1YQ3B

Avian respiratory complex ii with oxaloacetate and ubiquinone
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
242
structure length
242
Chain Sequence
AATSRIKKFSIYRWDPDKPGDKPRMQTYEVDLNKCGPMVLDALIKIKNELDSTLTFRRSCREGICGSCAMNIAGGNTLACTKKIDPDLSKTTKIYPLPHMYVVKDLVPDLSNFYAQYKSIEPYLKKKDESKQGKEQYLQSIEDRQKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDYTEERLAQLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase flavoprotein subunit
publication title 3-Nitropropionic Acid Is a Suicide Inhibitor of Mitochondrial Respiration That, upon Oxidation by Complex II, Forms a Covalent Adduct with a Catalytic Base Arginine in the Active Site of the Enzyme
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 70
structure length 242
sequence length 242
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2005-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 1yq3B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1yq3B01
1RFKA 1ZP0B 1ZOYB 2WU5B 1N61A 1YJIA 1WGKA 2N0SB 3ZYYX 5AUIA 1E6EB 3AB5A 3SFDB 1R7SA 1SB3C 2DWQA 5G5HA 3P4RB 1TYGB 2H88B 3B2FA 1N60A 5EE0A 4ZHOA 1H7WA 3AEEB 4N59A 1KFYB 4YT0B 1FM0D 3AECB 1V8CA 3NVYA 1GPXA 1J7CA 3HRDD 3AN1A 2PIAA 5AUKA 3ETRA 1FMAD 3NS1A 3P1MA 1QT9A 3AE1B 1QOBA 3AE2B 1RM6C 5C2TB 3AE9B 3HUIA 1YQ4B 1RWSA 4IDIA 3AEFB 5C3JB 2K5PA 3VR9B 3PO0A 3AEBB 4C80A 1L5PA 3NRZA 1JALA 1WYGA 3P4SB 1KF6B 1L0VB 2CJNA 5H8YE 1N5WA 4N6EB 3ABVB 1NYRA 3W5VB 4ZOHC 1I7HA 3VRAB 1WRIA 2PVGC 2W3SA 3AMZA 1XLOA 4C7ZA 2G1EA 2WQYB 1XLQA 3B2GA 4FXCA 1NVID 5H92C 1JWAD 2OHFA 1E10A 1L6VA 3NVVA 1RYJA 4YTNB 3HVZA 4P6VF 4C7YA 4YTPB 1FRRA 2MJ3A 3DWGC 1VLBA 2M56B 1NYQA 3CIRB 3EUB2 1YQ3B 3AE8B 1OQRA 2DBYA 3LB8C 2W54A 1PFDA 1J7BA 1T3QA 1NEKB 1FRDA 2MJEA 5EE3A 4US8A 1J7AA 1FXIA 2L52A 1PDXA 1QOGA 1WWTA 3P63A 4JWSC 4N58A 5EE9A 1GAQB 5EE1A 1YJJA 5GXGB 1SIJA 1N62A 3AV8A 4WWMA 1QF6A 1WXQA 2QIEB 4KX6B 1DOIA 3DWMA 3W5UB 2BS3B 1EWYC 2W55A 1JRPA 1XLPA 4YSXB 1FFVA 1TKYA 3VR8B 1SF0A 3FAHA 1GTEA 2WDRB 2BS4B 1B9RA 4WQMA 3B9JA 4YSZB 2WDQB 2Q5WD 4YTMB 1DOYA 4USAA 1XLNA 2WU2B 3VRBB 1XO3A 3AE7B 1NENB 2HTME 1ZXIA 2CJOA 3NVZA 3L4PA 4LTUA 3AE5B 1CJEA 2PKOA 1JWBD 1NI3A 1OFFA 1AYFA 1N63A 3SR6A 4ZHPA 1QLBB 1VDVA 1FO4A 1L6UA 1QOAA 2WS3B 1ZUD2 2E3TA 2QJLA 3AEAB 1F0ZA 2WDVB 3AE6B 1KRHA 1TJEA 4JX1C 4A9AA 2H89B 1FXAA 3RPFC 1IUEA 4YSYB 1ROEA 2EKIA 1N5XA 2PVOD 3CF4A 1E9MA 3FC4A 4HRSA 3BIID 4US9A 1AWDA 2BT6A 2CU3A 3P4QB 1E7PB 3P4PB 1OQQA 2FBWB 2KAJA 2W3RA 2WLBA 3WCQA 4ITKA 2M19A 3AE3B 1DGJA 2K22A 3KWLA 2MJDA 5MPOA 1A70A 1VJKA 2WP9B 1FIQA 3AE4B 1TKEA 3CWIA 1CZPA 1JW9D 4YXDB 3AEGB 2KMMA 2AX5A 1E0ZA 1JQ4A 2L83A 3W9CB 1TKGA 3NVWA 2LEKA 2K9XA 1DOXA 1PUTA 2B76B 5G5GA 1UWMA 3AH7A 3AM9A 2JX5A 2ACZB 3AEDB 1QOFA 4HROA 1V97A 2BS2B 3SFEB 1FFUA 1JROA 2Y5CA 3LXFA 1GTHA 2JQRB 1GT8A 4JWUC 2MH7A 1H7XA
chains in the Genus database with same CATH superfamily
4EE2A 1E6EB 2ON8A 2ZPYA 1WGYA 1N60A 3Q8EA 2D2QA 1D5XC 4NPNA 2QCZA 3HUIA 3PO0A 2L0FA 1WE6A 3P42A 4C80A 3CF6E 2VH2A 4URKA 3ZJTA 3N30A 4FJZA 3QQ8B 1L0VB 2BYEA 2V4IB 3MC9A 3RULA 1LXDA 4NAWA 1WRIA 4IUMB 4HCPB 2WXQA 4MT5A 1KOTA 3DBHI 1XLQA 4NZLB 1D5ZC 1YMHE 1XEEA 4K7SA 5DPTA 2K25A 2K1FA 1IBXB 2KANA 3IFWB 2BPSA 1LM8B 2ZVOA 4JWSC 5JHBA 2L76A 5GXGB 4OZBA 2K0PA 1WZ0A 2RDGA 2WDTB 3KUCB 1BMLC 4TV3A 2C9WB 1XCQL 1V86A 4WAFA 2V0GA 1JMLA 1JCKB 2IYDB 3U52E 2FCQA 2D11A 3DOWA 4MH8A 2KNBA 2O2VB 4JX1C 2GI9A 3U7ZA 3VTUA 3ZNID 1FXAA 2J42A 2LVOA 2PVOD 4CO7A 5IN7A 3NZ3A 1AWDA 2LGYA 1OQQA 4ANXA 1WGRA 1WJ4A 1OGWA 5CHWA 1QKZA 5MPOA 1Z2MA 1VCBA 2M1MA 1GJZA 3AULA 2AX5A 4W9EA 1DOXA 4I6PA 2MCNB 3D32A 1L7YA 4M0WA 1EM7A 2KZRA 2JX5A 3T9LA 2C5LC 1HXYD 2IPKD 5C1ZA 3GZNB 1TYGB 3RZWC 1H7WA 4GB9A 4KSLC 3NVYA 3HRDD 3GOEA 3ZRCA 2I38A 3AE1B 5HHDG 3AE9B 1YQ4B 2CR5A 2K5PA 4CYEA 1S1QB 3PTFC 1YN4A 2DAJA 2FCNA 4DHZB 3PLVA 3ZJUA 2ZZPB 2BB6A 2LI5A 3MTNB 3ZGZA 3M95A 2G1EA 2KX3A 2C7HA 2PW9A 5IO9A 1VR9A 4NAWB 1FRRA 1DYQA 1C78A 1F2RI 1NEKB 1IGCA 2PEAA 2NTTA 2KT7A 2BW2A 1AW7A 2QIEB 3SD5A 2UWQA 2V3NA 4PT5A 3A9KA 3Q2AC 1TZ1A 3BWUD 5DPRA 4YSZB 4GSWA 5HG2A 1NENB 1H4RA 1HE8A 3QARA 1AARA 2LWPA 3N1XC 3KUZA 3O65B 1HTOA 1J19A 1UNSA 4MH0E 3R3MA 3UQBA 4YSYB 2XNAC 1ZKHA 4XYCA 2G45B 3AE3B 1V80A 2ICIA 2GBKA 2C7MB 4A90A 3PPAA 4M8MA 3RYTA 5HKHA 1PUTA 1UWMA 3AH7A 4ICUA 2ZPNA 4JQWC 1JROA 1FFUA 3GE8C 4PK1A 2L32A 3CSFA 3RFZB 1N61A 3RNGC 4M0WB 1TTNA 1SB3C 2LXCA 3L08A 4N59A 4YT0B 1GPXA 3AECB 3ZKJC 1J7CA 4RF0A 1K52A 2KACA 3RMKC 3NS1A 4OZAA 3KH0A 1V1PA 4IDIA 2FAZA 2K8BA 3I5JC 1WX8A 1JALA 3JYUA 4DHZE 4ZRPA 3RUIB 3O13A 1N5WA 3PLUA 3Q14C 3WALA 1I35A 1FNWA 1XLOA 2WQYB 4RMAA 4G11A 1IYFA 4GU2A 3DWGC 1VLBA 3FILB 3CIRB 2JZ3B 4HJGE 5L83A 3BK1A 3N32A 2KXJA 4N58A 1XXGA 4DK5A 4HPLB 2JRIB 3DWMA 3W5UB 3WAPA 4ASWC 2QDFA 1RAXA 2IY1B 2QSDA 3ZXRA 1WGGA 2V9HA 2WDQB 3I63C 4KGSA 3VXWA 3DHHC 3R2IA 4FJVB 3WAOA 1MJDA 1ZUD2 5DPSA 4MDKE 2QJLA 3NUHB 4TKNA 4A9AA 4AUQC 1F2RC 3ZJVA 2G4SA 1RRBA 3OWEB 3RNBC 4C56C 4EZKA 3TSSA 3A1QA 3AE4B 2IO1B 2LJ5A 3ZXVA 3X0WA 1VRAB 4B0EA 3A4RA 1TGZB 2MH7A 1QZEA 5JZEB 1SXTA 2D3AA 2DZJA 2KDIA 3H1UA 3AEEB 1V8CA 1R4NB 2N9EB 1Q0WB 3VH3B 3VTWA 1ZDXA 1UBIA 1GB4A 2FIDA 4WJNA 3J9CA 4ZRQA 1OEYA 2N9LA 2PVGC 4NQKE 3BZDB 3Q3MC 5HI1A 1JWAD 2J0JA 4YTNB 2BYFA 2BB5A 2MBOA 3BVZA 1WGHA 2GBNA 5BMHA 4MSMB 5EE9A 1SE3A 3AV8A 4MGKE 1I4PA 1JRPA 1KTKA 2M4NA 3EHVA 2MQJA 4YTMB 1DOYA 2D07B 2WXOA 4X57B 2KFKB 3VRBB 1YIWA 1XO3A 2GBRA 3KLSX 2MEKA 4GDLB 2WXMA 4FN2A 4DDGD 2M0AA 2KTRA 2SEBD 2RPQA 1T0SC 2MBQA 4XC2A 1OEYJ 1N5XA 4J3OD 1E9MA 1UBQA 2CS4A 3DHGC 2M19A 4ACFA 1N6ZA 1E8WA 3CWIA 4A3OA 5I4DA 1RLFA 4P1BC 1Q5WB 4BBNF 3ZRFA 3C0RB 3A1QB 1LQBA 1XCTL 4B95A 2REXA 4IOIE 4RM8A 1TS3A 1D6EC 4RCOA 2KDMA 3SFDB 1MHHE 2ZJDA 1UF0A 3OJ4B 1KFYB 4K7WA 1E8XA 4OZCA 2L3ZA 1WXAA 4FJYA 1KLGD 3Q3JA 2KD0A 2J53A 2KLGA 1SJHD 3RT3B 3PZ8A 1C4PA 3SDLC 5J2RA 3QIJA 2PMVA 3U2SC 3DQVA 4EZLA 1C9FA 1ISNA 2LFIA 3QWZB 4FXCA 1L6VA 3CSTA 4C7YA 2BWES 1FXTB 1FRDA 1SEBD 3KVFB 3WANA 2J0MA 2WX0A 4HPMB 1QF6A 4MEMA 4W9IA 4C00A 4W9JA 4XE0A 2J4XA 2IBIB 3NS8A 4WWPA 2WDRB 1HQRD 2BS4B 2LASA 3PS6A 3UIPB 4BZAA 3TEXA 4FA6A 2WU2B 2RGFA 2KMAA 3NVZA 3L4PA 3AE5B 2PKOA 1NI3A 4DQOC 2INNE 3ZTCA 3ZVVA 1TS4A 2QILA 1KRHA 2V3SA 2H89B 1ROEA 2N7EA 2BT6A 1KLUD 1YX6B 1K53A 3P4PB 4DXFA 3DVNU 2W3RA 2WLBA 4BKGA 2JT4B 2JWUA 4QAYA 1JRUA 4BKSA 4GXBA 4EKUA 4EOYA 1TKGA 2K9XA 2MW5A 3GS2A 4AP4C 3UF8A 2A5UA 2IO0B 3Q6BA 1TY2A 1UGJA 4HROA 2KJRA 1V97A 4LNNA 3MC0B 4RH6A 1WGKA 4PS3A 3V3XA 1EWCA 4TQ1A 5G5HA 2HDEA 2GOWA 2H88B 4P1CC 4MSQB 3L16A 1E7UA 5J17A 5BMIA 2LHEA 3DBLB 1IGDA 2NBUA 1XT9B 3B08A 3B1LX 1GOZA 2DYMA 2KVZA 2JF5A 1R4MB 2X38A 5BO4B 2KQ4X 2MP2A 2FCMA 2KWDA 5IKCM 2PLPA 4XDDA 2R2QA 2I2YA 2Z59B 3WAMA 3QCAA 3IAM1 1YJJA 1L0XB 1T0RC 1WXQA 2DLBA 3EFUA 2WHIA 3T3OA 2BF8B 1HA5A 2NBWB 4HLEA 4NQLB 4PYUA 3NZSA 2FIFA 2K39A 1SJED 3UI3A 3BK2A 3TUOA 1WM2A 4AS1A 2KYWA 2WXLA 2HTME 3EA6A 3H6NA 3PRPB 4NJ7A 2R61A 5E6OA 2KO3A 4A55A 3RN9C 3RNFC 2ZCCA 3RZFA 5L95C 3U8ZA 4WWNA 2D3CA 3AE6B 1ZW7A 3AU5A 4YWGG 1IUEA 2JRHA 3ZDMC 1YQBA 4JPSA 5GMVA 1TKEA 1IP9A 3K9PB 2G4DB 2ZCBA 1MHXA 2W82A 3OJ3A 3IAS1 2JQRB 3M63B 1TZOA 5JHAA 1RFKA 2MHJA 1ZP0B 1XQQA 4IC7B 3VUYA 2AWTA 2NR2A 2WX1A 3R8BA 4ZHOA 4L1BA 4WJOA 5AUKA 3RCZA 3NY5A 1YOVB 3E56A 2HD5B 2RR9A 2KHWB 3EGRA 1TBEA 3ZDTA 2DNFA 3R66C 2K8CA 1I7HA 4C7ZA 3VHTC 1SGHA 2A4ZA 1E10A 2N1VA 3W1YA 4WQOB 2MRPA 4HJKA 4P6VF 4GGQA 3VDZA 4WH4A 2JPHA 1WJ6A 2VH1A 2E6XA 2BKRB 2VRRB 1WF9A 1SIJA 4LLGM 5IA7A 2L0TA 1EF5A 2AQ2B 2PTLA 4WWOA 2R2OA 4DXAB 2GB1A 3R7RA 1WJUA 2PPHA 1TT5B 1ZPSA 1ZXIA 3M62B 3VH4B 4ZHPA 1AYFA 4MGYE 1HEZE 1L2NA 2MBBB 1WXVA 2GLSA 3APFA 3FC4A 3PRZA 1EU3A 2FBWB 5CX3A 5LLIA 3N3KB 3IG3A 1ZDVA 5D6JB 1CZPA 4ZYSA 3LDZE 4PYZA 1BXTA 4HEA1 3WA0A 1PGXA 4ZDVA 2ZW0A 3Q8AA 2MX2A 4M02A 3AXCA 1ZOYB 4AWJA 3AB5A 2DWQA 2QEJC 2D5GA 2GBMA 4LNIA 5J18A 3IXSA 1KJTA 1TS2A 2PIAA 3ETRA 3ZTDA 4ZYNA 1Q10A 4BKSD 3RD2A 5LNK1 3V6EB 3H8HA 2ZNVC 1UD7A 1U4AA 3JSVA 4N6EB 2FNJB 1UZXB 2XK5A 2OJWA 3DBRI 1MI0A 4EZJA 1V2YA 3HVZA 4CQNA 2UYZB 3QAQA 3EUB2 4W9LA 2DBYA 2RMMA 1P0RA 2MBHA 3QA8A 2ONQA 2J7QB 4UDUC 3W1SC 1UGMA 1AN8A 4KZ0A 2JZPA 1GC7A 4RGMA 4N9F4 1M4VA 4REZA 2EKEC 4FADA 2ZVNA 1FCLA 2Y5BB 3ZLZA 3L0WB 1FNVA 4GIVA 4RF1A 1C76A 3WIMA 2WNMA 1LO5D 1KH0A 2CU1A 4K3BA 4S17A 4HRSA 3H7PA 4KZCA 3ZNZB 4W9KA 3M3JA 4ITKA 1A70A 2RSUA 3A9KB 3S2AA 4LJPB 3AEGB 1MVKA 2K8HA 4HPPA 2L05A 2J52A 3Q8FA 4NY0A 3N9YC 2DZIA 3AM9A 5FR6A 4AJWA 4IG7B 3MFGA 1I4QA 2WU5B 2BKFA 5CHVC 3ZYYX 4LNFA 3A4SC 1UWXA 5TR5A 2WXGA 4ICVA 3B2FA 3HHMA 3QK0A 5KHOA 3QJZA 1TY0A 1WIAA 5FR3A 1P9DU 3ZW3A 1WM3A 2MA9B 3L13A 1D4BA 1ESFA 1WYGA 5E6PA 5H8YE 4ARCA 3JVZX 1NYRA 5G55A 3GB1A 3B2GA 3PHXB 1NVID 1WH3A 3VUXA 4LK0M 5D7GA 2IY0B 3JSVB 4YTPB 2FCSA 2XK5B 5EE3A 1J7AA 4WJPA 3RNCC 3Q3OC 4DDID 5EE1A 1WRDB 2YLMA 1V1PB 1XLPA 4YSXB 1FFVA 1TKYA 1MFWA 1WYWB 3ONSA 1I4GA 4KIKA 2KFJA 4FLHA 2WXIA 1XLNA 4P7IA 1H8CA 2CJOA 2WXFA 1N63A 5TSSA 1RFAA 1EU4A 2E3TA 3AEAB 1YJ1A 1F0ZA 1EO6A 3AI5A 4TQ0A 1T5XD 2JXXA 2CU3A 1MG4A 3WCQA 4BOZB 2VZKB 2M17A 3H7PB 1A5RA 4IWOA 3BVGA 3VFKA 3QHTA 2L83A 2INPE 1V5TA 2L1AA 2N9XA 2FUG1 4M01A 1Y56A 3ZQ4A 2ACZB 1C77A 1NBFC 3SFEB 2GBJA 3LXFA 2XN9C 5IP4D 4DBGA 1MG8A 1YJIA 4IWQA 1K8RB 2LD9A 1R7SA 1KLVA 3NOBA 3V62A 4HWIB 2TSSA 4K7UA 2Y5PA 5BYSA 1QOBA 1WGDA 3VR9B 2LGXA 3NRZA 1L0YB 3TL5A 1Z5SB 4OVUA 4M8NA 1FEHA 1Q1OA 1F77A 3W5VB 1P7FA 3NHEB 2BGFA 1WR6E 4XWTA 2IGHA 2KK8A 2DENB 2OOBB 3NVVA 4R3DA 1FNUA 3L17A 1SIFA 1OQRA 1J0GA 1FCCC 2NS5A 1GG3A 1K51A 2O6VA 2JU6X 4OVZA 1B1ZA 2L7RA 3C19A 1T6BX 3A33B 1EWYC 2MSED 2N9PC 3VR8B 2OJRA 3GZNI 3X23A 1FPYA 3B9JA 1V9JA 3PREA 1EUVB 2AL3A 4KIKB 1VDVA 4KGTA 2AQ1B 2LHDA 2BQQA 3KUDB 4A3PA 4HKQA 2CHWA 3MC8A 3NJTA 5T8IA 3CF4A 2I1JA 3ML9A 1YNTE 1ZGUB 1C4AA 2INDC 1CMXB 4RFBA 4B0MA 2K6DB 2LXAA 2DZKA 5DPWA 2WGSA 3A9JA 2LEKA 5G5GA 3TMPB 2FE8A 4BAXA 3KYDD 2VZKD 1P7EA 1IBXA 2N0SB 4JL9A 2KTRB 4LNOA 2HE7A 4FHKA 2QC8A 4HXDA 2G9HD 1FMAD 1RM6C 5C2TB 4YL8A 3AEBB 1M94A 2D3BA 3MHSD 4NJCA 1HZ6A 3VVWB 3NZUA 3TBLD 1JWMD 1WXMA 3U4EG 3VRAB 1I4XA 1YD8U 3VUWA 2LVPA 5BYRA 2IO2B 4DWFA 3MJWA 1V81A 1UH6A 1ZE3D 4JE3B 1YQ3B 1WMHA 2L52A 3HK0A 3OAWA 4WWMA 5JH5C 2D10A 4LNKA 4LDTB 2O6VB 2LGSA 2KKCA 3PRMB 4BFRA 5E6NA 1WE7A 3IBEA 2Z8LA 3AE7B 4L23A 2MLBA 4LTUA 5IAAC 2KJ6A 1JWBD 1FO4A 3ENEA 3OG5A 3TIXA 1VD2A 4FHJA 5C23A 2WXHA 4F8CB 1GC6A 3DDCB 4RM9A 2BTEA 3DCGA 5LXHA 2N4FA 2INCC 4MACA 1VJKA 4I6NB 2LRUA 5KHQA 2KQ7A 1E5WA 4IM3A 1C1YB 1HZ5A 4KDLB 1WSPA 3PZDA 1C3TA 3AEDB 2BS2B 2RD0A 4BOSC 5FK9C 4JWUC 2LUMA 3A9JB 2LRWA 1YX5B 2KN5A 2MBEA 3K9OB 2V3PA 4ARIA 2KTFA 1FD6A 3ZNGC 5C3JB 1SE9A 3EC8A 2EMTA 3Q8BA 3KWVA 3ECIA 1D3ZA 4NNJB 3TJPA 2LGIA 4E74A 1GNUA 1F52A 3MJ5A 1MPEA 3KQ4A 3ZO5B 4I6LB 4BVUC 3DBSA 2KLCA 5EDSA 1SSNA 5BMGA 3LB8C 3LYYA 2YEPF 2W54A 3EECA 4US8A 3L10B 1OTRB 1PDXA 1QOGA 2EELA 2FUHB 1PQSA 2KOXA 3E9SA 3UGBB 2KQSA 1GAQB 2NCNA 4D2KA 3TCAA 1BUIC 1WMHB 2BS3B 2NMQA 5AZHA 3ZNHB 2N7JA 2ZEQA 4OW0A 1JWSD 1P3QU 2C60A 4ZRKA 2PJHA 3APCA 4MELA 2KWCA 1R4NI 1E90A 4TUUA 1D5MC 2MP2B 3UINB 3SR6A 2KN4A 5E6JA 5DCNA 4LDTD 5JXVA 2O6VD 2WXJA 3VAWA 2NVUI 4H2AA 4HK2A 2EMSA 2YEPB 3MHZA 2BBCA 2EKIA 4DXGA 2L00B 4TMAB 1V49A 2K22A 2WP9B 1FIQA 4YXDB 2JXTA 1VZ7A 5CHFA 1E0ZA 1WFYA 2B3AA 4JLCA 1F1HA 2B76B 2Y5CA 3JW0X 4ZRIA 1QILA 3GE3C 3H7SA 3U30A 1S3SG 2AQ3B 3FILA 3V60A 2KX0A 4DHJB 4KKJA 3P4RB 4GN1A 1XD3B 1FM0D 2D3GA 4WIPA 2BYVE 4JIOU 3MP9A 1QT9A 3AE2B 2OEDA 2MWSB 4IM0A 2LVQA 2IO3B 1P1AA 1I42A 3RNAC 4G0NB 4II3B 4GOCA 1KF6B 4IKGA 1SBBB 2W3SA 3V6CB 1PYWD 3UQAA 2JVCA 3H9DA 2RDHA 3SU8X 4GDKA 4K1RB 1J7BA 1T3QA 2JYEA 4PS8A 4MJSA 3Q3FA 2KDFB 4BKTA 3R7QA 1UUPA 4A6QA 5BYQA 3T3NA 2N1WA 4IW0A 1XF5L 2WXKA 5IOIA 4S0RA 2V1YA 3W1SA 4B6WA 3FAHA 4MGIE 4HVBA 4A20A 4XZ4A 4P16A 2DYOA 1CJEA 3VTVA 3RNEC 4LJOB 1K50A 2BYTA 1L6UA 4EFOA 1ENFA 2BWFA 5AZFA 3BYTB 2M0XA 2DZMA 1LFDA 1I4RA 2J0KA 2KC2A 2KAJA 3B0AA 2JZZA 2MJDA 1LGRA 1E7VA 2Y3AA 3LJ3A 1V1OA 3N20C 3NVWA 5D3DA 3PSEB 3ALBA 2YVCA 4RGNA 3BY4B 3CMMB 1GT8A 1H7XA 2PE6B 2IDYA 3IT6B 3R2TA 3U7DA 1WJNA 4Q2JA 5AUIA 3DBHB 4W9FA 4KVGB 3SEBA 4EUTA 3KYCD 4MGZE 2AYOB 2I1KA 2CHXA 1TIFA 2N7DA 4W9GA 1GB1A 2DX5B 5EE0A 4M00A 2W9NA 1WY8A 2JY6A 3BVMA 5FKAC 4DHJD 2WXPA 4F7ZA 2NPTA 1BT0A 5AEKB 3PHWB 2KFKA 4F1SA 2V4LA 3ABVB 3AMZA 2IGDA 4HKZE 4GDLA 4AOFA 3V61A 2ZW1A 4HCNB 2G3QB 5H92C 2UU7A 2ZNVB 1T0QC 1X1MA 3AE8B 2JWZA 2L8JA 3PT2B 2MJEA 2WXNA 2LUEA 3RI7C 3I57A 3P63A 1WWTA 2X8XX 2QHOA 4W9DA 3BYYB 4GDKB 1N62A 4KX6B 1C79A 1P98A 3QX1A 4AQ7A 2ASQA 4NJ6A 2W55A 1OQYA 3Q69A 2WWZA 4JGHB 4MJSB 4CHKA 4KKIA 1SF0A 4PS7A 3HVDA 4WQMA 2LMCA 4USAA 3DBLI 2KWUB 1WZ3A 3TEYA 5LXIB 2Z0DB 4G3XB 3T8MA 4ANUA 1HTQA 1Y8RC 2DHZA 1R4MI 2LGDA 4LCDE 3BIID 4US9A 4E3CA 4ZRJA 3C8YA 3KWLA 4XWWA 1ZXHA 4A8XC 2M8SA 1NDDA 1PGAA 4KSKC 2CHZA 4II2B 3URYA 2IJ0A 3EFCA 2KMCA 4NAMA 1E8ZA 1NI2A 1TS5A 2PE9A 4XX5A 2Z0EB 1YN3A 2KDBA 3AU4A 4BBNC 3P1MA 3IHPC 4O1NA 1L5PA 2WXRA 4GMVA 4IM2A 2CJNA 3N1ZC 3DVGY 2KDEB 2LZ6A 2KC1A 2NPTB 2OHFA 1RYJA 3GP7A 2MJ3A 4W9HA 4C4VA 4WAAA 5CTRC 1PFDA 4FULA 4KDIC 3PV1A 2WYQA 3BINA 3IVFA 1SE2A 4ANWA 1DOIA 1WI0A 5G2NA 3DVGX 4RGTA 1CQVA 1B9RA 2HTHA 4HDQA 1T0YA 2JUOA 1OFFA 2K3UA 4EEWA 2WS3B 1PGBA 1L4ZB 3VQIA 1V6EA 4K3CA 2QMTA 4K81A 1SE4A 2KJHB 4MM3A 1C4CA 2XEWA 3DBRB 1VZ6A 2RDBC 1JW9D 2K6QA 2KMMA 3DVNV 3P2BA 4XDCA 1QOFA 3PGEA 1L4DB 3APDA 4RNAA 3I9V1 3NG0A 5AZGA 2JYTA 5D3IB 4ANVA 1ET9A 2C7NB 3PVLA 3QC8B 4W9CA 3AN1A 1CK1A 4KV2A 1YN5A 4B9KA 2IGGA 2N9KA 1RWSA 2KWVB 3AEFB 1WX9A 4HDOA 2AEHA 3HM6X 4GLSC 2IZVB 2CKHB 2DAFA 4AJYB 3KW5B 3SHQA 3P4SB 1J8CA 3ML8A 1F9JA 1GUAB 3HM3A 3DPDA 4ZOHC 3V05A 2HJ1A 1KM7A 4G50A 2RPVA 4WURA 4L2YA 1E8YA 2M56B 1NYQA 2BVCA 2AL6A 2GRIA 2XBBC 3PZ7A 3W2DA 1FXIA 5D94A 1JWUD 3L54A 2SAKA 4C4VB 3OLMD 4RGOS 1IPGA 5D2MB 3HIZA 4FBJB 5HFYA 1QQRA 3UIOB 1GTEA 3IT4B 1UELA 3Q3NC 2Q5WD 4IWPA 4OHJA 4WJQA 1STEA 4OVVA 2O2VA 3ZIMA 3TEWA 1WX7A 1I4HA 3TEZA 1QLBB 1QOAA 4E71A 1ACCA 1WXSA 2LJIA 2HJ8A 2KVRA 2WDVB 1TJEA 3N1YC 3RPFC 4TSSA 2JSVX 2DYBA 3P4QB 1E7PB 1EF1A 1V5OA 2GMIC 1ET6A 4J6IA 3I3TB 1DGJA 2NTSA 1VZ8A 4XGAB 3ZUNA 3Q8CA 1JQ4A 4MM3B 1WR1A 3W9CB 4KGRA 3FKYA 1G6JA 3DHIC 2NBVB 1GTHA
chains in the Genus database with same CATH topology
1TS3A 1D6EC 4EE2A 3MFGA 4RCOA 1I4QA 2AQ3B 2WU5B 3FILA 3ZYYX 2KDMA 1E6EB 3SFDB 1MHHE 2ON8A 4KKJA 3P4RB 1UWXA 2WXGA 3B2FA 1N60A 1KFYB 1FM0D 3Q8EA 4WIPA 1TY0A 5FR3A 1D5XC 3MP9A 1QT9A 4OZCA 3AE2B 2OEDA 3HUIA 3PO0A 1D4BA 3P42A 4C80A 1KLGD 3ZJTA 2J53A 1ESFA 1WYGA 1KF6B 1L0VB 1SBBB 1SJHD 2V4IB 4IKGA 3PZ8A 5H8YE 4ARCA 1C4PA 1NYRA 2PMVA 3U2SC 2W3SA 1WRIA 2WXQA 3GB1A 4MT5A 1C9FA 1XLQA 1PYWD 2LFIA 3B2GA 1NVID 1D5ZC 4FXCA 4NZLB 1YMHE 1XEEA 4LK0M 5D7GA 1L6VA 4C7YA 4YTPB 2RDHA 1IBXB 1J7BA 1T3QA 5EE3A 1FRDA 1SEBD 2JYEA 1J7AA 1UUPA 4A6QA 5BYQA 4JWSC 3T3NA 5EE1A 5GXGB 1QF6A 1XF5L 4OZBA 2WXKA 4XE0A 1V1PB 2J4XA 1XLPA 2K0PA 4YSXB 1FFVA 1TKYA 2RDGA 3W1SA 3FAHA 2WDRB 1HQRD 2BS4B 1BMLC 1I4GA 4P16A 2WXIA 3TEXA 1XCQL 1XLNA 2WU2B 4WAFA 2V0GA 1JMLA 1JCKB 2CJOA 2DYOA 3L4PA 3NVZA 3AE5B 3U52E 1CJEA 2PKOA 1NI3A 2WXFA 4DQOC 1K50A 1N63A 5TSSA 2INNE 2BYTA 1L6UA 1EU4A 4MH8A 2E3TA 3AEAB 1ENFA 1TS4A 2QILA 1F0ZA 1KRHA 4JX1C 2GI9A 2H89B 3U7ZA 4TQ0A 1FXAA 1T5XD 1ROEA 2J42A 2PVOD 3BYTB 1AWDA 2BT6A 2CU3A 1KLUD 3NZ3A 1K53A 3P4PB 1OQQA 1I4RA 2KAJA 4DXFA 2W3RA 2WLBA 3WCQA 2VZKB 1QKZA 2MJDA 5MPOA 2JWUA 2Y3AA 3BVGA 2AX5A 2L83A 1V1OA 2INPE 1TKGA 3NVWA 5D3DA 1DOXA 2K9XA 2L1AA 2FUG1 3GS2A 4M0WA 1EM7A 1Y56A 1TY2A 2ACZB 1C77A 1UGJA 2JX5A 4HROA 1V97A 4RGNA 3ZQ4A 3SFEB 3LXFA 1GT8A 3MC0B 2XN9C 1H7XA 4RH6A 2IDYA 1HXYD 2IPKD 3IT6B 3R2TA 1YJIA 1WGKA 3V3XA 4Q2JA 5AUIA 1EWCA 1R7SA 4TQ1A 5G5HA 2HDEA 1TYGB 2H88B 1H7WA 2TSSA 3SEBA 3NVYA 2Y5PA 3HRDD 5BMIA 2LHEA 5BYSA 2I38A 1IGDA 1GB1A 5EE0A 3AE1B 1QOBA 5HHDG 3AE9B 1YQ4B 2K5PA 3VR9B 3BVMA 3NRZA 1L0YB 1YN4A 5FKAC 1GOZA 2WXPA 1FEHA 2DYMA 1F77A 3ABVB 3W5VB 2X38A 3ZJUA 1P7FA 2KQ4X 4XWTA 2BB6A 3AMZA 3ZGZA 2IGHA 2IGDA 4HKZE 2G1EA 2PW9A 2ZW1A 5H92C 1VR9A 2KWDA 3NVVA 4NAWB 4R3DA 1FRRA 1DYQA 2PLPA 1FNUA 4XDDA 3AE8B 1OQRA 1C78A 1F2RI 1FCCC 2I2YA 2MJEA 1NEKB 1IGCA 2WXNA 3I57A 3P63A 2NTTA 1WWTA 1K51A 2JU6X 2BW2A 1AW7A 4OVZA 1B1ZA 3IAM1 3BYYB 1YJJA 4GDKB 1N62A 1L0XB 1WXQA 2DLBA 2QIEB 4KX6B 1C79A 3T3OA 1T6BX 2V3NA 4PT5A 4AQ7A 1HA5A 1EWYC 2W55A 3Q69A 3BWUD 3VR8B 1SF0A 4KKIA 3UI3A 1SJED 3HVDA 4WQMA 2LMCA 3BK2A 3TUOA 3B9JA 4YSZB 4USAA 5HG2A 4AS1A 2WXLA 2HTME 3EA6A 1NENB 3TEYA 2R61A 4A55A 1VDVA 4KGTA 2AQ1B 2LHDA 4HKQA 1UNSA 3AE6B 4YWGG 1IUEA 4YSYB 5T8IA 3CF4A 4US9A 3BIID 2XNAC 1YNTE 3AE3B 1C4AA 3C8YA 4JPSA 3KWLA 2ICIA 4RFBA 4XWWA 1ZXHA 4A8XC 1TKEA 4B0MA 4A90A 1PGAA 1MHXA 2W82A 2LEKA 1PUTA 3URYA 5G5GA 1UWMA 3AH7A 2FE8A 2IJ0A 3IAS1 1JROA 1FFUA 4NAMA 2JQRB 1TZOA 1TS5A 2VZKD 1RFKA 1ZP0B 1P7EA 2L32A 1IBXA 3RFZB 1N61A 2N0SB 1SB3C 1YN3A 3R8BA 4ZHOA 4N59A 4YT0B 1GPXA 3AECB 4L1BA 1J7CA 4RF0A 1K52A 2KACA 5AUKA 2G9HD 1FMAD 3NS1A 3P1MA 4OZAA 1RM6C 5C2TB 4O1NA 1V1PA 4IDIA 3E56A 3AEBB 1L5PA 4NJCA 1HZ6A 2WXRA 1JALA 3EGRA 2CJNA 1JWMD 4ZRPA 3O13A 3U4EG 1N5WA 1I7HA 3VRAB 1FNWA 1XLOA 4C7ZA 1I4XA 2WQYB 1E10A 5BYRA 2OHFA 1RYJA 4P6VF 3GP7A 2MJ3A 3DWGC 4WH4A 1ZE3D 1VLBA 4JE3B 3FILB 3CIRB 1YQ3B 4HJGE 1PFDA 2E6XA 2L52A 3BK1A 4N58A 1XXGA 1SIJA 1SE2A 4WWMA 4LLGM 1DOIA 3DWMA 3W5UB 4RGTA 2AQ2B 2PTLA 1CQVA 2QSDA 1B9RA 2GB1A 2WDQB 4KGSA 2Z8LA 1ZPSA 3AE7B 4L23A 4LTUA 1ZXIA 3R2IA 1JWBD 1OFFA 1AYFA 4ZHPA 2K3UA 1FO4A 2WS3B 1ZUD2 1PGBA 1HEZE 2QJLA 1L4ZB 3VQIA 3NUHB 4A9AA 2WXHA 3FC4A 1F2RC 3ZJVA 2QMTA 1EU3A 1SE4A 2FBWB 1C4CA 2BTEA 1VZ6A 3OWEB 4MACA 1VJKA 1ZDVA 4C56C 3TSSA 3AE4B 1CZPA 1JW9D 4ZYSA 2KMMA 1HZ5A 1BXTA 4XDCA 1WSPA 4HEA1 1PGXA 3AEDB 1QOFA 1VRAB 2BS2B 1L4DB 4B0EA 2ZW0A 4RNAA 3I9V1 5FK9C 3Q8AA 4JWUC 2MH7A 2JYTA 2LUMA 5D3IB 1ZOYB 1ET9A 3AB5A 1SXTA 2DWQA 2QEJC 2D5GA 3AEEB 3IXSA 1TS2A 1V8CA 2V3PA 4ARIA 3AN1A 2PIAA 1CK1A 1YN5A 3ETRA 1FD6A 1Q10A 2IGGA 2N9KA 5LNK1 1RWSA 3AEFB 5C3JB 3H8HA 1ZDXA 3Q8BA 4GLSC 1GB4A 3KWVA 3P4SB 3J9CA 2LGIA 4ZRQA 3MJ5A 4N6EB 1MPEA 4ZOHC 2N9LA 2PVGC 3V05A 3BZDB 3KQ4A 2RPVA 5HI1A 1JWAD 4WURA 1MI0A 4L2YA 4YTNB 3HVZA 4CQNA 2BB5A 1SSNA 5BMGA 2M56B 1NYQA 3EUB2 3LB8C 3LYYA 2DBYA 2YEPF 2GRIA 2W54A 3PZ7A 2RMMA 4US8A 3BVZA 3W2DA 1FXIA 1PDXA 1QOGA 2EELA 2ONQA 1JWUD 5BMHA 3E9SA 2SAKA 5EE9A 4RGOS 1GAQB 1SE3A 4D2KA 3AV8A 4UDUC 1BUIC 1I4PA 2BS3B 2NMQA 1JRPA 5HFYA 2N7JA 1KTKA 1AN8A 1QQRA 1JWSD 4OW0A 1GTEA 2JZPA 3IT4B 4RGMA 2Q5WD 1DOYA 4YTMB 4OHJA 2WXOA 3VRBB 1STEA 1XO3A 1M4VA 3KLSX 4REZA 3TEWA 1D5MC 2MEKA 4GDLB 2WXMA 1I4HA 3TEZA 3SR6A 2KN4A 5E6JA 1QLBB 1FCLA 1QOAA 1ACCA 2M0AA 5JXVA 2LJIA 1FNVA 2SEBD 2WXJA 2WDVB 4RF1A 1C76A 4H2AA 1TJEA 2WNMA 1LO5D 1KH0A 2YEPB 3RPFC 3MHZA 4TSSA 2JSVX 2BBCA 1N5XA 2EKIA 1E9MA 4HRSA 4J3OD 4DXGA 3P4QB 1E7PB 4TMAB 1ET6A 4ITKA 2M19A 1DGJA 2NTSA 1VZ8A 2K22A 1A70A 2WP9B 1FIQA 3CWIA 5I4DA 3Q8CA 4YXDB 3AEGB 2JXTA 1MVKA 1VZ7A 1E0ZA 1JQ4A 4MM3B 3W9CB 4KGRA 2J52A 3Q8FA 3N9YC 2B76B 3AM9A 1XCTL 2Y5CA 1GTHA 4IOIE 1QILA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RFK A;  1ZP0 B;  1ZOY B;  2WU5 B;  1N61 A;  1YJI A;  1WGK A;  2N0S B;  3ZYY X;  5AUI A;  1E6E B;  3AB5 A;  3SFD B;  1R7S A;  1SB3 C;  2DWQ A;  5G5H A;  3P4R B;  1TYG B;  2H88 B;  3B2F A;  1N60 A;  5EE0 A;  4ZHO A;  1H7W A;  3AEE B;  4N59 A;  1KFY B;  4YT0 B;  1FM0 D;  3AEC B;  1V8C A;  3NVY A;  1GPX A;  1J7C A;  3HRD D;  3AN1 A;  2PIA A;  5AUK A;  3ETR A;  1FMA D;  3NS1 A;  3P1M A;  1QT9 A;  3AE1 B;  1QOB A;  3AE2 B;  1RM6 C;  5C2T B;  3AE9 B;  3HUI A;  1YQ4 B;  1RWS A;  4IDI A;  3AEF B;  5C3J B;  2K5P A;  3VR9 B;  3PO0 A;  3AEB B;  4C80 A;  1L5P A;  3NRZ A;  1JAL A;  1WYG A;  3P4S B;  1KF6 B;  1L0V B;  2CJN A;  5H8Y E;  1N5W A;  4N6E B;  3ABV B;  1NYR A;  3W5V B;  4ZOH C;  1I7H A;  3VRA B;  1WRI A;  2PVG C;  2W3S A;  3AMZ A;  1XLO A;  4C7Z A;  2G1E A;  2WQY B;  1XLQ A;  3B2G A;  4FXC A;  1NVI D;  5H92 C;  1JWA D;  2OHF A;  1E10 A;  1L6V A;  3NVV A;  1RYJ A;  4YTN B;  3HVZ A;  4P6V F;  4C7Y A;  4YTP B;  1FRR A;  2MJ3 A;  3DWG C;  1VLB A;  2M56 B;  1NYQ A;  3CIR B;  3EUB 2;  1YQ3 B;  3AE8 B;  1OQR A;  2DBY A;  3LB8 C;  2W54 A;  1PFD A;  1J7B A;  1T3Q A;  1NEK B;  1FRD A;  2MJE A;  5EE3 A;  4US8 A;  1J7A A;  1FXI A;  2L52 A;  1PDX A;  1QOG A;  1WWT A;  3P63 A;  4JWS C;  4N58 A;  5EE9 A;  1GAQ B;  5EE1 A;  1YJJ A;  5GXG B;  1SIJ A;  1N62 A;  3AV8 A;  4WWM A;  1QF6 A;  1WXQ A;  2QIE B;  4KX6 B;  1DOI A;  3DWM A;  3W5U B;  2BS3 B;  1EWY C;  2W55 A;  1JRP A;  1XLP A;  4YSX B;  1FFV A;  1TKY A;  3VR8 B;  1SF0 A;  3FAH A;  1GTE A;  2WDR B;  2BS4 B;  1B9R A;  4WQM A;  3B9J A;  4YSZ B;  2WDQ B;  2Q5W D;  4YTM B;  1DOY A;  4USA A;  1XLN A;  2WU2 B;  3VRB B;  1XO3 A;  3AE7 B;  1NEN B;  2HTM E;  1ZXI A;  2CJO A;  3NVZ A;  3L4P A;  4LTU A;  3AE5 B;  1CJE A;  2PKO A;  1JWB D;  1NI3 A;  1OFF A;  1AYF A;  1N63 A;  3SR6 A;  4ZHP A;  1QLB B;  1VDV A;  1FO4 A;  1L6U A;  1QOA A;  2WS3 B;  1ZUD 2;  2E3T A;  2QJL A;  3AEA B;  1F0Z A;  2WDV B;  3AE6 B;  1KRH A;  1TJE A;  4JX1 C;  4A9A A;  2H89 B;  1FXA A;  3RPF C;  1IUE A;  4YSY B;  1ROE A;  2EKI A;  1N5X A;  2PVO D;  3CF4 A;  1E9M A;  3FC4 A;  4HRS A;  3BII D;  4US9 A;  1AWD A;  2BT6 A;  2CU3 A;  3P4Q B;  1E7P B;  3P4P B;  1OQQ A;  2FBW B;  2KAJ A;  2W3R A;  2WLB A;  3WCQ A;  4ITK A;  2M19 A;  3AE3 B;  1DGJ A;  2K22 A;  3KWL A;  2MJD A;  5MPO A;  1A70 A;  1VJK A;  2WP9 B;  1FIQ A;  3AE4 B;  1TKE A;  3CWI A;  1CZP A;  1JW9 D;  4YXD B;  3AEG B;  2KMM A;  2AX5 A;  1E0Z A;  1JQ4 A;  2L83 A;  3W9C B;  1TKG A;  3NVW A;  2LEK A;  2K9X A;  1DOX A;  1PUT A;  2B76 B;  5G5G A;  1UWM A;  3AH7 A;  3AM9 A;  2JX5 A;  2ACZ B;  3AED B;  1QOF A;  4HRO A;  1V97 A;  2BS2 B;  3SFE B;  1FFU A;  1JRO A;  2Y5C A;  3LXF A;  1GTH A;  2JQR B;  1GT8 A;  4JWU C;  2MH7 A;  1H7X A; 
#chains in the Genus database with same CATH topology
 4EE2 A;  1E6E B;  2ON8 A;  2ZPY A;  1WGY A;  1N60 A;  3Q8E A;  2D2Q A;  1D5X C;  4NPN A;  2QCZ A;  3HUI A;  3PO0 A;  2L0F A;  1WE6 A;  3P42 A;  4C80 A;  3CF6 E;  2VH2 A;  4URK A;  3ZJT A;  3N30 A;  4FJZ A;  3QQ8 B;  1L0V B;  2BYE A;  2V4I B;  3MC9 A;  3RUL A;  1LXD A;  4NAW A;  1WRI A;  4IUM B;  4HCP B;  2WXQ A;  4MT5 A;  1KOT A;  3DBH I;  1XLQ A;  4NZL B;  1D5Z C;  1YMH E;  1XEE A;  4K7S A;  5DPT A;  2K25 A;  2K1F A;  1IBX B;  2KAN A;  3IFW B;  2BPS A;  1LM8 B;  2ZVO A;  4JWS C;  5JHB A;  2L76 A;  5GXG B;  4OZB A;  2K0P A;  1WZ0 A;  2RDG A;  2WDT B;  3KUC B;  1BML C;  4TV3 A;  2C9W B;  1XCQ L;  1V86 A;  4WAF A;  2V0G A;  1JML A;  1JCK B;  2IYD B;  3U52 E;  2FCQ A;  2D11 A;  3DOW A;  4MH8 A;  2KNB A;  2O2V B;  4JX1 C;  2GI9 A;  3U7Z A;  3VTU A;  3ZNI D;  1FXA A;  2J42 A;  2LVO A;  2PVO D;  4CO7 A;  5IN7 A;  3NZ3 A;  1AWD A;  2LGY A;  1OQQ A;  4ANX A;  1WGR A;  1WJ4 A;  1OGW A;  5CHW A;  1QKZ A;  5MPO A;  1Z2M A;  1VCB A;  2M1M A;  1GJZ A;  3AUL A;  2AX5 A;  4W9E A;  1DOX A;  4I6P A;  2MCN B;  3D32 A;  1L7Y A;  4M0W A;  1EM7 A;  2KZR A;  2JX5 A;  3T9L A;  2C5L C;  1HXY D;  2IPK D;  5C1Z A;  3GZN B;  1TYG B;  3RZW C;  1H7W A;  4GB9 A;  4KSL C;  3NVY A;  3HRD D;  3GOE A;  3ZRC A;  2I38 A;  3AE1 B;  5HHD G;  3AE9 B;  1YQ4 B;  2CR5 A;  2K5P A;  4CYE A;  1S1Q B;  3PTF C;  1YN4 A;  2DAJ A;  2FCN A;  4DHZ B;  3PLV A;  3ZJU A;  2ZZP B;  2BB6 A;  2LI5 A;  3MTN B;  3ZGZ A;  3M95 A;  2G1E A;  2KX3 A;  2C7H A;  2PW9 A;  5IO9 A;  1VR9 A;  4NAW B;  1FRR A;  1DYQ A;  1C78 A;  1F2R I;  1NEK B;  1IGC A;  2PEA A;  2NTT A;  2KT7 A;  2BW2 A;  1AW7 A;  2QIE B;  3SD5 A;  2UWQ A;  2V3N A;  4PT5 A;  3A9K A;  3Q2A C;  1TZ1 A;  3BWU D;  5DPR A;  4YSZ B;  4GSW A;  5HG2 A;  1NEN B;  1H4R A;  1HE8 A;  3QAR A;  1AAR A;  2LWP A;  3N1X C;  3KUZ A;  3O65 B;  1HTO A;  1J19 A;  1UNS A;  4MH0 E;  3R3M A;  3UQB A;  4YSY B;  2XNA C;  1ZKH A;  4XYC A;  2G45 B;  3AE3 B;  1V80 A;  2ICI A;  2GBK A;  2C7M B;  4A90 A;  3PPA A;  4M8M A;  3RYT A;  5HKH A;  1PUT A;  1UWM A;  3AH7 A;  4ICU A;  2ZPN A;  4JQW C;  1JRO A;  1FFU A;  3GE8 C;  4PK1 A;  2L32 A;  3CSF A;  3RFZ B;  1N61 A;  3RNG C;  4M0W B;  1TTN A;  1SB3 C;  2LXC A;  3L08 A;  4N59 A;  4YT0 B;  1GPX A;  3AEC B;  3ZKJ C;  1J7C A;  4RF0 A;  1K52 A;  2KAC A;  3RMK C;  3NS1 A;  4OZA A;  3KH0 A;  1V1P A;  4IDI A;  2FAZ A;  2K8B A;  3I5J C;  1WX8 A;  1JAL A;  3JYU A;  4DHZ E;  4ZRP A;  3RUI B;  3O13 A;  1N5W A;  3PLU A;  3Q14 C;  3WAL A;  1I35 A;  1FNW A;  1XLO A;  2WQY B;  4RMA A;  4G11 A;  1IYF A;  4GU2 A;  3DWG C;  1VLB A;  3FIL B;  3CIR B;  2JZ3 B;  4HJG E;  5L83 A;  3BK1 A;  3N32 A;  2KXJ A;  4N58 A;  1XXG A;  4DK5 A;  4HPL B;  2JRI B;  3DWM A;  3W5U B;  3WAP A;  4ASW C;  2QDF A;  1RAX A;  2IY1 B;  2QSD A;  3ZXR A;  1WGG A;  2V9H A;  2WDQ B;  3I63 C;  4KGS A;  3VXW A;  3DHH C;  3R2I A;  4FJV B;  3WAO A;  1MJD A;  1ZUD 2;  5DPS A;  4MDK E;  2QJL A;  3NUH B;  4TKN A;  4A9A A;  4AUQ C;  1F2R C;  3ZJV A;  2G4S A;  1RRB A;  3OWE B;  3RNB C;  4C56 C;  4EZK A;  3TSS A;  3A1Q A;  3AE4 B;  2IO1 B;  2LJ5 A;  3ZXV A;  3X0W A;  1VRA B;  4B0E A;  3A4R A;  1TGZ B;  2MH7 A;  1QZE A;  5JZE B;  1SXT A;  2D3A A;  2DZJ A;  2KDI A;  3H1U A;  3AEE B;  1V8C A;  1R4N B;  2N9E B;  1Q0W B;  3VH3 B;  3VTW A;  1ZDX A;  1UBI A;  1GB4 A;  2FID A;  4WJN A;  3J9C A;  4ZRQ A;  1OEY A;  2N9L A;  2PVG C;  4NQK E;  3BZD B;  3Q3M C;  5HI1 A;  1JWA D;  2J0J A;  4YTN B;  2BYF A;  2BB5 A;  2MBO A;  3BVZ A;  1WGH A;  2GBN A;  5BMH A;  4MSM B;  5EE9 A;  1SE3 A;  3AV8 A;  4MGK E;  1I4P A;  1JRP A;  1KTK A;  2M4N A;  3EHV A;  2MQJ A;  4YTM B;  1DOY A;  2D07 B;  2WXO A;  4X57 B;  2KFK B;  3VRB B;  1YIW A;  1XO3 A;  2GBR A;  3KLS X;  2MEK A;  4GDL B;  2WXM A;  4FN2 A;  4DDG D;  2M0A A;  2KTR A;  2SEB D;  2RPQ A;  1T0S C;  2MBQ A;  4XC2 A;  1OEY J;  1N5X A;  4J3O D;  1E9M A;  1UBQ A;  2CS4 A;  3DHG C;  2M19 A;  4ACF A;  1N6Z A;  1E8W A;  3CWI A;  4A3O A;  5I4D A;  1RLF A;  4P1B C;  1Q5W B;  4BBN F;  3ZRF A;  3C0R B;  3A1Q B;  1LQB A;  1XCT L;  4B95 A;  2REX A;  4IOI E;  4RM8 A;  1TS3 A;  1D6E C;  4RCO A;  2KDM A;  3SFD B;  1MHH E;  2ZJD A;  1UF0 A;  3OJ4 B;  1KFY B;  4K7W A;  1E8X A;  4OZC A;  2L3Z A;  1WXA A;  4FJY A;  1KLG D;  3Q3J A;  2KD0 A;  2J53 A;  2KLG A;  1SJH D;  3RT3 B;  3PZ8 A;  1C4P A;  3SDL C;  5J2R A;  3QIJ A;  2PMV A;  3U2S C;  3DQV A;  4EZL A;  1C9F A;  1ISN A;  2LFI A;  3QWZ B;  4FXC A;  1L6V A;  3CST A;  4C7Y A;  2BWE S;  1FXT B;  1FRD A;  1SEB D;  3KVF B;  3WAN A;  2J0M A;  2WX0 A;  4HPM B;  1QF6 A;  4MEM A;  4W9I A;  4C00 A;  4W9J A;  4XE0 A;  2J4X A;  2IBI B;  3NS8 A;  4WWP A;  2WDR B;  1HQR D;  2BS4 B;  2LAS A;  3PS6 A;  3UIP B;  4BZA A;  3TEX A;  4FA6 A;  2WU2 B;  2RGF A;  2KMA A;  3NVZ A;  3L4P A;  3AE5 B;  2PKO A;  1NI3 A;  4DQO C;  2INN E;  3ZTC A;  3ZVV A;  1TS4 A;  2QIL A;  1KRH A;  2V3S A;  2H89 B;  1ROE A;  2N7E A;  2BT6 A;  1KLU D;  1YX6 B;  1K53 A;  3P4P B;  4DXF A;  3DVN U;  2W3R A;  2WLB A;  4BKG A;  2JT4 B;  2JWU A;  4QAY A;  1JRU A;  4BKS A;  4GXB A;  4EKU A;  4EOY A;  1TKG A;  2K9X A;  2MW5 A;  3GS2 A;  4AP4 C;  3UF8 A;  2A5U A;  2IO0 B;  3Q6B A;  1TY2 A;  1UGJ A;  4HRO A;  2KJR A;  1V97 A;  4LNN A;  3MC0 B;  4RH6 A;  1WGK A;  4PS3 A;  3V3X A;  1EWC A;  4TQ1 A;  5G5H A;  2HDE A;  2GOW A;  2H88 B;  4P1C C;  4MSQ B;  3L16 A;  1E7U A;  5J17 A;  5BMI A;  2LHE A;  3DBL B;  1IGD A;  2NBU A;  1XT9 B;  3B08 A;  3B1L X;  1GOZ A;  2DYM A;  2KVZ A;  2JF5 A;  1R4M B;  2X38 A;  5BO4 B;  2KQ4 X;  2MP2 A;  2FCM A;  2KWD A;  5IKC M;  2PLP A;  4XDD A;  2R2Q A;  2I2Y A;  2Z59 B;  3WAM A;  3QCA A;  3IAM 1;  1YJJ A;  1L0X B;  1T0R C;  1WXQ A;  2DLB A;  3EFU A;  2WHI A;  3T3O A;  2BF8 B;  1HA5 A;  2NBW B;  4HLE A;  4NQL B;  4PYU A;  3NZS A;  2FIF A;  2K39 A;  1SJE D;  3UI3 A;  3BK2 A;  3TUO A;  1WM2 A;  4AS1 A;  2KYW A;  2WXL A;  2HTM E;  3EA6 A;  3H6N A;  3PRP B;  4NJ7 A;  2R61 A;  5E6O A;  2KO3 A;  4A55 A;  3RN9 C;  3RNF C;  2ZCC A;  3RZF A;  5L95 C;  3U8Z A;  4WWN A;  2D3C A;  3AE6 B;  1ZW7 A;  3AU5 A;  4YWG G;  1IUE A;  2JRH A;  3ZDM C;  1YQB A;  4JPS A;  5GMV A;  1TKE A;  1IP9 A;  3K9P B;  2G4D B;  2ZCB A;  1MHX A;  2W82 A;  3OJ3 A;  3IAS 1;  2JQR B;  3M63 B;  1TZO A;  5JHA A;  1RFK A;  2MHJ A;  1ZP0 B;  1XQQ A;  4IC7 B;  3VUY A;  2AWT A;  2NR2 A;  2WX1 A;  3R8B A;  4ZHO A;  4L1B A;  4WJO A;  5AUK A;  3RCZ A;  3NY5 A;  1YOV B;  3E56 A;  2HD5 B;  2RR9 A;  2KHW B;  3EGR A;  1TBE A;  3ZDT A;  2DNF A;  3R66 C;  2K8C A;  1I7H A;  4C7Z A;  3VHT C;  1SGH A;  2A4Z A;  1E10 A;  2N1V A;  3W1Y A;  4WQO B;  2MRP A;  4HJK A;  4P6V F;  4GGQ A;  3VDZ A;  4WH4 A;  2JPH A;  1WJ6 A;  2VH1 A;  2E6X A;  2BKR B;  2VRR B;  1WF9 A;  1SIJ A;  4LLG M;  5IA7 A;  2L0T A;  1EF5 A;  2AQ2 B;  2PTL A;  4WWO A;  2R2O A;  4DXA B;  2GB1 A;  3R7R A;  1WJU A;  2PPH A;  1TT5 B;  1ZPS A;  1ZXI A;  3M62 B;  3VH4 B;  4ZHP A;  1AYF A;  4MGY E;  1HEZ E;  1L2N A;  2MBB B;  1WXV A;  2GLS A;  3APF A;  3FC4 A;  3PRZ A;  1EU3 A;  2FBW B;  5CX3 A;  5LLI A;  3N3K B;  3IG3 A;  1ZDV A;  5D6J B;  1CZP A;  4ZYS A;  3LDZ E;  4PYZ A;  1BXT A;  4HEA 1;  3WA0 A;  1PGX A;  4ZDV A;  2ZW0 A;  3Q8A A;  2MX2 A;  4M02 A;  3AXC A;  1ZOY B;  4AWJ A;  3AB5 A;  2DWQ A;  2QEJ C;  2D5G A;  2GBM A;  4LNI A;  5J18 A;  3IXS A;  1KJT A;  1TS2 A;  2PIA A;  3ETR A;  3ZTD A;  4ZYN A;  1Q10 A;  4BKS D;  3RD2 A;  5LNK 1;  3V6E B;  3H8H A;  2ZNV C;  1UD7 A;  1U4A A;  3JSV A;  4N6E B;  2FNJ B;  1UZX B;  2XK5 A;  2OJW A;  3DBR I;  1MI0 A;  4EZJ A;  1V2Y A;  3HVZ A;  4CQN A;  2UYZ B;  3QAQ A;  3EUB 2;  4W9L A;  2DBY A;  2RMM A;  1P0R A;  2MBH A;  3QA8 A;  2ONQ A;  2J7Q B;  4UDU C;  3W1S C;  1UGM A;  1AN8 A;  4KZ0 A;  2JZP A;  1GC7 A;  4RGM A;  4N9F 4;  1M4V A;  4REZ A;  2EKE C;  4FAD A;  2ZVN A;  1FCL A;  2Y5B B;  3ZLZ A;  3L0W B;  1FNV A;  4GIV A;  4RF1 A;  1C76 A;  3WIM A;  2WNM A;  1LO5 D;  1KH0 A;  2CU1 A;  4K3B A;  4S17 A;  4HRS A;  3H7P A;  4KZC A;  3ZNZ B;  4W9K A;  3M3J A;  4ITK A;  1A70 A;  2RSU A;  3A9K B;  3S2A A;  4LJP B;  3AEG B;  1MVK A;  2K8H A;  4HPP A;  2L05 A;  2J52 A;  3Q8F A;  4NY0 A;  3N9Y C;  2DZI A;  3AM9 A;  5FR6 A;  4AJW A;  4IG7 B;  3MFG A;  1I4Q A;  2WU5 B;  2BKF A;  5CHV C;  3ZYY X;  4LNF A;  3A4S C;  1UWX A;  5TR5 A;  2WXG A;  4ICV A;  3B2F A;  3HHM A;  3QK0 A;  5KHO A;  3QJZ A;  1TY0 A;  1WIA A;  5FR3 A;  1P9D U;  3ZW3 A;  1WM3 A;  2MA9 B;  3L13 A;  1D4B A;  1ESF A;  1WYG A;  5E6P A;  5H8Y E;  4ARC A;  3JVZ X;  1NYR A;  5G55 A;  3GB1 A;  3B2G A;  3PHX B;  1NVI D;  1WH3 A;  3VUX A;  4LK0 M;  5D7G A;  2IY0 B;  3JSV B;  4YTP B;  2FCS A;  2XK5 B;  5EE3 A;  1J7A A;  4WJP A;  3RNC C;  3Q3O C;  4DDI D;  5EE1 A;  1WRD B;  2YLM A;  1V1P B;  1XLP A;  4YSX B;  1FFV A;  1TKY A;  1MFW A;  1WYW B;  3ONS A;  1I4G A;  4KIK A;  2KFJ A;  4FLH A;  2WXI A;  1XLN A;  4P7I A;  1H8C A;  2CJO A;  2WXF A;  1N63 A;  5TSS A;  1RFA A;  1EU4 A;  2E3T A;  3AEA B;  1YJ1 A;  1F0Z A;  1EO6 A;  3AI5 A;  4TQ0 A;  1T5X D;  2JXX A;  2CU3 A;  1MG4 A;  3WCQ A;  4BOZ B;  2VZK B;  2M17 A;  3H7P B;  1A5R A;  4IWO A;  3BVG A;  3VFK A;  3QHT A;  2L83 A;  2INP E;  1V5T A;  2L1A A;  2N9X A;  2FUG 1;  4M01 A;  1Y56 A;  3ZQ4 A;  2ACZ B;  1C77 A;  1NBF C;  3SFE B;  2GBJ A;  3LXF A;  2XN9 C;  5IP4 D;  4DBG A;  1MG8 A;  1YJI A;  4IWQ A;  1K8R B;  2LD9 A;  1R7S A;  1KLV A;  3NOB A;  3V62 A;  4HWI B;  2TSS A;  4K7U A;  2Y5P A;  5BYS A;  1QOB A;  1WGD A;  3VR9 B;  2LGX A;  3NRZ A;  1L0Y B;  3TL5 A;  1Z5S B;  4OVU A;  4M8N A;  1FEH A;  1Q1O A;  1F77 A;  3W5V B;  1P7F A;  3NHE B;  2BGF A;  1WR6 E;  4XWT A;  2IGH A;  2KK8 A;  2DEN B;  2OOB B;  3NVV A;  4R3D A;  1FNU A;  3L17 A;  1SIF A;  1OQR A;  1J0G A;  1FCC C;  2NS5 A;  1GG3 A;  1K51 A;  2O6V A;  2JU6 X;  4OVZ A;  1B1Z A;  2L7R A;  3C19 A;  1T6B X;  3A33 B;  1EWY C;  2MSE D;  2N9P C;  3VR8 B;  2OJR A;  3GZN I;  3X23 A;  1FPY A;  3B9J A;  1V9J A;  3PRE A;  1EUV B;  2AL3 A;  4KIK B;  1VDV A;  4KGT A;  2AQ1 B;  2LHD A;  2BQQ A;  3KUD B;  4A3P A;  4HKQ A;  2CHW A;  3MC8 A;  3NJT A;  5T8I A;  3CF4 A;  2I1J A;  3ML9 A;  1YNT E;  1ZGU B;  1C4A A;  2IND C;  1CMX B;  4RFB A;  4B0M A;  2K6D B;  2LXA A;  2DZK A;  5DPW A;  2WGS A;  3A9J A;  2LEK A;  5G5G A;  3TMP B;  2FE8 A;  4BAX A;  3KYD D;  2VZK D;  1P7E A;  1IBX A;  2N0S B;  4JL9 A;  2KTR B;  4LNO A;  2HE7 A;  4FHK A;  2QC8 A;  4HXD A;  2G9H D;  1FMA D;  1RM6 C;  5C2T B;  4YL8 A;  3AEB B;  1M94 A;  2D3B A;  3MHS D;  4NJC A;  1HZ6 A;  3VVW B;  3NZU A;  3TBL D;  1JWM D;  1WXM A;  3U4E G;  3VRA B;  1I4X A;  1YD8 U;  3VUW A;  2LVP A;  5BYR A;  2IO2 B;  4DWF A;  3MJW A;  1V81 A;  1UH6 A;  1ZE3 D;  4JE3 B;  1YQ3 B;  1WMH A;  2L52 A;  3HK0 A;  3OAW A;  4WWM A;  5JH5 C;  2D10 A;  4LNK A;  4LDT B;  2O6V B;  2LGS A;  2KKC A;  3PRM B;  4BFR A;  5E6N A;  1WE7 A;  3IBE A;  2Z8L A;  3AE7 B;  4L23 A;  2MLB A;  4LTU A;  5IAA C;  2KJ6 A;  1JWB D;  1FO4 A;  3ENE A;  3OG5 A;  3TIX A;  1VD2 A;  4FHJ A;  5C23 A;  2WXH A;  4F8C B;  1GC6 A;  3DDC B;  4RM9 A;  2BTE A;  3DCG A;  5LXH A;  2N4F A;  2INC C;  4MAC A;  1VJK A;  4I6N B;  2LRU A;  5KHQ A;  2KQ7 A;  1E5W A;  4IM3 A;  1C1Y B;  1HZ5 A;  4KDL B;  1WSP A;  3PZD A;  1C3T A;  3AED B;  2BS2 B;  2RD0 A;  4BOS C;  5FK9 C;  4JWU C;  2LUM A;  3A9J B;  2LRW A;  1YX5 B;  2KN5 A;  2MBE A;  3K9O B;  2V3P A;  4ARI A;  2KTF A;  1FD6 A;  3ZNG C;  5C3J B;  1SE9 A;  3EC8 A;  2EMT A;  3Q8B A;  3KWV A;  3ECI A;  1D3Z A;  4NNJ B;  3TJP A;  2LGI A;  4E74 A;  1GNU A;  1F52 A;  3MJ5 A;  1MPE A;  3KQ4 A;  3ZO5 B;  4I6L B;  4BVU C;  3DBS A;  2KLC A;  5EDS A;  1SSN A;  5BMG A;  3LB8 C;  3LYY A;  2YEP F;  2W54 A;  3EEC A;  4US8 A;  3L10 B;  1OTR B;  1PDX A;  1QOG A;  2EEL A;  2FUH B;  1PQS A;  2KOX A;  3E9S A;  3UGB B;  2KQS A;  1GAQ B;  2NCN A;  4D2K A;  3TCA A;  1BUI C;  1WMH B;  2BS3 B;  2NMQ A;  5AZH A;  3ZNH B;  2N7J A;  2ZEQ A;  4OW0 A;  1JWS D;  1P3Q U;  2C60 A;  4ZRK A;  2PJH A;  3APC A;  4MEL A;  2KWC A;  1R4N I;  1E90 A;  4TUU A;  1D5M C;  2MP2 B;  3UIN B;  3SR6 A;  2KN4 A;  5E6J A;  5DCN A;  4LDT D;  5JXV A;  2O6V D;  2WXJ A;  3VAW A;  2NVU I;  4H2A A;  4HK2 A;  2EMS A;  2YEP B;  3MHZ A;  2BBC A;  2EKI A;  4DXG A;  2L00 B;  4TMA B;  1V49 A;  2K22 A;  2WP9 B;  1FIQ A;  4YXD B;  2JXT A;  1VZ7 A;  5CHF A;  1E0Z A;  1WFY A;  2B3A A;  4JLC A;  1F1H A;  2B76 B;  2Y5C A;  3JW0 X;  4ZRI A;  1QIL A;  3GE3 C;  3H7S A;  3U30 A;  1S3S G;  2AQ3 B;  3FIL A;  3V60 A;  2KX0 A;  4DHJ B;  4KKJ A;  3P4R B;  4GN1 A;  1XD3 B;  1FM0 D;  2D3G A;  4WIP A;  2BYV E;  4JIO U;  3MP9 A;  1QT9 A;  3AE2 B;  2OED A;  2MWS B;  4IM0 A;  2LVQ A;  2IO3 B;  1P1A A;  1I42 A;  3RNA C;  4G0N B;  4II3 B;  4GOC A;  1KF6 B;  4IKG A;  1SBB B;  2W3S A;  3V6C B;  1PYW D;  3UQA A;  2JVC A;  3H9D A;  2RDH A;  3SU8 X;  4GDK A;  4K1R B;  1J7B A;  1T3Q A;  2JYE A;  4PS8 A;  4MJS A;  3Q3F A;  2KDF B;  4BKT A;  3R7Q A;  1UUP A;  4A6Q A;  5BYQ A;  3T3N A;  2N1W A;  4IW0 A;  1XF5 L;  2WXK A;  5IOI A;  4S0R A;  2V1Y A;  3W1S A;  4B6W A;  3FAH A;  4MGI E;  4HVB A;  4A20 A;  4XZ4 A;  4P16 A;  2DYO A;  1CJE A;  3VTV A;  3RNE C;  4LJO B;  1K50 A;  2BYT A;  1L6U A;  4EFO A;  1ENF A;  2BWF A;  5AZF A;  3BYT B;  2M0X A;  2DZM A;  1LFD A;  1I4R A;  2J0K A;  2KC2 A;  2KAJ A;  3B0A A;  2JZZ A;  2MJD A;  1LGR A;  1E7V A;  2Y3A A;  3LJ3 A;  1V1O A;  3N20 C;  3NVW A;  5D3D A;  3PSE B;  3ALB A;  2YVC A;  4RGN A;  3BY4 B;  3CMM B;  1GT8 A;  1H7X A;  2PE6 B;  2IDY A;  3IT6 B;  3R2T A;  3U7D A;  1WJN A;  4Q2J A;  5AUI A;  3DBH B;  4W9F A;  4KVG B;  3SEB A;  4EUT A;  3KYC D;  4MGZ E;  2AYO B;  2I1K A;  2CHX A;  1TIF A;  2N7D A;  4W9G A;  1GB1 A;  2DX5 B;  5EE0 A;  4M00 A;  2W9N A;  1WY8 A;  2JY6 A;  3BVM A;  5FKA C;  4DHJ D;  2WXP A;  4F7Z A;  2NPT A;  1BT0 A;  5AEK B;  3PHW B;  2KFK A;  4F1S A;  2V4L A;  3ABV B;  3AMZ A;  2IGD A;  4HKZ E;  4GDL A;  4AOF A;  3V61 A;  2ZW1 A;  4HCN B;  2G3Q B;  5H92 C;  2UU7 A;  2ZNV B;  1T0Q C;  1X1M A;  3AE8 B;  2JWZ A;  2L8J A;  3PT2 B;  2MJE A;  2WXN A;  2LUE A;  3RI7 C;  3I57 A;  3P63 A;  1WWT A;  2X8X X;  2QHO A;  4W9D A;  3BYY B;  4GDK B;  1N62 A;  4KX6 B;  1C79 A;  1P98 A;  3QX1 A;  4AQ7 A;  2ASQ A;  4NJ6 A;  2W55 A;  1OQY A;  3Q69 A;  2WWZ A;  4JGH B;  4MJS B;  4CHK A;  4KKI A;  1SF0 A;  4PS7 A;  3HVD A;  4WQM A;  2LMC A;  4USA A;  3DBL I;  2KWU B;  1WZ3 A;  3TEY A;  5LXI B;  2Z0D B;  4G3X B;  3T8M A;  4ANU A;  1HTQ A;  1Y8R C;  2DHZ A;  1R4M I;  2LGD A;  4LCD E;  3BII D;  4US9 A;  4E3C A;  4ZRJ A;  3C8Y A;  3KWL A;  4XWW A;  1ZXH A;  4A8X C;  2M8S A;  1NDD A;  1PGA A;  4KSK C;  2CHZ A;  4II2 B;  3URY A;  2IJ0 A;  3EFC A;  2KMC A;  4NAM A;  1E8Z A;  1NI2 A;  1TS5 A;  2PE9 A;  4XX5 A;  2Z0E B;  1YN3 A;  2KDB A;  3AU4 A;  4BBN C;  3P1M A;  3IHP C;  4O1N A;  1L5P A;  2WXR A;  4GMV A;  4IM2 A;  2CJN A;  3N1Z C;  3DVG Y;  2KDE B;  2LZ6 A;  2KC1 A;  2NPT B;  2OHF A;  1RYJ A;  3GP7 A;  2MJ3 A;  4W9H A;  4C4V A;  4WAA A;  5CTR C;  1PFD A;  4FUL A;  4KDI C;  3PV1 A;  2WYQ A;  3BIN A;  3IVF A;  1SE2 A;  4ANW A;  1DOI A;  1WI0 A;  5G2N A;  3DVG X;  4RGT A;  1CQV A;  1B9R A;  2HTH A;  4HDQ A;  1T0Y A;  2JUO A;  1OFF A;  2K3U A;  4EEW A;  2WS3 B;  1PGB A;  1L4Z B;  3VQI A;  1V6E A;  4K3C A;  2QMT A;  4K81 A;  1SE4 A;  2KJH B;  4MM3 A;  1C4C A;  2XEW A;  3DBR B;  1VZ6 A;  2RDB C;  1JW9 D;  2K6Q A;  2KMM A;  3DVN V;  3P2B A;  4XDC A;  1QOF A;  3PGE A;  1L4D B;  3APD A;  4RNA A;  3I9V 1;  3NG0 A;  5AZG A;  2JYT A;  5D3I B;  4ANV A;  1ET9 A;  2C7N B;  3PVL A;  3QC8 B;  4W9C A;  3AN1 A;  1CK1 A;  4KV2 A;  1YN5 A;  4B9K A;  2IGG A;  2N9K A;  1RWS A;  2KWV B;  3AEF B;  1WX9 A;  4HDO A;  2AEH A;  3HM6 X;  4GLS C;  2IZV B;  2CKH B;  2DAF A;  4AJY B;  3KW5 B;  3SHQ A;  3P4S B;  1J8C A;  3ML8 A;  1F9J A;  1GUA B;  3HM3 A;  3DPD A;  4ZOH C;  3V05 A;  2HJ1 A;  1KM7 A;  4G50 A;  2RPV A;  4WUR A;  4L2Y A;  1E8Y A;  2M56 B;  1NYQ A;  2BVC A;  2AL6 A;  2GRI A;  2XBB C;  3PZ7 A;  3W2D A;  1FXI A;  5D94 A;  1JWU D;  3L54 A;  2SAK A;  4C4V B;  3OLM D;  4RGO S;  1IPG A;  5D2M B;  3HIZ A;  4FBJ B;  5HFY A;  1QQR A;  3UIO B;  1GTE A;  3IT4 B;  1UEL A;  3Q3N C;  2Q5W D;  4IWP A;  4OHJ A;  4WJQ A;  1STE A;  4OVV A;  2O2V A;  3ZIM A;  3TEW A;  1WX7 A;  1I4H A;  3TEZ A;  1QLB B;  1QOA A;  4E71 A;  1ACC A;  1WXS A;  2LJI A;  2HJ8 A;  2KVR A;  2WDV B;  1TJE A;  3N1Y C;  3RPF C;  4TSS A;  2JSV X;  2DYB A;  3P4Q B;  1E7P B;  1EF1 A;  1V5O A;  2GMI C;  1ET6 A;  4J6I A;  3I3T B;  1DGJ A;  2NTS A;  1VZ8 A;  4XGA B;  3ZUN A;  3Q8C A;  1JQ4 A;  4MM3 B;  1WR1 A;  3W9C B;  4KGR A;  3FKY A;  1G6J A;  3DHI C;  2NBV B;  1GTH A; 
#chains in the Genus database with same CATH homology
 1TS3 A;  1D6E C;  4EE2 A;  3MFG A;  4RCO A;  1I4Q A;  2AQ3 B;  2WU5 B;  3FIL A;  3ZYY X;  2KDM A;  1E6E B;  3SFD B;  1MHH E;  2ON8 A;  4KKJ A;  3P4R B;  1UWX A;  2WXG A;  3B2F A;  1N60 A;  1KFY B;  1FM0 D;  3Q8E A;  4WIP A;  1TY0 A;  5FR3 A;  1D5X C;  3MP9 A;  1QT9 A;  4OZC A;  3AE2 B;  2OED A;  3HUI A;  3PO0 A;  1D4B A;  3P42 A;  4C80 A;  1KLG D;  3ZJT A;  2J53 A;  1ESF A;  1WYG A;  1KF6 B;  1L0V B;  1SBB B;  1SJH D;  2V4I B;  4IKG A;  3PZ8 A;  5H8Y E;  4ARC A;  1C4P A;  1NYR A;  2PMV A;  3U2S C;  2W3S A;  1WRI A;  2WXQ A;  3GB1 A;  4MT5 A;  1C9F A;  1XLQ A;  1PYW D;  2LFI A;  3B2G A;  1NVI D;  1D5Z C;  4FXC A;  4NZL B;  1YMH E;  1XEE A;  4LK0 M;  5D7G A;  1L6V A;  4C7Y A;  4YTP B;  2RDH A;  1IBX B;  1J7B A;  1T3Q A;  5EE3 A;  1FRD A;  1SEB D;  2JYE A;  1J7A A;  1UUP A;  4A6Q A;  5BYQ A;  4JWS C;  3T3N A;  5EE1 A;  5GXG B;  1QF6 A;  1XF5 L;  4OZB A;  2WXK A;  4XE0 A;  1V1P B;  2J4X A;  1XLP A;  2K0P A;  4YSX B;  1FFV A;  1TKY A;  2RDG A;  3W1S A;  3FAH A;  2WDR B;  1HQR D;  2BS4 B;  1BML C;  1I4G A;  4P16 A;  2WXI A;  3TEX A;  1XCQ L;  1XLN A;  2WU2 B;  4WAF A;  2V0G A;  1JML A;  1JCK B;  2CJO A;  2DYO A;  3L4P A;  3NVZ A;  3AE5 B;  3U52 E;  1CJE A;  2PKO A;  1NI3 A;  2WXF A;  4DQO C;  1K50 A;  1N63 A;  5TSS A;  2INN E;  2BYT A;  1L6U A;  1EU4 A;  4MH8 A;  2E3T A;  3AEA B;  1ENF A;  1TS4 A;  2QIL A;  1F0Z A;  1KRH A;  4JX1 C;  2GI9 A;  2H89 B;  3U7Z A;  4TQ0 A;  1FXA A;  1T5X D;  1ROE A;  2J42 A;  2PVO D;  3BYT B;  1AWD A;  2BT6 A;  2CU3 A;  1KLU D;  3NZ3 A;  1K53 A;  3P4P B;  1OQQ A;  1I4R A;  2KAJ A;  4DXF A;  2W3R A;  2WLB A;  3WCQ A;  2VZK B;  1QKZ A;  2MJD A;  5MPO A;  2JWU A;  2Y3A A;  3BVG A;  2AX5 A;  2L83 A;  1V1O A;  2INP E;  1TKG A;  3NVW A;  5D3D A;  1DOX A;  2K9X A;  2L1A A;  2FUG 1;  3GS2 A;  4M0W A;  1EM7 A;  1Y56 A;  1TY2 A;  2ACZ B;  1C77 A;  1UGJ A;  2JX5 A;  4HRO A;  1V97 A;  4RGN A;  3ZQ4 A;  3SFE B;  3LXF A;  1GT8 A;  3MC0 B;  2XN9 C;  1H7X A;  4RH6 A;  2IDY A;  1HXY D;  2IPK D;  3IT6 B;  3R2T A;  1YJI A;  1WGK A;  3V3X A;  4Q2J A;  5AUI A;  1EWC A;  1R7S A;  4TQ1 A;  5G5H A;  2HDE A;  1TYG B;  2H88 B;  1H7W A;  2TSS A;  3SEB A;  3NVY A;  2Y5P A;  3HRD D;  5BMI A;  2LHE A;  5BYS A;  2I38 A;  1IGD A;  1GB1 A;  5EE0 A;  3AE1 B;  1QOB A;  5HHD G;  3AE9 B;  1YQ4 B;  2K5P A;  3VR9 B;  3BVM A;  3NRZ A;  1L0Y B;  1YN4 A;  5FKA C;  1GOZ A;  2WXP A;  1FEH A;  2DYM A;  1F77 A;  3ABV B;  3W5V B;  2X38 A;  3ZJU A;  1P7F A;  2KQ4 X;  4XWT A;  2BB6 A;  3AMZ A;  3ZGZ A;  2IGH A;  2IGD A;  4HKZ E;  2G1E A;  2PW9 A;  2ZW1 A;  5H92 C;  1VR9 A;  2KWD A;  3NVV A;  4NAW B;  4R3D A;  1FRR A;  1DYQ A;  2PLP A;  1FNU A;  4XDD A;  3AE8 B;  1OQR A;  1C78 A;  1F2R I;  1FCC C;  2I2Y A;  2MJE A;  1NEK B;  1IGC A;  2WXN A;  3I57 A;  3P63 A;  2NTT A;  1WWT A;  1K51 A;  2JU6 X;  2BW2 A;  1AW7 A;  4OVZ A;  1B1Z A;  3IAM 1;  3BYY B;  1YJJ A;  4GDK B;  1N62 A;  1L0X B;  1WXQ A;  2DLB A;  2QIE B;  4KX6 B;  1C79 A;  3T3O A;  1T6B X;  2V3N A;  4PT5 A;  4AQ7 A;  1HA5 A;  1EWY C;  2W55 A;  3Q69 A;  3BWU D;  3VR8 B;  1SF0 A;  4KKI A;  3UI3 A;  1SJE D;  3HVD A;  4WQM A;  2LMC A;  3BK2 A;  3TUO A;  3B9J A;  4YSZ B;  4USA A;  5HG2 A;  4AS1 A;  2WXL A;  2HTM E;  3EA6 A;  1NEN B;  3TEY A;  2R61 A;  4A55 A;  1VDV A;  4KGT A;  2AQ1 B;  2LHD A;  4HKQ A;  1UNS A;  3AE6 B;  4YWG G;  1IUE A;  4YSY B;  5T8I A;  3CF4 A;  4US9 A;  3BII D;  2XNA C;  1YNT E;  3AE3 B;  1C4A A;  3C8Y A;  4JPS A;  3KWL A;  2ICI A;  4RFB A;  4XWW A;  1ZXH A;  4A8X C;  1TKE A;  4B0M A;  4A90 A;  1PGA A;  1MHX A;  2W82 A;  2LEK A;  1PUT A;  3URY A;  5G5G A;  1UWM A;  3AH7 A;  2FE8 A;  2IJ0 A;  3IAS 1;  1JRO A;  1FFU A;  4NAM A;  2JQR B;  1TZO A;  1TS5 A;  2VZK D;  1RFK A;  1ZP0 B;  1P7E A;  2L32 A;  1IBX A;  3RFZ B;  1N61 A;  2N0S B;  1SB3 C;  1YN3 A;  3R8B A;  4ZHO A;  4N59 A;  4YT0 B;  1GPX A;  3AEC B;  4L1B A;  1J7C A;  4RF0 A;  1K52 A;  2KAC A;  5AUK A;  2G9H D;  1FMA D;  3NS1 A;  3P1M A;  4OZA A;  1RM6 C;  5C2T B;  4O1N A;  1V1P A;  4IDI A;  3E56 A;  3AEB B;  1L5P A;  4NJC A;  1HZ6 A;  2WXR A;  1JAL A;  3EGR A;  2CJN A;  1JWM D;  4ZRP A;  3O13 A;  3U4E G;  1N5W A;  1I7H A;  3VRA B;  1FNW A;  1XLO A;  4C7Z A;  1I4X A;  2WQY B;  1E10 A;  5BYR A;  2OHF A;  1RYJ A;  4P6V F;  3GP7 A;  2MJ3 A;  3DWG C;  4WH4 A;  1ZE3 D;  1VLB A;  4JE3 B;  3FIL B;  3CIR B;  1YQ3 B;  4HJG E;  1PFD A;  2E6X A;  2L52 A;  3BK1 A;  4N58 A;  1XXG A;  1SIJ A;  1SE2 A;  4WWM A;  4LLG M;  1DOI A;  3DWM A;  3W5U B;  4RGT A;  2AQ2 B;  2PTL A;  1CQV A;  2QSD A;  1B9R A;  2GB1 A;  2WDQ B;  4KGS A;  2Z8L A;  1ZPS A;  3AE7 B;  4L23 A;  4LTU A;  1ZXI A;  3R2I A;  1JWB D;  1OFF A;  1AYF A;  4ZHP A;  2K3U A;  1FO4 A;  2WS3 B;  1ZUD 2;  1PGB A;  1HEZ E;  2QJL A;  1L4Z B;  3VQI A;  3NUH B;  4A9A A;  2WXH A;  3FC4 A;  1F2R C;  3ZJV A;  2QMT A;  1EU3 A;  1SE4 A;  2FBW B;  1C4C A;  2BTE A;  1VZ6 A;  3OWE B;  4MAC A;  1VJK A;  1ZDV A;  4C56 C;  3TSS A;  3AE4 B;  1CZP A;  1JW9 D;  4ZYS A;  2KMM A;  1HZ5 A;  1BXT A;  4XDC A;  1WSP A;  4HEA 1;  1PGX A;  3AED B;  1QOF A;  1VRA B;  2BS2 B;  1L4D B;  4B0E A;  2ZW0 A;  4RNA A;  3I9V 1;  5FK9 C;  3Q8A A;  4JWU C;  2MH7 A;  2JYT A;  2LUM A;  5D3I B;  1ZOY B;  1ET9 A;  3AB5 A;  1SXT A;  2DWQ A;  2QEJ C;  2D5G A;  3AEE B;  3IXS A;  1TS2 A;  1V8C A;  2V3P A;  4ARI A;  3AN1 A;  2PIA A;  1CK1 A;  1YN5 A;  3ETR A;  1FD6 A;  1Q10 A;  2IGG A;  2N9K A;  5LNK 1;  1RWS A;  3AEF B;  5C3J B;  3H8H A;  1ZDX A;  3Q8B A;  4GLS C;  1GB4 A;  3KWV A;  3P4S B;  3J9C A;  2LGI A;  4ZRQ A;  3MJ5 A;  4N6E B;  1MPE A;  4ZOH C;  2N9L A;  2PVG C;  3V05 A;  3BZD B;  3KQ4 A;  2RPV A;  5HI1 A;  1JWA D;  4WUR A;  1MI0 A;  4L2Y A;  4YTN B;  3HVZ A;  4CQN A;  2BB5 A;  1SSN A;  5BMG A;  2M56 B;  1NYQ A;  3EUB 2;  3LB8 C;  3LYY A;  2DBY A;  2YEP F;  2GRI A;  2W54 A;  3PZ7 A;  2RMM A;  4US8 A;  3BVZ A;  3W2D A;  1FXI A;  1PDX A;  1QOG A;  2EEL A;  2ONQ A;  1JWU D;  5BMH A;  3E9S A;  2SAK A;  5EE9 A;  4RGO S;  1GAQ B;  1SE3 A;  4D2K A;  3AV8 A;  4UDU C;  1BUI C;  1I4P A;  2BS3 B;  2NMQ A;  1JRP A;  5HFY A;  2N7J A;  1KTK A;  1AN8 A;  1QQR A;  1JWS D;  4OW0 A;  1GTE A;  2JZP A;  3IT4 B;  4RGM A;  2Q5W D;  1DOY A;  4YTM B;  4OHJ A;  2WXO A;  3VRB B;  1STE A;  1XO3 A;  1M4V A;  3KLS X;  4REZ A;  3TEW A;  1D5M C;  2MEK A;  4GDL B;  2WXM A;  1I4H A;  3TEZ A;  3SR6 A;  2KN4 A;  5E6J A;  1QLB B;  1FCL A;  1QOA A;  1ACC A;  2M0A A;  5JXV A;  2LJI A;  1FNV A;  2SEB D;  2WXJ A;  2WDV B;  4RF1 A;  1C76 A;  4H2A A;  1TJE A;  2WNM A;  1LO5 D;  1KH0 A;  2YEP B;  3RPF C;  3MHZ A;  4TSS A;  2JSV X;  2BBC A;  1N5X A;  2EKI A;  1E9M A;  4HRS A;  4J3O D;  4DXG A;  3P4Q B;  1E7P B;  4TMA B;  1ET6 A;  4ITK A;  2M19 A;  1DGJ A;  2NTS A;  1VZ8 A;  2K22 A;  1A70 A;  2WP9 B;  1FIQ A;  3CWI A;  5I4D A;  3Q8C A;  4YXD B;  3AEG B;  2JXT A;  1MVK A;  1VZ7 A;  1E0Z A;  1JQ4 A;  4MM3 B;  3W9C B;  4KGR A;  2J52 A;  3Q8F A;  3N9Y C;  2B76 B;  3AM9 A;  1XCT L;  2Y5C A;  1GTH A;  4IOI E;  1QIL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...