1YQ3B

Avian respiratory complex ii with oxaloacetate and ubiquinone
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
242
structure length
242
Chain Sequence
AATSRIKKFSIYRWDPDKPGDKPRMQTYEVDLNKCGPMVLDALIKIKNELDSTLTFRRSCREGICGSCAMNIAGGNTLACTKKIDPDLSKTTKIYPLPHMYVVKDLVPDLSNFYAQYKSIEPYLKKKDESKQGKEQYLQSIEDRQKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDYTEERLAQLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 3-Nitropropionic Acid Is a Suicide Inhibitor of Mitochondrial Respiration That, upon Oxidation by Complex II, Forms a Covalent Adduct with a Catalytic Base Arginine in the Active Site of the Enzyme
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Succinate dehydrogenase flavoprotein subunit
total genus 70
structure length 242
sequence length 242
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2005-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 1yq3B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1yq3B01
1H7WA 4ZHOA 2KAJA 3P4RB 1FIQA 3W5UB 1UWMA 3P1MA 3AE8B 4YTMB 1XO3A 1JWAD 1B9RA 3SFDB 5H8YE 1GPXA 3SFEB 1TJEA 2WLBA 3B9JA 3AMZA 2PKOA 1JALA 1FXAA 3HUIA 4YSYB 1EWYC 2M19A 2JX5A 1JW9D 3KWLA 1V97A 3NVVA 3DWGC 1FO4A 1TKGA 3AV8A 4YTPB 3P4QB 1NYRA 1QT9A 5G5HA 1N62A 3RPFC 1DGJA 2W55A 1E0ZA 2DWQA 4US9A 5EE3A 1JWBD 1QLBB 1N61A 1E9MA 3AEGB 4ZHPA 1OQRA 1H7XA 4YSXB 2H89B 1N5XA 2CJOA 2PVOD 5EE9A 1L0VB 1E10A 1JQ4A 3FC4A 4ZOHC 2G1EA 2W3SA 1FFVA 4JWSC 1WGKA 1N60A 2K9XA 2Q5WD 1YQ3B 1NEKB 1ZUD2 4FXCA 3LXFA 2BS4B 2QJLA 1DOXA 2AX5A 1NI3A 1RYJA 2Y5CA 4IDIA 5GXGB 1QF6A 3B2FA 2L52A 2BS3B 3VRBB 4WWMA 5MPOA 1E6EB 3AE9B 1J7BA 3ETRA 4P6VF 1I7HA 1A70A 2BS2B 1N5WA 1GTEA 2MH7A 1XLOA 4KX6B 1L6UA 2B76B 2W54A 4N59A 1TKYA 3ZYYX 3NS1A 4N6EB 5H92C 2CJNA 2CU3A 3WCQA 1JROA 3NRZA 1IUEA 4LTUA 1RFKA 3AEAB 1L6VA 2E3TA 2PIAA 4C7ZA 1KFYB 3AE3B 1FRRA 1L5PA 2N0SB 4C80A 1J7AA 3AB5A 3AN1A 4USAA 1CJEA 1FM0D 2QIEB 5C2TB 3EUB2 3ABVB 3VR8B 2KMMA 2WQYB 1ZOYB 4YXDB 1ZP0B 1OFFA 2K5PA 1GAQB 2M56B 3AH7A 5G5GA 4A9AA 4US8A 3CF4A 1FMAD 1SF0A 3VRAB 4C7YA 2ACZB 3CIRB 1WWTA 2H88B 1NENB 3P4SB 1ROEA 3CWIA 3NVWA 4HRSA 2MJDA 1V8CA 1T3QA 5C3JB 5EE1A 2MJEA 1GT8A 1DOYA 2DBYA 4JX1C 1VLBA 1JRPA 1F0ZA 5EE0A 1YQ4B 4YT0B 3AEEB 3AEDB 3W5VB 2WU5B 1SB3C 1NYQA 1RWSA 1CZPA 3AE4B 3AECB 3BIID 1AYFA 3NVZA 2LEKA 4HROA 2L83A 3W9CB 1RM6C 3B2GA 1PFDA 3AE2B 2WU2B 3P4PB 4ITKA 1FRDA 2PVGC 1NVID 2BT6A 2EKIA 1TYGB 2W3RA 2WDVB 3AE6B 3AEFB 2JQRB 1OQQA 3L4PA 1GTHA 1AWDA 4JWUC 3AM9A 1PUTA 1ZXIA 2FBWB 2WP9B 3LB8C 2MJ3A 1VJKA 1QOBA 1QOFA 5AUKA 4WQMA 3AE5B 2WDQB 3AE1B 3AEBB 1J7CA 1FXIA 1KRHA 1QOAA 1QOGA 1R7SA 1XLPA 2K22A 4YSZB 4YTNB 2WDRB 3DWMA 1KF6B 3HRDD 1TKEA 3HVZA 3NVYA 1DOIA 3VR9B 5AUIA 1N63A 3PO0A 1SIJA 1VDVA 1FFUA 1WRIA 1WXQA 1YJJA 3P63A 3AE7B 2OHFA 3SR6A 1YJIA 3FAHA 1E7PB 1XLQA 1WYGA 2WS3B 2HTME 1XLNA 4N58A 1PDXA
chains in the Genus database with same CATH superfamily
4CO7A 3N30A 1STEA 2NR2A 1UD7A 3JSVA 1TS2A 2INDC 3RNCC 4DXGA 4DDGD 4FADA 2JX5A 3ECIA 1GC7A 4GXBA 4BOSC 1C79A 2KN5A 2M0XA 1GB1A 1J19A 2FE8A 4GLSC 3T8MA 5IKCM 1E10A 1JQ4A 4ZOHC 1PGAA 3IBEA 2CR5A 4DXAB 3MFGA 1YQ3B 4EZLA 1PGBA 4CHKA 4KDLB 1MG4A 5BO4B 4HEA1 3NZUA 2R61A 1I7HA 3VDZA 2Z0DB 2W54A 1YJ1A 2MBHA 2WXHA 4M8NA 1TKYA 4ZRQA 2CJNA 2NBVB 5BMIA 2SEBD 5E6NA 3TUOA 1WXMA 2IYDB 3AEAB 1L5PA 4MM3A 2KOXA 1V5TA 2XBBC 3VRAB 1F1HA 2I38A 3NVWA 3R66C 1WX9A 3MP9A 2ZPYA 4GDKA 3NVZA 5JXVA 4P7IA 2KDIA 3ALBA 4FJVB 4XYCA 3PRPB 2HTHA 1ET9A 2KTRA 3Q8FA 1IBXB 1XEEA 4IC7B 2CHWA 2I1JA 1WSPA 4KGTA 1Q0WB 4KVGB 1ZDVA 1CMXB 2KQ4X 2KTRB 2PE6B 3EGRA 2KDMA 3L54A 3IT6B 2BPSA 1YN3A 4XDCA 2NCNA 1E9MA 3H9DA 2VZKB 3FC4A 1FXTB 4DDID 3GOEA 1N60A 2REXA 2GMIC 2E6XA 1QF6A 4OW0A 2L52A 3WAOA 1IGCA 5IO9A 1GTEA 3PREA 2LRWA 2WXGA 1JROA 2LRUA 3FILB 1R4MB 4C7ZA 2MHJA 2A5UA 1F77A 2N0SB 3U30A 1E8YA 1OEYJ 4GDLA 3RZWC 2KZRA 1ESFA 1XXGA 3C0RB 1KLVA 3TIXA 4FJYA 3AULA 3CIRB 2HD5B 3ZIMA 3ONSA 1E8WA 1H8CA 4LJPB 2LUMA 4NAMA 2RPQA 4WAAA 2CHXA 1YNTE 1FNVA 3APDA 2LXCA 3N1XC 4FHJA 1CZPA 1AYFA 1AARA 2DYOA 1YX5B 2G9HD 2WU2B 3GE8C 1WFYA 2FIFA 1TYGB 2A4ZA 2QC8A 4G11A 4DHZE 2BYFA 2WP9B 2WXKA 3DVNU 1E8XA 2LMCA 1QOFA 5CHFA 4IWOA 1C78A 4GGQA 3Q6BA 1TT5B 3NVYA 2MSED 3ML8A 3RULA 4XWTA 3PZ7A 2INNE 3U7ZA 4RM9A 2KX3A 1XLQA 2GBRA 3URYA 4I6NB 4LNOA 4X57B 3AE8B 2Y5BB 2LD9A 1HTOA 1PQSA 2FCQA 2GBNA 1EWYC 4TQ1A 4E74A 1OQYA 4LCDE 4CQNA 3P4QB 2KMAA 1QT9A 4AJYB 2RDGA 4IUMB 1I35A 4LNKA 1UGJA 2LJ5A 2BWFA 1D3ZA 1R4NB 2WXNA 1FFVA 2GBKA 1Q5WB 2DAFA 4PK1A 2L00B 5CHWA 4ICVA 4PS7A 4DHJB 2N9KA 1NI3A 4TUUA 3TCAA 2WHIA 4JL9A 2V1YA 4EOYA 2BS2B 2KD0A 4E3CA 1MFWA 1WJUA 4FA6A 2DZMA 4W9FA 4DK5A 2KC1A 3AB5A 4AUQC 3R2TA 4HK2A 2K25A 2K1FA 3JW0X 2JYTA 3L16A 4IW0A 4PT5A 3X0WA 1ROEA 1WRDB 2ZPNA 1YQBA 3ZJVA 4FULA 3AEEB 2LI5A 3Q8EA 4ANXA 3VH4B 4AP4C 4A20A 1VZ6A 4HROA 2ZW0A 1C3TA 1TS3A 5HHDG 3UINB 3JVZX 2EKIA 1EU3A 5I4DA 1MHXA 2C7HA 1F9JA 3RNGC 2K22A 1BT0A 3H7SA 5AUIA 2DZIA 3ML9A 3EFCA 3PZ8A 1V49A 1T0YA 3CF6E 4XE0A 2DZJA 4FJZA 4ZHOA 4GN1A 1B9RA 3PSEB 2DLBA 3NG0A 2WDTB 1Z2MA 1I4HA 1IGDA 1JW9D 2ON8A 3L08A 3ZXVA 2V4IB 4CYEA 5DPTA 1IBXA 2JPHA 2JXXA 2J53A 4ZYSA 1F52A 1N61A 5JZEB 2N1VA 1V86A 2MEKA 2YEPF 3LDZE 3BYTB 3ZNHB 2JT4B 4W9GA 1GNUA 4KIKB 1JWMD 4AQ7A 1T0SC 3PS6A 4KSKC 3PGEA 3QCAA 4EUTA 2QEJC 4C80A 2K8HA 3UF8A 5HG2A 4YXDB 2L05A 1YMHE 2I2YA 4A9AA 3Q3MC 3CF4A 4W9DA 2KXJA 2NPTB 3A1QA 2V9HA 4BKSD 1V8CA 2MJEA 4F8CB 4WJPA 3RCZA 4M0WB 3PHWB 1NDDA 3W9CB 3ZQ4A 4J3OD 3H6NA 2OJWA 1GTHA 4MGYE 2KWUB 4RM8A 1XCQL 3TL5A 1YD8U 4KDIC 1QKZA 1QQRA 4D2KA 1QOAA 2N7JA 1GUAB 3AU4A 2WX1A 1XQQA 2QSDA 3WIMA 1WXSA 4RFBA 2KTFA 2KAJA 1GPXA 1HA5A 1HE8A 2LVOA 1P98A 1FXAA 3RUIB 4YSYB 2AWTA 5GMVA 4K7SA 4HWIB 2G4DB 4L1BA 2R2QA 3DVNV 2C7NB 4II3B 1KJTA 2KDEB 4G50A 1SJED 3AEGB 2IY1B 1OQRA 4HPPA 1L0VB 4HXDA 3TEYA 2D10A 1ZDXA 1UZXB 2GRIA 3DDCB 5J18A 1C4CA 2FNJB 3VTUA 2K9XA 3PRZA 1V1PA 4N9F4 2QJLA 1WJ4A 1WYWB 3K9OB 2KT7A 3BVGA 4K7UA 1WF9A 2G3QB 5AZGA 2BB5A 2MH7A 3PRMB 2TSSA 4K3BA 2AQ2B 3K9PB 3T9LA 1KFYB 4L2YA 4KGSA 4NJ6A 4AWJA 5JH5C 2D07B 1UUPA 3PV1A 2J0MA 1WWTA 2KDBA 2N7EA 3P4SB 4IWPA 4H2AA 1E8ZA 5JHAA 2KX0A 1DOYA 1ZE3D 3NHEB 2IO2B 2GLSA 4KKJA 3W5VB 3ZDTA 4KZ0A 4R3DA 2J52A 3L17A 3EFUA 2EELA 3EA6A 3B2GA 2D2QA 3WAPA 2LGDA 4HCNB 1AWDA 2J0JA 1V2YA 4W9EA 4WJQA 1JWUD 2IBIB 4NPNA 4URKA 2LGSA 4LDTD 3V61A 2WDRB 1KF6B 3IAM1 1WI0A 2KWCA 1RRBA 1LO5D 1IP9A 1QILA 1AW7A 2DZKA 1TY2A 3IFWB 4ASWC 2KLGA 1JWAD 4M02A 3SFDB 3ZGZA 5AZFA 2X38A 4MEMA 2M1MA 3FILA 4HJGE 2MCNB 2GB1A 4NNJB 3RZFA 2LGYA 4W9CA 3IAS1 4MACA 2LGXA 1OEYA 3NUHB 1VZ8A 3A9KB 1J8CA 1FCCC 1WR6E 1ZUD2 3A9JB 4FXCA 4RF0A 2RPVA 2Y5CA 4EZKA 5D3DA 3VUXA 1E6EB 4PYZA 1N5WA 1L6UA 4LNFA 2C60A 1L6VA 3A9KA 2K0PA 3I5JC 1CJEA 2RR9A 1TZOA 5IP4D 5C1ZA 1MHHE 1GAQB 4LK0M 3UGBB 3UI3A 4DXFA 1C4PA 2N9PC 2WXFA 2DNFA 2BYEA 1FNUA 4DHJD 3DVGY 3AI5A 4KGRA 3N20C 1BXTA 2D3AA 2WDVB 1OTRB 3C8YA 1D4BA 5J2RA 1C76A 1D5MC 1Q10A 3RNAC 4FN2A 3BK1A 2KJ6A 4B9KA 1R7SA 3HRDD 4K7WA 4YSZB 4YTNB 1E5WA 1UNSA 5BMGA 1HEZE 1WXAA 1H4RA 1FIQA 3P1MA 4YTMB 5DPSA 1TJEA 2OEDA 2WLBA 2RDBC 3HUIA 3RD2A 2PE9A 3KWLA 4JIOU 4FLHA 1FO4A 3AV8A 2IGHA 4FBJB 2W55A 1YIWA 1E7VA 2PVOD 3KYCD 4B0MA 1WGKA 3H7PB 4B0EA 2MBQA 1T0QC 1SXTA 1K50A 2WXIA 2KNBA 2KFKA 3AE9B 4LLGM 1C77A 1ZW7A 2PLPA 1MPEA 1YN4A 4L23A 2JUOA 2NMQA 1SE2A 2DYBA 1KLUD 1FM0D 4FHKA 3OG5A 2KMMA 1NBFC 5HFYA 4ACFA 3AH7A 4GDLB 4P1BC 3HM3A 2ZCCA 4RNAA 5C23A 3ZNID 1VLBA 2NBUA 3HM6X 4HDQA 4MM3B 3AEDB 1I4QA 1EM7A 4WURA 3RT3B 1RWSA 3AECB 3TEWA 2GI9A 3W1SC 4EKUA 2KO3A 3O13A 1KM7A 1QOBA 5H8YE 1Q1OA 3DWMA 5FR3A 1AN8A 2JRHA 1V81A 1YJJA 3HHMA 1T6BX 5L95C 2WS3B 5KHQA 2K6QA 3VH3B 2W9NA 3HVDA 4RCOA 2J7QB 4F7ZA 4UDUC 1M4VA 4NY0A 3NVVA 4ZRIA 2ZNVC 4OHJA 4IG7B 4DWFA 2IGGA 1N62A 3RPFC 3OWEB 4JQWC 1QLBB 2DENB 3DPDA 1PGXA 2VRRB 3Q3FA 1N5XA 3VUYA 4BOZB 1D5XC 4JWSC 3M95A 2L8JA 1NI2A 4MJSA 3BINA 1P7EA 1RYJA 1P1AA 3HIZA 5MPOA 4A8XC 5D7GA 4LNNA 2DAJA 3DBLB 2HJ8A 1RAXA 2JXTA 4XGAB 1IPGA 3N9YC 3V05A 3AN1A 2C5LC 3NZSA 2J0KA 5BYSA 5HI1A 4HJKA 3U52E 1SF0A 3QARA 3PHXB 2JWZA 1CK1A 4HPLB 1K52A 4GOCA 5EE0A 3KUDB 4YT0B 1I4PA 1V9JA 2MWSB 3ZTCA 1EWCA 1GC6A 1JMLA 3L13A 5E6JA 2DX5B 1RM6C 2AQ1B 2V3SA 1PFDA 3AEFB 2K6DB 4JPSA 1RLFA 2NTTA 3MC9A 3AEBB 1FXIA 3DWGC 3TBLD 3EHVA 3HVZA 2V3NA 5FKAC 1VDVA 3P63A 3H7PA 3U8ZA 2L7RA 1R4MI 3OLMD 3ENEA 2ZNVB 1WXVA 4KSLC 2Y5PA 4WWOA 1TKGA 1P3QU 2ICIA 1NYRA 3VXWA 1UWXA 2WXRA 5G5HA 3A1QB 2N9LA 1GG3A 1SEBD 2QILA 5EE3A 2D3BA 2GBJA 1ISNA 2PTLA 3OJ4B 3R7QA 1LQBA 2MP2B 2H89B 3Q3JA 3MHSD 3PLUA 2KLCA 3QHTA 2Q5WD 3N1YC 1K8RB 2JZPA 2PPHA 2HJ1A 2NTSA 4II2B 1K51A 3IVFA 4WWMA 2K8CA 2IZVB 2CKHB 4WH4A 2RMMA 4M00A 5DPRA 3KUCB 5H92C 3T3OA 4PS3A 3AU5A 3ABVB 3VR8B 4EE2A 1OFFA 2K5PA 4GB9A 2YLMA 3BYYB 2XNAC 4TKNA 4HCPB 5CTRC 1XD3B 1M94A 5IA7A 1P0RA 3RNBC 2WU5B 1MI0A 3Q14C 1WX8A 3DBRI 2N7DA 3OAWA 1IYFA 4JGHB 4C4VA 1EUVB 3VVWB 2MRPA 1WGHA 1NVID 2KHWB 3L4PA 4IKGA 2LHEA 4HKQA 2Z0EB 1LGRA 4OZBA 1HQRD 4G3XB 2FUG1 1VZ7A 4M01A 5J17A 4WWNA 3RN9C 4OVUA 4TSSA 3J9CA 1YOVB 1L0YB 4KZCA 5BYRA 2N1WA 1FEHA 2XN9C 1YX6B 2KFJA 3EC8A 3V6CB 4KIKA 2O6VB 4DQOC 2JF5A 1ACCA 2PJHA 1ZGUB 4QAYA 3RNEC 1DYQA 3GZNB 3ZNGC 1OGWA 2UU7A 1X1MA 3MJWA 3N32A 1H7XA 2IO3B 3S2AA 5EE9A 3DBRB 3GS2A 3Q2AC 4AOFA 2VH2A 4A55A 3QWZB 5TSSA 3ZLZA 3RFZB 3RNFC 3U4EG 3LXFA 2WXJA 1WGGA 3JYUA 1V5OA 3QA8A 5D2MB 2BS3B 3V6EB 4E71A 4P6VF 1XLOA 4EFOA 1SGHA 4N6EB 1TTNA 1XCTL 3NOBA 1S1QB 4MGZE 2E3TA 4ZRPA 4USAA 2RGFA 4A3OA 3U7DA 3ZTDA 3DBSA 4XX5A 3KW5B 2WXPA 2L0FA 4JE3B 3UIOB 1F0ZA 2JSVX 3EECA 2KJHB 4TQ0A 2AL3A 3UIPB 3BIID 1G6JA 1L2NA 3VFKA 2RSUA 4C4VB 2WNMA 4TMAB 4RGTA 1P7FA 1VJKA 2CS4A 3OJ3A 4M0WA 4W9LA 1SE3A 4GU2A 3W2DA 4ZDVA 1SIJA 1WH3A 3HK0A 2KC2A 1L4DB 2C9WB 2ZVNA 1WYGA 2GBMA 4PS8A 3PZDA 3R3MA 1UWMA 3DBHB 2IDYA 4K81A 2KFKB 1WJNA 2N4FA 2D5GA 2INCC 2BQQA 2R2OA 1UH6A 3MC0B 3LJ3A 3H8HA 4W9KA 3MTNB 4MGKE 3R2IA 1UBIA 1N6ZA 3B0AA 2BWES 4LJOB 1DGJA 2DWQA 2HE7A 1Y8RC 2ZEQA 4ZHPA 4YSXB 2G1EA 2OOBB 3TEXA 1WZ0A 1U4AA 3WA0A 2BS4B 3GZNI 2KWDA 4MH8A 2L0TA 5GXGB 4GSWA 2LXAA 1TBEA 1J7BA 1KH0A 1A70A 4KX6B 3NS8A 3ZYYX 4MSMB 3WCQA 1C9FA 2NVUI 1VD2A 2BF8B 2PIAA 2PMVA 3PVLA 3AE3B 2IY0B 1C4AA 2KN4A 3Q69A 2Y3AA 3EUB2 5FK9C 2WQYB 3GE3C 1Z5SB 5L83A 3DBLI 5G5GA 1I4GA 4ANWA 1FMAD 2BYVE 4TV3A 1NENB 3W1YA 2FCNA 1EO6A 5BYQA 4AS1A 2PW9A 1F2RI 3DVGX 3E56A 3PPAA 5FR6A 2J4XA 3B1LX 1SJHD 2EMTA 2KJRA 3A4RA 3KVFB 2V0GA 2L1AA 3SEBA 2LWPA 2JWUA 4DBGA 5LXHA 1FRDA 2PVGC 2BT6A 4LNIA 2LJIA 1PUTA 3L0WB 4HKZE 2WDQB 2AL6A 3NZ3A 4IM2A 4IM0A 4MSQB 3I63C 2AEHA 4RF1A 4ANUA 3NY5A 1V1OA 1L0XB 3SHQA 1XO3A 3SFEB 4XZ4A 1WR1A 2NS5A 4XDDA 1WZ3A 4BBNC 4B6WA 1WGYA 2M19A 1TS5A 1RFAA 3Q3OC 4NAWA 4A90A 4YTPB 1R4NI 2MBEA 1E0ZA 2GOWA 2WXOA 1JWBD 3VTVA 2XK5B 2INPE 2CJOA 2KVZA 2NPTA 2Z8LA 4ZRJA 2PEAA 5AZHA 2BVCA 3R7RA 1NEKB 3QX1A 4WAFA 1DOXA 3ETRA 4O1NA 4BKGA 4C56C 4N59A 3NS1A 2CU3A 4BAXA 2M4NA 2M17A 4NAWB 1KLGD 1TZ1A 2QIEB 4KV2A 3RMKC 3TEZA 2L32A 1I4XA 1CQVA 2WGSA 4NQLB 3KWVA 4MH0E 2H88B 5D3IB 2IJ0A 3VAWA 1QZEA 3ZW3A 4K1RB 3R8BA 2IO0B 4JX1C 4HLEA 4IWQA 4S17A 1GB4A 3KYDD 4ARCA 4WQOB 4WJNA 3RYTA 5G2NA 2L83A 1TS4A 1EU4A 2IO1B 3QIJA 4ITKA 3QAQA 3ZO5B 4JWUC 3BVMA 3DOWA 2M0AA 3V3XA 4WQMA 3WAMA 3AE1B 1QOGA 2JYEA 1LFDA 4M8MA 4NJCA 4P16A 4ZRKA 2ONQA 1WMHB 3ZJUA 1N63A 2JY6A 4A6QA 3WANA 1FFUA 1WX7A 3SU8X 4XWWA 1JCKB 2WWZA 1YJIA 2IPKD 2YEPB 2KACA 4N58A 1FD6A 3QC8B 1SE4A 3VTWA 4MELA 4RGNA 1ENFA 2KVRA 4BBNF 2JZ3B 4K3CA 2FUHB 1BUIC 1V97A 1EF1A 1UF0A 3I3TB 3B08A 2N9EB 2OJRA 5E6OA 3N3KB 3E9SA 1KOTA 3CSFA 3VRBB 2I1KA 2BGFA 3ZRFA 3NRZA 1E7UA 3APFA 1LXDA 3W1SA 1FRRA 2FCSA 3T3NA 2QMTA 3M63B 5DCNA 4P1CC 1ZOYB 2M56B 4US8A 3ZXRA 4C7YA 5CHVC 4BKTA 1P9DU 2MLBA 4HRSA 2O2VA 4XC2A 1A5RA 3BK2A 2DHZA 4WWPA 1J0GA 2LEKA 2MBOA 3NJTA 3D32A 3IXSA 2V3PA 1TY0A 4GIVA 3P4PB 3AXCA 2MA9B 2MP2A 2QCZA 2KDFB 4YWGG 2UYZB 1WMHA 4HDOA 2MJ3A 2YVCA 2MBBB 2MQJA 2EMSA 3UQBA 3PO0A 1E90A 2N9XA 3AE7B 3SR6A 3A33B 2KMCA 1SBBB 2D11A 3ZUNA 1H7WA 4HPMB 3PLVA 3B9JA 4ZYNA 2PKOA 1UELA 4HVBA 3DHHC 4BZAA 4MGIE 4IOIE 2L3ZA 3PTFC 2BBCA 3KLSX 2KWVB 4JLCA 2EKEC 5DPWA 5BMHA 3DQVA 4US9A 2ZCBA 4BKSA 1D6EC 3U2SC 1XF5L 3DHGC 4ICUA 2C7MB 2W3SA 3ZDMC 3MC8A 2CU1A 2DYMA 4WIPA 1D5ZC 3IT4B 2W82A 5CX3A 3BY4B 3B2FA 2IGDA 5LNK1 2JVCA 2Z59B 3I9V1 1KTKA 1IUEA 3DHIC 1TIFA 4LTUA 4OZCA 2AYOB 2BKRB 2KQ7A 1L7YA 4MDKE 3LYYA 4NQKE 2LUEA 5LLIA 1ZP0B 4Q2JA 4RGMA 3VUWA 1C1YB 3QQ8B 2WYQA 1T3QA 3Q8AA 2XEWA 3L10B 1WM2A 1SIFA 3M3JA 2KKCA 1I4RA 2LVQA 4RMAA 2O2VB 1VR9A 1GOZA 2AQ3B 2G4SA 3MHZA 3O65B 2K8BA 1T0RC 2BB6A 1VRAB 2LGIA 2LZ6A 2ZVOA 3AE2B 3SDLC 3BVZA 4G0NB 3AM9A 3WALA 2FBWB 3QJZA 3X23A 3GB1A 4EZJA 1KRHA 1J7CA 1XLPA 1TKEA 1DOIA 3VR9B 1F2RC 3DBHI 1WY8A 2WXMA 2OHFA 1E7PB 3DCGA 2HTME 2LVPA 5T8IA 2RD0A 5EDSA 2KK8A 4REZA 3AMZA 1JALA 3BWUD 3SD5A 2K3UA 1V6EA 4W9IA 4W9JA 1S3SG 1ZXHA 1PYWD 1WE6A 2QHOA 4OVZA 1UGMA 3JSVB 3A9JA 4ARIA 4I6PA 1WJ6A 4B95A 4F1SA 1ZPSA 2LFIA 1GJZA 2FIDA 2KYWA 5IN7A 1WM3A 3PT2B 4W9HA 2D3CA 3CSTA 1HZ6A 1Y56A 3VHTC 4NJ7A 2JRIB 2FCMA 3IHPC 1MJDA 2NBWB 2RDHA 4IM3A 4AJWA 1RFKA 4EEWA 1HTQA 3TMPB 3M62B 2ASQA 2JZZA 1J7AA 3VQIA 4RGOS 2SAKA 3N1ZC 2K39A 2BTEA 1L4ZB 3IG3A 1VCBA 4KKIA 5E6PA 4BFRA 3CWIA 1V80A 5EE1A 3ZJTA 3KQ4A 1JRPA 1XT9B 3KUZA 3V60A 4S0RA 3Q3NC 1YQ4B 3APCA 2B3AA 2KQSA 1ZKHA 2LHDA 3AE4B 2X8XX 4GMVA 1HXYD 1B1ZA 1JRUA 5IAAC 3AE6B 2JQRB 1ET6A 3KH0A 5IOIA 2ZW1A 3LB8C 2BYTA 5HKHA 1K53A 2AX5A 3FKYA 5LXIB 4A3PA 1WXQA 4WJOA 3FAHA 4YL8A 2CHZA 1MVKA 2FAZA 1XLNA 1YN5A 3W5UB 3P4RB 2M8SA 2QDFA 4BVUC 5D94A 1FPYA 3A4SC 3P42A 2V4LA 2G45B 1SE9A 2KANA 3GP7A 4OVVA 3TSSA 1UBQA 1HZ5A 5TR5A 3H1UA 1V1PB 4PYUA 4OZAA 3TJPA 2D3GA 2WXLA 2J42A 2JU6X 3CMMB 2HDEA 3ZKJC 4IDIA 2BW2A 4C00A 2B76B 3RI7C 1MG8A 3QK0A 1JWSD 2MX2A 3V62A 1BMLC 1WIAA 4RH6A 4NZLB 5C2TB 1FNWA 1TGZB 4I6LB 3ZVVA 2UWQA 2VZKD 2MW5A 2XK5A 1SSNA 3Q8BA 1I42A 2ACZB 2MJDA 2VH1A 5C3JB 2LASA 2ZJDA 3BZDB 1GT8A 2DBYA 4GDKB 3MJ5A 3ZRCA 1SB3C 1NYQA 1WGDA 4J6IA 5AEKB 1FCLA 1LM8B 2O6VD 4LDTB 2WX0A 1WE7A 4MT5A 4DHZB 2BKFA 3P2BA 4ANVA 2W3RA 3C19A 1OQQA 3UQAA 1ZXIA 5D6JB 2L76A 5KHOA 3Q8CA 5AUKA 1WGRA 4MJSB 3AE5B 3I57A 3ZNZB 2ZZPB 1WRIA 1T5XD 2O6VA 2WXQA 5JHBA 1EF5A 5G55A 1PDXA
chains in the Genus database with same CATH topology
1SE4A 2KAJA 1STEA 1GPXA 1HA5A 1TS2A 4RGNA 1ENFA 4DXGA 1FXAA 4YSYB 2JX5A 2Y5PA 1BUIC 1V97A 1TKGA 2ICIA 1NYRA 1UWXA 4L1BA 2WXRA 5G5HA 2N9LA 1C79A 1SEBD 2QILA 5EE3A 1GB1A 1SJED 2FE8A 2PTLA 3AEGB 4GLSC 1OQRA 2H89B 1E10A 1JQ4A 1L0VB 4ZOHC 3TEYA 1ZDXA 1PGAA 2GRIA 1C4CA 3E9SA 3MFGA 2K9XA 2Q5WD 1YQ3B 1V1PA 1PGBA 2QJLA 2JZPA 3BVGA 2NTSA 4HEA1 3VRBB 1K51A 2R61A 4WWMA 1I7HA 2BB5A 2MH7A 2W54A 2WXHA 2RMMA 4WH4A 1TKYA 4ZRQA 5H92C 2CJNA 2TSSA 3NRZA 5BMIA 2AQ2B 2SEBD 3TUOA 3W1SA 3T3OA 3AEAB 1KFYB 1FRRA 1L5PA 3T3NA 4L2YA 2QMTA 4KGSA 3ABVB 3VR8B 4EE2A 1ZOYB 1OFFA 2K5PA 1UUPA 2M56B 3BYYB 4US8A 2XNAC 4C7YA 3VRAB 2I38A 1WWTA 4HRSA 3P4SB 3NVWA 4H2AA 1DOYA 1ZE3D 4KKJA 3W5VB 2WU5B 1MI0A 3MP9A 3BK2A 4R3DA 2J52A 3NVZA 5JXVA 2LEKA 2EELA 3IXSA 3EA6A 2V3PA 3B2GA 1TY0A 3P4PB 1NVID 2LHEA 3L4PA 1ET9A 4IKGA 4HKQA 1AWDA 4OZBA 1HQRD 4YWGG 3Q8FA 1IBXB 2FUG1 1VZ7A 1XEEA 2MJ3A 1JWUD 2WDRB 1KF6B 1WSPA 4KGTA 3IAM1 4TSSA 3J9CA 3PO0A 1L0YB 5BYRA 1FEHA 1ZDVA 3AE7B 2XN9C 1LO5D 3SR6A 1QILA 1SBBB 1AW7A 1H7WA 1TY2A 1JWAD 3SFDB 2KQ4X 3ZGZA 3B9JA 4DQOC 2PKOA 1ACCA 2X38A 4HJGE 3FILA 4IOIE 2GB1A 1DYQA 3EGRA 2KDMA 2BBCA 3KLSX 3IT6B 5BMHA 1YN3A 4XDCA 4US9A 3V3XA 1D6EC 3U2SC 3IAS1 1XF5L 1E9MA 4MACA 1H7XA 5EE9A 3NUHB 3GS2A 2VZKB 3FC4A 2W3SA 1VZ8A 4A55A 5TSSA 2DYMA 4WIPA 1D5ZC 1N60A 3RFZB 1FCCC 1ZUD2 3IT4B 3LXFA 4FXCA 2WXJA 2E6XA 2RPVA 2W82A 4RF0A 2Y5CA 3U4EG 1QF6A 4OW0A 3B2FA 5D3DA 2L52A 2BS3B 2IGDA 5LNK1 1E6EB 4P6VF 1IGCA 1N5WA 3I9V1 1GTEA 1XLOA 1L6UA 4N6EB 1KTKA 1XCTL 1JROA 2WXGA 1IUEA 3FILB 4LTUA 1L6VA 2E3TA 4C7ZA 4OZCA 1F77A 2N0SB 4ZRPA 2K0PA 4USAA 1CJEA 3LYYA 1TZOA 1ESFA 1MHHE 1XXGA 1ZP0B 1GAQB 4Q2JA 4RGMA 4LK0M 3CIRB 3UI3A 4DXFA 1T3QA 3Q8AA 2WXPA 1C4PA 4JE3B 2WXFA 2LUMA 1F0ZA 4NAMA 2JSVX 1FNUA 4TQ0A 1I4RA 1YNTE 1FNVA 1VR9A 1GOZA 1CZPA 2AQ3B 3BIID 1AYFA 3MHZA 2DYOA 4KGRA 2BB6A 1VRAB 2LGIA 3AE2B 2WU2B 1BXTA 2G9HD 1TYGB 2WDVB 3BVZA 3C8YA 1D4BA 3AM9A 2WNMA 1C76A 2FBWB 2WP9B 2WXKA 1D5MC 4TMAB 1Q10A 4RGTA 1P7FA 1VJKA 3BK1A 3GB1A 2LMCA 1QOFA 1KRHA 1C78A 1J7CA 1R7SA 3HRDD 4M0WA 1XLPA 3NVYA 4YSZB 4YTNB 1SE3A 1TKEA 1DOIA 3VR9B 1UNSA 4XWTA 3W2DA 3PZ7A 1F2RC 2INNE 5BMGA 1SIJA 1HEZE 2WXMA 3U7ZA 1L4DB 2OHFA 1E7PB 1XLQA 1WYGA 2HTME 5T8IA 3URYA 1FIQA 1UWMA 2IDYA 3P1MA 3AE8B 4YTMB 4REZA 1TJEA 2OEDA 2WLBA 3AMZA 2D5GA 1JALA 3HUIA 3BWUD 1EWYC 3MC0B 4TQ1A 2K3UA 3KWLA 3H8HA 1FO4A 3AV8A 4CQNA 3P4QB 2IGHA 3R2IA 1QT9A 2RDGA 1ZXHA 1PYWD 4OVZA 1DGJA 2W55A 2DWQA 4ZHPA 4YSXB 1UGJA 2PVOD 4ARIA 4B0MA 2G1EA 2WXNA 1FFVA 1ZPSA 3TEXA 1WGKA 2LFIA 4B0EA 1SXTA 2BS4B 1K50A 2WXIA 2N9KA 1NI3A 2KWDA 4MH8A 5GXGB 3AE9B 1J7BA 1KH0A 1A70A 2BS2B 4KX6B 3ZYYX 4LLGM 1HZ6A 1C77A 1Y56A 3WCQA 1C9FA 2RDHA 1RFKA 2PLPA 2PIAA 1MPEA 1YN4A 2PMVA 4L23A 3AE3B 2NMQA 1SE2A 1J7AA 3AB5A 3R2TA 1C4AA 3VQIA 1KLUD 2KN4A 1FM0D 3Q69A 4RGOS 2Y3AA 3EUB2 5FK9C 2SAKA 2KMMA 2WQYB 5HFYA 5G5GA 3AH7A 2BTEA 1I4GA 1FMAD 1L4ZB 2JYTA 4GDLB 4KKIA 4PT5A 1NENB 3CWIA 1ROEA 4RNAA 5BYQA 4AS1A 5EE1A 2PW9A 3ZJTA 3KQ4A 1F2RI 1VLBA 3ZJVA 1JRPA 3E56A 1YQ4B 3AEEB 2J4XA 4MM3B 3AEDB 1I4QA 1SJHD 3Q8EA 1EM7A 2LHDA 4WURA 1RWSA 2V0GA 3AE4B 3AECB 1VZ6A 3TEWA 2L1AA 4HROA 2ZW0A 3SEBA 1TS3A 1HXYD 1B1ZA 5HHDG 2JWUA 2GI9A 1FRDA 2PVGC 2BT6A 2EKIA 1EU3A 3AE6B 2JQRB 5I4DA 1MHXA 1ET6A 2LJIA 3O13A 1PUTA 2ZW1A 3LB8C 2BYTA 1QOBA 1K53A 4HKZE 5H8YE 2AX5A 2WDQB 3NZ3A 2K22A 3DWMA 5FR3A 1AN8A 5AUIA 1WXQA 1YJJA 4RF1A 3PZ8A 3FAHA 1T6BX 1MVKA 1V1OA 1L0XB 4XE0A 2WS3B 1XLNA 1YN5A 4ZHOA 3W5UB 3P4RB 3HVDA 4RCOA 1XO3A 1B9RA 2DLBA 3SFEB 3P42A 4XDDA 1I4HA 2M19A 1IGDA 1JW9D 1TS5A 2ON8A 1M4VA 4UDUC 3NVVA 4A90A 2V4IB 4OHJA 4YTPB 2IGGA 3GP7A 1IBXA 1N62A 2J53A 3RPFC 3OWEB 3TSSA 1E0ZA 4ZYSA 2WXOA 1JWBD 1QLBB 1N61A 1HZ5A 1PGXA 2INPE 1N5XA 2CJOA 2MEKA 1D5XC 1V1PB 2YEPF 2Z8LA 4JWSC 4OZAA 2WXLA 3BYTB 2J42A 2JU6X 1NEKB 4WAFA 1P7EA 2HDEA 1DOXA 1RYJA 4IDIA 2BW2A 5MPOA 3ETRA 1JWMD 4O1NA 4A8XC 5D7GA 4AQ7A 2B76B 4C56C 4N59A 3NS1A 2CU3A 2JXTA 1JWSD 2QEJC 4NAWB 4C80A 1BMLC 3N9YC 3V05A 1KLGD 3AN1A 4RH6A 2QIEB 4NZLB 5C2TB 1FNWA 5HG2A 3TEZA 2L32A 2VZKD 4YXDB 1I4XA 1YMHE 1CQVA 5BYSA 5HI1A 2I2YA 4A9AA 3CF4A 3KWVA 1SSNA 3Q8BA 3U52E 1SF0A 2ACZB 2H88B 5D3IB 2IJ0A 1CK1A 2MJDA 1V8CA 1K52A 5C3JB 2MJEA 3BZDB 3R8BA 1GT8A 2DBYA 4JX1C 4GDKB 5EE0A 3MJ5A 4YT0B 1GB4A 1I4PA 4ARCA 1SB3C 1NYQA 1FCLA 1EWCA 1JMLA 2L83A 1TS4A 1EU4A 5E6JA 4MT5A 3W9CB 3ZQ4A 1RM6C 2AQ1B 1PFDA 4ITKA 4J3OD 2W3RA 3AEFB 1OQQA 1GTHA 4JWUC 4JPSA 1XCQL 3BVMA 1ZXIA 1QKZA 1QQRA 2NTTA 3Q8CA 4D2KA 2M0AA 5AUKA 4WQMA 3AE5B 3AEBB 3AE1B 1FXIA 1QOAA 1QOGA 2JYEA 2N7JA 3DWGC 3I57A 4NJCA 3HVZA 4P16A 2ONQA 3ZJUA 1N63A 4A6QA 2V3NA 5FKAC 1VDVA 1FFUA 1WRIA 4XWWA 1T5XD 3P63A 2QSDA 1JCKB 1YJIA 2WXQA 2IPKD 2YEPB 4RFBA 2KACA 4N58A 1FD6A 1PDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H7W A;  4ZHO A;  2KAJ A;  3P4R B;  1FIQ A;  3W5U B;  1UWM A;  3P1M A;  3AE8 B;  4YTM B;  1XO3 A;  1JWA D;  1B9R A;  3SFD B;  5H8Y E;  1GPX A;  3SFE B;  1TJE A;  2WLB A;  3B9J A;  3AMZ A;  2PKO A;  1JAL A;  1FXA A;  3HUI A;  4YSY B;  1EWY C;  2M19 A;  2JX5 A;  1JW9 D;  3KWL A;  1V97 A;  3NVV A;  3DWG C;  1FO4 A;  1TKG A;  3AV8 A;  4YTP B;  3P4Q B;  1NYR A;  1QT9 A;  5G5H A;  1N62 A;  3RPF C;  1DGJ A;  2W55 A;  1E0Z A;  2DWQ A;  4US9 A;  5EE3 A;  1JWB D;  1QLB B;  1N61 A;  1E9M A;  3AEG B;  4ZHP A;  1OQR A;  1H7X A;  4YSX B;  2H89 B;  1N5X A;  2CJO A;  2PVO D;  5EE9 A;  1L0V B;  1E10 A;  1JQ4 A;  3FC4 A;  4ZOH C;  2G1E A;  2W3S A;  1FFV A;  4JWS C;  1WGK A;  1N60 A;  2K9X A;  2Q5W D;  1YQ3 B;  1NEK B;  1ZUD 2;  4FXC A;  3LXF A;  2BS4 B;  2QJL A;  1DOX A;  2AX5 A;  1NI3 A;  1RYJ A;  2Y5C A;  4IDI A;  5GXG B;  1QF6 A;  3B2F A;  2L52 A;  2BS3 B;  3VRB B;  4WWM A;  5MPO A;  1E6E B;  3AE9 B;  1J7B A;  3ETR A;  4P6V F;  1I7H A;  1A70 A;  2BS2 B;  1N5W A;  1GTE A;  2MH7 A;  1XLO A;  4KX6 B;  1L6U A;  2B76 B;  2W54 A;  4N59 A;  1TKY A;  3ZYY X;  3NS1 A;  4N6E B;  5H92 C;  2CJN A;  2CU3 A;  3WCQ A;  1JRO A;  3NRZ A;  1IUE A;  4LTU A;  1RFK A;  3AEA B;  1L6V A;  2E3T A;  2PIA A;  4C7Z A;  1KFY B;  3AE3 B;  1FRR A;  1L5P A;  2N0S B;  4C80 A;  1J7A A;  3AB5 A;  3AN1 A;  4USA A;  1CJE A;  1FM0 D;  2QIE B;  5C2T B;  3EUB 2;  3ABV B;  3VR8 B;  2KMM A;  2WQY B;  1ZOY B;  4YXD B;  1ZP0 B;  1OFF A;  2K5P A;  1GAQ B;  2M56 B;  3AH7 A;  5G5G A;  4A9A A;  4US8 A;  3CF4 A;  1FMA D;  1SF0 A;  3VRA B;  4C7Y A;  2ACZ B;  3CIR B;  1WWT A;  2H88 B;  1NEN B;  3P4S B;  1ROE A;  3CWI A;  3NVW A;  4HRS A;  2MJD A;  1V8C A;  1T3Q A;  5C3J B;  5EE1 A;  2MJE A;  1GT8 A;  1DOY A;  2DBY A;  4JX1 C;  1VLB A;  1JRP A;  1F0Z A;  5EE0 A;  1YQ4 B;  4YT0 B;  3AEE B;  3AED B;  3W5V B;  2WU5 B;  1SB3 C;  1NYQ A;  1RWS A;  1CZP A;  3AE4 B;  3AEC B;  3BII D;  1AYF A;  3NVZ A;  2LEK A;  4HRO A;  2L83 A;  3W9C B;  1RM6 C;  3B2G A;  1PFD A;  3AE2 B;  2WU2 B;  3P4P B;  4ITK A;  1FRD A;  2PVG C;  1NVI D;  2BT6 A;  2EKI A;  1TYG B;  2W3R A;  2WDV B;  3AE6 B;  3AEF B;  2JQR B;  1OQQ A;  3L4P A;  1GTH A;  1AWD A;  4JWU C;  3AM9 A;  1PUT A;  1ZXI A;  2FBW B;  2WP9 B;  3LB8 C;  2MJ3 A;  1VJK A;  1QOB A;  1QOF A;  5AUK A;  4WQM A;  3AE5 B;  2WDQ B;  3AE1 B;  3AEB B;  1J7C A;  1FXI A;  1KRH A;  1QOA A;  1QOG A;  1R7S A;  1XLP A;  2K22 A;  4YSZ B;  4YTN B;  2WDR B;  3DWM A;  1KF6 B;  3HRD D;  1TKE A;  3HVZ A;  3NVY A;  1DOI A;  3VR9 B;  5AUI A;  1N63 A;  3PO0 A;  1SIJ A;  1VDV A;  1FFU A;  1WRI A;  1WXQ A;  1YJJ A;  3P63 A;  3AE7 B;  2OHF A;  3SR6 A;  1YJI A;  3FAH A;  1E7P B;  1XLQ A;  1WYG A;  2WS3 B;  2HTM E;  1XLN A;  4N58 A;  1PDX A; 
#chains in the Genus database with same CATH topology
 4CO7 A;  3N30 A;  1STE A;  2NR2 A;  1UD7 A;  3JSV A;  1TS2 A;  2IND C;  3RNC C;  4DXG A;  4DDG D;  4FAD A;  2JX5 A;  3ECI A;  1GC7 A;  4GXB A;  4BOS C;  1C79 A;  2KN5 A;  2M0X A;  1GB1 A;  1J19 A;  2FE8 A;  4GLS C;  3T8M A;  5IKC M;  1E10 A;  1JQ4 A;  4ZOH C;  1PGA A;  3IBE A;  2CR5 A;  4DXA B;  3MFG A;  1YQ3 B;  4EZL A;  1PGB A;  4CHK A;  4KDL B;  1MG4 A;  5BO4 B;  4HEA 1;  3NZU A;  2R61 A;  1I7H A;  3VDZ A;  2Z0D B;  2W54 A;  1YJ1 A;  2MBH A;  2WXH A;  4M8N A;  1TKY A;  4ZRQ A;  2CJN A;  2NBV B;  5BMI A;  2SEB D;  5E6N A;  3TUO A;  1WXM A;  2IYD B;  3AEA B;  1L5P A;  4MM3 A;  2KOX A;  1V5T A;  2XBB C;  3VRA B;  1F1H A;  2I38 A;  3NVW A;  3R66 C;  1WX9 A;  3MP9 A;  2ZPY A;  4GDK A;  3NVZ A;  5JXV A;  4P7I A;  2KDI A;  3ALB A;  4FJV B;  4XYC A;  3PRP B;  2HTH A;  1ET9 A;  2KTR A;  3Q8F A;  1IBX B;  1XEE A;  4IC7 B;  2CHW A;  2I1J A;  1WSP A;  4KGT A;  1Q0W B;  4KVG B;  1ZDV A;  1CMX B;  2KQ4 X;  2KTR B;  2PE6 B;  3EGR A;  2KDM A;  3L54 A;  3IT6 B;  2BPS A;  1YN3 A;  4XDC A;  2NCN A;  1E9M A;  3H9D A;  2VZK B;  3FC4 A;  1FXT B;  4DDI D;  3GOE A;  1N60 A;  2REX A;  2GMI C;  2E6X A;  1QF6 A;  4OW0 A;  2L52 A;  3WAO A;  1IGC A;  5IO9 A;  1GTE A;  3PRE A;  2LRW A;  2WXG A;  1JRO A;  2LRU A;  3FIL B;  1R4M B;  4C7Z A;  2MHJ A;  2A5U A;  1F77 A;  2N0S B;  3U30 A;  1E8Y A;  1OEY J;  4GDL A;  3RZW C;  2KZR A;  1ESF A;  1XXG A;  3C0R B;  1KLV A;  3TIX A;  4FJY A;  3AUL A;  3CIR B;  2HD5 B;  3ZIM A;  3ONS A;  1E8W A;  1H8C A;  4LJP B;  2LUM A;  4NAM A;  2RPQ A;  4WAA A;  2CHX A;  1YNT E;  1FNV A;  3APD A;  2LXC A;  3N1X C;  4FHJ A;  1CZP A;  1AYF A;  1AAR A;  2DYO A;  1YX5 B;  2G9H D;  2WU2 B;  3GE8 C;  1WFY A;  2FIF A;  1TYG B;  2A4Z A;  2QC8 A;  4G11 A;  4DHZ E;  2BYF A;  2WP9 B;  2WXK A;  3DVN U;  1E8X A;  2LMC A;  1QOF A;  5CHF A;  4IWO A;  1C78 A;  4GGQ A;  3Q6B A;  1TT5 B;  3NVY A;  2MSE D;  3ML8 A;  3RUL A;  4XWT A;  3PZ7 A;  2INN E;  3U7Z A;  4RM9 A;  2KX3 A;  1XLQ A;  2GBR A;  3URY A;  4I6N B;  4LNO A;  4X57 B;  3AE8 B;  2Y5B B;  2LD9 A;  1HTO A;  1PQS A;  2FCQ A;  2GBN A;  1EWY C;  4TQ1 A;  4E74 A;  1OQY A;  4LCD E;  4CQN A;  3P4Q B;  2KMA A;  1QT9 A;  4AJY B;  2RDG A;  4IUM B;  1I35 A;  4LNK A;  1UGJ A;  2LJ5 A;  2BWF A;  1D3Z A;  1R4N B;  2WXN A;  1FFV A;  2GBK A;  1Q5W B;  2DAF A;  4PK1 A;  2L00 B;  5CHW A;  4ICV A;  4PS7 A;  4DHJ B;  2N9K A;  1NI3 A;  4TUU A;  3TCA A;  2WHI A;  4JL9 A;  2V1Y A;  4EOY A;  2BS2 B;  2KD0 A;  4E3C A;  1MFW A;  1WJU A;  4FA6 A;  2DZM A;  4W9F A;  4DK5 A;  2KC1 A;  3AB5 A;  4AUQ C;  3R2T A;  4HK2 A;  2K25 A;  2K1F A;  3JW0 X;  2JYT A;  3L16 A;  4IW0 A;  4PT5 A;  3X0W A;  1ROE A;  1WRD B;  2ZPN A;  1YQB A;  3ZJV A;  4FUL A;  3AEE B;  2LI5 A;  3Q8E A;  4ANX A;  3VH4 B;  4AP4 C;  4A20 A;  1VZ6 A;  4HRO A;  2ZW0 A;  1C3T A;  1TS3 A;  5HHD G;  3UIN B;  3JVZ X;  2EKI A;  1EU3 A;  5I4D A;  1MHX A;  2C7H A;  1F9J A;  3RNG C;  2K22 A;  1BT0 A;  3H7S A;  5AUI A;  2DZI A;  3ML9 A;  3EFC A;  3PZ8 A;  1V49 A;  1T0Y A;  3CF6 E;  4XE0 A;  2DZJ A;  4FJZ A;  4ZHO A;  4GN1 A;  1B9R A;  3PSE B;  2DLB A;  3NG0 A;  2WDT B;  1Z2M A;  1I4H A;  1IGD A;  1JW9 D;  2ON8 A;  3L08 A;  3ZXV A;  2V4I B;  4CYE A;  5DPT A;  1IBX A;  2JPH A;  2JXX A;  2J53 A;  4ZYS A;  1F52 A;  1N61 A;  5JZE B;  2N1V A;  1V86 A;  2MEK A;  2YEP F;  3LDZ E;  3BYT B;  3ZNH B;  2JT4 B;  4W9G A;  1GNU A;  4KIK B;  1JWM D;  4AQ7 A;  1T0S C;  3PS6 A;  4KSK C;  3PGE A;  3QCA A;  4EUT A;  2QEJ C;  4C80 A;  2K8H A;  3UF8 A;  5HG2 A;  4YXD B;  2L05 A;  1YMH E;  2I2Y A;  4A9A A;  3Q3M C;  3CF4 A;  4W9D A;  2KXJ A;  2NPT B;  3A1Q A;  2V9H A;  4BKS D;  1V8C A;  2MJE A;  4F8C B;  4WJP A;  3RCZ A;  4M0W B;  3PHW B;  1NDD A;  3W9C B;  3ZQ4 A;  4J3O D;  3H6N A;  2OJW A;  1GTH A;  4MGY E;  2KWU B;  4RM8 A;  1XCQ L;  3TL5 A;  1YD8 U;  4KDI C;  1QKZ A;  1QQR A;  4D2K A;  1QOA A;  2N7J A;  1GUA B;  3AU4 A;  2WX1 A;  1XQQ A;  2QSD A;  3WIM A;  1WXS A;  4RFB A;  2KTF A;  2KAJ A;  1GPX A;  1HA5 A;  1HE8 A;  2LVO A;  1P98 A;  1FXA A;  3RUI B;  4YSY B;  2AWT A;  5GMV A;  4K7S A;  4HWI B;  2G4D B;  4L1B A;  2R2Q A;  3DVN V;  2C7N B;  4II3 B;  1KJT A;  2KDE B;  4G50 A;  1SJE D;  3AEG B;  2IY1 B;  1OQR A;  4HPP A;  1L0V B;  4HXD A;  3TEY A;  2D10 A;  1ZDX A;  1UZX B;  2GRI A;  3DDC B;  5J18 A;  1C4C A;  2FNJ B;  3VTU A;  2K9X A;  3PRZ A;  1V1P A;  4N9F 4;  2QJL A;  1WJ4 A;  1WYW B;  3K9O B;  2KT7 A;  3BVG A;  4K7U A;  1WF9 A;  2G3Q B;  5AZG A;  2BB5 A;  2MH7 A;  3PRM B;  2TSS A;  4K3B A;  2AQ2 B;  3K9P B;  3T9L A;  1KFY B;  4L2Y A;  4KGS A;  4NJ6 A;  4AWJ A;  5JH5 C;  2D07 B;  1UUP A;  3PV1 A;  2J0M A;  1WWT A;  2KDB A;  2N7E A;  3P4S B;  4IWP A;  4H2A A;  1E8Z A;  5JHA A;  2KX0 A;  1DOY A;  1ZE3 D;  3NHE B;  2IO2 B;  2GLS A;  4KKJ A;  3W5V B;  3ZDT A;  4KZ0 A;  4R3D A;  2J52 A;  3L17 A;  3EFU A;  2EEL A;  3EA6 A;  3B2G A;  2D2Q A;  3WAP A;  2LGD A;  4HCN B;  1AWD A;  2J0J A;  1V2Y A;  4W9E A;  4WJQ A;  1JWU D;  2IBI B;  4NPN A;  4URK A;  2LGS A;  4LDT D;  3V61 A;  2WDR B;  1KF6 B;  3IAM 1;  1WI0 A;  2KWC A;  1RRB A;  1LO5 D;  1IP9 A;  1QIL A;  1AW7 A;  2DZK A;  1TY2 A;  3IFW B;  4ASW C;  2KLG A;  1JWA D;  4M02 A;  3SFD B;  3ZGZ A;  5AZF A;  2X38 A;  4MEM A;  2M1M A;  3FIL A;  4HJG E;  2MCN B;  2GB1 A;  4NNJ B;  3RZF A;  2LGY A;  4W9C A;  3IAS 1;  4MAC A;  2LGX A;  1OEY A;  3NUH B;  1VZ8 A;  3A9K B;  1J8C A;  1FCC C;  1WR6 E;  1ZUD 2;  3A9J B;  4FXC A;  4RF0 A;  2RPV A;  2Y5C A;  4EZK A;  5D3D A;  3VUX A;  1E6E B;  4PYZ A;  1N5W A;  1L6U A;  4LNF A;  2C60 A;  1L6V A;  3A9K A;  2K0P A;  3I5J C;  1CJE A;  2RR9 A;  1TZO A;  5IP4 D;  5C1Z A;  1MHH E;  1GAQ B;  4LK0 M;  3UGB B;  3UI3 A;  4DXF A;  1C4P A;  2N9P C;  2WXF A;  2DNF A;  2BYE A;  1FNU A;  4DHJ D;  3DVG Y;  3AI5 A;  4KGR A;  3N20 C;  1BXT A;  2D3A A;  2WDV B;  1OTR B;  3C8Y A;  1D4B A;  5J2R A;  1C76 A;  1D5M C;  1Q10 A;  3RNA C;  4FN2 A;  3BK1 A;  2KJ6 A;  4B9K A;  1R7S A;  3HRD D;  4K7W A;  4YSZ B;  4YTN B;  1E5W A;  1UNS A;  5BMG A;  1HEZ E;  1WXA A;  1H4R A;  1FIQ A;  3P1M A;  4YTM B;  5DPS A;  1TJE A;  2OED A;  2WLB A;  2RDB C;  3HUI A;  3RD2 A;  2PE9 A;  3KWL A;  4JIO U;  4FLH A;  1FO4 A;  3AV8 A;  2IGH A;  4FBJ B;  2W55 A;  1YIW A;  1E7V A;  2PVO D;  3KYC D;  4B0M A;  1WGK A;  3H7P B;  4B0E A;  2MBQ A;  1T0Q C;  1SXT A;  1K50 A;  2WXI A;  2KNB A;  2KFK A;  3AE9 B;  4LLG M;  1C77 A;  1ZW7 A;  2PLP A;  1MPE A;  1YN4 A;  4L23 A;  2JUO A;  2NMQ A;  1SE2 A;  2DYB A;  1KLU D;  1FM0 D;  4FHK A;  3OG5 A;  2KMM A;  1NBF C;  5HFY A;  4ACF A;  3AH7 A;  4GDL B;  4P1B C;  3HM3 A;  2ZCC A;  4RNA A;  5C23 A;  3ZNI D;  1VLB A;  2NBU A;  3HM6 X;  4HDQ A;  4MM3 B;  3AED B;  1I4Q A;  1EM7 A;  4WUR A;  3RT3 B;  1RWS A;  3AEC B;  3TEW A;  2GI9 A;  3W1S C;  4EKU A;  2KO3 A;  3O13 A;  1KM7 A;  1QOB A;  5H8Y E;  1Q1O A;  3DWM A;  5FR3 A;  1AN8 A;  2JRH A;  1V81 A;  1YJJ A;  3HHM A;  1T6B X;  5L95 C;  2WS3 B;  5KHQ A;  2K6Q A;  3VH3 B;  2W9N A;  3HVD A;  4RCO A;  2J7Q B;  4F7Z A;  4UDU C;  1M4V A;  4NY0 A;  3NVV A;  4ZRI A;  2ZNV C;  4OHJ A;  4IG7 B;  4DWF A;  2IGG A;  1N62 A;  3RPF C;  3OWE B;  4JQW C;  1QLB B;  2DEN B;  3DPD A;  1PGX A;  2VRR B;  3Q3F A;  1N5X A;  3VUY A;  4BOZ B;  1D5X C;  4JWS C;  3M95 A;  2L8J A;  1NI2 A;  4MJS A;  3BIN A;  1P7E A;  1RYJ A;  1P1A A;  3HIZ A;  5MPO A;  4A8X C;  5D7G A;  4LNN A;  2DAJ A;  3DBL B;  2HJ8 A;  1RAX A;  2JXT A;  4XGA B;  1IPG A;  3N9Y C;  3V05 A;  3AN1 A;  2C5L C;  3NZS A;  2J0K A;  5BYS A;  5HI1 A;  4HJK A;  3U52 E;  1SF0 A;  3QAR A;  3PHX B;  2JWZ A;  1CK1 A;  4HPL B;  1K52 A;  4GOC A;  5EE0 A;  3KUD B;  4YT0 B;  1I4P A;  1V9J A;  2MWS B;  3ZTC A;  1EWC A;  1GC6 A;  1JML A;  3L13 A;  5E6J A;  2DX5 B;  1RM6 C;  2AQ1 B;  2V3S A;  1PFD A;  3AEF B;  2K6D B;  4JPS A;  1RLF A;  2NTT A;  3MC9 A;  3AEB B;  1FXI A;  3DWG C;  3TBL D;  3EHV A;  3HVZ A;  2V3N A;  5FKA C;  1VDV A;  3P63 A;  3H7P A;  3U8Z A;  2L7R A;  1R4M I;  3OLM D;  3ENE A;  2ZNV B;  1WXV A;  4KSL C;  2Y5P A;  4WWO A;  1TKG A;  1P3Q U;  2ICI A;  1NYR A;  3VXW A;  1UWX A;  2WXR A;  5G5H A;  3A1Q B;  2N9L A;  1GG3 A;  1SEB D;  2QIL A;  5EE3 A;  2D3B A;  2GBJ A;  1ISN A;  2PTL A;  3OJ4 B;  3R7Q A;  1LQB A;  2MP2 B;  2H89 B;  3Q3J A;  3MHS D;  3PLU A;  2KLC A;  3QHT A;  2Q5W D;  3N1Y C;  1K8R B;  2JZP A;  2PPH A;  2HJ1 A;  2NTS A;  4II2 B;  1K51 A;  3IVF A;  4WWM A;  2K8C A;  2IZV B;  2CKH B;  4WH4 A;  2RMM A;  4M00 A;  5DPR A;  3KUC B;  5H92 C;  3T3O A;  4PS3 A;  3AU5 A;  3ABV B;  3VR8 B;  4EE2 A;  1OFF A;  2K5P A;  4GB9 A;  2YLM A;  3BYY B;  2XNA C;  4TKN A;  4HCP B;  5CTR C;  1XD3 B;  1M94 A;  5IA7 A;  1P0R A;  3RNB C;  2WU5 B;  1MI0 A;  3Q14 C;  1WX8 A;  3DBR I;  2N7D A;  3OAW A;  1IYF A;  4JGH B;  4C4V A;  1EUV B;  3VVW B;  2MRP A;  1WGH A;  1NVI D;  2KHW B;  3L4P A;  4IKG A;  2LHE A;  4HKQ A;  2Z0E B;  1LGR A;  4OZB A;  1HQR D;  4G3X B;  2FUG 1;  1VZ7 A;  4M01 A;  5J17 A;  4WWN A;  3RN9 C;  4OVU A;  4TSS A;  3J9C A;  1YOV B;  1L0Y B;  4KZC A;  5BYR A;  2N1W A;  1FEH A;  2XN9 C;  1YX6 B;  2KFJ A;  3EC8 A;  3V6C B;  4KIK A;  2O6V B;  4DQO C;  2JF5 A;  1ACC A;  2PJH A;  1ZGU B;  4QAY A;  3RNE C;  1DYQ A;  3GZN B;  3ZNG C;  1OGW A;  2UU7 A;  1X1M A;  3MJW A;  3N32 A;  1H7X A;  2IO3 B;  3S2A A;  5EE9 A;  3DBR B;  3GS2 A;  3Q2A C;  4AOF A;  2VH2 A;  4A55 A;  3QWZ B;  5TSS A;  3ZLZ A;  3RFZ B;  3RNF C;  3U4E G;  3LXF A;  2WXJ A;  1WGG A;  3JYU A;  1V5O A;  3QA8 A;  5D2M B;  2BS3 B;  3V6E B;  4E71 A;  4P6V F;  1XLO A;  4EFO A;  1SGH A;  4N6E B;  1TTN A;  1XCT L;  3NOB A;  1S1Q B;  4MGZ E;  2E3T A;  4ZRP A;  4USA A;  2RGF A;  4A3O A;  3U7D A;  3ZTD A;  3DBS A;  4XX5 A;  3KW5 B;  2WXP A;  2L0F A;  4JE3 B;  3UIO B;  1F0Z A;  2JSV X;  3EEC A;  2KJH B;  4TQ0 A;  2AL3 A;  3UIP B;  3BII D;  1G6J A;  1L2N A;  3VFK A;  2RSU A;  4C4V B;  2WNM A;  4TMA B;  4RGT A;  1P7F A;  1VJK A;  2CS4 A;  3OJ3 A;  4M0W A;  4W9L A;  1SE3 A;  4GU2 A;  3W2D A;  4ZDV A;  1SIJ A;  1WH3 A;  3HK0 A;  2KC2 A;  1L4D B;  2C9W B;  2ZVN A;  1WYG A;  2GBM A;  4PS8 A;  3PZD A;  3R3M A;  1UWM A;  3DBH B;  2IDY A;  4K81 A;  2KFK B;  1WJN A;  2N4F A;  2D5G A;  2INC C;  2BQQ A;  2R2O A;  1UH6 A;  3MC0 B;  3LJ3 A;  3H8H A;  4W9K A;  3MTN B;  4MGK E;  3R2I A;  1UBI A;  1N6Z A;  3B0A A;  2BWE S;  4LJO B;  1DGJ A;  2DWQ A;  2HE7 A;  1Y8R C;  2ZEQ A;  4ZHP A;  4YSX B;  2G1E A;  2OOB B;  3TEX A;  1WZ0 A;  1U4A A;  3WA0 A;  2BS4 B;  3GZN I;  2KWD A;  4MH8 A;  2L0T A;  5GXG B;  4GSW A;  2LXA A;  1TBE A;  1J7B A;  1KH0 A;  1A70 A;  4KX6 B;  3NS8 A;  3ZYY X;  4MSM B;  3WCQ A;  1C9F A;  2NVU I;  1VD2 A;  2BF8 B;  2PIA A;  2PMV A;  3PVL A;  3AE3 B;  2IY0 B;  1C4A A;  2KN4 A;  3Q69 A;  2Y3A A;  3EUB 2;  5FK9 C;  2WQY B;  3GE3 C;  1Z5S B;  5L83 A;  3DBL I;  5G5G A;  1I4G A;  4ANW A;  1FMA D;  2BYV E;  4TV3 A;  1NEN B;  3W1Y A;  2FCN A;  1EO6 A;  5BYQ A;  4AS1 A;  2PW9 A;  1F2R I;  3DVG X;  3E56 A;  3PPA A;  5FR6 A;  2J4X A;  3B1L X;  1SJH D;  2EMT A;  2KJR A;  3A4R A;  3KVF B;  2V0G A;  2L1A A;  3SEB A;  2LWP A;  2JWU A;  4DBG A;  5LXH A;  1FRD A;  2PVG C;  2BT6 A;  4LNI A;  2LJI A;  1PUT A;  3L0W B;  4HKZ E;  2WDQ B;  2AL6 A;  3NZ3 A;  4IM2 A;  4IM0 A;  4MSQ B;  3I63 C;  2AEH A;  4RF1 A;  4ANU A;  3NY5 A;  1V1O A;  1L0X B;  3SHQ A;  1XO3 A;  3SFE B;  4XZ4 A;  1WR1 A;  2NS5 A;  4XDD A;  1WZ3 A;  4BBN C;  4B6W A;  1WGY A;  2M19 A;  1TS5 A;  1RFA A;  3Q3O C;  4NAW A;  4A90 A;  4YTP B;  1R4N I;  2MBE A;  1E0Z A;  2GOW A;  2WXO A;  1JWB D;  3VTV A;  2XK5 B;  2INP E;  2CJO A;  2KVZ A;  2NPT A;  2Z8L A;  4ZRJ A;  2PEA A;  5AZH A;  2BVC A;  3R7R A;  1NEK B;  3QX1 A;  4WAF A;  1DOX A;  3ETR A;  4O1N A;  4BKG A;  4C56 C;  4N59 A;  3NS1 A;  2CU3 A;  4BAX A;  2M4N A;  2M17 A;  4NAW B;  1KLG D;  1TZ1 A;  2QIE B;  4KV2 A;  3RMK C;  3TEZ A;  2L32 A;  1I4X A;  1CQV A;  2WGS A;  4NQL B;  3KWV A;  4MH0 E;  2H88 B;  5D3I B;  2IJ0 A;  3VAW A;  1QZE A;  3ZW3 A;  4K1R B;  3R8B A;  2IO0 B;  4JX1 C;  4HLE A;  4IWQ A;  4S17 A;  1GB4 A;  3KYD D;  4ARC A;  4WQO B;  4WJN A;  3RYT A;  5G2N A;  2L83 A;  1TS4 A;  1EU4 A;  2IO1 B;  3QIJ A;  4ITK A;  3QAQ A;  3ZO5 B;  4JWU C;  3BVM A;  3DOW A;  2M0A A;  3V3X A;  4WQM A;  3WAM A;  3AE1 B;  1QOG A;  2JYE A;  1LFD A;  4M8M A;  4NJC A;  4P16 A;  4ZRK A;  2ONQ A;  1WMH B;  3ZJU A;  1N63 A;  2JY6 A;  4A6Q A;  3WAN A;  1FFU A;  1WX7 A;  3SU8 X;  4XWW A;  1JCK B;  2WWZ A;  1YJI A;  2IPK D;  2YEP B;  2KAC A;  4N58 A;  1FD6 A;  3QC8 B;  1SE4 A;  3VTW A;  4MEL A;  4RGN A;  1ENF A;  2KVR A;  4BBN F;  2JZ3 B;  4K3C A;  2FUH B;  1BUI C;  1V97 A;  1EF1 A;  1UF0 A;  3I3T B;  3B08 A;  2N9E B;  2OJR A;  5E6O A;  3N3K B;  3E9S A;  1KOT A;  3CSF A;  3VRB B;  2I1K A;  2BGF A;  3ZRF A;  3NRZ A;  1E7U A;  3APF A;  1LXD A;  3W1S A;  1FRR A;  2FCS A;  3T3N A;  2QMT A;  3M63 B;  5DCN A;  4P1C C;  1ZOY B;  2M56 B;  4US8 A;  3ZXR A;  4C7Y A;  5CHV C;  4BKT A;  1P9D U;  2MLB A;  4HRS A;  2O2V A;  4XC2 A;  1A5R A;  3BK2 A;  2DHZ A;  4WWP A;  1J0G A;  2LEK A;  2MBO A;  3NJT A;  3D32 A;  3IXS A;  2V3P A;  1TY0 A;  4GIV A;  3P4P B;  3AXC A;  2MA9 B;  2MP2 A;  2QCZ A;  2KDF B;  4YWG G;  2UYZ B;  1WMH A;  4HDO A;  2MJ3 A;  2YVC A;  2MBB B;  2MQJ A;  2EMS A;  3UQB A;  3PO0 A;  1E90 A;  2N9X A;  3AE7 B;  3SR6 A;  3A33 B;  2KMC A;  1SBB B;  2D11 A;  3ZUN A;  1H7W A;  4HPM B;  3PLV A;  3B9J A;  4ZYN A;  2PKO A;  1UEL A;  4HVB A;  3DHH C;  4BZA A;  4MGI E;  4IOI E;  2L3Z A;  3PTF C;  2BBC A;  3KLS X;  2KWV B;  4JLC A;  2EKE C;  5DPW A;  5BMH A;  3DQV A;  4US9 A;  2ZCB A;  4BKS A;  1D6E C;  3U2S C;  1XF5 L;  3DHG C;  4ICU A;  2C7M B;  2W3S A;  3ZDM C;  3MC8 A;  2CU1 A;  2DYM A;  4WIP A;  1D5Z C;  3IT4 B;  2W82 A;  5CX3 A;  3BY4 B;  3B2F A;  2IGD A;  5LNK 1;  2JVC A;  2Z59 B;  3I9V 1;  1KTK A;  1IUE A;  3DHI C;  1TIF A;  4LTU A;  4OZC A;  2AYO B;  2BKR B;  2KQ7 A;  1L7Y A;  4MDK E;  3LYY A;  4NQK E;  2LUE A;  5LLI A;  1ZP0 B;  4Q2J A;  4RGM A;  3VUW A;  1C1Y B;  3QQ8 B;  2WYQ A;  1T3Q A;  3Q8A A;  2XEW A;  3L10 B;  1WM2 A;  1SIF A;  3M3J A;  2KKC A;  1I4R A;  2LVQ A;  4RMA A;  2O2V B;  1VR9 A;  1GOZ A;  2AQ3 B;  2G4S A;  3MHZ A;  3O65 B;  2K8B A;  1T0R C;  2BB6 A;  1VRA B;  2LGI A;  2LZ6 A;  2ZVO A;  3AE2 B;  3SDL C;  3BVZ A;  4G0N B;  3AM9 A;  3WAL A;  2FBW B;  3QJZ A;  3X23 A;  3GB1 A;  4EZJ A;  1KRH A;  1J7C A;  1XLP A;  1TKE A;  1DOI A;  3VR9 B;  1F2R C;  3DBH I;  1WY8 A;  2WXM A;  2OHF A;  1E7P B;  3DCG A;  2HTM E;  2LVP A;  5T8I A;  2RD0 A;  5EDS A;  2KK8 A;  4REZ A;  3AMZ A;  1JAL A;  3BWU D;  3SD5 A;  2K3U A;  1V6E A;  4W9I A;  4W9J A;  1S3S G;  1ZXH A;  1PYW D;  1WE6 A;  2QHO A;  4OVZ A;  1UGM A;  3JSV B;  3A9J A;  4ARI A;  4I6P A;  1WJ6 A;  4B95 A;  4F1S A;  1ZPS A;  2LFI A;  1GJZ A;  2FID A;  2KYW A;  5IN7 A;  1WM3 A;  3PT2 B;  4W9H A;  2D3C A;  3CST A;  1HZ6 A;  1Y56 A;  3VHT C;  4NJ7 A;  2JRI B;  2FCM A;  3IHP C;  1MJD A;  2NBW B;  2RDH A;  4IM3 A;  4AJW A;  1RFK A;  4EEW A;  1HTQ A;  3TMP B;  3M62 B;  2ASQ A;  2JZZ A;  1J7A A;  3VQI A;  4RGO S;  2SAK A;  3N1Z C;  2K39 A;  2BTE A;  1L4Z B;  3IG3 A;  1VCB A;  4KKI A;  5E6P A;  4BFR A;  3CWI A;  1V80 A;  5EE1 A;  3ZJT A;  3KQ4 A;  1JRP A;  1XT9 B;  3KUZ A;  3V60 A;  4S0R A;  3Q3N C;  1YQ4 B;  3APC A;  2B3A A;  2KQS A;  1ZKH A;  2LHD A;  3AE4 B;  2X8X X;  4GMV A;  1HXY D;  1B1Z A;  1JRU A;  5IAA C;  3AE6 B;  2JQR B;  1ET6 A;  3KH0 A;  5IOI A;  2ZW1 A;  3LB8 C;  2BYT A;  5HKH A;  1K53 A;  2AX5 A;  3FKY A;  5LXI B;  4A3P A;  1WXQ A;  4WJO A;  3FAH A;  4YL8 A;  2CHZ A;  1MVK A;  2FAZ A;  1XLN A;  1YN5 A;  3W5U B;  3P4R B;  2M8S A;  2QDF A;  4BVU C;  5D94 A;  1FPY A;  3A4S C;  3P42 A;  2V4L A;  2G45 B;  1SE9 A;  2KAN A;  3GP7 A;  4OVV A;  3TSS A;  1UBQ A;  1HZ5 A;  5TR5 A;  3H1U A;  1V1P B;  4PYU A;  4OZA A;  3TJP A;  2D3G A;  2WXL A;  2J42 A;  2JU6 X;  3CMM B;  2HDE A;  3ZKJ C;  4IDI A;  2BW2 A;  4C00 A;  2B76 B;  3RI7 C;  1MG8 A;  3QK0 A;  1JWS D;  2MX2 A;  3V62 A;  1BML C;  1WIA A;  4RH6 A;  4NZL B;  5C2T B;  1FNW A;  1TGZ B;  4I6L B;  3ZVV A;  2UWQ A;  2VZK D;  2MW5 A;  2XK5 A;  1SSN A;  3Q8B A;  1I42 A;  2ACZ B;  2MJD A;  2VH1 A;  5C3J B;  2LAS A;  2ZJD A;  3BZD B;  1GT8 A;  2DBY A;  4GDK B;  3MJ5 A;  3ZRC A;  1SB3 C;  1NYQ A;  1WGD A;  4J6I A;  5AEK B;  1FCL A;  1LM8 B;  2O6V D;  4LDT B;  2WX0 A;  1WE7 A;  4MT5 A;  4DHZ B;  2BKF A;  3P2B A;  4ANV A;  2W3R A;  3C19 A;  1OQQ A;  3UQA A;  1ZXI A;  5D6J B;  2L76 A;  5KHO A;  3Q8C A;  5AUK A;  1WGR A;  4MJS B;  3AE5 B;  3I57 A;  3ZNZ B;  2ZZP B;  1WRI A;  1T5X D;  2O6V A;  2WXQ A;  5JHB A;  1EF5 A;  5G55 A;  1PDX A; 
#chains in the Genus database with same CATH homology
 1SE4 A;  2KAJ A;  1STE A;  1GPX A;  1HA5 A;  1TS2 A;  4RGN A;  1ENF A;  4DXG A;  1FXA A;  4YSY B;  2JX5 A;  2Y5P A;  1BUI C;  1V97 A;  1TKG A;  2ICI A;  1NYR A;  1UWX A;  4L1B A;  2WXR A;  5G5H A;  2N9L A;  1C79 A;  1SEB D;  2QIL A;  5EE3 A;  1GB1 A;  1SJE D;  2FE8 A;  2PTL A;  3AEG B;  4GLS C;  1OQR A;  2H89 B;  1E10 A;  1JQ4 A;  1L0V B;  4ZOH C;  3TEY A;  1ZDX A;  1PGA A;  2GRI A;  1C4C A;  3E9S A;  3MFG A;  2K9X A;  2Q5W D;  1YQ3 B;  1V1P A;  1PGB A;  2QJL A;  2JZP A;  3BVG A;  2NTS A;  4HEA 1;  3VRB B;  1K51 A;  2R61 A;  4WWM A;  1I7H A;  2BB5 A;  2MH7 A;  2W54 A;  2WXH A;  2RMM A;  4WH4 A;  1TKY A;  4ZRQ A;  5H92 C;  2CJN A;  2TSS A;  3NRZ A;  5BMI A;  2AQ2 B;  2SEB D;  3TUO A;  3W1S A;  3T3O A;  3AEA B;  1KFY B;  1FRR A;  1L5P A;  3T3N A;  4L2Y A;  2QMT A;  4KGS A;  3ABV B;  3VR8 B;  4EE2 A;  1ZOY B;  1OFF A;  2K5P A;  1UUP A;  2M56 B;  3BYY B;  4US8 A;  2XNA C;  4C7Y A;  3VRA B;  2I38 A;  1WWT A;  4HRS A;  3P4S B;  3NVW A;  4H2A A;  1DOY A;  1ZE3 D;  4KKJ A;  3W5V B;  2WU5 B;  1MI0 A;  3MP9 A;  3BK2 A;  4R3D A;  2J52 A;  3NVZ A;  5JXV A;  2LEK A;  2EEL A;  3IXS A;  3EA6 A;  2V3P A;  3B2G A;  1TY0 A;  3P4P B;  1NVI D;  2LHE A;  3L4P A;  1ET9 A;  4IKG A;  4HKQ A;  1AWD A;  4OZB A;  1HQR D;  4YWG G;  3Q8F A;  1IBX B;  2FUG 1;  1VZ7 A;  1XEE A;  2MJ3 A;  1JWU D;  2WDR B;  1KF6 B;  1WSP A;  4KGT A;  3IAM 1;  4TSS A;  3J9C A;  3PO0 A;  1L0Y B;  5BYR A;  1FEH A;  1ZDV A;  3AE7 B;  2XN9 C;  1LO5 D;  3SR6 A;  1QIL A;  1SBB B;  1AW7 A;  1H7W A;  1TY2 A;  1JWA D;  3SFD B;  2KQ4 X;  3ZGZ A;  3B9J A;  4DQO C;  2PKO A;  1ACC A;  2X38 A;  4HJG E;  3FIL A;  4IOI E;  2GB1 A;  1DYQ A;  3EGR A;  2KDM A;  2BBC A;  3KLS X;  3IT6 B;  5BMH A;  1YN3 A;  4XDC A;  4US9 A;  3V3X A;  1D6E C;  3U2S C;  3IAS 1;  1XF5 L;  1E9M A;  4MAC A;  1H7X A;  5EE9 A;  3NUH B;  3GS2 A;  2VZK B;  3FC4 A;  2W3S A;  1VZ8 A;  4A55 A;  5TSS A;  2DYM A;  4WIP A;  1D5Z C;  1N60 A;  3RFZ B;  1FCC C;  1ZUD 2;  3IT4 B;  3LXF A;  4FXC A;  2WXJ A;  2E6X A;  2RPV A;  2W82 A;  4RF0 A;  2Y5C A;  3U4E G;  1QF6 A;  4OW0 A;  3B2F A;  5D3D A;  2L52 A;  2BS3 B;  2IGD A;  5LNK 1;  1E6E B;  4P6V F;  1IGC A;  1N5W A;  3I9V 1;  1GTE A;  1XLO A;  1L6U A;  4N6E B;  1KTK A;  1XCT L;  1JRO A;  2WXG A;  1IUE A;  3FIL B;  4LTU A;  1L6V A;  2E3T A;  4C7Z A;  4OZC A;  1F77 A;  2N0S B;  4ZRP A;  2K0P A;  4USA A;  1CJE A;  3LYY A;  1TZO A;  1ESF A;  1MHH E;  1XXG A;  1ZP0 B;  1GAQ B;  4Q2J A;  4RGM A;  4LK0 M;  3CIR B;  3UI3 A;  4DXF A;  1T3Q A;  3Q8A A;  2WXP A;  1C4P A;  4JE3 B;  2WXF A;  2LUM A;  1F0Z A;  4NAM A;  2JSV X;  1FNU A;  4TQ0 A;  1I4R A;  1YNT E;  1FNV A;  1VR9 A;  1GOZ A;  1CZP A;  2AQ3 B;  3BII D;  1AYF A;  3MHZ A;  2DYO A;  4KGR A;  2BB6 A;  1VRA B;  2LGI A;  3AE2 B;  2WU2 B;  1BXT A;  2G9H D;  1TYG B;  2WDV B;  3BVZ A;  3C8Y A;  1D4B A;  3AM9 A;  2WNM A;  1C76 A;  2FBW B;  2WP9 B;  2WXK A;  1D5M C;  4TMA B;  1Q10 A;  4RGT A;  1P7F A;  1VJK A;  3BK1 A;  3GB1 A;  2LMC A;  1QOF A;  1KRH A;  1C78 A;  1J7C A;  1R7S A;  3HRD D;  4M0W A;  1XLP A;  3NVY A;  4YSZ B;  4YTN B;  1SE3 A;  1TKE A;  1DOI A;  3VR9 B;  1UNS A;  4XWT A;  3W2D A;  3PZ7 A;  1F2R C;  2INN E;  5BMG A;  1SIJ A;  1HEZ E;  2WXM A;  3U7Z A;  1L4D B;  2OHF A;  1E7P B;  1XLQ A;  1WYG A;  2HTM E;  5T8I A;  3URY A;  1FIQ A;  1UWM A;  2IDY A;  3P1M A;  3AE8 B;  4YTM B;  4REZ A;  1TJE A;  2OED A;  2WLB A;  3AMZ A;  2D5G A;  1JAL A;  3HUI A;  3BWU D;  1EWY C;  3MC0 B;  4TQ1 A;  2K3U A;  3KWL A;  3H8H A;  1FO4 A;  3AV8 A;  4CQN A;  3P4Q B;  2IGH A;  3R2I A;  1QT9 A;  2RDG A;  1ZXH A;  1PYW D;  4OVZ A;  1DGJ A;  2W55 A;  2DWQ A;  4ZHP A;  4YSX B;  1UGJ A;  2PVO D;  4ARI A;  4B0M A;  2G1E A;  2WXN A;  1FFV A;  1ZPS A;  3TEX A;  1WGK A;  2LFI A;  4B0E A;  1SXT A;  2BS4 B;  1K50 A;  2WXI A;  2N9K A;  1NI3 A;  2KWD A;  4MH8 A;  5GXG B;  3AE9 B;  1J7B A;  1KH0 A;  1A70 A;  2BS2 B;  4KX6 B;  3ZYY X;  4LLG M;  1HZ6 A;  1C77 A;  1Y56 A;  3WCQ A;  1C9F A;  2RDH A;  1RFK A;  2PLP A;  2PIA A;  1MPE A;  1YN4 A;  2PMV A;  4L23 A;  3AE3 B;  2NMQ A;  1SE2 A;  1J7A A;  3AB5 A;  3R2T A;  1C4A A;  3VQI A;  1KLU D;  2KN4 A;  1FM0 D;  3Q69 A;  4RGO S;  2Y3A A;  3EUB 2;  5FK9 C;  2SAK A;  2KMM A;  2WQY B;  5HFY A;  5G5G A;  3AH7 A;  2BTE A;  1I4G A;  1FMA D;  1L4Z B;  2JYT A;  4GDL B;  4KKI A;  4PT5 A;  1NEN B;  3CWI A;  1ROE A;  4RNA A;  5BYQ A;  4AS1 A;  5EE1 A;  2PW9 A;  3ZJT A;  3KQ4 A;  1F2R I;  1VLB A;  3ZJV A;  1JRP A;  3E56 A;  1YQ4 B;  3AEE B;  2J4X A;  4MM3 B;  3AED B;  1I4Q A;  1SJH D;  3Q8E A;  1EM7 A;  2LHD A;  4WUR A;  1RWS A;  2V0G A;  3AE4 B;  3AEC B;  1VZ6 A;  3TEW A;  2L1A A;  4HRO A;  2ZW0 A;  3SEB A;  1TS3 A;  1HXY D;  1B1Z A;  5HHD G;  2JWU A;  2GI9 A;  1FRD A;  2PVG C;  2BT6 A;  2EKI A;  1EU3 A;  3AE6 B;  2JQR B;  5I4D A;  1MHX A;  1ET6 A;  2LJI A;  3O13 A;  1PUT A;  2ZW1 A;  3LB8 C;  2BYT A;  1QOB A;  1K53 A;  4HKZ E;  5H8Y E;  2AX5 A;  2WDQ B;  3NZ3 A;  2K22 A;  3DWM A;  5FR3 A;  1AN8 A;  5AUI A;  1WXQ A;  1YJJ A;  4RF1 A;  3PZ8 A;  3FAH A;  1T6B X;  1MVK A;  1V1O A;  1L0X B;  4XE0 A;  2WS3 B;  1XLN A;  1YN5 A;  4ZHO A;  3W5U B;  3P4R B;  3HVD A;  4RCO A;  1XO3 A;  1B9R A;  2DLB A;  3SFE B;  3P42 A;  4XDD A;  1I4H A;  2M19 A;  1IGD A;  1JW9 D;  1TS5 A;  2ON8 A;  1M4V A;  4UDU C;  3NVV A;  4A90 A;  2V4I B;  4OHJ A;  4YTP B;  2IGG A;  3GP7 A;  1IBX A;  1N62 A;  2J53 A;  3RPF C;  3OWE B;  3TSS A;  1E0Z A;  4ZYS A;  2WXO A;  1JWB D;  1QLB B;  1N61 A;  1HZ5 A;  1PGX A;  2INP E;  1N5X A;  2CJO A;  2MEK A;  1D5X C;  1V1P B;  2YEP F;  2Z8L A;  4JWS C;  4OZA A;  2WXL A;  3BYT B;  2J42 A;  2JU6 X;  1NEK B;  4WAF A;  1P7E A;  2HDE A;  1DOX A;  1RYJ A;  4IDI A;  2BW2 A;  5MPO A;  3ETR A;  1JWM D;  4O1N A;  4A8X C;  5D7G A;  4AQ7 A;  2B76 B;  4C56 C;  4N59 A;  3NS1 A;  2CU3 A;  2JXT A;  1JWS D;  2QEJ C;  4NAW B;  4C80 A;  1BML C;  3N9Y C;  3V05 A;  1KLG D;  3AN1 A;  4RH6 A;  2QIE B;  4NZL B;  5C2T B;  1FNW A;  5HG2 A;  3TEZ A;  2L32 A;  2VZK D;  4YXD B;  1I4X A;  1YMH E;  1CQV A;  5BYS A;  5HI1 A;  2I2Y A;  4A9A A;  3CF4 A;  3KWV A;  1SSN A;  3Q8B A;  3U52 E;  1SF0 A;  2ACZ B;  2H88 B;  5D3I B;  2IJ0 A;  1CK1 A;  2MJD A;  1V8C A;  1K52 A;  5C3J B;  2MJE A;  3BZD B;  3R8B A;  1GT8 A;  2DBY A;  4JX1 C;  4GDK B;  5EE0 A;  3MJ5 A;  4YT0 B;  1GB4 A;  1I4P A;  4ARC A;  1SB3 C;  1NYQ A;  1FCL A;  1EWC A;  1JML A;  2L83 A;  1TS4 A;  1EU4 A;  5E6J A;  4MT5 A;  3W9C B;  3ZQ4 A;  1RM6 C;  2AQ1 B;  1PFD A;  4ITK A;  4J3O D;  2W3R A;  3AEF B;  1OQQ A;  1GTH A;  4JWU C;  4JPS A;  1XCQ L;  3BVM A;  1ZXI A;  1QKZ A;  1QQR A;  2NTT A;  3Q8C A;  4D2K A;  2M0A A;  5AUK A;  4WQM A;  3AE5 B;  3AEB B;  3AE1 B;  1FXI A;  1QOA A;  1QOG A;  2JYE A;  2N7J A;  3DWG C;  3I57 A;  4NJC A;  3HVZ A;  4P16 A;  2ONQ A;  3ZJU A;  1N63 A;  4A6Q A;  2V3N A;  5FKA C;  1VDV A;  1FFU A;  1WRI A;  4XWW A;  1T5X D;  3P63 A;  2QSD A;  1JCK B;  1YJI A;  2WXQ A;  2IPK D;  2YEP B;  4RFB A;  2KAC A;  4N58 A;  1FD6 A;  1PDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...