH 2NX5A 4XNQA 5LQBH 4P2OD 2PYFB 4PGBB 5D72L 4ZFGH 1L7TL 2H1PH 1G7LA 1KBGL 4JFZH 3L95A 1DQML 1H3PH 1FSKC 4Y0GA 2AABL 1BBJA 3OWEA 2ZOKA 4Z7VA 3UX9B 4OD1H 5F93C 3DSNA 2EH8H 4M7KL 1SM3H 3ARPA 4YHIB 4PJCF 4QGTA 4GBXA 5TFSL 5IFJB 5I1HL 2NXYB 1EGJL 4J12A 2PCPB 2Y5TA 3QUXD 3T0BA 5GZND 4L8DA 1V3JA 4JO2L 4D9LH 5E2JA 5BXFA 5SWZE 4P5MA 3ARUA 3IU3B 4LVHB 3VGBA 5JLZB 1QFUH 2Q3ZA 4JY6A 4GLRI 2WLYA 2QQQA 3IFPA 3VFSB 3UPAA 2NX5E 1IGJB 2Y07L 2N1KA 3FO1B 4PV8A 4ZOAA 5DYOA 4E0RB 2P5EB 2Y72A 1XIWA 1U92A 2FH8A 1EVUA 4D0DB 5HVHB 4Z7VE 1L6XA 3RGVD 4HX1B 2GJZB 4HZAA 3ARGA 4LP4A 4DVRH 4EN3A 4S1SL 5TQ2L 3SJVA 3B83A 4ONGH 3O6KH 4D94A 1FFPB 3PP3H 4PYHA 1H5BB 3MLRL 4RAVB 3BYTA 3IDUA 3IKCA 1ONQB 4J4PC 4X6CF 3C5ZB 4FFVD 2H9GB 3CUPB 3CFDA 2ZCKH 3QDAA 1LP9A 2B4CH 1A6UH 3F12B 4H5SA 2VXSL 1FYHB 3DX6B 2GK0A 3ZE1F 4PG9B 4LLVA 1CD0A 2DMBA 4RFEB 4Q9RL 4XI5D 35C8H 1AHWC 4H1LG 1IGFL 1PYWB 1MI5A 2C3WA 2ICWI 5I0DA 5LCVL 2FX8H 3ULUC 1FFOA 1JF1B 5TE6H 3ZT7A 3I84A 5C92A 4HCRH 3RWGB 4KK8C 1GAFH 5ID1B 5KVEH 4Z7OF 1UYWH 2VDOH 5IMMB 3C08L 1OP3K 1KYOK 3EYQC 3C60A 3PDGA 4JPWH 3U46A 2J8UF 3QHFH 1AQKL 1MFDL 3UTTD 4J23A 3V6BR 1WWCA 3T0XA 4OGXH 1LP9E 1AY1L 1A0QH 1KJ2L 4PY7B 4FZ8L 3VWKA 2ADIA 4S1QL 4WI5A 3E3QE 3W81A 2OI9B 1FG2A 4L8CB 3LHPL 5I17A 1MI5E 5C86A 5C09B 2W9EL 1ZLUK 3BH8A 5BVJB 4MNGA 1UJTA 1KN4H 3DETD 5DMYA 4NOFA 5CKGA 5DJYA 1ZANL 1IL1B 1BAFL 2IQAB 3GMRA 5DQJA 3IDGA 5DLML 1TCMA 5CILL 1IGCL 3GGWB 1J8HD 4KVCL 2VZ1A 1Q0YH 4MJID 3HZYB 2WK2A 4JFFA 1ZVYA 1WTLA 1UB5A 4OCXL 3A0OA 3GJFB 3CU1A 5EBMA 2AXFA 2K7QA 2XYCA 1YNKH 1ZLSH 1NAMB 2WWMC 5D7LB 2ITDA 4HH9B 3EGSB 4C56A 5J06A 1OTTD 5FCUH 4XBPA 4NNXB 1JBJA 2F5AH 5F7EL 1HNGA 2AEPH 4DAGH 5HYJD 3OB8A 3VFRB 5IFAH 2EDTA 3VGEA 3JWOH 3I6KA 5GGRA 3WJLC 3MROA 2VB5A 3PWNA 1CDIA 4MNGE 2H26B 2XTJE 4XC3H 3W9DA 2ZNWA 3MLYH 5CD5D 1NFIB 3UAJD 3KPMA 2C3GA 4MVBC 4LEOB 3QWOB 3H8NA 4KI1A 5IMKA 2FEEI 4FQQB 3WIFB 2APVA 3AREB 2GITA 2XZCH 2ESVB 3CLEL 1GSMA 1S9XA 4JFFE 3IDJA 1S7VB 5F9JA 3JWDC 4HWZA 3F62A 5HHME 4CMMB 1T5WA 2HKHH 3GJFH 1EBPA 5I15H 3RPIB 4YH6A 1ZA3B 3IU4L 3RL1B 3RY6C 3HC4H 2KZ1B 5KBNC 5DD5H 2QTEA 4QXTB 4ZO6A 3QWQB 2VDNH 3HB3D 1AGBB 1FC2D 4HMEA 4JHBA 5ESAA 3FCTA 4FFZL 1WITA 4UNVA 2D7OA 5DSCA 3MFFA 3CVIL 5BW7A 5C0RH 1RZGB 1SY6A 3W2DL 4GW5A 4G3YL 5FO9A 4HPYL 1AD0A 3A6CH 4NQED 3GZKA 2EH7L 1G6VK 4FTVA 5D5MF 4UIMB 2ATPB 1NUNB 2GUOA 4M5YH 1RIUL 2P8LA 3O2WH 1D7FA 3GK8H 1GGTA 1IQDB 5CEXA 1WV7T 2WBJA 1JK8B 3E1F1 4X80H 1YZZA 2VNCA 2QQLL 1VCAA 2LU3A 3DVNA 4PRID 5J9PA 5BO1H 3CFCH 1KLGB 4L5FL 4JFEE 1E28B 2NY1D 1KB9K 4HJGB 1GPOH 2GTZA 1IBGH 4L8SA 1FZJA 1RHHB 1MCPH 3AY4A 2AJXH 1UJ3A 1V3MA 4HS6A 5EU7C 5CZVH 1QBBA 5T3XL 3CFJA 1B6UA 4G43A 1AJ7L 5FOBB 3B3IB 3G5XA 5CBEA 1S5IH 3T65B 1OCWL 4Y7MA 4NQXA 3VGGA 1GGYA 2EKSA 3PDOB 1T0MB 5ITBH 2Z31B 2IG2L 3H42L 3RUGB 4F58L 3NZ8B 3C5SA 5EORH 4HMDA 3UTQB 3QIUB 3FRPG 5E5MA 3H7BB 2YK1H 4JFOA 3NGBC 4HF5H 1IEBA 3O11B 4W70A 3WNLA 4NKMB 4XNYL 1JNNL 4JFXA 1K6QH 4UI2A 5C0IA 1WBXB 4LLYB 4AENB 5HDLA 1XF5A 4HUWA 4U31A 4N5ED 2W0KA 4ORGB 1MFBL 5MEPA 3BP4B 5DJXB 3JXAA 3JV4A 5EZIL 4HBCH 1A3RL 1YN7B 2DQDL 2VQ1B 2FHFA 5BZWB 1T20B 4TRPH 2N56A 5FECB 2XKNB 4NUJB 2CPCA 3MFGB 3DROA 2MKLC 4HKZB 4K3EH 1YNLH 4HT1H 1KGCE 3I50H 1D5MA 2VITB 3RZCD 1J12A 4J2XA 2CLZB 1DEDA 1QSFB 1ZGLM 4EDWL 1NC2A 4HFWB 1C5BL 3U9UA 1MJUH 2FBOJ 2R0LL 3RWHB 3OKMA 1NBQA 2VXVL 3MC0A 4LK4A 1CDBA 2AJYL 3KPNA 2DJSA 5T1KD 5TDPB 3PGCB 4G8GB 4QHKI 4AEHH 5IQ7L 4YBQD 4JQIH 1HHJB 2ORBL 2G9HB 2F15A 4LSQH 1E27B 3KPSD 1RZKH 5ALCH 1FPTL 5KSAB 4GUPA 3MGAA 2V2TA 4P46B 2WQ8A 4ISVA 3MLSL 4XX1E 2OL3A 4WVRA 3G08B 5D8JL 4LL9A 4FXLA 5J4MA 4NZUL 1DVFD 2XTJC 3LQAC 3WSQL 1FNSL 1MUJA 3ET9F 3QHTC 4CJ0A 2GYSA 3RX7A 2JB6A 4XPTL 5BRZB 1ETZA 2FL5B 3NPSC 4KK5D 4PB0H 1ES0B 4PJ7F 2ADJB 3DVIA 4XWGL 2YPKB 2KH2B 5J12B 1NDMB 2GTWB 4AM0B 5CJXC 2P24B 3ARBA 1I7ZA 3NFSH 3QEQE 2W91A 3LEXB 2D7MA 4YBLC 2APTA 2EEBA 4OLWH 4MD4A 2XICA 4KKLC 2N7BA 2Y36H 4YWGL 5I30L 2ATKB 3BPNC 1CF8H 2PXYC 2R8SH 1I4FB 1T2XA 5DT1H 1AI1L 3RWCA 3I9GL 1PDKA 4RMWA 4PG2C 5IVXE 2Z8VC 3VE0A 5FHBH 3MBEA 2Z92B 2MQ0A 4G6KH 4M6OL 5HD8D 1LK2B 2DQIH 4XHJD 4BUHA 3WO4C 4P2OB 4X5WB 5J6HA 4UV4H 4XXDA 3BQUC 3S4SG 3TN0C 3S88L 3WMSA 4BZ2H 4R0LA 4NYLB 4G42B 4OQ1A 3QXAA 3U0WH 4Y5VC 3D18B 2ZOLB 2D31A 1J18A 1WUNT 1MVUA 1XH3B 4Q9QH 4WI3A 1V7NL 3QUXB 4HPOL 2BDNH 4WNQB 1DE4B 3IYLW 4FRWA 4XAKD 4I18C 4PJ5D 1P4LB 3ILPA 5EIVA 1KJ3L 1KYOJ 1QFHA 2X4OB 4MDIB 3VXPA 1R3KA 2BNQD 5L8KB 3QH3A 3L9RA 4GS7C 4D9QD 1EPFA 5CWSB 4F15B 3R06B 1X5XA 1QKZH 1IAKB 3VXUA 5JW4Q 2L4OA 3Q5YA 3B2UC 1LNUB 3O2VH 4KMQA 1CIDA 3SE8L 3X12A 2B39A 5EZJB 4Y4FA 2ZKHH 5CINL 3RGVB 3RVXD 4QRUA 3CGTA 5ID0B 2GSGA 3MRRB 5MEOB 4G8FB 1B88A 1XGTA 3FONA 3GKWL 1CTOA 1LD9A 4XPHL 5HHPB 1OSZA 5FGRA 5JUEH 1HHGA 4O2EA 4UIKL 3P73A 2FJHB 4L9LA 5C6PB 1KTDB 5FM5M 3ARDA 1CIUA 4X7SH 3PWPD 2EIDA 3CK0L 2LE9A 5C3TA 4D9RD 4DUWA 1JGLH 4AIXA 3LN5A 3S5LA 2R56L 4Y5XB 1FNFA 2IBZY 4XBGB 5L2KD 5EULV 4PJXF 4B0MM 4L3EA 1IKNA 2HT3D 5ADPH 1MCDA 1Z9MA 4JM2F 4B5EA 2E7LC 1CFQA 2NY7L 3EDJA 4OCRH 1NKRA 1BFTA 4J3OC 4RGOL 2EIEA 4RAHA 4BH8B 2VABA 3VXNA 4FXGA 2BRRH 4UTBL 5MERB 2P7TA 5E4EB 3P11H 4XMPL 2CGRH 4YDKL 3UTTB 2X6MA 2DI7A 4ORZC 2X1QA 5JOPE 2D0HA 3P9MB 2DYPA 5IW1B 4B50A 5BS0A 4GO6B 3DUSA 1P4IH 1V3KA 2LU4A 4OM0H 1U42A 2NR6D 1BVLA 1IGIL 2HYMA 1CGYA 4YZFE 5C8JA 1QFWH 3MRMB 2CKBL 2YD6A 5E7FA 5ILTL 2ADFL 3FB8B 4K3JL 1MH5A 4K7PX 3ES6B 2X42A 4YO0A 5DJAB 2CSPA 4HQQH 4JGMA 3V5HB 1N7MH 1WJ3A 3E6FA 4DZBA 1A9EB 2VLRD 1JWSB 4NCC1 4GG6F 4QO1A 3V52H 1YC8A 1J8HB 3KXFD 2L7JA 4MJIB 3BESR 3KWWB 3ZT5A 1JHLL 4LHUD 2E7CA 3T3PF 3IETB 3MCKB 3DURB 1R3HB 3ULSB 5A2LH 3K74B 2ITCA 3DRTA 4MX7B 4NQCD 2ZUQC 3RY5A 2FNBA 3QXVA 2ZUUA 5HYJB 2JK5A 4F7EB 3G5ZA 3C5JB 1VSCA 4FA8A 5E99H 1U8QB 2JLLA 4I5BB 4KJPD 1MREH 4MAYC 3WFHA 1QYGH 1KB9J 1QD0A 2X1WL 5SX5H 4M6AA 4BK4A 1LDPH 1TZHB 3TEUA 2X89A 4PJDB 3QNZA 4KI5F 4JQVA 4PJEF 4K3HA 3TBSB 2EDDA 1E4KA 3BHBB 4R4ND 5K9QG 4CMHC 3STZA 2V5SA 4W6WB 2HFFB 2YUVA 4B41A 3BIKA 2I9TB 2GI7A 4DTGH 4ZUVB 1YPZB 1BQLH 1SHMA 2F53D 4ZSOB 1D9KD 2ARJA 1WBZA 2X4UB 3TIDB 3NCCB 4ALAH 1CYGA 4NQEB 4X7TB 3IFOB 4BFIA 4R96A 1BQSA 5JOEA 2C3VB 2CRYA 3SGEI 2IBBA 4HH8A 1JN6B 4C4KO 5T3XE 3DMMA 1CGSH 4WU7A 1QNZH 1K8IB 4WUUA 3MGOB 4PRIB 1K4CA 4OD3H 1BX2B 3NIFF 4CKVX 3CH1A 4TTDC 1OWWA 2DLIA 2NY6C 2NY1B 4XXCC 3HHRB 2OQJB 5C9JA 4F3FA 1MF2H 3SDXB 1RAMA 4IEFB 1OD7A 2XWJA 1EAJA 1X5KA 1D5BB 3NCJL 3WKML 5C07E 3C6LD 4TUJA 4DGIL 5E1HB 2NLJB 4R2GC 1DBAL 4Z78A 4BELD 4WHCA 4ZDHA 3MLWH 4P23A 1BECA 2DJUA 4PRBA 3QIWA 2EDKA 3ARYA 3D2UA 3T0VA 3UP1A 3V5DB 3VXSA 2JIXA 2VDMH 2P5WD 4U1KB 5BV7L 5J8OA 2VIRA 2LVEA 3TGXA 4LPYA 5HYQB 4QRQB 4BZ1L 4AEIH 4E5XB 4WUUE 2H32B 5IHZA 3K4AA 3B9DA 5SWSE 4WGVB 5BVPL 1LO0H 5I74C 2HVKA 2VR5A 3U0PA 3VD3A 1IFHH 1PEWA 5CGYC 2Q6WA 3W11D 1T1YA 1IRAY 5CHNB 4OZHA 4UBDD 1PW3A 1KCLA 1BPVA 2GCYB 5I1JL 5IB5B 4YHPB 3JV6A 4PY8J 1KELH 1RUQH 3DVFA 4JFPA 1S7RA 1K2DB 1MRFL 4R26L 4YXHH 4YHNA 4P3CH 4WHDA 4KJQC 1ZEAL 2WQRA 3H3PL 4LCUA 1QEWA 3B6SA 3T1FB 4C83B 3RZCB 3VXSE 2PW1A 3R0MA 1TVHA 2K9UA 4U6HA 1IZKA 1FDLL 2R1YB 5CEYA 5IV2A 3U0TA 3QQ3A 5KG9A 3DTXB 4DN3L 5D7IB 1A6TA 5INDB 4PJBF 1Z2KA 3G5VB 1IEAA 5T1KB 5H94B 1GHFL 5IJVA 2ZJSL 3LQZA 4PJHA 2MPAL 1BFOB 2ZG2A 4IIQC 3WUWA 4YHYC 1XCTB 3ELAT 2XZAH 3HNVH 1HH9B 1YYML 1D6VH 3KPSB 3MXWH 4IJ3C 5FYKD 1A6AB 2UWEB 4TVPE 3WS6A 1KPUB 3P30L 3IXAA 3HFMH 1ULVA 2BY1A 1LE9A 3S97C 1Q9KA 2QL1A 2Z35A 1LO4L 5D2LB 3SKJL 4IMLA 4MA1B 4HUKB 1B2WH 4TSBL 3QUYC 5K9OB 4EI6A 3AS0A 3STLB 1DVFB 5KOVC 2DQTH 3EOYG 4U1LB 2R9HD 2PN5A 3MUJA 4JJ5A 1ZE3C 2X70A 4KUCD 2AJZA 2WZPD 3DX7A 5FB8B 4X6FB 4AT6A 2R4RH 4J4PD 1M7DA 1YEKH 4GAJL 1S78D 1CQKA 2ICEA 4OZGE 5E1AA 3MX0A 1BOYA 1GGIL 2Z8SA 3O6FA 4ENED 3BEVB 5ACZB 1RK1B 4LCWE 3JTSA 1N64H 2C1PA 2PW2B 5F1IB 3A67H 4ODTL 3O6LL 1JGUL 5ICYB 2WUCH 4D8PA 3FO0L 4G8IB 3EAKA 4NQDE 3SE4C 1JZ2A 5A1AA 4I8DA 1AP2B 4G8EA 3T2QA 3QIBA 3IJYB 3ULUD 4FFWC 5E00A 5GGTH 1RUPH 4Q9CA 5LQBL 4LNRB 3QZWA 4WFEE 1B4JL 1WWAX 4P2QE 4KK8D 1UXWA 3HC0B 1U2HA 1H3PL 3RU8H 4Z6AT 3EYQD 2VSCA 3FB6B 1XMWA 1BLNA 3IDMA 4KC3B 1JV5A 3BDBA 5GPRA 5I8EB 1XF2A 3T8XB 2BSSA 1A6ZA 1DLFH 1FV1B 4JO3H 4FP8H 5INCA 2E8YA 5E70A 2W0FB 4NN5B 1X44A 3OQ3B 1UQSB 4X98B 3HLAB 3KPLB 3Q6FB 1NDGA 3W82A 4XVUC 4KAQH 4LSPH 1DEEA 3S98A 1T4KB 3V6OA 1XCQB 5FHAL 1REIA 3EO1B 5HHOD 4G9FA 4JPIA 1U8LA 5F1OB 4DUXA 3MV7A 3E2HC 5D2NA 1RZ8A 3EO9H 1IGML 3N85H 3KJ4B 4PJ5B 1PEZA 3MACH 5D96B 1YUHB 3PQYD 1MCSA 2A73A 2IADB 3QUMB 5I1EH 3SGJC 5CSZA 2BNQB 2E9JA 2NXZC 3SN6N 1U3JA 4FQXC 4DK6A 3ARWA 4PTTA 4XTRC 2XA3A 3W9EB 1T1XA 3C2AH 4U6VH 4KMLB 4H1LA 4R9HA 1ZGLB 2DAVA 2VN4A 4M1DH 1I9JH 7CGTA 4GT7A 4U1GB 5GS0D 2D03L 1BIIB 1XGYH 2LFGA 1SJHB 3SDYH 4PJGF 3V6OE 3EO0B 5F7YC 3DV6A 2ADGB 3MQIA 3P2TA 3P77A 4MVBD 5LGJB 5C0JB 2YEZB 1GGBH 4MD0A 2Q76B 5T5FH 1PVHA 1F11A 2WW8A 4KK6D 4BFBD 2EDJA 2FX8L 3LKPB 2EZ0C 3ZHDA 2E27L 1ZS8A 3KPPA 1TFHA 4IRZH 4NP4L 4Z7VF 3RWIB 3D69B 2DLTA 3SPVB 4F7CA 3MNVB 4HCRL 3BAEH 4Z7QE 1VB9A 1SJVA 4PRNA 2YZ8A 2F74A 3DI3B 2D7QA 1KIQB 2OMNA 4UQ2A 3T0EC 1D5XB 2B5IB 1AGEB 4DW2H 5L2KB 3LS5H 3PXJA 5J13C 3QR2A 1I85C 2X7LB 5SWZD 4PREA 4ZYKA 1A0QL 5IB2B 1YEEH 5I16B 2NW3B 2OXHA 1AFVL 3FFCA 3S35X 5ANMB 3DHMA 1FNGA 2ZG3A 3OKYA 4WCYL 43CAA 4X6EA 3X3GL 5DHVH 3RVVD 1RU9H 4JRYD 3M07A 1WC7B 3BD4A 3RNKA 1U8JB 4YHOL 1RZ7L 1MHHA 1NGXA 4JFDD 3EFDH 1KT2A 3L1OH 1PD6A 1HOCA 3VFMA 5K9KB 5ERWA 4K9EH 5ICZA 2YHGA 3N1PC 5FKAA 1CD8A 1P84K 1XF3B 1RIHH 2ENYA 3U1SL 1XEDA 2X4RB 4H8WH 1RZFH 3VFWA 2UV3A 2VLRB 4S1DC 4MJ2A 3KJ6H 1BQUA 3A6BH 3VXOB 4X6DA 3KXFB 4M7LL 3BZEA 2EO1A 1T2QL 4X99B 5IQ9B 4C4KT 1QACA 4NQTA 4N1HB 2V7NB 2X40A 3TT1L 5MEQA 3CH8A 4MXWH 1EHLH 1FORH 1QA9B 1RJZA 4XC3L 4HUUA 1ACZA 3RJQB 2KQNA 3BZFB 2XG4A 1T03L 5JPMA 4NQCB 3L7EB 3L3JB 4HGWA 2ILLA 4XRCA 1RIVH 1DQJA 4NKIL 1EFQA 5FUCC 4BSJA 1JZ4A 5KVGH 5DJ0A 4GQ9L 4CVZB 2OL3L 1A14L 2CD0A 4YXKH 1WT5C 3HUJE 5ECJE 2F58L 3WCYA 5DJ6B 1NEUA 3WNMA 4Y19D 3T4YA 2NY0C 3V4VH 3IAQA 1QLEH 5D6DC 5GRYA 3U2SB 2O61B 4WIQA 2APXA 5EIQA 1X5YA 3HRPA 2APBA 1SVZA 5F9WB 3WFDH 1XF1A 5DI8B 5C1MB 1BF2A 2VDNL 3MRDA 3LIZH 4KDTC 4O58H 3GMQB 5J6GA 3UJTH 3NACL 1IKFL 3DXAD 4LQ1A 1IC7H 3HMXH 2RFXB 4HIIB 4JRXA 1MI5D 1Z5LB 4XP9H 5ETUA 4GW4B 3WIIH 3T08A 2J1KA 3A6CL 1MFNA 3PP4L 4HXBH 4P3DB 4TN9A 1PY4A 1IC4H 2VZOA 1MCNA 4GRLC 5EUKB 4M5YL 5GRJH 2FZ3A 3O2DH 5CIPH 4O4YH 3OKKB 3TH3T 4LDEB 1D9KB 2VL5A 3GB7B 5F3HA 3RWDB 3WO3B 3LAFA 2ZCLL 4LSRL 4EI5A 2F54E 4PGJA 4GW1A 1RQ5A 2B1HL 1I1AA 1EZVY 5DUMH 5KW9H 1EJOH 2Z9TA 5A16A 3SOBL 1AGDA 3QDJA 3WEXA 2DQJH 3FQTA 3FRPA 4B7IA 2VWEE 5CZVL 5FGCE 3R1GH 1AXSB 1RUKH 4JRXE 4DN4H 1IQWL 5E8OB 4PJ8C 4U0RC 5HI4C 1AGCA 3MUGB 3V2AR 5ITBL 5KS9A 3U7YH 3U4EA 3MGTB 2XTJD 5EORL 1UM5L 4HFUH 4YDLC 2R1WB 5SV4A 4UAOC 3WV0A 2MTPA 3HMWH 5D1ZC 2HTKC 4HJ0C 5T3ZL 3Q6GH 2OX5A 4WU5A 3C6LB 5BOZG 1AIFB 1BZ9B 2F5BL 1IAIM 2X09A 3NAAH 3B8SA 4Z76A 3G6JA 5HHMD 3D3VE 2ICWJ 3TNMA 4LASL 1N6UA 4AIZA 4H20L 3TYFB 4UQ3A 2P5WB 15C8H 4V1DE 2CLVA 1Q8MA 4DZ8A 4M48L 2XIDA 5AEAA 3MUY1 4KKLD 1CG9B 4M93B 1BVKB 3RJDA 2BOCA 1I1FB 2VO5A 2PXYD 4HBCL 5C6TH 5HHNB 1G6RL 3G04A 5I1CL 2DL2A 4TRPL 1QSED 4GRWE 2V2XB 4HT1L 4HKBA 4G7YL 4J3VA 4OLYH 1JIBA 3I50L 4HDIA 1JYNA 3V4UH 3GMOA 5KVMC 4J1UB 5D70L 3LRHA 5EO1B 2G60L 3MOBL 4CADA 1I8LC 1SJEB 2VTFA 3DRQB 4Z7UB 5I1LB 3F7QA 1BJMA 4OKDA 3BQUD 2R2HA 4M1GL 4R3SB 4FQPA 4QOKD 3VDBA 1OT1A 5LGHH 1MPAL 2WP3O 3CVHB 5CJQH 4Q97A 3H9SA 4OD2B 4JFED 4LCCA 2AK1L 4JZNB 4NO2A 1VFMA 4HIXH 3F6IA 4LSSH 2OTPA 5F7KC 5HGBA 4NM4H 1TQCC 4ZOBA 1GOFA 4RAUB 4W6YB 3BD3A 1EFXA 5EUOE 3MJ7B 4N1EA 3QT2A 2A9NH 4D2NA 4QT5A 4XPGH 5IMOB 1BM3H 3KR3H 4RGMC 2XPGA 1X3DA 3MRCB 2Q7YA 4P9ML 4I77L 3INUH 3S36H 2E9WA 3SKUD 1RJLB 3QFDA 4QHLA 5F96H 5I8CB 3AGVA 4NDMA 3CVHH 3QG6A 1FZKA 3S96A 4CW1A 1ZVSA 5L7XH 1VFAA 4Q74A 4BSVB 1F8TL 2Q8BH 2VAAA 3BKJL 2P1YA 4OLWL 2YPVL 3IXTB 4W4NA 3HG1E 1ZLWH 1CZ8H 2Y36L 3MLTB 1CXLA 4ZUUB 3SEPA 3OL2A 5CFHA 2P8MB 3MJGX 1KFAL 5I1KH 3B9EA 5TE7H 1KGCD 2LQRA 2PYFA 4PGBA 3AXLB 3NPZB 5F3BB 1JNHA 4UOW0 3ARZA 1AHWB 5TF1H 2XZQH 5FHBL 5A43C 4A6YB 1P4BH 4KROC 1W0WB 1BBDL 3FT4B 1OAKL 3NVQA 4YHIA 5IFJA 5B4MC 1MEXL 2PCPA 2D0FA 4ZO7A 1WISA 4WV1C 3IU3A 1IAOB 1RFDH 4NN6C 3H9YA 5JHDD