1YQ3B

Avian respiratory complex ii with oxaloacetate and ubiquinone
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
242
structure length
242
Chain Sequence
b'AATSRIKKFSIYRWDPDKPGDKPRMQTYEVDLNKCGPMVLDALIKIKNELDSTLTFRRSCREGICGSCAMNIAGGNTLACTKKIDPDLSKTTKIYPLPHMYVVKDLVPDLSNFYAQYKSIEPYLKKKDESKQGKEQYLQSIEDRQKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDYTEERLAQLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase flavoprotein subunit
molecule tags Oxidoreductase
publication title 3-Nitropropionic Acid Is a Suicide Inhibitor of Mitochondrial Respiration That, upon Oxidation by Complex II, Forms a Covalent Adduct with a Catalytic Base Arginine in the Active Site of the Enzyme
pubmed doi rcsb
total genus 70
structure length 242
sequence length 242
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2005-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 1yq3B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1yq3B01
2ACZB 1XLQA 3AE5B 3B2GA 5G5HA 4US9A 1OQRA 1AYFA 1DGJA 2K22A 4A9AA 5G5GA 4C80A 1DOXA 1FFUA 1FXIA 2WLBA 1CJEA 3AM9A 3B2FA 2W55A 1TYGB 2QIEB 3VRAB 2JQRB 1A70A 3W5UB 3AE1B 1N60A 3AE3B 1PDXA 4C7ZA 1B9RA 1ZP0B 1FMAD 1E0ZA 5GXGB 3P4SB 2WDQB 2MH7A 4YSYB 2WDVB 1EWYC 2H88B 2WS3B 1ROEA 2M19A 3AN1A 3VR9B 1WYGA 3HRDD 2KAJA 1J7AA 1KF6B 2FBWB 1E6EB 1ZOYB 1WRIA 3ABVB 2PKOA 3AV8A 2MJ3A 1PFDA 1E7PB 1KRHA 1J7BA 3NVWA 3DWMA 3CIRB 3VRBB 2DBYA 1L5PA 1E10A 3NVYA 1JRPA 2WQYB 2MJDA 1AWDA 2PVOD 2JX5A 3EUB2 2K5PA 3AEDB 1V97A 2QJLA 1QLBB 1GPXA 1GT8A 1ZUD2 2EKIA 2L52A 1VDVA 1GTHA 2M56B 3B9JA 3KWLA 5AUIA 1QF6A 1JWBD 3ZYYX 4ZHPA 1H7XA 1SF0A 2CJNA 4ITKA 4N59A 2KMMA 2BS3B 1JALA 2H89B 1RWSA 1N5XA 3CF4A 1VLBA 5EE0A 1N62A 2BS2B 1DOIA 3SFDB 1QT9A 2LEKA 3AEFB 1YJJA 1SB3C 3AE2B 5MPOA 1NEKB 1DOYA 4YXDB 2L83A 3AE6B 3L4PA 4P6VF 1I7HA 3SFEB 3AMZA 1TKGA 4IDIA 1WXQA 1KFYB 1GTEA 1NI3A 3P4RB 1JW9D 3AB5A 4USAA 2E3TA 4LTUA 3P1MA 4N58A 4YTPB 2N0SB 3DWGC 4C7YA 1NENB 3AE7B 1XLPA 2W3SA 3HUIA 1FM0D 1WWTA 3P63A 4JX1C 3AEGB 1QOAA 4YTMB 2K9XA 3NRZA 1J7CA 5EE9A 4HROA 1E9MA 4ZHOA 2W54A 1NVID 3VR8B 3AH7A 1YQ4B 1TKEA 1WGKA 3AEAB 1VJKA 3LXFA 3CWIA 3AE4B 4KX6B 3BIID 1N5WA 1ZXIA 1FO4A 1NYRA 5EE3A 1IUEA 1FRDA 4WQMA 2Q5WD 4ZOHC 1H7WA 4YTNB 1V8CA 3P4QB 2PIAA 4JWSC 3WCQA 3NS1A 1CZPA 1RM6C 1N63A 3HVZA 4FXCA 5AUKA 1SIJA 2G1EA 2MJEA 1FIQA 4JWUC 2WU2B 5C3JB 1N61A 1UWMA 2WDRB 1XLNA 3AE8B 1XO3A 2CJOA 3NVVA 4N6EB 3W9CB 1PUTA 1JQ4A 2CU3A 1FFVA 1OFFA 1FRRA 1T3QA 2BT6A 3P4PB 3W5VB 1F0ZA 2AX5A 1YJIA 5EE1A 1L6VA 1TKYA 1RYJA 1NYQA 1XLOA 4HRSA 2WP9B 2BS4B 1QOFA 1RFKA 3ETRA 1GAQB 2W3RA 3RPFC 3LB8C 2B76B 3PO0A 1YQ3B 1FXAA 2DWQA 4YT0B 3AEEB 1OQQA 3NVZA 1L0VB 1L6UA 2Y5CA 1JROA 1JWAD 2PVGC 5H8YE 1TJEA 3AECB 2HTME 3FAHA 4WWMA 2OHFA 4YSZB 1QOBA 3SR6A 4YSXB 3FC4A 4US8A 1R7SA 2WU5B 5H92C 1QOGA 5C2TB 3AE9B 3AEBB
chains in the Genus database with same CATH superfamily
1YNTE 2VZKB 3EHVA 4HKQA 5HI1A 1FNUA 3FILA 5BMGA 1KJTA 4KVGB 1MFWA 5D7GA 1JMLA 1WYGA 4HDQA 1RAXA 2LI5A 3H8HA 3DHHC 3H9DA 1LXDA 2BWES 2WXIA 4WJPA 3RD2A 1TS5A 3OWEB 1BXTA 2LJIA 3GOEA 3NVYA 1AWDA 2DZMA 3BYTB 2QJLA 4NJ6A 4LNOA 2Z59B 4BKGA 2PE9A 4ITKA 5IO9A 4IG7B 4NQLB 1I42A 5E6NA 1YOVB 2RDGA 2KHWB 1YX6B 3P63A 4K7WA 2ZJDA 2XBBC 4ZRPA 3URYA 3MC9A 3HVDA 1WE7A 1MJDA 2R61A 4WJNA 2NMQA 4DHJB 3BIID 4P7IA 1NBFC 3ZKJC 4FHJA 1HZ5A 2NPTA 2QSDA 4LDTB 2EMTA 2KDIA 1V5TA 3IAS1 3P2BA 1OFFA 1VCBA 4MGZE 2KLCA 1QZEA 2WWZA 1GG3A 3VTVA 1IYFA 4D2KA 2L32A 1TS2A 4PS8A 2V3PA 3DBHI 4R3DA 2N9EB 3OAWA 1IGCA 2M1MA 1WM3A 2VRRB 3RNCC 2LWPA 3DHGC 2GBRA 4ZYSA 2Y3AA 2AEHA 4W9FA 1AYFA 1DGJA 3J9CA 2TSSA 5J18A 3VRAB 4HDOA 1J0GA 4JL9A 1E7UA 4FJZA 2KAJA 1E6EB 1P1AA 3H7PA 3EECA 1E8YA 4RGOS 2LRUA 1L5PA 2WQYB 1XCTL 1XF5L 4IKGA 4KV2A 1ZUD2 4A6QA 2M4NA 1SF0A 3IBEA 2WYQA 1HXYD 2G4SA 1HA5A 4KKIA 2IBIB 3ZO5B 4IOIE 2LVPA 4S17A 5CHFA 4II3B 2QHOA 1SSNA 4I6PA 3C19A 4USAA 2KLGA 4LLGM 2ASQA 3A4SC 3NRZA 3ZRCA 4HCPB 3AH7A 3ZRFA 3GZNB 2KKCA 4GB9A 4PT5A 2AWTA 3DCGA 3VUYA 2FE8A 1Q1OA 4KIKB 3NS8A 4ZOHC 1V6EA 1V8CA 3PT2B 2D2QA 4J6IA 3RNEC 1IPGA 4WQOB 1SIJA 1N6ZA 3IG3A 5C3JB 1XLNA 3KUCB 3TIXA 5E6PA 3AE8B 1V5OA 1L2NA 1T3QA 4E71A 2D07B 2FUG1 1VZ7A 2HDEA 3RN9C 2X8XX 2W82A 2W3RA 3AXCA 1M94A 1X1MA 4OZAA 1V9JA 2DYBA 2FCNA 1TJEA 3SD5A 4IWOA 2JRIB 3R7RA 5L83A 4JGHB 3VQIA 3AEBB 4NJ7A 3VAWA 2IO3B 1WJNA 1T0YA 5AZHA 4TQ1A 3BWUD 2XK5B 4FN2A 3AULA 3AE1B 2ZVOA 2J0MA 3UI3A 4C7ZA 2GBMA 1JCKB 2KQ4X 1GC6A 3VVWB 1KF6B 1C78A 3VRBB 1MVKA 5FK9C 5JZEB 4XGAB 3U4EG 3ZVVA 3MJWA 3R2TA 4IM0A 1XXGA 2IJ0A 3ZQ4A 3QC8B 1SE2A 3VXWA 2FCSA 2CJNA 3BK1A 3A9KA 2BS2B 1VZ6A 2WX1A 3AE6B 3Q8BA 1V1OA 2GMIC 3IHPC 1GB4A 1KFYB 2ZNVC 3PLUA 2KN4A 4HVBA 3TUOA 4PYZA 1T0SC 2MX2A 4MDKE 3PRPB 1AARA 3AU4A 1PGBA 1TKEA 3W1SC 3ZJVA 2FAZA 4HCNB 2K8HA 2KXJA 2R2QA 2Z0EB 4AQ7A 2HJ8A 2MP2B 3UGBB 4JWSC 1VR9A 3RT3B 2KC1A 1I4XA 3U2SC 3TEZA 2CJOA 4N6EB 1PYWD 1TS3A 4K81A 4NQKE 2BWFA 1FRRA 1WX9A 4AP4C 3HHMA 4MJSB 1LFDA 4HXDA 2GB1A 5JHBA 3DBRB 2D3GA 1YQ3B 1FXAA 2CHXA 2X38A 1KLUD 1FNWA 1KTKA 2KQ7A 2GRIA 3UIPB 2PPHA 3HM6X 2LGXA 1L0XB 1SJHD 1XLQA 1SE4A 2INDC 3B2FA 1HTOA 2W55A 1N60A 2MRPA 1TGZB 1EWYC 5IN7A 2DENB 3KWVA 3MP9A 2KMCA 1J7AA 2XN9C 4UDUC 1PFDA 5DPTA 4TSSA 3MC0B 1WXMA 3V62A 1V97A 2D5GA 2LXAA 2CR5A 5AUIA 2KTFA 3N32A 2RDHA 5L95C 1WMHA 1EF5A 3QX1A 1QT9A 4N9F4 4EUTA 5CTRC 4HEA1 2KYWA 3LDZE 2E3TA 2EELA 4CO7A 1H4RA 3QIJA 1PGXA 2C9WB 4JX1C 4K3CA 2KDEB 1RRBA 1C3TA 1WF9A 4ICUA 4MEMA 2QC8A 3AEAB 4XWTA 2A4ZA 3Q8EA 3PZ7A 4JE3B 2AQ3B 2NVUI 3HK0A 3NZ3A 2G9HD 1Z5SB 2NR2A 2XK5A 2BB5A 3DBLI 2Z0DB 2KJRA 2AL3A 2BYVE 1L6VA 1WJ6A 3NUHB 4FULA 4QAYA 3BVMA 3QAQA 2RPQA 4A8XC 4XC2A 3KUZA 2KX0A 1WY8A 2O6VD 2O2VA 3FC4A 3RFZB 3WANA 1XEEA 4C80A 2K22A 4A9AA 1JWMD 4TUUA 2WLBA 1FPYA 3N1YC 2MWSB 2BF8B 2ONQA 1F2RC 2MH7A 2JYTA 2C5LC 1TY0A 4NY0A 5AZGA 5KHOA 4C4VA 3ZUNA 3ABVB 1I4HA 3DVGY 2LHEA 4AJWA 5JXVA 4MSQB 2D10A 4NPNA 1WYWB 2L52A 2D3CA 2WXFA 1RWSA 1Q10A 3AE2B 4XX5A 4KZCA 3X0WA 4WURA 3P4RB 1JW9D 3VUWA 3V61A 4EFOA 5EE9A 3RYTA 1WGKA 4K7UA 2KC2A 3DPDA 3APDA 3Q3JA 2GBNA 1FRDA 3QK0A 2BYTA 2PIAA 1FNVA 3FILB 1WXVA 2N7DA 4M00A 5AUKA 1F9JA 4CYEA 2JYEA 2WXPA 4BKSA 1JQ4A 3Q8FA 4HPMB 3OJ3A 3Q8AA 2EKEC 1TKYA 4HRSA 1QOFA 1WR6E 3BINA 3LB8C 4ANUA 4KDLB 2JY6A 5BYQA 5D3DA 5EDSA 3JW0X 4US8A 2FIDA 2CS4A 3DHIC 2BBCA 4B0MA 5LLIA 4OHJA 1KM7A 1CJEA 4K7SA 4XDDA 2B3AA 4ZRQA 2JQRB 1IBXB 1NI2A 4F1SA 3P4SB 2WDQB 2NTSA 3N20C 1L7YA 2H88B 1SXTA 2DLBA 1XT9B 1C4CA 2MJDA 1WZ3A 4A20A 3EUB2 4PK1A 4XYCA 4LJOB 3VH4B 1TZ1A 2JZZA 4DXGA 1UNSA 1UGMA 3SFDB 3AEFB 1SB3C 3DVNV 4JIOU 1YN3A 3HIZA 1WXQA 1L4ZB 3ZDTA 3M63B 3APFA 4BKSD 4PYUA 3AE7B 5HFYA 2LUEA 4AOFA 4RM9A 3RNGC 3ZLZA 1FCCC 4HROA 4ZHOA 2LXCA 4YWGG 1CK1A 4KX6B 1ZXIA 2NCNA 2WXMA 3PPAA 4W9CA 3O13A 3PREA 3P4QB 1G6JA 2HD5B 5BMIA 3IXSA 2V9HA 1KH0A 1YJ1A 2D3AA 1TBEA 2BPSA 2BKRB 2PMVA 2LZ6A 1C1YB 3I3TB 1F0ZA 4GSWA 1GUAB 5EE1A 3TBLD 1XLOA 2WP9B 2BS4B 2KZRA 2I1JA 2OJRA 2BGFA 1WSPA 1NDDA 2YVCA 2REXA 3AECB 3H7SA 4B95A 3L10B 3VH3B 1SEBD 3SR6A 2L7RA 2WU5B 2RR9A 3OJ4B 1QOGA 1WJ4A 3VTWA 1FCLA 2ZZPB 4XE0A 2PW9A 3ZW3A 2IGGA 2C7MB 5G5GA 3KW5B 5BYSA 2N9XA 4GDLA 3IT4B 1T5XD 2LMCA 3DBHB 1J8CA 3HRDD 2WS3B 3QJZA 2MJ3A 1KRHA 1J7BA 3N1XC 1E10A 4DXFA 3RMKC 2J52A 3AEDB 3N1ZC 1GT8A 3B9JA 4WWNA 1JWBD 4N59A 3TMPB 1C77A 1VRAB 1MPEA 1WRDB 1D6EC 4C56C 1YIWA 3KYCD 3DQVA 5D3IB 3A9JA 3P1MA 1JWSD 2Z8LA 4N58A 3Q8CA 4HPPA 1WWTA 3IAM1 3W2DA 5E6JA 3JYUA 1C4PA 3DBRI 3MJ5A 1UD7A 4RGTA 3ZTDA 4KKJA 1ZW7A 3ZNHB 2ON8A 2AQ2B 3ECIA 3HVZA 2J0JA 1N61A 4ANWA 2WXHA 2CU3A 4LNKA 3L54A 2AX5A 4GU2A 3RPFC 3Q2AC 1GAQB 2JU6X 3TSSA 3U30A 2K25A 3A1QA 4GIVA 2HTME 3VHTC 1H8CA 4K3BA 4RCOA 4WAAA 2MBHA 4DWFA 1ZKHA 2BKFA 1I4PA 4EE2A 2ZW0A 3L16A 1D5MC 2M8SA 3UINB 2KJHB 1ROEA 4IWQA 2G45B 2RPVA 1QQRA 2G4DB 4GOCA 3CIRB 1JRPA 2JVCA 2IGDA 2NBWB 4ARIA 1GTHA 1Q5WB 2CHZA 4ZHPA 2J53A 3MFGA 3NZSA 2WDTB 2DX5B 3U52E 2MSED 2L05A 4YXDB 2L83A 1S1QB 5LXHA 1L4DB 1TT5B 3AI5A 1GTEA 2WXQA 2OEDA 3GP7A 2KD0A 1IP9A 1FM0D 3I5JC 3D32A 3AEGB 1HTQA 1J7CA 1R4NI 3ENEA 2KJ6A 3VR8B 2AQ1B 1QKZA 2KDBA 2EMSA 2DAFA 1EU3A 4REZA 3JSVA 1UUPA 4GGQA 4MGKE 2DZKA 4KSLC 2C7NB 4E74A 1QILA 1STEA 1N63A 1MHXA 3VDZA 2G1EA 2MJEA 1OEYJ 2ZPNA 3LJ3A 2BT6A 5LXIB 1VZ8A 3IFWB 2L0FA 3KLSX 3V3XA 1KOTA 3ETRA 3GE8C 2B76B 2NS5A 2GI9A 1HE8A 4GDLB 3KUDB 3NOBA 1EU4A 2D11A 1YD8U 3BY4B 4LNIA 2BVCA 3BYYB 2PE6B 2MEKA 3AM9A 5HKHA 1SIFA 3W5UB 1PDXA 4KZ0A 1E0ZA 3DBLB 1WXAA 3N3KB 3VR9B 3KQ4A 2O2VB 2KWUB 4HJGE 3NVWA 4HLEA 2LGIA 5C1ZA 1OQYA 4GN1A 1V1PB 2IY0B 4A90A 3QQ8B 3TEXA 2GLSA 1Q0WB 2JXXA 3H6NA 4PS7A 2L3ZA 3SFEB 1EM7A 1E7VA 1YX5B 5IKCM 1WGYA 3PHXB 1EF1A 3ZTCA 4YTPB 1JRUA 1SJED 4IM3A 4NZLB 1ET9A 4XZ4A 2W54A 1LGRA 5D94A 1S3SG 1YQ4B 3V6CB 2NPTB 3LXFA 3CWIA 3B08A 3K9PB 5FR6A 1N5WA 4XWWA 3ONSA 4WQMA 2LHDA 1ZDXA 1H7WA 3MTNB 1LO5D 2BW2A 2N7JA 4ANXA 4IW0A 4G50A 3DVNU 1V2YA 3RZWC 3NVVA 3P4PB 4M0WB 1TY2A 1C4AA 3GS2A 1ET6A 4DHZE 1T6BX 2AYOB 2IPKD 2RSUA 1SBBB 4XDCA 4CHKA 1OQQA 3Q14C 3N9YC 1JWAD 2PTLA 5H8YE 3NJTA 5DPSA 3X23A 4DHJD 4LNNA 5C2TB 2VZKD 5I4DA 2K1FA 2FNJB 1BUIC 2PLPA 1TYGB 2QIEB 1A70A 1GJZA 1V80A 2R2OA 4JPSA 2M19A 3V05A 2QDFA 3R7QA 3AV8A 2BYFA 3HM3A 4GXBA 2KVZA 3O65B 5CX3A 4MGYE 3E9SA 2C7HA 1E5WA 4NAWA 5GMVA 4LCDE 3KWLA 2KX3A 5HG2A 2HJ1A 2GBKA 5J2RA 5EE0A 3RZFA 1VD2A 2N1WA 3WIMA 1WX7A 1I7HA 3A33B 3AB5A 3CF6E 2UU7A 1GOZA 4P1BC 3NY5A 2FCQA 1V86A 2DNFA 2WNMA 3R66C 4MELA 4DQOC 1HEZE 3ZJTA 4M0WA 1ISNA 2WXRA 4CQNA 4A55A 5CHWA 3Q6BA 4FJVB 3WAMA 3ZXVA 3PSEB 1OTRB 1ZPSA 2RDBC 1ZGUB 3QWZB 3R2IA 4FBJB 4KGRA 3Q3OC 4FJYA 2VH2A 2VH1A 2LVQA 1WGGA 1E90A 1UF0A 1CZPA 4I6LB 3B0AA 3B1LX 3VFKA 1DYQA 2K39A 4ZRKA 1R4MB 2MQJA 1TTNA 1ENFA 2YLMA 2KN5A 1M4VA 3MHZA 2BB6A 4I6NB 1ZDVA 2IDYA 1BMLC 4RMAA 4W9EA 1K51A 3L08A 1LQBA 4KGSA 5E6OA 1L6UA 2PVGC 3MHSD 2ZW1A 1K53A 2LVOA 4WWMA 1QOBA 4YSXB 2KNBA 4K1RB 1OEYA 2MBEA 1CMXB 2L0TA 3EFCA 4ZRJA 2IYDB 3I63C 1TS4A 4ZRIA 3PLVA 4RM8A 1ZP0B 2ZEQA 3CMMB 1UGJA 2J42A 3AN1A 3A9JB 2WXKA 2KDMA 3WALA 4KSKC 2JZ3B 5JHAA 3DWMA 2ZVNA 2KFKB 3ML9A 3H1UA 1PQSA 2KWCA 3TL5A 2J4XA 3ZIMA 3TJPA 4W9DA 3GZNI 4BAXA 4B6WA 4EEWA 2M0XA 2NBUA 4M01A 1DOIA 3R3MA 1NEKB 3C8YA 4P6VF 1NI3A 1P9DU 2N9LA 2MHJA 2LUMA 1WI0A 1FD6A 1WGRA 2DZJA 2O6VB 1F1HA 2Y5BB 2INCC 2WXOA 5BO4B 2IO2B 3NHEB 3AE4B 3ZGZA 1WMHB 1TIFA 1P7EA 4BBNC 1C79A 3NS1A 4F8CB 4OVVA 3JSVB 1FIQA 5IOIA 4II2B 2JXTA 4HJKA 1JWUD 2MA9B 4MH0E 1D3ZA 3N30A 4AJYB 2CKHB 1MI0A 3W5VB 2KMAA 2QMTA 2BYEA 4F7ZA 3BVZA 1D4BA 4L23A 3M95A 4G3XB 1JROA 2LGSA 2XEWA 2N1VA 3ALBA 2L00B 4L1BA 2MBBB 5H92C 3R8BA 3U8ZA 3AE9B 3VUXA 2PEAA 2INNE 5G5HA 3W1YA 2KWDA 2V3SA 2QILA 3PHWB 4OZBA 4W9LA 1FEHA 3AE3B 2A5UA 1Y56A 2WDVB 2WGSA 1WRIA 1E7PB 3VTUA 2IO0B 2DBYA 1F2RI 2KT7A 1WJUA 3PGEA 2PVOD 4OW0A 2K5PA 4WIPA 2BQQA 1TZOA 4A3OA 1RLFA 3U7DA 1VDVA 1GC7A 2RMMA 4BBNF 3ZYYX 4RGNA 1H7XA 2HE7A 2JZPA 1AW7A 3PZDA 1GNUA 3RCZA 2LEKA 4DXAB 1DOYA 3QHTA 4MGIE 2NBVB 2J0KA 3KH0A 3NZUA 1C9FA 2N0SB 3K9OB 2N9KA 2N9PC 4GMVA 3M3JA 1IGDA 2V3NA 4NJCA 2WXLA 2JWZA 3OG5A 2IZVB 4MSMB 3Q3NC 2Q5WD 5BYRA 4B0EA 4DHZB 3A1QB 2DHZA 3OLMD 4FXCA 4BKTA 3ZXRA 4JWUC 3ZNGC 1D5XC 1UWMA 2WDRB 3ZNZB 1WGDA 1PUTA 5FR3A 3ZDMC 2O6VA 2KQSA 4JLCA 3U7ZA 2WXNA 4RFBA 4C4VB 4YT0B 5IAAC 3NVZA 2V4IB 1KLGD 1ZXHA 2MP2A 3EA6A 1EWCA 2K0PA 4HWIB 5LNK1 4RGMA 2MBOA 2JT4B 1K50A 2I2YA 2KTRA 5G55A 2LGYA 2KO3A 2WX0A 5AZFA 1V81A 3E56A 1LM8B 1B9RA 4GDKB 4G11A 2W9NA 4NNJB 2OJWA 3T8MA 3QARA 1B1ZA 2FBWB 2FUHB 1ZOYB 4RH6A 4ANVA 5DPWA 4JQWC 2JX5A 4OVZA 3A9KB 2N4FA 2BTEA 2LJ5A 3SHQA 2JF5A 4TQ0A 1Y8RC 3WA0A 2DYOA 2MLBA 2H89B 1VLBA 3ML8A 4MM3B 3Q3FA 5BMHA 2WXJA 3S2AA 5T8IA 1YN5A 3Q3MC 2L1AA 4W9KA 1I4GA 4LTUA 4TKNA 4ZDVA 1I35A 4E3CA 5AEKB 1XLPA 1UELA 1YMHE 4RNAA 1F77A 1QOAA 1L0YB 3PZ8A 1E9MA 4B9KA 4WWOA 1A5RA 3IVFA 3TEYA 3BZDB 4HKZE 4L2YA 3L13A 3T3NA 1VJKA 2V1YA 1K8RB 1IUEA 4MT5A 4DDID 3A4RA 3MC8A 2ICIA 1HQRD 3L0WB 3TEWA 3SDLC 3BK2A 4IM2A 1WZ0A 1RM6C 5TR5A 1SE9A 2Y5PA 4M8MA 3I57A 2M17A 3QCAA 5IA7A 5DPRA 2N7EA 1RYJA 4P16A 2UYZB 1RFKA 4J3OD 4EOYA 3RULA 1MG4A 1P7FA 2KFJA 4ARCA 5JH5C 3RNBC 4ACFA 1XQQA 2WXGA 1P3QU 1CQVA 1R7SA 4FADA 1U4AA 4Q2JA 3W1SA 4A3PA 2KOXA 4FHKA 2DYMA 4US9A 1DOXA 1WGHA 1I4RA 3C0RB 1K52A 4NAWB 4OVUA 3ZNID 1RFAA 2KVRA 2FIFA 3I9V1 3APCA 3IT6B 2PKOA 4DK5A 4RF1A 1T0RC 2KTRB 2I38A 4EZKA 4IUMB 1J19A 2E6XA 1QF6A 2GBJA 3ZJUA 1FXTB 3CF4A 5TSSA 1N62A 5HHDG 1YJJA 4G0NB 2INPE 2DAJA 4KIKA 3WAOA 2LASA 3PTFC 2JPHA 1ACCA 2IO1B 2W3SA 3CSTA 1IBXA 2K9XA 3GE3C 4YTMB 1KLVA 4YL8A 3EFUA 1WH3A 4NAMA 2HTHA 4BOSC 1WXSA 5DCNA 4RF0A 1NVID 1ESFA 2JWUA 3PV1A 1NYRA 3Q69A 1V49A 4W9GA 4YTNB 1E8XA 4KGTA 2RD0A 2K6QA 3UIOB 4BZAA 2NTTA 4X57B 4EKUA 3V6EB 1Z2MA 3W9CB 4W9JA 2ZCBA 4AUQC 1YN4A 1P0RA 4LK0M 3H7PB 5CHVC 2LFIA 3T3OA 4HK2A 1L0VB 2K6DB 1EUVB 4EZLA 3FAHA 5KHQA 4YSZB 2CU1A 2ZPYA 2LD9A 1EO6A 4DBGA 2KWVB 3AE5B 4LNFA 4M8NA 2PJHA 1MHHE 2DZIA 1FMAD 2JRHA 4PS3A 4WAFA 1UH6A 3JVZX 4W9HA 2SAKA 5FKAC 3P42A 4TV3A 2LGDA 1BT0A 2M56B 3PVLA 2ZCCA 2BS3B 1JALA 3FKYA 5MPOA 2OOBB 2QCZA 4IDIA 1YQBA 1PGAA 3UF8A 3RNFC 4C00A 2JSVX 3PRMB 2MCNB 4C7YA 1NENB 3GB1A 3WAPA 4WJOA 2WHIA 2J7QB 3QA8A 1WR1A 1T0QC 4MACA 2KK8A 4AWJA 2C60A 3M62B 4HPLB 5EE3A 1XCQL 3SEBA 2FCMA 4EZJA 5D2MB 3WCQA 1UBQA 2IGHA 1E8ZA 2K8CA 3T9LA 2WU2B 3DDCB 1XO3A 3PRZA 1I4QA 2SEBD 1FFVA 4M02A 1HZ6A 5G2NA 2YEPF 4LJPB 3RNAC 1OGWA 2MW5A 2KANA 4W9IA 2L8JA 3AEEB 2Y5CA 1SE3A 2YEPB 3DBSA 5IP4D 1UZXB 1UWXA 4KDIC 2JUOA 3TCAA 4TMAB 2ACZB 4WH4A 4IC7B 2KFKA 3B2GA 1OQRA 2MBQA 4P1CC 1FFUA 1FXIA 2K3UA 1WM2A 2IY1B 2V4LA 5GXGB 4BVUC 1WFYA 3UQAA 4YSYB 2KACA 3KVFB 3DOWA 1AN8A 1WX8A 2GOWA 1P98A 4WJQA 4BOZB 4LDTD 4OZCA 3KYDD 1QLBB 1GPXA 2I1KA 2QEJC 2EKIA 4IWPA 1WE6A 2KMMA 1N5XA 3UQBA 4S0RA 2KDFB 2L76A 3EGRA 4O1NA 3L4PA 3CSFA 4H2AA 3AMZA 1TKGA 2CHWA 2LRWA 4GDKA 1D5ZC 1E8WA 3DWGC 2K8BA 2G3QB 1R4NB 4ICVA 3BVGA 3HUIA 4MH8A 4MJSA 1UBIA 3LYYA 2V0GA 4BFRA 3RI7C 3SU8X 1V1PA 2D3BA 4GLSC 4DDGD 2XNAC 4WWPA 3V60A 1FO4A 3EC8A 3PS6A 4URKA 4MM3A 4ASWC 2ZNVB 1SGHA 1R4MI 2M0AA 5D6JB 2RGFA 5J17A 3DVGX 3L17A 3NG0A 4FLHA 4AS1A 1XD3B 1YJIA 1WIAA 3RUIB 1NYQA 2AL6A 1GB1A 3PO0A 2DWQA 4ZYNA 1C76A 1MG8A 1F52A 2OHFA 1ZE3D 3AU5A 4FA6A 5C23A 2UWQA
chains in the Genus database with same CATH topology
1YNTE 1K50A 2I2YA 1XEEA 2VZKB 4C80A 2K22A 4A9AA 1JWMD 4HKQA 2WLBA 3BYYB 3AM9A 2MEKA 5HI1A 3W5UB 1FNUA 3FILA 1PDXA 3E56A 5BMGA 1B9RA 4GDKB 2ONQA 5D7GA 1E0ZA 1F2RC 2MH7A 2JYTA 1JMLA 3VR9B 1TY0A 1WYGA 3KQ4A 1B1ZA 2FBWB 3H8HA 1ZOYB 4HJGE 3ABVB 1I4HA 2WXIA 4RH6A 2LHEA 3NVWA 1TS5A 2LGIA 3OWEB 1BXTA 2LJIA 3NVYA 5JXVA 1AWDA 2JX5A 4OVZA 2BTEA 3BYTB 1V1PB 2QJLA 4TQ0A 4A90A 2L52A 2WXFA 2DYOA 4ITKA 1RWSA 2H89B 1Q10A 1VLBA 3TEXA 4MM3B 3AE2B 5BMHA 2WXJA 3SFEB 5T8IA 1EM7A 1YN5A 4WURA 3P4RB 1JW9D 2L1AA 1I4GA 4LTUA 2RDGA 4YTPB 1XLPA 1YMHE 4RNAA 3P63A 1SJED 1F77A 1QOAA 1L0YB 5EE9A 3PZ8A 1E9MA 4NZLB 1ET9A 4ZRPA 3URYA 2W54A 3TEYA 3HVDA 3BZDB 4HKZE 1YQ4B 4L2YA 1WGKA 2R61A 3T3NA 1VJKA 2NMQA 3LXFA 3CWIA 3BIID 1N5WA 4XWWA 1IUEA 1FRDA 4MT5A 4WQMA 2LHDA 2BYTA 1ZDXA 1H7WA 2PIAA 1HZ5A 1LO5D 2BW2A 2ICIA 1HQRD 1FNVA 3FILB 3TEWA 2QSDA 3BK2A 1RM6C 2N7JA 5AUKA 2JYEA 2Y5PA 3NVVA 2WXPA 3I57A 3IAS1 3Q8FA 1JQ4A 1OFFA 3P4PB 3Q8AA 1TY2A 1C4AA 3GS2A 1TKYA 1RYJA 1ET6A 4P16A 4HRSA 1QOFA 1RFKA 1T6BX 4J3OD 2L32A 4D2KA 3LB8C 1P7FA 4ARCA 2IPKD 1TS2A 1SBBB 4XDCA 5BYQA 2V3PA 1OQQA 3N9YC 4R3DA 5D3DA 1JWAD 2PTLA 2WXGA 5H8YE 1IGCA 4US8A 1CQVA 1R7SA 4Q2JA 4ZYSA 2Y3AA 5C2TB 3W1SA 2VZKD 5I4DA 2BBCA 4B0MA 2DYMA 4US9A 1AYFA 1DGJA 1BUIC 2PLPA 3J9CA 4OHJA 1DOXA 1I4RA 2TSSA 1K52A 1CJEA 4NAWB 4XDDA 4ZRQA 1TYGB 2QIEB 3VRAB 2JQRB 1IBXB 1A70A 3P4SB 4JPSA 2WDQB 2NTSA 2M19A 2H88B 3V05A 3I9V1 1SXTA 2DLBA 2KAJA 3AV8A 1E6EB 3IT6B 2PKOA 4RF1A 3E9SA 1C4CA 4RGOS 1L5PA 2I38A 2WQYB 1XCTL 2MJDA 3EUB2 1XF5L 4IKGA 1ZUD2 3KWLA 2E6XA 5HG2A 1QF6A 4A6QA 1SF0A 4DXGA 1UNSA 3ZJUA 3CF4A 5EE0A 5TSSA 1N62A 3SFDB 5HHDG 3AEFB 1HXYD 1SB3C 1YJJA 1HA5A 4KKIA 1YN3A 1I7HA 4IOIE 2INPE 1WXQA 1L4ZB 1SSNA 3AB5A 4USAA 1GOZA 4LLGM 3AE7B 5HFYA 1ACCA 2W3SA 4DQOC 2WNMA 1IBXA 3ZJTA 1HEZE 2K9XA 4YTMB 3NRZA 4M0WA 1FCCC 4HROA 4NAMA 4ZHOA 2WXRA 1NVID 4RF0A 4A55A 1ESFA 3AH7A 4CQNA 4YWGG 2JWUA 1CK1A 4KX6B 1ZXIA 4PT5A 1NYRA 3Q69A 2FE8A 1ZPSA 2WXMA 3R2IA 4ZOHC 4KGRA 3O13A 4YTNB 1V8CA 3P4QB 4KGTA 5BMIA 3IXSA 2NTTA 1CZPA 1KH0A 1SIJA 1DYQA 5C3JB 1XLNA 3AE8B 3W9CB 2PMVA 1ENFA 1T3QA 1F0ZA 1M4VA 3MHZA 2FUG1 1VZ7A 2BB6A 1YN4A 1ZDVA 5EE1A 2HDEA 2IDYA 1BMLC 1XLOA 2WP9B 2BS4B 2W82A 2W3RA 4OZAA 1K51A 4LK0M 2LFIA 3T3OA 1WSPA 4KGSA 1L0VB 1L6UA 2PVGC 2ZW1A 1K53A 1TJEA 3AECB 3FAHA 4WWMA 4YSZB 1QOBA 1SEBD 3SR6A 4YSXB 2WU5B 1QOGA 3VQIA 1FCLA 3AEBB 4XE0A 2PW9A 2IGGA 3AE5B 5G5GA 5BYSA 4TQ1A 3BWUD 1TS4A 1MHHE 3AE1B 3IT4B 3UI3A 4C7ZA 1T5XD 1ZP0B 2LMCA 1FMAD 1JCKB 1UGJA 2KQ4X 2J42A 3HRDD 2WS3B 3AN1A 4WAFA 2WXKA 2KDMA 1KF6B 2SAKA 2MJ3A 1C78A 1KRHA 1J7BA 3DWMA 3VRBB 1MVKA 1E10A 4DXFA 5FK9C 5FKAC 3U4EG 2J52A 3P42A 3AEDB 3R2TA 1XXGA 1GT8A 2M56B 2IJ0A 3B9JA 3ZQ4A 1SE2A 1JWBD 2J4XA 2CJNA 4N59A 3BK1A 2BS3B 1JALA 1C77A 2BS2B 1DOIA 1MPEA 1VRAB 1VZ6A 5MPOA 1NEKB 1D6EC 3C8YA 4C56C 3AE6B 3Q8BA 1V1OA 4P6VF 4IDIA 1GB4A 1KFYB 1PGAA 1NI3A 5D3IB 3P1MA 1JWSD 2N9LA 2Z8LA 2JSVX 3Q8CA 4N58A 2LUMA 4C7YA 1NENB 2KN4A 3GB1A 3TUOA 1WWTA 1FD6A 3IAM1 3W2DA 4MACA 5E6JA 2WXOA 1PGBA 1TKEA 3ZJVA 1C4PA 3AE4B 3ZGZA 5EE3A 3MJ5A 4AQ7A 1XCQL 4RGTA 4KKJA 1P7EA 4JWSC 3SEBA 1C79A 1VR9A 3WCQA 3NS1A 2IGHA 2ON8A 2AQ2B 3HVZA 1I4XA 3U2SC 1FIQA 2WU2B 2JXTA 1JWUD 1N61A 3TEZA 1XO3A 2CJOA 2WXHA 4N6EB 1I4QA 2CU3A 1FFVA 1PYWD 1MI0A 1TS3A 1FRRA 1HZ6A 2SEBD 3W5VB 2AX5A 2QMTA 2YEPF 3BVZA 1D4BA 3RPFC 1GAQB 2GB1A 2JU6X 4L23A 3TSSA 1YQ3B 1FXAA 2X38A 3AEEB 1KLUD 2Y5CA 1SE3A 1FNWA 1JROA 2YEPB 2HTME 1KTKA 1UWXA 2GRIA 4RCOA 4L1BA 5H92C 3R8BA 3AE9B 1L0XB 4TMAB 1SJHD 2ACZB 1XLQA 2INNE 4WH4A 3B2GA 5G5HA 1I4PA 1OQRA 2KWDA 1SE4A 1FFUA 1FXIA 2K3UA 4EE2A 2ZW0A 3B2FA 2W55A 2QILA 1D5MC 4OZBA 1FEHA 3AE3B 1N60A 5GXGB 1Y56A 4YSYB 2WDVB 1EWYC 1ROEA 2RPVA 1QQRA 2KACA 3KWVA 3MP9A 1J7AA 1WRIA 2XN9C 4UDUC 1PFDA 1E7PB 4TSSA 3CIRB 2DBYA 1AN8A 1F2RI 3MC0B 1JRPA 2PVOD 4OW0A 2K5PA 1V97A 2D5GA 4OZCA 4WIPA 1QLBB 1TZOA 2IGDA 1GPXA 2QEJC 5AUIA 2EKIA 4ARIA 1VDVA 1GTHA 2RMMA 3ZYYX 4RGNA 4ZHPA 1H7XA 2J53A 2KMMA 1N5XA 2JZPA 3MFGA 1AW7A 2RDHA 3U52E 1QT9A 2LEKA 3EGRA 4O1NA 1DOYA 4YXDB 2L83A 3L4PA 4HEA1 4H2AA 3AMZA 1TKGA 1L4DB 1GTEA 2WXQA 2OEDA 1D5ZC 2E3TA 2EELA 3GP7A 1C9FA 2N0SB 3DWGC 2N9KA 3BVGA 3HUIA 4MH8A 1FM0D 1PGXA 4JX1C 3AEGB 1J7CA 3LYYA 2V0GA 1V1PA 1IGDA 4GLSC 3VR8B 2AQ1B 1QKZA 2V3NA 2XNAC 3AEAB 4NJCA 2WXLA 4XWTA 1EU3A 4REZA 1FO4A 3Q8EA 3PZ7A 4JE3B 2AQ3B 1UUPA 2Q5WD 5BYRA 4B0EA 1QILA 3NZ3A 1STEA 1N63A 1MHXA 4FXCA 2G9HD 2G1EA 2M0AA 2MJEA 4JWUC 1D5XC 1UWMA 2WDRB 4AS1A 1PUTA 2BB5A 5FR3A 2BT6A 1YJIA 1VZ8A 1L6VA 3KLSX 3U7ZA 3V3XA 1NYQA 2WXNA 3ETRA 3NUHB 4RFBA 3BVMA 1GB1A 2B76B 3PO0A 2DWQA 4YT0B 2GI9A 3NVZA 1C76A 4GDLB 2V4IB 4A8XC 1KLGD 1ZXHA 3EA6A 1EWCA 2K0PA 1EU4A 1ZE3D 2OHFA 5LNK1 3FC4A 3RFZB 4RGMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ACZ B;  1XLQ A;  3AE5 B;  3B2G A;  5G5H A;  4US9 A;  1OQR A;  1AYF A;  1DGJ A;  2K22 A;  4A9A A;  5G5G A;  4C80 A;  1DOX A;  1FFU A;  1FXI A;  2WLB A;  1CJE A;  3AM9 A;  3B2F A;  2W55 A;  1TYG B;  2QIE B;  3VRA B;  2JQR B;  1A70 A;  3W5U B;  3AE1 B;  1N60 A;  3AE3 B;  1PDX A;  4C7Z A;  1B9R A;  1ZP0 B;  1FMA D;  1E0Z A;  5GXG B;  3P4S B;  2WDQ B;  2MH7 A;  4YSY B;  2WDV B;  1EWY C;  2H88 B;  2WS3 B;  1ROE A;  2M19 A;  3AN1 A;  3VR9 B;  1WYG A;  3HRD D;  2KAJ A;  1J7A A;  1KF6 B;  2FBW B;  1E6E B;  1ZOY B;  1WRI A;  3ABV B;  2PKO A;  3AV8 A;  2MJ3 A;  1PFD A;  1E7P B;  1KRH A;  1J7B A;  3NVW A;  3DWM A;  3CIR B;  3VRB B;  2DBY A;  1L5P A;  1E10 A;  3NVY A;  1JRP A;  2WQY B;  2MJD A;  1AWD A;  2PVO D;  2JX5 A;  3EUB 2;  2K5P A;  3AED B;  1V97 A;  2QJL A;  1QLB B;  1GPX A;  1GT8 A;  1ZUD 2;  2EKI A;  2L52 A;  1VDV A;  1GTH A;  2M56 B;  3B9J A;  3KWL A;  5AUI A;  1QF6 A;  1JWB D;  3ZYY X;  4ZHP A;  1H7X A;  1SF0 A;  2CJN A;  4ITK A;  4N59 A;  2KMM A;  2BS3 B;  1JAL A;  2H89 B;  1RWS A;  1N5X A;  3CF4 A;  1VLB A;  5EE0 A;  1N62 A;  2BS2 B;  1DOI A;  3SFD B;  1QT9 A;  2LEK A;  3AEF B;  1YJJ A;  1SB3 C;  3AE2 B;  5MPO A;  1NEK B;  1DOY A;  4YXD B;  2L83 A;  3AE6 B;  3L4P A;  4P6V F;  1I7H A;  3SFE B;  3AMZ A;  1TKG A;  4IDI A;  1WXQ A;  1KFY B;  1GTE A;  1NI3 A;  3P4R B;  1JW9 D;  3AB5 A;  4USA A;  2E3T A;  4LTU A;  3P1M A;  4N58 A;  4YTP B;  2N0S B;  3DWG C;  4C7Y A;  1NEN B;  3AE7 B;  1XLP A;  2W3S A;  3HUI A;  1FM0 D;  1WWT A;  3P63 A;  4JX1 C;  3AEG B;  1QOA A;  4YTM B;  2K9X A;  3NRZ A;  1J7C A;  5EE9 A;  4HRO A;  1E9M A;  4ZHO A;  2W54 A;  1NVI D;  3VR8 B;  3AH7 A;  1YQ4 B;  1TKE A;  1WGK A;  3AEA B;  1VJK A;  3LXF A;  3CWI A;  3AE4 B;  4KX6 B;  3BII D;  1N5W A;  1ZXI A;  1FO4 A;  1NYR A;  5EE3 A;  1IUE A;  1FRD A;  4WQM A;  2Q5W D;  4ZOH C;  1H7W A;  4YTN B;  1V8C A;  3P4Q B;  2PIA A;  4JWS C;  3WCQ A;  3NS1 A;  1CZP A;  1RM6 C;  1N63 A;  3HVZ A;  4FXC A;  5AUK A;  1SIJ A;  2G1E A;  2MJE A;  1FIQ A;  4JWU C;  2WU2 B;  5C3J B;  1N61 A;  1UWM A;  2WDR B;  1XLN A;  3AE8 B;  1XO3 A;  2CJO A;  3NVV A;  4N6E B;  3W9C B;  1PUT A;  1JQ4 A;  2CU3 A;  1FFV A;  1OFF A;  1FRR A;  1T3Q A;  2BT6 A;  3P4P B;  3W5V B;  1F0Z A;  2AX5 A;  1YJI A;  5EE1 A;  1L6V A;  1TKY A;  1RYJ A;  1NYQ A;  1XLO A;  4HRS A;  2WP9 B;  2BS4 B;  1QOF A;  1RFK A;  3ETR A;  1GAQ B;  2W3R A;  3RPF C;  3LB8 C;  2B76 B;  3PO0 A;  1YQ3 B;  1FXA A;  2DWQ A;  4YT0 B;  3AEE B;  1OQQ A;  3NVZ A;  1L0V B;  1L6U A;  2Y5C A;  1JRO A;  1JWA D;  2PVG C;  5H8Y E;  1TJE A;  3AEC B;  2HTM E;  3FAH A;  4WWM A;  2OHF A;  4YSZ B;  1QOB A;  3SR6 A;  4YSX B;  3FC4 A;  4US8 A;  1R7S A;  2WU5 B;  5H92 C;  1QOG A;  5C2T B;  3AE9 B;  3AEB B; 
#chains in the Genus database with same CATH topology
 1YNT E;  2VZK B;  3EHV A;  4HKQ A;  5HI1 A;  1FNU A;  3FIL A;  5BMG A;  1KJT A;  4KVG B;  1MFW A;  5D7G A;  1JML A;  1WYG A;  4HDQ A;  1RAX A;  2LI5 A;  3H8H A;  3DHH C;  3H9D A;  1LXD A;  2BWE S;  2WXI A;  4WJP A;  3RD2 A;  1TS5 A;  3OWE B;  1BXT A;  2LJI A;  3GOE A;  3NVY A;  1AWD A;  2DZM A;  3BYT B;  2QJL A;  4NJ6 A;  4LNO A;  2Z59 B;  4BKG A;  2PE9 A;  4ITK A;  5IO9 A;  4IG7 B;  4NQL B;  1I42 A;  5E6N A;  1YOV B;  2RDG A;  2KHW B;  1YX6 B;  3P63 A;  4K7W A;  2ZJD A;  2XBB C;  4ZRP A;  3URY A;  3MC9 A;  3HVD A;  1WE7 A;  1MJD A;  2R61 A;  4WJN A;  2NMQ A;  4DHJ B;  3BII D;  4P7I A;  1NBF C;  3ZKJ C;  4FHJ A;  1HZ5 A;  2NPT A;  2QSD A;  4LDT B;  2EMT A;  2KDI A;  1V5T A;  3IAS 1;  3P2B A;  1OFF A;  1VCB A;  4MGZ E;  2KLC A;  1QZE A;  2WWZ A;  1GG3 A;  3VTV A;  1IYF A;  4D2K A;  2L32 A;  1TS2 A;  4PS8 A;  2V3P A;  3DBH I;  4R3D A;  2N9E B;  3OAW A;  1IGC A;  2M1M A;  1WM3 A;  2VRR B;  3RNC C;  2LWP A;  3DHG C;  2GBR A;  4ZYS A;  2Y3A A;  2AEH A;  4W9F A;  1AYF A;  1DGJ A;  3J9C A;  2TSS A;  5J18 A;  3VRA B;  4HDO A;  1J0G A;  4JL9 A;  1E7U A;  4FJZ A;  2KAJ A;  1E6E B;  1P1A A;  3H7P A;  3EEC A;  1E8Y A;  4RGO S;  2LRU A;  1L5P A;  2WQY B;  1XCT L;  1XF5 L;  4IKG A;  4KV2 A;  1ZUD 2;  4A6Q A;  2M4N A;  1SF0 A;  3IBE A;  2WYQ A;  1HXY D;  2G4S A;  1HA5 A;  4KKI A;  2IBI B;  3ZO5 B;  4IOI E;  2LVP A;  4S17 A;  5CHF A;  4II3 B;  2QHO A;  1SSN A;  4I6P A;  3C19 A;  4USA A;  2KLG A;  4LLG M;  2ASQ A;  3A4S C;  3NRZ A;  3ZRC A;  4HCP B;  3AH7 A;  3ZRF A;  3GZN B;  2KKC A;  4GB9 A;  4PT5 A;  2AWT A;  3DCG A;  3VUY A;  2FE8 A;  1Q1O A;  4KIK B;  3NS8 A;  4ZOH C;  1V6E A;  1V8C A;  3PT2 B;  2D2Q A;  4J6I A;  3RNE C;  1IPG A;  4WQO B;  1SIJ A;  1N6Z A;  3IG3 A;  5C3J B;  1XLN A;  3KUC B;  3TIX A;  5E6P A;  3AE8 B;  1V5O A;  1L2N A;  1T3Q A;  4E71 A;  2D07 B;  2FUG 1;  1VZ7 A;  2HDE A;  3RN9 C;  2X8X X;  2W82 A;  2W3R A;  3AXC A;  1M94 A;  1X1M A;  4OZA A;  1V9J A;  2DYB A;  2FCN A;  1TJE A;  3SD5 A;  4IWO A;  2JRI B;  3R7R A;  5L83 A;  4JGH B;  3VQI A;  3AEB B;  4NJ7 A;  3VAW A;  2IO3 B;  1WJN A;  1T0Y A;  5AZH A;  4TQ1 A;  3BWU D;  2XK5 B;  4FN2 A;  3AUL A;  3AE1 B;  2ZVO A;  2J0M A;  3UI3 A;  4C7Z A;  2GBM A;  1JCK B;  2KQ4 X;  1GC6 A;  3VVW B;  1KF6 B;  1C78 A;  3VRB B;  1MVK A;  5FK9 C;  5JZE B;  4XGA B;  3U4E G;  3ZVV A;  3MJW A;  3R2T A;  4IM0 A;  1XXG A;  2IJ0 A;  3ZQ4 A;  3QC8 B;  1SE2 A;  3VXW A;  2FCS A;  2CJN A;  3BK1 A;  3A9K A;  2BS2 B;  1VZ6 A;  2WX1 A;  3AE6 B;  3Q8B A;  1V1O A;  2GMI C;  3IHP C;  1GB4 A;  1KFY B;  2ZNV C;  3PLU A;  2KN4 A;  4HVB A;  3TUO A;  4PYZ A;  1T0S C;  2MX2 A;  4MDK E;  3PRP B;  1AAR A;  3AU4 A;  1PGB A;  1TKE A;  3W1S C;  3ZJV A;  2FAZ A;  4HCN B;  2K8H A;  2KXJ A;  2R2Q A;  2Z0E B;  4AQ7 A;  2HJ8 A;  2MP2 B;  3UGB B;  4JWS C;  1VR9 A;  3RT3 B;  2KC1 A;  1I4X A;  3U2S C;  3TEZ A;  2CJO A;  4N6E B;  1PYW D;  1TS3 A;  4K81 A;  4NQK E;  2BWF A;  1FRR A;  1WX9 A;  4AP4 C;  3HHM A;  4MJS B;  1LFD A;  4HXD A;  2GB1 A;  5JHB A;  3DBR B;  2D3G A;  1YQ3 B;  1FXA A;  2CHX A;  2X38 A;  1KLU D;  1FNW A;  1KTK A;  2KQ7 A;  2GRI A;  3UIP B;  2PPH A;  3HM6 X;  2LGX A;  1L0X B;  1SJH D;  1XLQ A;  1SE4 A;  2IND C;  3B2F A;  1HTO A;  2W55 A;  1N60 A;  2MRP A;  1TGZ B;  1EWY C;  5IN7 A;  2DEN B;  3KWV A;  3MP9 A;  2KMC A;  1J7A A;  2XN9 C;  4UDU C;  1PFD A;  5DPT A;  4TSS A;  3MC0 B;  1WXM A;  3V62 A;  1V97 A;  2D5G A;  2LXA A;  2CR5 A;  5AUI A;  2KTF A;  3N32 A;  2RDH A;  5L95 C;  1WMH A;  1EF5 A;  3QX1 A;  1QT9 A;  4N9F 4;  4EUT A;  5CTR C;  4HEA 1;  2KYW A;  3LDZ E;  2E3T A;  2EEL A;  4CO7 A;  1H4R A;  3QIJ A;  1PGX A;  2C9W B;  4JX1 C;  4K3C A;  2KDE B;  1RRB A;  1C3T A;  1WF9 A;  4ICU A;  4MEM A;  2QC8 A;  3AEA B;  4XWT A;  2A4Z A;  3Q8E A;  3PZ7 A;  4JE3 B;  2AQ3 B;  2NVU I;  3HK0 A;  3NZ3 A;  2G9H D;  1Z5S B;  2NR2 A;  2XK5 A;  2BB5 A;  3DBL I;  2Z0D B;  2KJR A;  2AL3 A;  2BYV E;  1L6V A;  1WJ6 A;  3NUH B;  4FUL A;  4QAY A;  3BVM A;  3QAQ A;  2RPQ A;  4A8X C;  4XC2 A;  3KUZ A;  2KX0 A;  1WY8 A;  2O6V D;  2O2V A;  3FC4 A;  3RFZ B;  3WAN A;  1XEE A;  4C80 A;  2K22 A;  4A9A A;  1JWM D;  4TUU A;  2WLB A;  1FPY A;  3N1Y C;  2MWS B;  2BF8 B;  2ONQ A;  1F2R C;  2MH7 A;  2JYT A;  2C5L C;  1TY0 A;  4NY0 A;  5AZG A;  5KHO A;  4C4V A;  3ZUN A;  3ABV B;  1I4H A;  3DVG Y;  2LHE A;  4AJW A;  5JXV A;  4MSQ B;  2D10 A;  4NPN A;  1WYW B;  2L52 A;  2D3C A;  2WXF A;  1RWS A;  1Q10 A;  3AE2 B;  4XX5 A;  4KZC A;  3X0W A;  4WUR A;  3P4R B;  1JW9 D;  3VUW A;  3V61 A;  4EFO A;  5EE9 A;  3RYT A;  1WGK A;  4K7U A;  2KC2 A;  3DPD A;  3APD A;  3Q3J A;  2GBN A;  1FRD A;  3QK0 A;  2BYT A;  2PIA A;  1FNV A;  3FIL B;  1WXV A;  2N7D A;  4M00 A;  5AUK A;  1F9J A;  4CYE A;  2JYE A;  2WXP A;  4BKS A;  1JQ4 A;  3Q8F A;  4HPM B;  3OJ3 A;  3Q8A A;  2EKE C;  1TKY A;  4HRS A;  1QOF A;  1WR6 E;  3BIN A;  3LB8 C;  4ANU A;  4KDL B;  2JY6 A;  5BYQ A;  5D3D A;  5EDS A;  3JW0 X;  4US8 A;  2FID A;  2CS4 A;  3DHI C;  2BBC A;  4B0M A;  5LLI A;  4OHJ A;  1KM7 A;  1CJE A;  4K7S A;  4XDD A;  2B3A A;  4ZRQ A;  2JQR B;  1IBX B;  1NI2 A;  4F1S A;  3P4S B;  2WDQ B;  2NTS A;  3N20 C;  1L7Y A;  2H88 B;  1SXT A;  2DLB A;  1XT9 B;  1C4C A;  2MJD A;  1WZ3 A;  4A20 A;  3EUB 2;  4PK1 A;  4XYC A;  4LJO B;  3VH4 B;  1TZ1 A;  2JZZ A;  4DXG A;  1UNS A;  1UGM A;  3SFD B;  3AEF B;  1SB3 C;  3DVN V;  4JIO U;  1YN3 A;  3HIZ A;  1WXQ A;  1L4Z B;  3ZDT A;  3M63 B;  3APF A;  4BKS D;  4PYU A;  3AE7 B;  5HFY A;  2LUE A;  4AOF A;  4RM9 A;  3RNG C;  3ZLZ A;  1FCC C;  4HRO A;  4ZHO A;  2LXC A;  4YWG G;  1CK1 A;  4KX6 B;  1ZXI A;  2NCN A;  2WXM A;  3PPA A;  4W9C A;  3O13 A;  3PRE A;  3P4Q B;  1G6J A;  2HD5 B;  5BMI A;  3IXS A;  2V9H A;  1KH0 A;  1YJ1 A;  2D3A A;  1TBE A;  2BPS A;  2BKR B;  2PMV A;  2LZ6 A;  1C1Y B;  3I3T B;  1F0Z A;  4GSW A;  1GUA B;  5EE1 A;  3TBL D;  1XLO A;  2WP9 B;  2BS4 B;  2KZR A;  2I1J A;  2OJR A;  2BGF A;  1WSP A;  1NDD A;  2YVC A;  2REX A;  3AEC B;  3H7S A;  4B95 A;  3L10 B;  3VH3 B;  1SEB D;  3SR6 A;  2L7R A;  2WU5 B;  2RR9 A;  3OJ4 B;  1QOG A;  1WJ4 A;  3VTW A;  1FCL A;  2ZZP B;  4XE0 A;  2PW9 A;  3ZW3 A;  2IGG A;  2C7M B;  5G5G A;  3KW5 B;  5BYS A;  2N9X A;  4GDL A;  3IT4 B;  1T5X D;  2LMC A;  3DBH B;  1J8C A;  3HRD D;  2WS3 B;  3QJZ A;  2MJ3 A;  1KRH A;  1J7B A;  3N1X C;  1E10 A;  4DXF A;  3RMK C;  2J52 A;  3AED B;  3N1Z C;  1GT8 A;  3B9J A;  4WWN A;  1JWB D;  4N59 A;  3TMP B;  1C77 A;  1VRA B;  1MPE A;  1WRD B;  1D6E C;  4C56 C;  1YIW A;  3KYC D;  3DQV A;  5D3I B;  3A9J A;  3P1M A;  1JWS D;  2Z8L A;  4N58 A;  3Q8C A;  4HPP A;  1WWT A;  3IAM 1;  3W2D A;  5E6J A;  3JYU A;  1C4P A;  3DBR I;  3MJ5 A;  1UD7 A;  4RGT A;  3ZTD A;  4KKJ A;  1ZW7 A;  3ZNH B;  2ON8 A;  2AQ2 B;  3ECI A;  3HVZ A;  2J0J A;  1N61 A;  4ANW A;  2WXH A;  2CU3 A;  4LNK A;  3L54 A;  2AX5 A;  4GU2 A;  3RPF C;  3Q2A C;  1GAQ B;  2JU6 X;  3TSS A;  3U30 A;  2K25 A;  3A1Q A;  4GIV A;  2HTM E;  3VHT C;  1H8C A;  4K3B A;  4RCO A;  4WAA A;  2MBH A;  4DWF A;  1ZKH A;  2BKF A;  1I4P A;  4EE2 A;  2ZW0 A;  3L16 A;  1D5M C;  2M8S A;  3UIN B;  2KJH B;  1ROE A;  4IWQ A;  2G45 B;  2RPV A;  1QQR A;  2G4D B;  4GOC A;  3CIR B;  1JRP A;  2JVC A;  2IGD A;  2NBW B;  4ARI A;  1GTH A;  1Q5W B;  2CHZ A;  4ZHP A;  2J53 A;  3MFG A;  3NZS A;  2WDT B;  2DX5 B;  3U52 E;  2MSE D;  2L05 A;  4YXD B;  2L83 A;  1S1Q B;  5LXH A;  1L4D B;  1TT5 B;  3AI5 A;  1GTE A;  2WXQ A;  2OED A;  3GP7 A;  2KD0 A;  1IP9 A;  1FM0 D;  3I5J C;  3D32 A;  3AEG B;  1HTQ A;  1J7C A;  1R4N I;  3ENE A;  2KJ6 A;  3VR8 B;  2AQ1 B;  1QKZ A;  2KDB A;  2EMS A;  2DAF A;  1EU3 A;  4REZ A;  3JSV A;  1UUP A;  4GGQ A;  4MGK E;  2DZK A;  4KSL C;  2C7N B;  4E74 A;  1QIL A;  1STE A;  1N63 A;  1MHX A;  3VDZ A;  2G1E A;  2MJE A;  1OEY J;  2ZPN A;  3LJ3 A;  2BT6 A;  5LXI B;  1VZ8 A;  3IFW B;  2L0F A;  3KLS X;  3V3X A;  1KOT A;  3ETR A;  3GE8 C;  2B76 B;  2NS5 A;  2GI9 A;  1HE8 A;  4GDL B;  3KUD B;  3NOB A;  1EU4 A;  2D11 A;  1YD8 U;  3BY4 B;  4LNI A;  2BVC A;  3BYY B;  2PE6 B;  2MEK A;  3AM9 A;  5HKH A;  1SIF A;  3W5U B;  1PDX A;  4KZ0 A;  1E0Z A;  3DBL B;  1WXA A;  3N3K B;  3VR9 B;  3KQ4 A;  2O2V B;  2KWU B;  4HJG E;  3NVW A;  4HLE A;  2LGI A;  5C1Z A;  1OQY A;  4GN1 A;  1V1P B;  2IY0 B;  4A90 A;  3QQ8 B;  3TEX A;  2GLS A;  1Q0W B;  2JXX A;  3H6N A;  4PS7 A;  2L3Z A;  3SFE B;  1EM7 A;  1E7V A;  1YX5 B;  5IKC M;  1WGY A;  3PHX B;  1EF1 A;  3ZTC A;  4YTP B;  1JRU A;  1SJE D;  4IM3 A;  4NZL B;  1ET9 A;  4XZ4 A;  2W54 A;  1LGR A;  5D94 A;  1S3S G;  1YQ4 B;  3V6C B;  2NPT B;  3LXF A;  3CWI A;  3B08 A;  3K9P B;  5FR6 A;  1N5W A;  4XWW A;  3ONS A;  4WQM A;  2LHD A;  1ZDX A;  1H7W A;  3MTN B;  1LO5 D;  2BW2 A;  2N7J A;  4ANX A;  4IW0 A;  4G50 A;  3DVN U;  1V2Y A;  3RZW C;  3NVV A;  3P4P B;  4M0W B;  1TY2 A;  1C4A A;  3GS2 A;  1ET6 A;  4DHZ E;  1T6B X;  2AYO B;  2IPK D;  2RSU A;  1SBB B;  4XDC A;  4CHK A;  1OQQ A;  3Q14 C;  3N9Y C;  1JWA D;  2PTL A;  5H8Y E;  3NJT A;  5DPS A;  3X23 A;  4DHJ D;  4LNN A;  5C2T B;  2VZK D;  5I4D A;  2K1F A;  2FNJ B;  1BUI C;  2PLP A;  1TYG B;  2QIE B;  1A70 A;  1GJZ A;  1V80 A;  2R2O A;  4JPS A;  2M19 A;  3V05 A;  2QDF A;  3R7Q A;  3AV8 A;  2BYF A;  3HM3 A;  4GXB A;  2KVZ A;  3O65 B;  5CX3 A;  4MGY E;  3E9S A;  2C7H A;  1E5W A;  4NAW A;  5GMV A;  4LCD E;  3KWL A;  2KX3 A;  5HG2 A;  2HJ1 A;  2GBK A;  5J2R A;  5EE0 A;  3RZF A;  1VD2 A;  2N1W A;  3WIM A;  1WX7 A;  1I7H A;  3A33 B;  3AB5 A;  3CF6 E;  2UU7 A;  1GOZ A;  4P1B C;  3NY5 A;  2FCQ A;  1V86 A;  2DNF A;  2WNM A;  3R66 C;  4MEL A;  4DQO C;  1HEZ E;  3ZJT A;  4M0W A;  1ISN A;  2WXR A;  4CQN A;  4A55 A;  5CHW A;  3Q6B A;  4FJV B;  3WAM A;  3ZXV A;  3PSE B;  1OTR B;  1ZPS A;  2RDB C;  1ZGU B;  3QWZ B;  3R2I A;  4FBJ B;  4KGR A;  3Q3O C;  4FJY A;  2VH2 A;  2VH1 A;  2LVQ A;  1WGG A;  1E90 A;  1UF0 A;  1CZP A;  4I6L B;  3B0A A;  3B1L X;  3VFK A;  1DYQ A;  2K39 A;  4ZRK A;  1R4M B;  2MQJ A;  1TTN A;  1ENF A;  2YLM A;  2KN5 A;  1M4V A;  3MHZ A;  2BB6 A;  4I6N B;  1ZDV A;  2IDY A;  1BML C;  4RMA A;  4W9E A;  1K51 A;  3L08 A;  1LQB A;  4KGS A;  5E6O A;  1L6U A;  2PVG C;  3MHS D;  2ZW1 A;  1K53 A;  2LVO A;  4WWM A;  1QOB A;  4YSX B;  2KNB A;  4K1R B;  1OEY A;  2MBE A;  1CMX B;  2L0T A;  3EFC A;  4ZRJ A;  2IYD B;  3I63 C;  1TS4 A;  4ZRI A;  3PLV A;  4RM8 A;  1ZP0 B;  2ZEQ A;  3CMM B;  1UGJ A;  2J42 A;  3AN1 A;  3A9J B;  2WXK A;  2KDM A;  3WAL A;  4KSK C;  2JZ3 B;  5JHA A;  3DWM A;  2ZVN A;  2KFK B;  3ML9 A;  3H1U A;  1PQS A;  2KWC A;  3TL5 A;  2J4X A;  3ZIM A;  3TJP A;  4W9D A;  3GZN I;  4BAX A;  4B6W A;  4EEW A;  2M0X A;  2NBU A;  4M01 A;  1DOI A;  3R3M A;  1NEK B;  3C8Y A;  4P6V F;  1NI3 A;  1P9D U;  2N9L A;  2MHJ A;  2LUM A;  1WI0 A;  1FD6 A;  1WGR A;  2DZJ A;  2O6V B;  1F1H A;  2Y5B B;  2INC C;  2WXO A;  5BO4 B;  2IO2 B;  3NHE B;  3AE4 B;  3ZGZ A;  1WMH B;  1TIF A;  1P7E A;  4BBN C;  1C79 A;  3NS1 A;  4F8C B;  4OVV A;  3JSV B;  1FIQ A;  5IOI A;  4II2 B;  2JXT A;  4HJK A;  1JWU D;  2MA9 B;  4MH0 E;  1D3Z A;  3N30 A;  4AJY B;  2CKH B;  1MI0 A;  3W5V B;  2KMA A;  2QMT A;  2BYE A;  4F7Z A;  3BVZ A;  1D4B A;  4L23 A;  3M95 A;  4G3X B;  1JRO A;  2LGS A;  2XEW A;  2N1V A;  3ALB A;  2L00 B;  4L1B A;  2MBB B;  5H92 C;  3R8B A;  3U8Z A;  3AE9 B;  3VUX A;  2PEA A;  2INN E;  5G5H A;  3W1Y A;  2KWD A;  2V3S A;  2QIL A;  3PHW B;  4OZB A;  4W9L A;  1FEH A;  3AE3 B;  2A5U A;  1Y56 A;  2WDV B;  2WGS A;  1WRI A;  1E7P B;  3VTU A;  2IO0 B;  2DBY A;  1F2R I;  2KT7 A;  1WJU A;  3PGE A;  2PVO D;  4OW0 A;  2K5P A;  4WIP A;  2BQQ A;  1TZO A;  4A3O A;  1RLF A;  3U7D A;  1VDV A;  1GC7 A;  2RMM A;  4BBN F;  3ZYY X;  4RGN A;  1H7X A;  2HE7 A;  2JZP A;  1AW7 A;  3PZD A;  1GNU A;  3RCZ A;  2LEK A;  4DXA B;  1DOY A;  3QHT A;  4MGI E;  2NBV B;  2J0K A;  3KH0 A;  3NZU A;  1C9F A;  2N0S B;  3K9O B;  2N9K A;  2N9P C;  4GMV A;  3M3J A;  1IGD A;  2V3N A;  4NJC A;  2WXL A;  2JWZ A;  3OG5 A;  2IZV B;  4MSM B;  3Q3N C;  2Q5W D;  5BYR A;  4B0E A;  4DHZ B;  3A1Q B;  2DHZ A;  3OLM D;  4FXC A;  4BKT A;  3ZXR A;  4JWU C;  3ZNG C;  1D5X C;  1UWM A;  2WDR B;  3ZNZ B;  1WGD A;  1PUT A;  5FR3 A;  3ZDM C;  2O6V A;  2KQS A;  4JLC A;  3U7Z A;  2WXN A;  4RFB A;  4C4V B;  4YT0 B;  5IAA C;  3NVZ A;  2V4I B;  1KLG D;  1ZXH A;  2MP2 A;  3EA6 A;  1EWC A;  2K0P A;  4HWI B;  5LNK 1;  4RGM A;  2MBO A;  2JT4 B;  1K50 A;  2I2Y A;  2KTR A;  5G55 A;  2LGY A;  2KO3 A;  2WX0 A;  5AZF A;  1V81 A;  3E56 A;  1LM8 B;  1B9R A;  4GDK B;  4G11 A;  2W9N A;  4NNJ B;  2OJW A;  3T8M A;  3QAR A;  1B1Z A;  2FBW B;  2FUH B;  1ZOY B;  4RH6 A;  4ANV A;  5DPW A;  4JQW C;  2JX5 A;  4OVZ A;  3A9K B;  2N4F A;  2BTE A;  2LJ5 A;  3SHQ A;  2JF5 A;  4TQ0 A;  1Y8R C;  3WA0 A;  2DYO A;  2MLB A;  2H89 B;  1VLB A;  3ML8 A;  4MM3 B;  3Q3F A;  5BMH A;  2WXJ A;  3S2A A;  5T8I A;  1YN5 A;  3Q3M C;  2L1A A;  4W9K A;  1I4G A;  4LTU A;  4TKN A;  4ZDV A;  1I35 A;  4E3C A;  5AEK B;  1XLP A;  1UEL A;  1YMH E;  4RNA A;  1F77 A;  1QOA A;  1L0Y B;  3PZ8 A;  1E9M A;  4B9K A;  4WWO A;  1A5R A;  3IVF A;  3TEY A;  3BZD B;  4HKZ E;  4L2Y A;  3L13 A;  3T3N A;  1VJK A;  2V1Y A;  1K8R B;  1IUE A;  4MT5 A;  4DDI D;  3A4R A;  3MC8 A;  2ICI A;  1HQR D;  3L0W B;  3TEW A;  3SDL C;  3BK2 A;  4IM2 A;  1WZ0 A;  1RM6 C;  5TR5 A;  1SE9 A;  2Y5P A;  4M8M A;  3I57 A;  2M17 A;  3QCA A;  5IA7 A;  5DPR A;  2N7E A;  1RYJ A;  4P16 A;  2UYZ B;  1RFK A;  4J3O D;  4EOY A;  3RUL A;  1MG4 A;  1P7F A;  2KFJ A;  4ARC A;  5JH5 C;  3RNB C;  4ACF A;  1XQQ A;  2WXG A;  1P3Q U;  1CQV A;  1R7S A;  4FAD A;  1U4A A;  4Q2J A;  3W1S A;  4A3P A;  2KOX A;  4FHK A;  2DYM A;  4US9 A;  1DOX A;  1WGH A;  1I4R A;  3C0R B;  1K52 A;  4NAW B;  4OVU A;  3ZNI D;  1RFA A;  2KVR A;  2FIF A;  3I9V 1;  3APC A;  3IT6 B;  2PKO A;  4DK5 A;  4RF1 A;  1T0R C;  2KTR B;  2I38 A;  4EZK A;  4IUM B;  1J19 A;  2E6X A;  1QF6 A;  2GBJ A;  3ZJU A;  1FXT B;  3CF4 A;  5TSS A;  1N62 A;  5HHD G;  1YJJ A;  4G0N B;  2INP E;  2DAJ A;  4KIK A;  3WAO A;  2LAS A;  3PTF C;  2JPH A;  1ACC A;  2IO1 B;  2W3S A;  3CST A;  1IBX A;  2K9X A;  3GE3 C;  4YTM B;  1KLV A;  4YL8 A;  3EFU A;  1WH3 A;  4NAM A;  2HTH A;  4BOS C;  1WXS A;  5DCN A;  4RF0 A;  1NVI D;  1ESF A;  2JWU A;  3PV1 A;  1NYR A;  3Q69 A;  1V49 A;  4W9G A;  4YTN B;  1E8X A;  4KGT A;  2RD0 A;  2K6Q A;  3UIO B;  4BZA A;  2NTT A;  4X57 B;  4EKU A;  3V6E B;  1Z2M A;  3W9C B;  4W9J A;  2ZCB A;  4AUQ C;  1YN4 A;  1P0R A;  4LK0 M;  3H7P B;  5CHV C;  2LFI A;  3T3O A;  4HK2 A;  1L0V B;  2K6D B;  1EUV B;  4EZL A;  3FAH A;  5KHQ A;  4YSZ B;  2CU1 A;  2ZPY A;  2LD9 A;  1EO6 A;  4DBG A;  2KWV B;  3AE5 B;  4LNF A;  4M8N A;  2PJH A;  1MHH E;  2DZI A;  1FMA D;  2JRH A;  4PS3 A;  4WAF A;  1UH6 A;  3JVZ X;  4W9H A;  2SAK A;  5FKA C;  3P42 A;  4TV3 A;  2LGD A;  1BT0 A;  2M56 B;  3PVL A;  2ZCC A;  2BS3 B;  1JAL A;  3FKY A;  5MPO A;  2OOB B;  2QCZ A;  4IDI A;  1YQB A;  1PGA A;  3UF8 A;  3RNF C;  4C00 A;  2JSV X;  3PRM B;  2MCN B;  4C7Y A;  1NEN B;  3GB1 A;  3WAP A;  4WJO A;  2WHI A;  2J7Q B;  3QA8 A;  1WR1 A;  1T0Q C;  4MAC A;  2KK8 A;  4AWJ A;  2C60 A;  3M62 B;  4HPL B;  5EE3 A;  1XCQ L;  3SEB A;  2FCM A;  4EZJ A;  5D2M B;  3WCQ A;  1UBQ A;  2IGH A;  1E8Z A;  2K8C A;  3T9L A;  2WU2 B;  3DDC B;  1XO3 A;  3PRZ A;  1I4Q A;  2SEB D;  1FFV A;  4M02 A;  1HZ6 A;  5G2N A;  2YEP F;  4LJP B;  3RNA C;  1OGW A;  2MW5 A;  2KAN A;  4W9I A;  2L8J A;  3AEE B;  2Y5C A;  1SE3 A;  2YEP B;  3DBS A;  5IP4 D;  1UZX B;  1UWX A;  4KDI C;  2JUO A;  3TCA A;  4TMA B;  2ACZ B;  4WH4 A;  4IC7 B;  2KFK A;  3B2G A;  1OQR A;  2MBQ A;  4P1C C;  1FFU A;  1FXI A;  2K3U A;  1WM2 A;  2IY1 B;  2V4L A;  5GXG B;  4BVU C;  1WFY A;  3UQA A;  4YSY B;  2KAC A;  3KVF B;  3DOW A;  1AN8 A;  1WX8 A;  2GOW A;  1P98 A;  4WJQ A;  4BOZ B;  4LDT D;  4OZC A;  3KYD D;  1QLB B;  1GPX A;  2I1K A;  2QEJ C;  2EKI A;  4IWP A;  1WE6 A;  2KMM A;  1N5X A;  3UQB A;  4S0R A;  2KDF B;  2L76 A;  3EGR A;  4O1N A;  3L4P A;  3CSF A;  4H2A A;  3AMZ A;  1TKG A;  2CHW A;  2LRW A;  4GDK A;  1D5Z C;  1E8W A;  3DWG C;  2K8B A;  2G3Q B;  1R4N B;  4ICV A;  3BVG A;  3HUI A;  4MH8 A;  4MJS A;  1UBI A;  3LYY A;  2V0G A;  4BFR A;  3RI7 C;  3SU8 X;  1V1P A;  2D3B A;  4GLS C;  4DDG D;  2XNA C;  4WWP A;  3V60 A;  1FO4 A;  3EC8 A;  3PS6 A;  4URK A;  4MM3 A;  4ASW C;  2ZNV B;  1SGH A;  1R4M I;  2M0A A;  5D6J B;  2RGF A;  5J17 A;  3DVG X;  3L17 A;  3NG0 A;  4FLH A;  4AS1 A;  1XD3 B;  1YJI A;  1WIA A;  3RUI B;  1NYQ A;  2AL6 A;  1GB1 A;  3PO0 A;  2DWQ A;  4ZYN A;  1C76 A;  1MG8 A;  1F52 A;  2OHF A;  1ZE3 D;  3AU5 A;  4FA6 A;  5C23 A;  2UWQ A; 
#chains in the Genus database with same CATH homology
 1YNT E;  1K50 A;  2I2Y A;  1XEE A;  2VZK B;  4C80 A;  2K22 A;  4A9A A;  1JWM D;  4HKQ A;  2WLB A;  3BYY B;  3AM9 A;  2MEK A;  5HI1 A;  3W5U B;  1FNU A;  3FIL A;  1PDX A;  3E56 A;  5BMG A;  1B9R A;  4GDK B;  2ONQ A;  5D7G A;  1E0Z A;  1F2R C;  2MH7 A;  2JYT A;  1JML A;  3VR9 B;  1TY0 A;  1WYG A;  3KQ4 A;  1B1Z A;  2FBW B;  3H8H A;  1ZOY B;  4HJG E;  3ABV B;  1I4H A;  2WXI A;  4RH6 A;  2LHE A;  3NVW A;  1TS5 A;  2LGI A;  3OWE B;  1BXT A;  2LJI A;  3NVY A;  5JXV A;  1AWD A;  2JX5 A;  4OVZ A;  2BTE A;  3BYT B;  1V1P B;  2QJL A;  4TQ0 A;  4A90 A;  2L52 A;  2WXF A;  2DYO A;  4ITK A;  1RWS A;  2H89 B;  1Q10 A;  1VLB A;  3TEX A;  4MM3 B;  3AE2 B;  5BMH A;  2WXJ A;  3SFE B;  5T8I A;  1EM7 A;  1YN5 A;  4WUR A;  3P4R B;  1JW9 D;  2L1A A;  1I4G A;  4LTU A;  2RDG A;  4YTP B;  1XLP A;  1YMH E;  4RNA A;  3P63 A;  1SJE D;  1F77 A;  1QOA A;  1L0Y B;  5EE9 A;  3PZ8 A;  1E9M A;  4NZL B;  1ET9 A;  4ZRP A;  3URY A;  2W54 A;  3TEY A;  3HVD A;  3BZD B;  4HKZ E;  1YQ4 B;  4L2Y A;  1WGK A;  2R61 A;  3T3N A;  1VJK A;  2NMQ A;  3LXF A;  3CWI A;  3BII D;  1N5W A;  4XWW A;  1IUE A;  1FRD A;  4MT5 A;  4WQM A;  2LHD A;  2BYT A;  1ZDX A;  1H7W A;  2PIA A;  1HZ5 A;  1LO5 D;  2BW2 A;  2ICI A;  1HQR D;  1FNV A;  3FIL B;  3TEW A;  2QSD A;  3BK2 A;  1RM6 C;  2N7J A;  5AUK A;  2JYE A;  2Y5P A;  3NVV A;  2WXP A;  3I57 A;  3IAS 1;  3Q8F A;  1JQ4 A;  1OFF A;  3P4P B;  3Q8A A;  1TY2 A;  1C4A A;  3GS2 A;  1TKY A;  1RYJ A;  1ET6 A;  4P16 A;  4HRS A;  1QOF A;  1RFK A;  1T6B X;  4J3O D;  2L32 A;  4D2K A;  3LB8 C;  1P7F A;  4ARC A;  2IPK D;  1TS2 A;  1SBB B;  4XDC A;  5BYQ A;  2V3P A;  1OQQ A;  3N9Y C;  4R3D A;  5D3D A;  1JWA D;  2PTL A;  2WXG A;  5H8Y E;  1IGC A;  4US8 A;  1CQV A;  1R7S A;  4Q2J A;  4ZYS A;  2Y3A A;  5C2T B;  3W1S A;  2VZK D;  5I4D A;  2BBC A;  4B0M A;  2DYM A;  4US9 A;  1AYF A;  1DGJ A;  1BUI C;  2PLP A;  3J9C A;  4OHJ A;  1DOX A;  1I4R A;  2TSS A;  1K52 A;  1CJE A;  4NAW B;  4XDD A;  4ZRQ A;  1TYG B;  2QIE B;  3VRA B;  2JQR B;  1IBX B;  1A70 A;  3P4S B;  4JPS A;  2WDQ B;  2NTS A;  2M19 A;  2H88 B;  3V05 A;  3I9V 1;  1SXT A;  2DLB A;  2KAJ A;  3AV8 A;  1E6E B;  3IT6 B;  2PKO A;  4RF1 A;  3E9S A;  1C4C A;  4RGO S;  1L5P A;  2I38 A;  2WQY B;  1XCT L;  2MJD A;  3EUB 2;  1XF5 L;  4IKG A;  1ZUD 2;  3KWL A;  2E6X A;  5HG2 A;  1QF6 A;  4A6Q A;  1SF0 A;  4DXG A;  1UNS A;  3ZJU A;  3CF4 A;  5EE0 A;  5TSS A;  1N62 A;  3SFD B;  5HHD G;  3AEF B;  1HXY D;  1SB3 C;  1YJJ A;  1HA5 A;  4KKI A;  1YN3 A;  1I7H A;  4IOI E;  2INP E;  1WXQ A;  1L4Z B;  1SSN A;  3AB5 A;  4USA A;  1GOZ A;  4LLG M;  3AE7 B;  5HFY A;  1ACC A;  2W3S A;  4DQO C;  2WNM A;  1IBX A;  3ZJT A;  1HEZ E;  2K9X A;  4YTM B;  3NRZ A;  4M0W A;  1FCC C;  4HRO A;  4NAM A;  4ZHO A;  2WXR A;  1NVI D;  4RF0 A;  4A55 A;  1ESF A;  3AH7 A;  4CQN A;  4YWG G;  2JWU A;  1CK1 A;  4KX6 B;  1ZXI A;  4PT5 A;  1NYR A;  3Q69 A;  2FE8 A;  1ZPS A;  2WXM A;  3R2I A;  4ZOH C;  4KGR A;  3O13 A;  4YTN B;  1V8C A;  3P4Q B;  4KGT A;  5BMI A;  3IXS A;  2NTT A;  1CZP A;  1KH0 A;  1SIJ A;  1DYQ A;  5C3J B;  1XLN A;  3AE8 B;  3W9C B;  2PMV A;  1ENF A;  1T3Q A;  1F0Z A;  1M4V A;  3MHZ A;  2FUG 1;  1VZ7 A;  2BB6 A;  1YN4 A;  1ZDV A;  5EE1 A;  2HDE A;  2IDY A;  1BML C;  1XLO A;  2WP9 B;  2BS4 B;  2W82 A;  2W3R A;  4OZA A;  1K51 A;  4LK0 M;  2LFI A;  3T3O A;  1WSP A;  4KGS A;  1L0V B;  1L6U A;  2PVG C;  2ZW1 A;  1K53 A;  1TJE A;  3AEC B;  3FAH A;  4WWM A;  4YSZ B;  1QOB A;  1SEB D;  3SR6 A;  4YSX B;  2WU5 B;  1QOG A;  3VQI A;  1FCL A;  3AEB B;  4XE0 A;  2PW9 A;  2IGG A;  3AE5 B;  5G5G A;  5BYS A;  4TQ1 A;  3BWU D;  1TS4 A;  1MHH E;  3AE1 B;  3IT4 B;  3UI3 A;  4C7Z A;  1T5X D;  1ZP0 B;  2LMC A;  1FMA D;  1JCK B;  1UGJ A;  2KQ4 X;  2J42 A;  3HRD D;  2WS3 B;  3AN1 A;  4WAF A;  2WXK A;  2KDM A;  1KF6 B;  2SAK A;  2MJ3 A;  1C78 A;  1KRH A;  1J7B A;  3DWM A;  3VRB B;  1MVK A;  1E10 A;  4DXF A;  5FK9 C;  5FKA C;  3U4E G;  2J52 A;  3P42 A;  3AED B;  3R2T A;  1XXG A;  1GT8 A;  2M56 B;  2IJ0 A;  3B9J A;  3ZQ4 A;  1SE2 A;  1JWB D;  2J4X A;  2CJN A;  4N59 A;  3BK1 A;  2BS3 B;  1JAL A;  1C77 A;  2BS2 B;  1DOI A;  1MPE A;  1VRA B;  1VZ6 A;  5MPO A;  1NEK B;  1D6E C;  3C8Y A;  4C56 C;  3AE6 B;  3Q8B A;  1V1O A;  4P6V F;  4IDI A;  1GB4 A;  1KFY B;  1PGA A;  1NI3 A;  5D3I B;  3P1M A;  1JWS D;  2N9L A;  2Z8L A;  2JSV X;  3Q8C A;  4N58 A;  2LUM A;  4C7Y A;  1NEN B;  2KN4 A;  3GB1 A;  3TUO A;  1WWT A;  1FD6 A;  3IAM 1;  3W2D A;  4MAC A;  5E6J A;  2WXO A;  1PGB A;  1TKE A;  3ZJV A;  1C4P A;  3AE4 B;  3ZGZ A;  5EE3 A;  3MJ5 A;  4AQ7 A;  1XCQ L;  4RGT A;  4KKJ A;  1P7E A;  4JWS C;  3SEB A;  1C79 A;  1VR9 A;  3WCQ A;  3NS1 A;  2IGH A;  2ON8 A;  2AQ2 B;  3HVZ A;  1I4X A;  3U2S C;  1FIQ A;  2WU2 B;  2JXT A;  1JWU D;  1N61 A;  3TEZ A;  1XO3 A;  2CJO A;  2WXH A;  4N6E B;  1I4Q A;  2CU3 A;  1FFV A;  1PYW D;  1MI0 A;  1TS3 A;  1FRR A;  1HZ6 A;  2SEB D;  3W5V B;  2AX5 A;  2QMT A;  2YEP F;  3BVZ A;  1D4B A;  3RPF C;  1GAQ B;  2GB1 A;  2JU6 X;  4L23 A;  3TSS A;  1YQ3 B;  1FXA A;  2X38 A;  3AEE B;  1KLU D;  2Y5C A;  1SE3 A;  1FNW A;  1JRO A;  2YEP B;  2HTM E;  1KTK A;  1UWX A;  2GRI A;  4RCO A;  4L1B A;  5H92 C;  3R8B A;  3AE9 B;  1L0X B;  4TMA B;  1SJH D;  2ACZ B;  1XLQ A;  2INN E;  4WH4 A;  3B2G A;  5G5H A;  1I4P A;  1OQR A;  2KWD A;  1SE4 A;  1FFU A;  1FXI A;  2K3U A;  4EE2 A;  2ZW0 A;  3B2F A;  2W55 A;  2QIL A;  1D5M C;  4OZB A;  1FEH A;  3AE3 B;  1N60 A;  5GXG B;  1Y56 A;  4YSY B;  2WDV B;  1EWY C;  1ROE A;  2RPV A;  1QQR A;  2KAC A;  3KWV A;  3MP9 A;  1J7A A;  1WRI A;  2XN9 C;  4UDU C;  1PFD A;  1E7P B;  4TSS A;  3CIR B;  2DBY A;  1AN8 A;  1F2R I;  3MC0 B;  1JRP A;  2PVO D;  4OW0 A;  2K5P A;  1V97 A;  2D5G A;  4OZC A;  4WIP A;  1QLB B;  1TZO A;  2IGD A;  1GPX A;  2QEJ C;  5AUI A;  2EKI A;  4ARI A;  1VDV A;  1GTH A;  2RMM A;  3ZYY X;  4RGN A;  4ZHP A;  1H7X A;  2J53 A;  2KMM A;  1N5X A;  2JZP A;  3MFG A;  1AW7 A;  2RDH A;  3U52 E;  1QT9 A;  2LEK A;  3EGR A;  4O1N A;  1DOY A;  4YXD B;  2L83 A;  3L4P A;  4HEA 1;  4H2A A;  3AMZ A;  1TKG A;  1L4D B;  1GTE A;  2WXQ A;  2OED A;  1D5Z C;  2E3T A;  2EEL A;  3GP7 A;  1C9F A;  2N0S B;  3DWG C;  2N9K A;  3BVG A;  3HUI A;  4MH8 A;  1FM0 D;  1PGX A;  4JX1 C;  3AEG B;  1J7C A;  3LYY A;  2V0G A;  1V1P A;  1IGD A;  4GLS C;  3VR8 B;  2AQ1 B;  1QKZ A;  2V3N A;  2XNA C;  3AEA B;  4NJC A;  2WXL A;  4XWT A;  1EU3 A;  4REZ A;  1FO4 A;  3Q8E A;  3PZ7 A;  4JE3 B;  2AQ3 B;  1UUP A;  2Q5W D;  5BYR A;  4B0E A;  1QIL A;  3NZ3 A;  1STE A;  1N63 A;  1MHX A;  4FXC A;  2G9H D;  2G1E A;  2M0A A;  2MJE A;  4JWU C;  1D5X C;  1UWM A;  2WDR B;  4AS1 A;  1PUT A;  2BB5 A;  5FR3 A;  2BT6 A;  1YJI A;  1VZ8 A;  1L6V A;  3KLS X;  3U7Z A;  3V3X A;  1NYQ A;  2WXN A;  3ETR A;  3NUH B;  4RFB A;  3BVM A;  1GB1 A;  2B76 B;  3PO0 A;  2DWQ A;  4YT0 B;  2GI9 A;  3NVZ A;  1C76 A;  4GDL B;  2V4I B;  4A8X C;  1KLG D;  1ZXH A;  3EA6 A;  1EWC A;  2K0P A;  1EU4 A;  1ZE3 D;  2OHF A;  5LNK 1;  3FC4 A;  3RFZ B;  4RGM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...