1YQ6A

Prd1 vertex protein p5
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
144
structure length
144
Chain Sequence
GGVTDALSLMYSTSTGGPASIAANALTDFDLSGALTVNSVGTGLTKSAAGIQLAAGKSGLYQITMTVKNNTVTTGNYLLRVKYGSSDFVVACPASSLTAGGTISLLIYCNVLGVVSLDVLKFSLCNDGAALSNYIINITAAKIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structure of the bacteriophage PRD1 spike sheds light on the evolution of viral capsid architecture.
pubmed doi rcsb
source organism Enterobacteria phage prd1
molecule tags Viral protein
molecule keywords Minor capsid protein
total genus 26
structure length 144
sequence length 144
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-02-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.670 Mainly Beta Sandwich Jelly Rolls Minor capsid protein. 1yq6A00
1YQ6A 1YQ8A 1YQ5A
chains in the Genus database with same CATH superfamily
2HWD1 3KCCA 1CJPA 1DU3D 1QJU1 1RL3A 3LCPA 2ZGQA 3MFCA 2WJSA 2XR4A 2NQYA 4MGZE 4WVMA 3R6SA 4HKWA 2MEV1 4BPZA 2ZEYA 3H0OA 4LO7A 2VMFA 2NYYA 4GWMA 5A7NA 1ZBA3 4IE5A 4YZ2A 3AJYA 4N8MA 3OCPA 2X10A 1GYKA 5G04L 4PIYA 1F4AA 1CIWA 2WZPP 2YPJA 4UW4A 5T5JA 3M3OA 4JHZA 1AR93 4Y3OA 3VBSB 4RS5A 5BYNA 3MEPA 3VD7A 5FPLA 3NKTA 2C6SA 2Y0OA 3FLTA 1NQJA 2ES3A 4IDZA 3WXPA 2JENA 3KCYA 1VB4A 3ZSEA 1MS4A 1BZWA 2I07B 2PYTA 1S0EA 4HK9A 1D0HA 1J59A 3I3QA 3ILNA 5G05L 2JICA 4BWOA 2PLV1 1LULA 2ZABA 1PK6A 3I2GA 4XIKA 4QT6A 5E88A 5IUQA 1YQ5A 3WP5A 1QKQA 1POV1 1JZ8A 1COV1 3AVSA 5KHHA 5FRAA 4CE8A 4RN5A 4Y5TA 4OMDA 1OLMA 1VPHA 1YNAA 3SEPA 1GKBA 1HDKA 3WUDA 5K0UC 5E89A 1F15A 4HLTA 2XJSA 2VZSA 4J1XA 2X5IC 2VBDA 5FMOL 5FZOA 3AZVA 1L3JA 1YXWA 2OVUA 4RS5B 4N9HA 3CF6E 1WLDA 3ZIWA 1HN0A 4HOOA 4IESA 4JX0A 3DL3A 3RRDA 4YG6A 1GU3A 5FY9A 4AEDB 4IE4A 3FZ3A 2VVDA 2W47A 4WV8A 3KMHA 2JDNA 2WUHA 2BP6A 4XUOA 2JB4A 3ZSJA 3ZYIB 2DCJA 5HV0A 3H3LA 3A23A 4GMP1 1Y43B 4X6RB 5AVAA 4G9SB 5GZDA 4GKYA 1Z7S1 2YGMA 1X9PA 2D93A 2A70A 4C0BA 1AR62 1DZQA 1CR7A 1O4TA 3VBHA 4AEKA 4EROA 1XYNA 4XYXA 1JYIA 1RUH1 3C8XA 4QHZA 3FHIB 4YZ3A 1CQ9A 1TE1B 4CP9B 4CUAA 5I91A 2PHFA 4L99A 1UOBA 5C70A 4NHMA 3KHCA 1IPKA 1X33A 3HIFA 4V2VA 1AL0G 1Q8VA 3UNPA 4Q4V1 4QPWA 4CDWC 2WO2A 2NMNA 2YU2A 2YXSA 1W05A 2B4KA 4YZ5A 2Y6LA 2K9ZA 4D7YA 4I0BA 1XOYA 1V6MA 4LO6B 2GC1A 1PVC1 3ACLA 4NPRA 2ZEZA 3RVHA 4H55A 5JSRA 1W0OA 3RZKA 2KD7A 4ITCA 4ZPIA 1LOEA 2VUCA 1YIFA 3GCWA 3H8XA 3OEAA 3PJYA 4LHNA 3A0KA 4AI0A 2ZGPA 4MV2A 3PVEA 5FKBA 2HWE3 3FC0A 4AL9A 1LECA 1SCSA 5L73A 1UY4A 3CJXA 5FJKA 3N9OA 4QWNA 1OKQA 5C4WB 5JZGA 5GKAC 5C8WA 2XPJA 3KB5A 4FOYA 4LHSA 5FZ3A 1LAJA 1YWKA 1LR5A 4V1PA 1VE0A 2VQ0A 4XBLA 4YGCA 4LKSA 1NY72 4QPGC 2DBNA 1IS3A 3K4DA 2XHKA 1UNBA 1KQRA 2WAAA 5J37A 5GZCA 5AC93 4R9AA 1W2TA 1J3RA 1OFNA 4Q4W1 3W20A 4BLJA 1J84A 1V6LA 3X29B 5FK7A 2QQKA 3Q8CA 2YV8A 4K7JA 4XF4A 3AP5A 2IFWA 4YSFA 1LOAA 2VOVA 3I97A 3E6CC 4FVVA 1COV3 2JXAA 5TSWA 1ULEA 4HPKB 3VHPA 4D8MA 2F6BA 3CZJA 5EHDA 4W8JA 5FP9A 2GNBA 3MI8A 1FV2A 1PVC3 4GAZA 4LKFA 4C90A 4NWVA 1ND3B 3R4UA 2P1BA 3U4SA 2WFF2 3B5LB 5LBBA 4UF0A 1W9YA 2MPFA 4HXCA 2GC2A 3MIGA 3MV11 1JI6A 4NHXA 1NAEA 1FMD3 4CCNA 4CP2A 2XJQA 5GLZA 4DRRA 1QNYA 1HV0A 4XAAA 2Q4SA 5B4XA 5J09A 2WNOA 3VBHB 3WOGA 5DDJ1 1Z0HA 1V6JA 2Z79A 1JYXA 5LBFA 4BA6A 2XJPA 1R1A2 4BMEA 1LHVA 5FMCA 5JOWA 5E16A 4AI2A 1ULFA 5HCHA 2J22A 1UU5A 1KDKA 2KR2A 3W9AA 4ISRA 3VDDA 2WO7A 5FYBA 5IJRA 1NA1C 3T4HB 3LDRA 3USSA 4GZ9A 2W68A 5J3UA 3O14A 1W3XA 1UKRA 5GLUA 1O59A 5HBAA 2H0VA 3J8F2 3WSOA 2ZHLA 1QIQA 4WZFA 3MGUA 4NHYA 2VZTA 5DG2A 4K8FA 2JDZA 2X8KA 4M4RA 4XQ4A 3ZN6A 4A2UA 1JTZX 3BTYA 4EN8B 4QKFA 1DGWX 2Q1ZB 5DMYA 4RFRB 3WV6A 2X05A 3OY8B 1LCLA 5F3EA 2QQVA 5FP7A 3ZOIA 3K3OA 4YPJA 1JMUB 4CEYC 5FCCA 4C8DA 4KQ7A 4IL7A 2NZ9A 5CAZA 5AC91 2J1SA 2JJ6A 3M7AA 2KXLA 4EN0A 1PX4A 3LEKA 3JBG2 2PA7A 4DNYA 1JYNA 2DUQA 1QJZA 2XVLA 4OYUA 3SMHA 3VZJA 1X50A 1AL23 1UOFA 1QF3A 3IDAA 1X82A 4YGBA 2PQQA 2G1MA 2YMZA 4Z82A 4EWDA 1JZ3A 1FMD2 1RMU1 1O8SA 1VBD2 3TB0A 4XJWA 5I0SA 1FOD2 3ZPYA 3RGBA 5JI9A 1DDLA 2HKXA 4IV3B 3NAPB 3VDAA 3WZ1A 4E4HA 4YW2A 1W06A 4LK7A 5JAXA 1K5MB 2J1EA 4QPIB 3ZMNA 2VZPA 4MO3M 2XKPA 1QH6A 1ZX5A 4XFBA 3N35A 4NRQA 4ORFA 2ZPXA 2EAAA 4JZRA 2I2SA 2XXZA 5FZMA 5JPNB 3JBG3 3SCFA 4HPKA 2VL4A 2YY1A 4PJYA 2W08A 3AMHA 5F2WA 4C0HA 4AXOA 2E7TA 2DUOA 4EQVA 3KLSA 4XBNA 4LR4A 4E2QA 2GN3A 3VBUA 5FO8B 1POQA 2ERFA 3P1IA 2KA3A 4Q1RA 1SPPB 3OSDA 5KHIA 3GHNA 1IKPA 2CWMA 4AI8A 1A3KA 2WNUA 1HQLA 4CEYB 3MIBA 3RZZA 5AFEA 3SCHA 2ENRA 4I0AA 3QACA 4IEYA 1R091 5FMDA 3GNEA 2EVXA 5DPNA 1NLSA 3CIHA 2A3XA 2GP3A 3DUIA 3HD8B 3UKNA 1BVVA 4IXLA 1UY0A 5BV6A 2ZACA 3R4DB 4ZU5A 5FZ6A 5T5LA 1T6GC 1XNCA 2FDGA 4KU8A 4QB1A 4XCAA 1H1IA 4B3NA 3ETQA 3SISA 1JU4A 4E8CA 2DVAA 5IK4A 4ASMB 1UO9A 1NA1B 3WUCA 3VD3A 4K40A 2BJSA 3TEZA 5I8TA 2JEMA 1K5JA 1W0PA 1FOD3 2JDUA 3PVNA 4N9IA 1NG0A 3LPFA 1AX1A 4O9GA 4XUTA 4MGTA 2VVFA 2WT1A 1QOTA 4PDWC 5FQ0B 4COVA 4ZKTB 4QB2A 1O5LA 1E5RA 2SLIA 3CEWA 1ALYA 3VBHC 2QCSB 4GB32 4CU6A 1T2XA 1QQP1 1PZ8A 2V4AA 4JKLA 3C7GA 2XWBB 2VCCA 2ZMLA 5GJ6A 2PN5A 4MX3A 3O1OA 4UFIA 2VNOA 1GQPA 4IEPA 5J96B 1HLCA 2XLAA 4K3UA 4BOWA 4DUXA 5FZEA 3BUCA 4OI0A 2EIBA 4Q2FA 2VJXA 4XXPA 2JG9B 1PZ7A 1W3VA 3VZKA 3DYPA 4R52A 4PLMA 3N7KA 1QDOA 5FREA 2OKXA 3BVCA 3TOJA 5FKCA 2VVEA 1E5SA 1TMF1 1RUJ1 5IHRA 3HOBA 4RHV3 5DAVA 2GZWA 2EXIA 4K21A 3QH6A 2BBVA 3PVOA 5FXWA 1VAKA 1RUI3 4KWLA 3H8OA 2JD9A 3GDBA 1OLRA 4OHWA 2PFWA 3Q9OA 1PGW1 4XPVA 1OI6A 3KT4A 3ZXGA 2VC9A 3K2OA 3GZAA 5HCAA 2VZRA 5C4WC 1Y9GA 1GICA 2BRTA 5GZGA 4X6QB 2VNRA 3VBOC 3IDBB 2C26A 3IPVB 1YEWA 1DQ6A 4XQDA 3O1SA 1H2NA 1W6PB 5GLTA 2HWF1 2QVSB 1JYCA 1UMHA 2A5ZA 2YU1A 3D8CA 1NX9A 4QXBA 5CU1A 3S7EA 4D6SA 3MIHA 4XIOA 4FP3A 1B35A 5EJZB 3ZXFA 2BGOA 5I0DA 1RUI2 4DO0A 4YM0A 4QKDA 3S5AA 3P6BA 1Y9QA 1GZTA 3A0NA 5DUUA 1W9SA 4XCBA 5FAXA 2DWRA 4LQRA 3ZO0B 4Q4X3 2Y6JA 1NCRC 1BEV2 1YRZA 2ORZA 4Q4Y3 1ZNPA 3IZOA 4SBVA 4D69A 2WRAA 4QKBA 2FDHA 3NNLA 2CYFA 4UFMA 4UFKA 4YVSC 1F4HA 1LU2A 2JDYA 4MYEA 2PAMA 4XF1A 4CEYA 1ZREA 5FYZA 2X5IB 3NNJA 1QOSA 1UYYA 4XJAA 3U4XA 1VRH2 2WS93 4GJYA 2WYFA 2Y33A 4YGEA 1NCRA 2X53S 1AR72 1C4RA 3FN9A 3HBZA 1FPN1 3FHQA 3LFIA 2D6MA 5LK5A 5L9VA 3NL1A 3LEIA 3CJIA 1OQ1A 4FO9A 2WWJA 5C3PA 4MXWA 4QU1A 5FP8A 4CUCA 4UAPA 1LODA 2JKXA 3I2HA 2GP5A 2Y6KA 1AXYA 3BB6A 3TN93 1PGL1 1CD3G 3B7MA 4PQ9A 4E27A 2AH2A 4PIZA 2VD7A 4HKLA 1QJX3 4ZU7A 1N3PA 3VKMA 3TAYA 1LEMA 2HEYF 4ISQA 5F3IA 1V0AA 1CAWB 5K0UB 4I3PA 5CFCC 2Y26A 1MZ6A 5IFTA 2RR12 3PU3A 5F2SA 1AF9A 2R063 3VL9A 2HEVF 2D5FA 5DUXA 4N53C 2ZOEB 1B35C 1YQ2A 4Q4Y2 2E7AA 3I2OA 4WM8C 1BLZA 2D6LX 3HR9A 1UF2C 4HN1A 5FP3A 2NLRA 1H6YA 3I4IA 5FBJA 1CPMA 1VP6A 1QMJA 2HWD3 5C3SA 2VUJA 4CDQA 5FUNA 1UPSA 1JN2P 1N1YA 2JWPA 1WCSA 3IM0A 5FPVA 3W21A 2IXHA 5FY0A 5CBLA 1GZ9A 1VRH3 1QOOA 1RHI3 2Z4FA 4H14A 4XXAA 3V0BB 1IPSA 4FXKB 4AHWA 1QJU2 1S4CA 3MBWA 3GJBA 4FOVA 2Y6HA 2MEV2 2D6OX 1AYM2 2D43A 4Q0VA 4FTEA 4FCAA 5FYCA 3WR0A 1V6KA 4PLOA 4AGVA 3T2QA 2ZX4A 1DQ2A 1VALA 3UL2A 2Z5WA 4QXKA 2QQIA 4QQLA 3OBTA 4NAOA 4AE2A 3K3NA 1KJLA 1RITA 2GMPA 4XE9A 4Y4RA 5HXMA 3GBWA 3T30A 4YW3A 3V64A 1RYYA 5JIAA 1RHI2 2VZQA 2BVBA 4CDXA 5HPOA 4Q27A 3EYPA 5K4LA 1KGYA 1W6MB 2J1UA 2IVIB 2HYKA 2R7EB 1J1TA 3HQUA 3I54A 3S7IA 2HWC3 5HI0A 2CGNA 2YDEA 1JZ2A 4Y1VA 2OZ6A 1S0JA 5DABA 3KWVA 3UK9A 4MXWB 2BPA2 1QXJA 1AXZA 3E6DA 4J1WA 4QU2A 4AWDA 2D6NA 2ILMA 5FY5A 3WF4A 3SXWA 3HPNA 4M4PA 1NCQA 4BQWA 5JUVA 5A6QA 4XF0A 1XNDA 1AJOA 4PQQA 4DQAA 3PU8A 2PELA 1G9BA 4XFFA 1PZ9A 3BTAA 2JG9C 1DHKB 5DQ0A 3ACHA 3ORJA 3SLIA 4BQ1A 3GM8A 4ATEA 4FPLA 1IOAA 1AVBA 2MNGA 2K2SA 1VRBA 2ZX3A 4UBGA 3MYXA 3VD9A 4AQ2A 4HG6B 2D40A 1DZTA 2XJVA 5KHGA 4P9XA 2RS51 1ZRDA 4PT6A 2XVGA 4BYYA 3A22A 1VBC1 1ZBE1 5CFDA 1Z7S2 1LENA 2DCTA 2P37A 4D7SA 2FDIA 1AR61 1SBDA 4M3CF 2RM22 4FT8A 4F83A 5JOZA 5C5TA 1W8UA 2O14A 3PJQA 4P9IA 3N7JA 3U11A 1RUH2 2P4EA 3ZX7A 1G9FA 1UWWA 1HRI2 3CQOA 3NJYA 3PHMA 3AJZA 4C91A 1MEC2 4QDRA 5A1LA 1ODNA 4PBOA 1IQAA 1O7FA 2BFUL 3NRUA 4QMAA 4UW3A 1JYVA 1XU1A 1XNBA 4JTOA 1HB1A 4WVWA 4HVOA 1O91A 4PBPA 2ID4A 2YZ4A 4GJZA 4AOCA 4COZA 5A7SA 1GWKA 1I5ZA 1VJ2A 4FTBA 2J1AA 3VDBA 3RYKA 2EICA 2VMHA 4XZUG 1OOPA 4YGDA 5JXHA 1UKGA 4LXLA 3CZUA 3AYEA 1ZM1A 1WZXA 3V0AB 1CPNA 2K0GA 1QU0A 4X8NA 4P00B 1Y9MA 2VCBA 2C9AA 2DF7A 2Z69A 1HQWA 4GH4A 3MLLA 3EJKA 2Q8OA 1W9WA 2W2IA 4HKOA 2QUOA 2UURA 3RZLA 1GOHA 1UMZA 1W90A 1WKYA 2R072 3T09A 1TME2 3MPPG 4LULA 4CPBD 2XLGA 4WVMB 4LK6A 3P3NA 1SMVA 2VQUA 4K9SA 3ZFFC 4DFSA 2PQSA 4QXCA 3ZKYA 4XDPA 4LUMA 1RUC1 2SBAA 2VO5A 1PO12 5DXDA 4M3CB 5A32B 1QGLA 2AZ5A 4KBBA 1Z7S3 2VOKA 4AI9A 1WMDA 1RXGA 4WM7C 1XPWA 2OIIA 1H2MA 2OT7A 4JGYA 1W8TA 4AVBA 1YC61 3CHXA 2E53A 4M0NA 4Y1XA 4EN7B 3KZ4C 3ZFFA 2EALA 4Y20B 3IN9A 3MHZA 1RUG1 2XHNA 1AR82 1BKZA 1J3PA 1UZYA 3MF6A 2FDJA 5A3TA 1JYWA 5EJ1B 4QGMA 1W8ZA 4MHRA 1PM4A 3UV9A 4RR3B 1GLHA 3B3QE 4OI1A 5A3MA 3RWKX 5HV4A 2FZ2A 5KXCA 1GNYA 1JUHA 4DXSA 1DYOA 1S0CA 4LE4A 3KQRA 2FQPA 3HWJA 3ZYJB 4WM7B 4CDXC 1OOPC 5D1IA 2XLFA 3PUSA 5T5OA 2GH2A 4M3CA 5ACA1 5C71A 5J36A 4NIDA 1VBE2 2AYHA 5C9AB 1GP4A 2HH9A 1SCRA 1US3A 2HWC2 5I93A 4IEZA 1LHUA 4BLIA 5J7MA 1R083 2GNMA 3WNPA 3WINE 2EA7A 4XVHA 5KHKA 5K8SA 1CX4A 1H30A 1F31A 1BEV3 1UIJA 3M3IA 3ZXDA 2HJIA 5DAQA 1W9FA 4MGQA 4A3XA 3ZFFB 1CX1A 3WDUA 3ATGA 3ZIXA 3VUOA 1YJLA 1L7QA 3VB9A 1SBEA 1QEXA 1M06G 2CWSA 4PHZA 4AFBA 2WS92 3HNBM 1QHDA 2PHXA 4L97A 2XGXA 1RGSA 2L9LA 2RMU1 2D97A 1RUF2 1ST8A 2QE3A 3MW3A 4CDQC 1ZZ7A 5F7UA 4IETA 4DB5A 1UCXA 2ZX1A 4HFSA 5LBEA 3U78A 3WF1A 3ZVXA 5L7OA 2R16A 2OQ6A 2PXJA 1CAWA 5K0UA 1VBB2 3POGA 4B8EA 5LA0A 5BPXA 3WQ7A 4ZXKA 1GNHA 2V73A 4OUEA 2VZOA 3C3VA 1PO22 2GSYA 1CZSA 2Q1FA 4NN0A 4DOUA 4PCRA 1KFXL 2R042 3JBG1 1W39A 4CPBA 3VBFB 2PHWA 2JD4A 3WT3A 3C7OA 5C33A 2IXKA 2P34A 2JDKA 4AK3A 3BU0A 4E4ZA 1KS4A 2AEYA 1RUH3 1CAXA 1ASJ1 1OQEA 1E5IA 1V00A 3K75B 4XC9A 4JRAA 2B7YA 1W6NB 1FOD1 3I3MA 1V9U3 3MO4A 1AYN3 3FL7A 3POYA 1RUG3 1IKQA 2ZKNA 3P5BA 4NIAA 2MHFA 2R062 1YLLA 5JMCA 4OHZA 1NE6A 1EAH1 1RUE1 2VMEA 5IK7A 3AKRA 4RGAA 2YROA 3WNXA 1RUOA 1YQ6A 4EN6B 2FDKA 4Y20A 4Q4X1 2XJRA 2QJVA 3B01A 5C8CC 1OQDA 2GMMA 4IUGA 2AACA 3C2UA 3GGLA 1CONA 3AKSA 2GU9A 1TG7A 1VBC3 1NE4A 1ZBE3 2VGDA 2W46A 1BBT2 2EXHA 4XUNA 5H9SA 2ZZJA 4OULA 2Q8CA 3UT0A 1NZIA 1ODMA 4IGOA 2VUAA 5D8AC 5ABJA 1F5JA 2E33A 5A3NA 5F3CA 3BIWE 3LPGA 4R9CA 4WVZA 4FFHA 4L0PA 3E97A 4OFGA 2EAKA 2AENA 1WUVA 2D3SA 4HN0A 2D44A 3J7NA 2JG8C 1HKDA 3PUQA 5CKNA 3SHRA 1TEIA 1WLTA 5T50A 3E1F1 1MQTB 4O65A 2P6CA 3H7YA 5KC5A 5FZGA 2RVAA 5JPMB 4A6SA 1Q5OA 2HYXA 2YHJA 1NZCA 1GR3A 3AC0A 2YFUA 2VM9A 1UYXA 2ARCA 4IV1B 1DGWA 2WFF3 4GD4A 5EYYA 2YB7A 1LJ7A 3JB4C 3LWCA 1OURA 5A6ZA 1ND2B 4KWUA 4HK8A 3NJVA 4EE2A 3AP7A 3PUIA 1ZZBA 1JH5A 4GB31 2W87A 2CGPA 2E51A 1DZRA 1W8FA 1WA6X 4R9DA 2VR4A 2LW8A 3K4AA 4QQOA 4EN9B 3ZR6A 4NE9A 4P14A 4AI1A 1XE8A 3WDWA 1QWRA 3OY8A 3ZXAC 1RINA 4QKNA 1QQP3 3D0JA 2QFEA 3VKFC 1IHMA 1R082 3WF3A 4NAMA 3AKQA 4ATFA 2IC1A 5FXXA 3WP4A 1AUYA 1ZYBA 2ET7A 3ZFGB 1SFPA 4BK5A 3LQCA 3N36A 5SV8A 2BVVA 3T1LA 2PHDA 2WNVC 1OVPA 1YI9A 2UWBA 1BK0A 3J4UH 1N3OA 2PHUA 3I3EA 4AGGA 5I0RA 1ZBA2 3O1VA 4O9EA 3I2FA 1S55A 2XOMA 4FPHA 1YUDA 1POV0 1LHOA 1AJKA 3ACGA 4XACA 4CDUB 5L9RA 1AL22 1UX6A 2GDFA 3POIA 4O61A 5F5QA 4FAGA 3H50A 1WCKA 1UX7A 3VHRA 4HVQA 5GALA 3TNQA 4AVVA 1S0DA 3FE5A 2WN2A 4EJRA 4XJUA 2QQNA 4I01A 2E32A 2XWJB 2IFRA 5A7OA 5LEJA 1K12A 2UYAA 5DUVA 2YYOA 1VBA1 1MZ5A 3OGVA 1IS6A 1N1SA 4TZDA 1QJX1 1MS1A 1V6IA 4BDVB 1WBFA 3LOIA 2QZ3A 5FPXA 3ZYBA 1UN1A 2BOJA 1LOCA 5E6HA 5LA9A 1V9U2 1XQNA 3EHKA 1P8JA 2DU1A 2GNTA 2VW1A 3DCQA 5FXVA 5JXJA 1EP0A 3VZMA 2ZGNA 2WAOA 2XQRA 1Q8SA 3AM2A 4NRPA 2DVDA 2R073 5IFPA 2LRPA 3NJXA 2CAUA 1O8PA 3I2DA 4P9YA 3USUA 3WW3A 1JZ6A 4IEVA 3D3AA 3RI8A 4UT5A 5FZDA 3TEWA 3FLRA 1BHGA 3BCWA 1ZRRA 4U2AA 4B1LA 5IVYA 1W2OA 3PTYA 4BQ2A 1VRH1 2VE1A 3W58A 2VQAA 1AR71 2WYSA 2B9UA 4Z07A 4OQ8A 4Q5OA 4A41A 2DCZA 4LBKA 1MVQA 3B93A 4NHLA 2F4PA 2ZHNA 2AUYA 2WFPA 5CZKA 3LIHA 4BM8A 4CCMA 3R4SA 1JZ7A 4CVUA 1O3QA 1ND3A 5LZ6A 2XBO2 1MS3A 4OHYA 3D0SA 4CEWC 1O3RA 1KRIA 2RS53 3NNMA 3ZSLA 2C4XA 2D3PA 2HEWF 2NMOA 3HEIA 5C6CA 3OGSA 2W94A 5C8CA 4DPNA 4GWNA 2RS13 4XTMA 5FZ4A 2VQTA 3H9AA 3JU9A 4N7IA 3B9IA 3RG0A 4NHKA 3T0BA 4EWAA 2C0ZA 3B69A 2ZEWA 1YI7A 4KL1A 3S5QA 4BB3A 1JW6A 5BNOC 5LA1A 3O0XA 4CU9A 1F8VA 3OBAA 2W3JA 4XAEA 2PLV3 3IDEA 5FYSA 3H3UA 3SH3A 1UXZA 2TNFA 5FTTC 3L9JT 3D82A 3OGJA 3M4FA 1COV2 1S1AA 2WQ8A 1VBA3 3AP6A 5IAVA 4OZXA 4BISA 1FV3A 2Y64A 2J1RA 2VAUA 2IVJA 4PLNA 1DGLA 3VBRA 5BNPC 5FYYA 3OUHA 4CDUA 5K9YA 1YHFA 1AR91 1CZVA 3LZZA 3HNYM 5A7WB 3P3PA 4BQ3A 3BTXA 1W8NA 5T55A 5H9RA 3H3ZA 1I5PA 5DAWA 5F5AA 2LM3A 3HQXA 2ZGLA 4JQRA 1AYM1 3S0MA 1ZA7A 4RHV2 1UY2A 2BUKA 4P9WA 4YVWB 4AF9A 2J1TA 2VZUA 3D5OA 1Y7BA 4LKDA 2HBUA 2VTFA 3AB0A 5FYUA 3WHTA 3ZPOA 3BODA 1LHNA 3U14A 1MS5A 2WNUC 2GH8A 1HXS2 5JOYA 1D2SA 4XFGA 3WQ1A 1WD4A 4ASKA 2XMLA 1W2NA 3T2TA 3LAGA 2I45A 4URAA 2ZCWA 3FX3A 3AFKA 2VG9A 3BALA 4CCOA 2WDBA 1GV9A 1RHI1 2DVFA 1MS8A 1G9AA 4JV4A 1W6QB 2WO1A 4D0QA 4QX5A 3MZHA 3RS6A 1OUXA 3T2PA 2WIIB 3NAPA 1F9KA 4IEQA 3VHNA 1HRV1 2BDRA 2WQ4A 3KT1A 4RR3C 4XMAA 5D21A 4A4AA 1GP6A 4RQPC 4HSJA 4LEJA 1FI2A 4LIVA 2D3RA 1LRHA 5CIRA 1Y4WA 4FOWA 4P02B 3I3DA 4AEDC 4NUBA 3AL5A 3OGGA 2WQZC 3V0BA 2OUJA 2XUEA 4FXGB 1S2BA 4YW6A 2BFUS 5EPAA 3C7HA 1A6CA 1SQ4A 2RV9A 1XYOA 2G19A 2VMDA 1RUNA 1WGPA 1YJKA 4IV3C 2YPDA 1UY1A 3CBNA 2HWE2 2O1QA 3LEGA 4AVSA 5DAPA 1NY71 1ULCA 3THDA 1UU4A 1WD3A 3NW4A 5A3WA 1EY2A 3K46A 5FY7A 4JDNA 4Q4W2 3OTFA 3NSTA 2RM21 4CSWA 1U5ZA 4DINB 4A44A 2VXJA 3KSCA 3K48A 2RMU3 1W6MA 2RS11 1S0FA 2DFCA 1DLCA 1DP0A 1APNA 4XABA 2WSVA 3TYJA 4BHPA 1GZCA 1Q43A 4XJZA 5FZ9A 4AQSA 2CNAA 2A7AA 3KV6A 1MEC1 4LHKA 1WMFA 1BXHA 1NA1A 5A7QA 3VBRB 2QQLA 4B7KA 3RZHA 3HN3A 4R4ZA 1GQGA 5KXEA 1SLCA 2PAKA 1URXA 3O0WA 3ZYFA 2W9XA 3ZSMA 4F7ZA 3OG2A 1HRV3 1HN1A 2ZX2A 2DBIA 1RXFA 4QDQA 5GZFA 3VDCA 2ETEA 1FT9A 1BVP1 1FYUA 5CA6A 3O12A 5ACA3 1WLCA 4DEVA 3E5QA 2VW0A 2ZS6B 3FFQA 4M3CE 1IPJA 4OMCA 1K42A 5A80A 2W5FA 2IWGB 4MSVA 4MHUA 2WNUB 1S0GA 4XMIA 5FY8A 4D94A 2R071 2JG8B 3ES1A 4LBJA 3WDTA 1E5HA 3O1RA 4NPMA 2DYCA 1HJFA 1Q8OA 1YQ8A 3J8F1 4IERA 2JE9A 5JWPA 4NOTA 2E6VA 1WMXA 3JXSA 1OHFA 2RJ2A 4NROA 4OUSA 4QPGB 2WSUA 3RNSA 1OSGA 1RUC2 4MH0E 1DQ4A 4QX8A 5J98B 4CXYA 3DPRC 2XB6C 2UWCA 2IXJA 3B94A 3DN7A 3WX5A 4AHXA 5E1RA 1CESA 1DLLA 4DMIA 5A6YA 3RYPA 3DXUA 1SLBA 4NRMA 2F4LA 2G9FA 4Y5SA 1YFXA 2QQUA 4YRDA 5JZGC 1O6UA 5CKMA 3NV2A 4YYOA 4Y33A 4B7EA 4E4DX 1NLQA 4RQPA 3SITA 2RS32 2DURA 5BNNB 3WQBA 1ZA4A 2PAEA 1RUG2 3QBQA 1AR81 4KU7A 2VOTA 4LO4B 5LA2A 3TRSB 2W0XA 1HJGA 2D6PA 5FV3A 1OLQA 3I3BA 4UI9L 4KI5M 4YG3A 5BNPB 3ES4A 1FMD1 4XF9A 3WG1A 1VBD1 2XJUA 4INDA 4CCEA 4Q8KA 3F95A 4NWWA 3DEMA 4QQHA 1UQXA 1MZFA 4EWEA 1UOJA 2GNDA 2BYVE 2BWAA 2VBBA 2ZAAA 5ACA2 4W6WA 2FCUA 2E9QA 2E63A 1D4M3 5BNNC 5LY2A 2Y8KA 2WZ8A 3MLKA 4CCKA 5F9TA 3RI9A 3B02A 2RDRA 2ZBJA 1JS9A 2BBAA 2P3JA 1POV3 1NUKA 5LB6A 4FFGA 3T08A 2TUNA 2WR9A 5DUWA 5JOXA 5DG1A 1RTVA 1C57A 3O5SA 2A6YA 4YW5A 3LFMA 4A7ZA 4MVTA 4YWAA 3UESA 3OBZA 1LOFA 1ZVFA 1H0BA 3TBDA 1DCSA 4YM2A 3IB3A 1UAIA 1RUF1 3KT7A 4AEDA 3C7EA 3THTA 1Z78A 4JQTA 4OVEA 1MS0A 1U0AA 3SCGA 2W91A 5F6LB 3WDXA 1CAXB 3JD72 4PDWB 4RYDA 1MEC3 3ILFA 5F37A 5LASA 4BQXA 1X7NA 3KF5A 4TXWA 4RR3A 4LPLA 3H1WA 3OUJA 2A3YA 2Y60A 5EYXA 4K20A 1QJY2 3LDBA 3WNMA 2TBVA 3WW2A 1JXNA 3NO8A 4WM8B 1AZDA 1S2EA 1OFSA 2E7QA 3ABZA 2BERA 3KF3A 4KGQA 4Q8LA 4YM1A 1XNTA 1HB3A 2RDNA 1GBGA 4AQTA 4BIFA 3TN91 3VV1A 4UFHA 4XBQA 1GUIA 3LGRA 4UWDA 4QPIA 5IT6A 2KM2A 5JR2A 4Q4V3 1HX6A 4Q0SA 2FMDA 2R1BA 5A3UA 4HT1T 3I2KA 1RUE2 4HETA 4CDQB 4CXXA 1O4ZA 1QQP2 4AFCA 3JZVA 1DF0A 4JVAA 4BMBA 3IIAA 1W2AX 2WC2A 3DXTA 4Q4X2 3CDZB 2R49A 4K1ZA 4S2DA 3S6PA 3WLUA 3IBMA 1UXXX 4PI2A 1C8M2 1OVSA 4RSUA 3UGHA 1SPPA 1E57A 5A32A 1BBT1 4RQPB 1MQTA 1XJAA 4QQ2A 4Z8BA 2W1UA 4QHOA 5FZFA 5FLIA 5A3OA 2WNVB 4CDUC 4O7XA 4MLOA 2B42B 2PMWB 2BTVC 2Q1MA 1RUE3 2B5HA 3H7JA 3CJIC 1RUJ2 3FUOA 3RMYA 1OA2A 4FAHA 1W6QA 1LOGA 3H8RA 1CAUA 2G4IA 3ZYHA 1AYN1 2BQPA 2J42A 3RJRA 3FWEA 1D4VB 4ZXEA 2PHLA 4UOJA 1MVEA 2P17A 3E5UA 4MOAA 4A7KA 4JTNA 2LALA 2WWUA 1PGW2 4FPFA 4Q0UA 1W8HA 3EQEA 4W50A 2VXRA 1BMV1 3ZFGC 1RUD2 1C5HA 4BH9A 4D6QA 4CTEA 5JLVA 4YW1A 2CSGA 4HVRA 3RZMA 2NPIA 3KD4A 4GB33 1UZ0A 4UBHA 4AZZA 3I8TA 3WNLA 4COUA 2R32A 1DQ1A 2VBPA 3G6JB 3VD5A 4UF0B 1NCQB 4XUQA 2OW4A 5D8AB 4CEWA 1YFYA 3ME2A 1RUI1 1OLME 4P9GA 4FPKA 1ND3C 1VBE3 2OS2A 3WNNA 4IE7A 5EXOA 3WG2A 2VH9A 3IKWA 3O1MA 1G86A 1ZZ8A 1BEV1 5ABJB 5JCTA 1FNYA 2N7GA 1SLTA 1UPIA 3RPQA 4BK4A 5F1RA 2LS6A 1R081 3N7LA 4E2GA 4XUPA 4TWTA 2F17A 1CN1A 1XB9A 1UYPA 3NNFA 4LNVA 1SEFA 4K6BA 5BUVA 1MQTC 1UL9A 1H8TA 4UXAA 4ZS2A 1X36A 3WDVA 3RWNA 5CFDB 1IS4A 4JCKA 5F6KA 2Y34A 4LE3A 5C3OA 1L7RA 3B9CA 2CTVA 2GC3A 1W0NA 4N53A 1H2LA 2BNMA 3JQXA 2VNVA 3AMMA 3VL8A 1FPN3 3ZYGA 1HIXA 4B4RA 3KCXA 2E31A 2UYBA 3WQ0A 1EYBA 1PO23 3ZXJA 1PNGA 3GBFA 4MGSA 4XJ9A 4B29A 1OMIA 5EZWA 3GHMA 5DZGA 1HW5A 3JD73 4Y24A 4FPYA 3ROUA 1A78A 3BI3A 5A1FA 3PIJA 2QQPA 1QJFA 1NXMA 1KS5A 3DPRB 3ALQA 2RJKA 1EAH3 1YQCA 1IZ3A 5FUIA 1D2QA 2DCKA 2EIEA 3U07A 5FYIA 1FX5A 5FWJA 3ECQA 3VHOA 2OPWA 2XUMA 5CADA 2EXKA 1VBA2 5EIYB 2JDMA 1R1ZA 1FNZA 2YC2A 1QJX2 3B00A 3ZSKA 3EO6A 1Q3EA 4M0HA 2YBPA 4I3GA 1HRI3 3ZKUA 3POBA 2FMYA 2CV6A 3RMXA 5FY1A 2FD8A 3VBUB 4FTSA 3RJ2X 4W65A 1DQ5A 4FFIA 4QX2A 4A6OA 3GJAA 4RFT0 1OA4A 1KJRA 4Q26A 5BNNA 4ONUA 4XOGA 3HMYA 1VAVA 1LOFC 4P08A 1W04A 5D8AA 4Y4YA 2FDFA 4RL7A 5A7PA 4C1WA 5IVEA 2WL1A 3BOPA 4G4FA 1HXS3 1QJEA 1A8DA 1D4M2 1Q56A 2AREA 2ARBA 2Z42A 2LUWA 3C7FA 4QX0A 4S2HA 4AFMA 2XKOA 4N43B 4XF3A 5LATA 3BN6A 4FSJA 2P3IA 1I1EA 2JX9A 5BY5A 2W52A 1DFQA 3I2JA 4KWKA 1RUJ3 5EWSA 3ZFEC 3O1TA 1RUF3 4XFIA 4QHBA 1ND2A 4ZONA 4DIQA 1JZ5A 3MW4A 4ZY9A 2A73B 1UYZA 4LITA 2LTNA 4Y26A 5FZCA 2DFBA 4F8AA 1W99A 4F3JA 3VD4A 3VKOA 1XNKA 4H7LA 3KVAA 4CCCA 1NLRA 1PO13 2DDUA 3CO2A 1EV13 3M70A 5CG9A 1K3IA 5IK8A 5F3GA 1N3QA 5FZ0A 5FO9B 1PVC2 3HQRA 4DXRA 1H6XA 2RG4A 5JXIA 4TLFA 5C9AA 4N53B 2PTMA 3F2ZA 4AW7A 2ZGTA 3S30A 3HNMA 4WZCA 3VLBB 5KXDA 1QJY3 3MDPA 4YZ4A 4JKMA 4Y22A 1CAVB 1SG3A 1W03A 1GNZA 2VNGA 3ACIA 4OLLA 5AVPA 5IVCA 1R64A 3GZTB 3DPRA 2FZ1A 4KGGA 4YVWA 1W9TA 1AYM3 4A42A 1AR92 1G9DA 3AZYA 3FUQA 2VECA 3AKPA 3BIEA 2RJLA 2PHRA 1RB8G 2V4VA 4CRQA 1VLNA 1MACA 1W8WA 3OD0A 1KEXA 5EP9A 1VBC2 1ZBE2 3KHBA 4RHV1 4L2NA 4PI0A 4AFAA 5B4NA 1G9CA 4OZOA 2QQWA 3NQHA 3AXDA 2C1FA 4M00A 5CKQA 1HXS1 2Q8EA 3NV3A 1OC1A 1OH3A 1NQDA 4N90A 3V65A 4AEJA 1W6NA 1ZZ9A 4DY3A 1D0GA 2YG0A 3VZLA 1TZOA 1REEA 2VZ3A 2W95A 3J7LA 2JDHA 4MGYE 5FZ7A 4ZHNA 4XURA 5APAA 3WF0A 1H4GA 3LA2A 5FJHA 1TNFA 5IK5A 4DUVA 1FATA 4LBOA 2AC1A 1W6PA 3VZNA 1DYPA 1GZWB 2ARXA 4DS0A 2W92A 4LA3A 1RIRA 3OD4A 4IV3A 5DDJ2 5CB7A 1U5YA 4IV1C 2OA2A 4DEQA 2UU8A 2CAVA 4N43A 4CZSA 4IGPA 4R8HA 3PUHA 2WNEA 4GXLA 5ERLA 1QDCA 5LK7B 5FLJA 2D98A 4H7MA 1YIPA 3AL6A 3DYMA 4LMFA 4N7UA 4LBLA 5LBCA 1TME1 3N9LA 2ZAHA 1ULPA 2VZVA 3I59B 3MUZ1 5E8AA 4TTGA 2DU0A 3ZLIA 4B1MA 3NMBA 2HWE1 3I7DA 2XVKA 3WG4A 5C3QA 1ENRA 4XFCA 2HWB2 1N1TA 3IAPA 4YM3A 5KXBA 1ZRCA 2YUEA 4N43C 4AVCA 2ZHKA 2VTXA 4I0WB 1DG6A 5IAXA 4H2AA 1GMMA 3DYOA 1VB2A 4UFLA 1ZRFA 5C8CB 4GIQA 3BU7A 4COWA 1GOFA 5F5IA 1O3TA 2RS12 1LGNA 3DKQA 1JOJA 4QD2A 1YO8A 1H1MA 1QY4A 2P5BA 4A3ZA 5L19A 4MG2A 1SHWB 3IAQA 4BXFA 2QQOA 4CA9A 4Z1VA 3TEXA 4FPCA 4Y5Z0 3WVJA 4HBNA 5CFDC 1B09A 1NKGA 3OOXA 2ARAA 1O4YA 1ONAA 4ARXA 3AYCA 2VCAA 3GALA 2EXJA 1PIV3 4QPYA 4EZ4A 3ILRA 4IW3A 2WWSA 3J26N 1WA4A 1V6NA 5HXVA 3GBGA 1JYTA 1GSLA 4LLOA 4P9JA 3UKTA 4JGYC 5JSOA 3BGAA 3VKLA 3WNKA 5IATA 1VBE1 1OH4A 2HWC1 1TQ5A 4GMP3 4TSVA 2XQXA 4XW3A 3S57A 1H9WA 2P2KA 1H8TB 4GULA 3M2MA 3LSEA 3LKJA 2R6QA 4I02A 1WW5A 3HAGA 3PNAA 3QCWA 4LUKA 1PVXA 3K51A 4META 3JUUA 4IE6A 4SLIA 2HWB3 3KV5A 3TEYA 1H1AA 3OPWA 3BPSA 3CMGA 3J8F3 2VTXJ 3SH4A 1DYKA 5JMOA 5FBZA 1ULOA 5ISLA 1GZWA 3OYWA 2AGSA 5BNOA 5CISA 1W6OB 4LORA 4DUWA 2A6ZA 1CZTA 3J7HA 3MICA 1O3SA 3VKNA 3MIDA 3SKJE 3VBRC 1ENSA 1NOVA 5BNPA 2XL9A 1UMIA 1X9TA 4I30A 4BQ5A 3PVBB 1VBB1 1OD3A 1RJ7A 1NCQC 2WA3A 2Z2SB 3JCIA 2GN7A 3IT8A 4FPOB 5FPZA 1CWPA 3KVBA 1R1A3 3ZR5A 2RS31 5GLVA 5IVVA 4KG0A 4DXTA 1C28A 5ANNA 5FP4A 1X8MA 2ADDA 5HCFA 1SACA 3FBYA 3GZEA 3ASIA 5FZAA 3A21A 3OYWB 4DXZA 4FP2A 2ATFA 3URFA 1IQDC 2TEPA 4NIHA 1LOBA 2IUWA 2R061 1C3HA 1B35B 4CXWA 3ENRA 1C1LA 1OA3A 1K5MC 4XHBA 2JIJA 4BQYA 4DY5A 2B39A 1SFYA 5DN2A 3FLPA 4GALA 5FQ0A 3AVRA 4YFZA 2ADEA 4WBBA 3SNMA 4OHVA 3MW2A 3ST7A 1SLLA 2XL7A 4QPGA 2GALA 4BJ0A 1BJQA 1OD5A 1REDA 3USUB 2O0OA 4Z2WA 1RC6A 1VAMA 1HQNA 1XYPA 1DIWA 3NJZA 4RS5C 1AXKA 2ZX0A 3UYJA 1FAYA 4S2FA 5F32A 5CEHA 1G7YA 2JKBA 5EQUA 4C1XA 1JUIA 3ZYPA 5GM0A 3AYDA 5D2AA 1SDWA 1BK1A 2C5DA 3WG3A 2R043 3BYWA 2BW8A 5DZEA 5DAXA 4YVSB 5FYTA 5FZOB 1RUD3 2ZMKA 2QTWB 1PM7A 3ETPA 2A3WA 3HT2A 1GWLA 3KQ4B 4KBZA 4LJHA 5FZ8A 5FMBA 1XSQA 1C8NA 2ZGOA 1WCDJ 2JE8A 3G7DA 3QLQA 3HT1A 4FPGA 4URTA 4Y22B 3WNOA 4LBNA 5L9BA 3O7OA 1UIKA 3QD6A 4KMQA 2P3YA 3Q8BA 4LT5A 3M8LA 2B45X 2OPKA 3R0RA 2EIGA 1STMA 2Y6FA 4OCTA 4UW5A 1RVF1 3W59A 2E26A 4CDWA 1I9RA 4DZGA 2J1VA 2ZGUA 3KGZA 3POJA 4CU8A 3IIIA 1EV12 2XONA 4CP9A 4FPEA 1J3QA 4LO5B 3TN92 1PIV1 4E9KA 4LA2A 2V5DA 1OF3A 1EPWA 4XILA 4CP1A 2WZEA 2A71A 2OQ7A 1XU2A 2XH6A 1OKOA 5EFUA 2IZWA 2HWF3 5C5UA 1H2KA 4NMIA 1JU3A 1F35A 1J1LA 3MV01 1JZ4A 3FHAA 5FUPA 3NWKA 1H4HA 1REFA 1H8TC 2BWCA 5A7WA 4QGLA 4JGZB 1C8M1 3VN4A 2VMIA 2OXBA 4JKKA 4Z2AA 4K1YA 1D7PM 1NT0A 2WZR1 3THPA 4CUGA 4LHLA 2W1SA 1UD1A 2VCMA 1U12A 1BYHA 4J25A 1UOGA 5CYYA 5IWFA 4BXSV 3DECA 4AFDA 4IEXA 5GZEA 2HWD2 2Q5TA 4AG4A 2DCYA 2YBSA 4CCJA 4PF5A 1FPN2 1GANA 2JB8A 3PLQA 4QX1A 5I0UA 1RMU3 4ARYA 2RHPA 3PDQA 1GOGA 4LLFA 1ZBA1 1WBLA 5FYMA 5FPUA 3CKHA 1HV1A 4ZU4A 2WLPA 2RS33 1LU1A 4I2OA 2BEOA 1LNSA 4MGKE 5C4WA 5JZGB 3ZXKA 4TLGA 1AL21 3SEEA 2WN3A 5GLWA 1PGL2 4B4QA 3OPZA 4GMP0 4COYA 1RUD1 1BMV2 3CU7A 1VMHA 4I09A 4LOTA 4AI3A 3Q8FA 1CGPA 2Q8DA 2BGCA 2AR6A 2QDRA 3KGLA 2DV9A 1C5IA 3AMNA 1SLAA 4LBQD 4XFAA 3BKZA 3WHUA 1PNFA 4K8RB 4EZHA 4OUMA 1AX0A 1ASJ3 1UW8A 1PMJX 1HB4A 2OZJA 2YBKA 4HSLA 4NPLA 4P5HA 3MUY1 3INAA 4X8PA 5IVFA 3VBOA 3PL0A 3IPVA 3WW1A 2PLV2 2RR11 3H8UA 4AQ6A 4IE0A 1XSRA 4XFHA 2JIGA 2B46X 3ZDVA 3BOWA 4AAXA 1QNWA 1OPOA 1U5IA 1JOBA 2DTWA 3RSJA 4IEWA 1DBNA 3FBMA 4XEZA 1UY3A 1S0BA 3ZMOA 2O8OA 3APBA 2R0HA 4QM8A 2WNVA 1OUSA 1VIWB 1CIYA 1JOPA 2BNNA 4LBQA 3SKVA 4CDWB 3AZZA 5A6XA 1IG0A 3N9MA 1T6BX 2HBTA 2VU9A 3WD5A 3ZFGA 1IG3A 4YFWA 4AAPA 4BQ4A 1ZRIA 2Y6GA 1CAUB 3RZGA 5ABJC 4J6GA 1PGSA 3M3CA 4PDWA 1Q8PA 1OBNA 2H0BA 5AFBA 3A7QA 3N7MA 2FCVA 5FWEA 3MIEA 1ULGA 2YFZA 4KNCA 5A3PA 5IYYA 2CL2A 3TNPB 3Q8EA 4XHXA 2YGLA 3D6EA 4BU2A 3AX4A 2FHRA 2QZ2A 3ON7A 2XBO1 5SV5A 2W39A 2VOWA 2JE7A 2ZGSA 3PMEA 1BQPA 4BE3A 4E2SA 1U5XA 1H9PA 5F5CA 4L8QA 5KR7A 4JC1A 1EPZA 4QXHA 2XDVA 3SQOA 4Y1UA 4YW4A 5LRSA 3PUAA 2VMCA 2B9VA 2GC0A 4FQ4A 2QNKA 4BIOA 3D4KA 2X29A 3H42B 4Q4V2 4QB6A 5L7OC 1LHWA 3O1PA 1OPMA 3PMSA 4CDXB 4DRVA 5JI7A 5CFCB 1SDDB 3PTRB 3BTZA 2RDSA 3NV1A 3NKGA 4P9LA 3MF9A 4Q4W3 2EF6A 3IMMA 2D7FA 4XZPA 1W6OA 2QKDA 3SC7X 3U37A 4ZZ5A 5J48A 1XC6A 1I3HA 3PURA 3VZOA 5JSPA 4QPIC 3WCSA 3T1MA 2A6WA 2JG8A 2QQMA 5JVVA 4OI4A 3EBRA 2G9ZA 3K77A 1XXNA 5T5PA 3RDIA 1UU6A 4R4XA 1S0IA 1MPXA 3M3QA 2WO3A 5FZIA 1V6OA 1KITA 1SZBA 1Y3TA 4NO4A 1F2NA 2CDPA 5FPAA 2GMEA 3N9NA 4QM9A 4CUBA 4XQWA 1K5MA 1XNAA 2VW2A 3VBSC 4IEOA 1JHJA 4TN7A 3DKWA 3VDDB 3K4ZA 4MUVA 1LGBA 3EMRA 2RS52 1D4M1 1WCQA 3LB9A 1NYWA 3POFA 4GWJA 4JAAA 4CYDA 4QQPA 5IVJA 1UZZA 5FZBA 3OBRA 4BZ4A 1L7LA 1VMJA 3J7MA 3VBOB 4AVAA 5A1AA 4A7YA 3LDKA 3HBKA 3U1XA 3DF0A 4Z92B 3DV8A 3N3HA 5KHJA 2YC4A 3ZN6B 3O0VA 5A33A 3ZXEA 4YG0A 5FFOC 2CY6A 4JDMA 5CVRA 5BXXA 4AYUA 1WMEA 4IV1A 1HRI1 5FIXA 3WP6A 2NM1A 5C7GA 2QBXA 2WFF1 1YYNA 4HONA 4MGIE 5DDJ3 1MZEA 3O1UA 2ZTNA 2CHHA 4CU7A 3QOPA 5A3LA 1HRV2 2IXCA 4KWJA 5HCBA 4FOQA 3KV9A 4YARA 3GYDA 1UZWA 4W6XA 3WF2A 1J58A 1I6XA 3THCA 3ZDSA 5L36A 5A70A 4D7TA 1LESA 2J7MA 1R1A1 4AVTA 1XE7A 2ZA9A 1QH7A 2DUPA 3NNGA 3U75A 3I49A 2BV4A 5JR7B 1N1VA 3FFZA 1CJDA 4Q0PA 4CCLA 3J9SA 2BU9A 4QGNA 3W5NA 2Q0AA 2NP0A 3RQ0A 4YZ1A 3AP4A 2LROA 2OX0A 4OHXA 1NXD1 4XTPA 5FYVA 5KWRA 3AK0A 4ZS3A 3VBUC 5LW9A 1IS5A 5K7PA 3V56A 4KG8A 4L11A 1WW7A 2NN8A 1PO11 1VMFA 3WY6A 3AMQA 4NJ4A 4YVWC 3N9PA 1J83A 2VZ1A 4KH9A 1W8OA 3T3YA 1AR83 4GWIA 4CP0A 3I2IA 3T2OA 3OB8A 4JGZC 1KXGA 4L92A 3NV4A 2Y0IA 2ET1A 3WCRA 3OJBA 5AC92 1ULDA 2JDAA 1BCXA 1W28A 1QXPA 4JGZA 2XG3A 1LGCA 4E4SA 3WP3A 3VBFC 3ZM8A 1JBCA 3QH7A 3TWIA 3JQWA 1KD7A 1EUTA 2C24A 2FBEA 1GFF2 3RFRA 3PIGA 2ZEXA 5T54A 3GCXA 1RMU2 2R30A 4EYUA 3N4MA 1JODA 2D6KA 2UY8A 3LA3A 3MFAA 2BNOA 3LIGA 4NR1A 3UGFA 5JDBA 4A45A 1C8M3 4WVVA 3A4UA 4L9BA 1TNRA 5I8YA 4WM7A 4AGRA 1KFUL 1SFNA 5FOBB 4W6YA 4IQPA 3ZFEA 1G8WA 4V2WA 2WBKA 2W1QA 3ZN5A 5IW0A 5LEKA 4QX7A 1SLIA 4HANA 5LY1A 3AYAA 5A33B 3MLJA 2K46A 2OYZA 3L2HA 1C1FA 3POEA 3EB7A 3OPTA 1KDMA 4LIUA 4OI2A 1CVNA 1A34A 3CL1A 2WS91 2WABA 5J1XA 3VDDC 2RMU2 3JB8A 1N47A 1R092 2HWB1 4Q29A 1PHMA 3OEBA 3HJRA 2QDNA 4JDOA 5KC6A 5LRRA 5T3NA 2AEZA 1BBT3 1ENXA 2JG9A 2V09A 3AMPA 1AR63 2R0FA 2Y38A 4W4ZA 4PIXA 1AR73 1PMHX 4XDOA 5B2GB 5FR3A 1ZZ6A 2FCTA 2ORXA 2A1XA 2X09A 3DGTA 4MXVA 1PO21 3UKVA 5I0TA 2GAUA 4G3YC 2IXIA 3OUIA 2R041 2ZMNA 4LBQB 4IEUA 4S2GA 2RM23 2WA4A 1A8MA 3VBFA 1R093 4CCDA 2VULA 1ASJ2 1VR3A 3CJIB 4GH4C 2DVBA 4P5YA 3AZXA 4RA0A 3UETA 1LKNA 2VPVA 1US2A 3IMNA 1AHSA 4M01A 3AXEA 2YC0A 5C9AC 2VUDA 5JXGA 4U36A 1EAH2 1OOPB 1VBD3 3NAPC 4UW6A 3I59A 1OXCA 2ZZQA 5FDBA 1S2KA 3LOBA 3ZXLA 2HLEA 1WCUA 3LD8A 4GH4B 1GP5A 1RUC3 4UYBA 1K45A 4Y1YA 3WEZA 3T0AA 5CNAA 3V0AA 2VOXA 4FPJA 1TVGA 4H3WA 2WT2A 4ES9A 4RD7A 4AEMA 5LWBA 3AZWA 2RDQA 5H9PA 4GKXA 1GWMA 2A6XA 1LEDA 2WKKA 4Q1PA 5FY4A 2EIDA 5CFCA 2BGPA 3M3EA 1QJU3 1TMF2 1XBFA 1PMIA 1TME3 2ZXQA 3E5XA 1AX2A 4D6RA 5T52A 2MEV3 1ACCA 2I74A 2X5IA 3AKTA 2PHTA 3JD71 4LTAA 1IGOA 4AHYA 2JDPA 2OUHA 2RR13 1X8EA 3H1MA 1LB2A 1NCRB 1VBB3 5M0TA 2P3KA 1ND2C 3AP9A 3LE0A 4WM8A 3ZFEB 4LO8A 4ET7A 5FZHA 1QJY1 2RE9A 3WW4A 3H1YA 2DTYA 2XJTA 1PK6C 4JHTA 5FO7B 5L7OB 4QDSA 4QAWA 1QXRA 2WLQA 4JGYB 1WWYA 3AFGA 1DQ0A 1RVF3 2ZKLA 3ZN4A 3CNAA 3EXUA 2H6CA 1HB2A 2HWF2 3LSDA 4MADA 2Q30A 2ZJCA 4ASLA 1V70A 3MIFA 4JRLA 4YLZA 4HMZA 5BNQA 1LTEA 2QQJA 4BCUA 1FXZA 5DZFA 2ZGKA 4HL0A 5C3RA 3T4VA 1MS9A 4FBFA 2V72A 3L2YA 3T0DA 3OGRA 2B8MA 1EUUA 2A75A 2CDOA 3FJSA 2VY0A 4GA9A 5EJ3A 2UWAA 2BOIA 4FI9A 4IGQA 4EV0A 3VBSA 4LBMA 5F8PA 1TMF3 2A6VA 1Q8QA 3LA7A 2BZDA 2JECA 2UY9A 2WZR3 3MPBA 3UGGA 5FK8A 4ZZ8A 4HZFA 3GXUA 1F5FA 3W5MA 3U10A 5FZLA 4E8DA 4ES8A 1WLWA 4QX3A 2W1WA 1DGRA 5FMOS 5JIUA 1XE0A 3UJQA 3ELNA 1OT5A 3NVCA 4UFJA 1AYN2 1WW4A 5CG8A 1PK6B 5IVBA 1H8VA 4TYSA 5FZKA 3ZYRA 4AHZA 4OQ9A 1DGRN 4MZUA 4YW7A 2WINB 3POSA 3RYRA 5F39A 2R1DA 3R05A 3KM5A 3IWZA 3N9QA 2CGOA 4XDQA 4FFFA 3KV4A 1YCIA 3Q8AA 5FZ1A 5FYHA 1RJ8A 1RVF2 4LKEA 5FPBA 4XJ8A 2C9KA 1XRUA 1EV11 2ZHMA 5I8SA 3HN1A 2IXLA 3BPZA 4CEWB 5FXZA 1PIV2 2V5YA 1YFWA 2O8QA 3U0ZA 1CAVA 2D5HA 3CLPA 3LEMA 2VMGA 3VGIA 1GQHA 3LF7A 4GQ7A 4NIGA 5ANQA 5KBFA 4Q4Y1 1JHNA 3RZJA 1PX3A 4NIIA 4XETA 4AR2A 4YNIA 3ACFA 1ZZCA 1ENQA 2WT0A 5BNOB 1V9U1 1O5UA 4RGGA 2P6HA 3E6BA 3WDYA 1G6NA 1M4WA 2G9GA 2ZGMA 4B4PA 1SBFA 3SH5A 4Y1ZA 5H9QA 4FQZA 5LCWL 3UJOA 4R9BA 1UZVA 2ZGRA 4LOSA 4NVPA 2DVGA 3POWA 5FLHA 4D3WA 3HVDA 3OF1A 2WZR2 1W2UA 1OF4A 1MR5A 4Q0QA 4RGKA 4YVSA 1WW6A 3ITQA 5EV7A 1YFUA 3GZUC 4PF1A 5FOJB 3GF6A 3FMGA 2CU5A 2H6BA 3IDCB 3KS7A 3M1HA 2XBO3
chains in the Genus database with same CATH topology
1YQ6A 1YQ8A 1YQ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YQ6 A;  1YQ8 A;  1YQ5 A; 
#chains in the Genus database with same CATH topology
 2HWD 1;  3KCC A;  1CJP A;  1DU3 D;  1QJU 1;  1RL3 A;  3LCP A;  2ZGQ A;  3MFC A;  2WJS A;  2XR4 A;  2NQY A;  4MGZ E;  4WVM A;  3R6S A;  4HKW A;  2MEV 1;  4BPZ A;  2ZEY A;  3H0O A;  4LO7 A;  2VMF A;  2NYY A;  4GWM A;  5A7N A;  1ZBA 3;  4IE5 A;  4YZ2 A;  3AJY A;  4N8M A;  3OCP A;  2X10 A;  1GYK A;  5G04 L;  4PIY A;  1F4A A;  1CIW A;  2WZP P;  2YPJ A;  4UW4 A;  5T5J A;  3M3O A;  4JHZ A;  1AR9 3;  4Y3O A;  3VBS B;  4RS5 A;  5BYN A;  3MEP A;  3VD7 A;  5FPL A;  3NKT A;  2C6S A;  2Y0O A;  3FLT A;  1NQJ A;  2ES3 A;  4IDZ A;  3WXP A;  2JEN A;  3KCY A;  1VB4 A;  3ZSE A;  1MS4 A;  1BZW A;  2I07 B;  2PYT A;  1S0E A;  4HK9 A;  1D0H A;  1J59 A;  3I3Q A;  3ILN A;  5G05 L;  2JIC A;  4BWO A;  2PLV 1;  1LUL A;  2ZAB A;  1PK6 A;  3I2G A;  4XIK A;  4QT6 A;  5E88 A;  5IUQ A;  1YQ5 A;  3WP5 A;  1QKQ A;  1POV 1;  1JZ8 A;  1COV 1;  3AVS A;  5KHH A;  5FRA A;  4CE8 A;  4RN5 A;  4Y5T A;  4OMD A;  1OLM A;  1VPH A;  1YNA A;  3SEP A;  1GKB A;  1HDK A;  3WUD A;  5K0U C;  5E89 A;  1F15 A;  4HLT A;  2XJS A;  2VZS A;  4J1X A;  2X5I C;  2VBD A;  5FMO L;  5FZO A;  3AZV A;  1L3J A;  1YXW A;  2OVU A;  4RS5 B;  4N9H A;  3CF6 E;  1WLD A;  3ZIW A;  1HN0 A;  4HOO A;  4IES A;  4JX0 A;  3DL3 A;  3RRD A;  4YG6 A;  1GU3 A;  5FY9 A;  4AED B;  4IE4 A;  3FZ3 A;  2VVD A;  2W47 A;  4WV8 A;  3KMH A;  2JDN A;  2WUH A;  2BP6 A;  4XUO A;  2JB4 A;  3ZSJ A;  3ZYI B;  2DCJ A;  5HV0 A;  3H3L A;  3A23 A;  4GMP 1;  1Y43 B;  4X6R B;  5AVA A;  4G9S B;  5GZD A;  4GKY A;  1Z7S 1;  2YGM A;  1X9P A;  2D93 A;  2A70 A;  4C0B A;  1AR6 2;  1DZQ A;  1CR7 A;  1O4T A;  3VBH A;  4AEK A;  4ERO A;  1XYN A;  4XYX A;  1JYI A;  1RUH 1;  3C8X A;  4QHZ A;  3FHI B;  4YZ3 A;  1CQ9 A;  1TE1 B;  4CP9 B;  4CUA A;  5I91 A;  2PHF A;  4L99 A;  1UOB A;  5C70 A;  4NHM A;  3KHC A;  1IPK A;  1X33 A;  3HIF A;  4V2V A;  1AL0 G;  1Q8V A;  3UNP A;  4Q4V 1;  4QPW A;  4CDW C;  2WO2 A;  2NMN A;  2YU2 A;  2YXS A;  1W05 A;  2B4K A;  4YZ5 A;  2Y6L A;  2K9Z A;  4D7Y A;  4I0B A;  1XOY A;  1V6M A;  4LO6 B;  2GC1 A;  1PVC 1;  3ACL A;  4NPR A;  2ZEZ A;  3RVH A;  4H55 A;  5JSR A;  1W0O A;  3RZK A;  2KD7 A;  4ITC A;  4ZPI A;  1LOE A;  2VUC A;  1YIF A;  3GCW A;  3H8X A;  3OEA A;  3PJY A;  4LHN A;  3A0K A;  4AI0 A;  2ZGP A;  4MV2 A;  3PVE A;  5FKB A;  2HWE 3;  3FC0 A;  4AL9 A;  1LEC A;  1SCS A;  5L73 A;  1UY4 A;  3CJX A;  5FJK A;  3N9O A;  4QWN A;  1OKQ A;  5C4W B;  5JZG A;  5GKA C;  5C8W A;  2XPJ A;  3KB5 A;  4FOY A;  4LHS A;  5FZ3 A;  1LAJ A;  1YWK A;  1LR5 A;  4V1P A;  1VE0 A;  2VQ0 A;  4XBL A;  4YGC A;  4LKS A;  1NY7 2;  4QPG C;  2DBN A;  1IS3 A;  3K4D A;  2XHK A;  1UNB A;  1KQR A;  2WAA A;  5J37 A;  5GZC A;  5AC9 3;  4R9A A;  1W2T A;  1J3R A;  1OFN A;  4Q4W 1;  3W20 A;  4BLJ A;  1J84 A;  1V6L A;  3X29 B;  5FK7 A;  2QQK A;  3Q8C A;  2YV8 A;  4K7J A;  4XF4 A;  3AP5 A;  2IFW A;  4YSF A;  1LOA A;  2VOV A;  3I97 A;  3E6C C;  4FVV A;  1COV 3;  2JXA A;  5TSW A;  1ULE A;  4HPK B;  3VHP A;  4D8M A;  2F6B A;  3CZJ A;  5EHD A;  4W8J A;  5FP9 A;  2GNB A;  3MI8 A;  1FV2 A;  1PVC 3;  4GAZ A;  4LKF A;  4C90 A;  4NWV A;  1ND3 B;  3R4U A;  2P1B A;  3U4S A;  2WFF 2;  3B5L B;  5LBB A;  4UF0 A;  1W9Y A;  2MPF A;  4HXC A;  2GC2 A;  3MIG A;  3MV1 1;  1JI6 A;  4NHX A;  1NAE A;  1FMD 3;  4CCN A;  4CP2 A;  2XJQ A;  5GLZ A;  4DRR A;  1QNY A;  1HV0 A;  4XAA A;  2Q4S A;  5B4X A;  5J09 A;  2WNO A;  3VBH B;  3WOG A;  5DDJ 1;  1Z0H A;  1V6J A;  2Z79 A;  1JYX A;  5LBF A;  4BA6 A;  2XJP A;  1R1A 2;  4BME A;  1LHV A;  5FMC A;  5JOW A;  5E16 A;  4AI2 A;  1ULF A;  5HCH A;  2J22 A;  1UU5 A;  1KDK A;  2KR2 A;  3W9A A;  4ISR A;  3VDD A;  2WO7 A;  5FYB A;  5IJR A;  1NA1 C;  3T4H B;  3LDR A;  3USS A;  4GZ9 A;  2W68 A;  5J3U A;  3O14 A;  1W3X A;  1UKR A;  5GLU A;  1O59 A;  5HBA A;  2H0V A;  3J8F 2;  3WSO A;  2ZHL A;  1QIQ A;  4WZF A;  3MGU A;  4NHY A;  2VZT A;  5DG2 A;  4K8F A;  2JDZ A;  2X8K A;  4M4R A;  4XQ4 A;  3ZN6 A;  4A2U A;  1JTZ X;  3BTY A;  4EN8 B;  4QKF A;  1DGW X;  2Q1Z B;  5DMY A;  4RFR B;  3WV6 A;  2X05 A;  3OY8 B;  1LCL A;  5F3E A;  2QQV A;  5FP7 A;  3ZOI A;  3K3O A;  4YPJ A;  1JMU B;  4CEY C;  5FCC A;  4C8D A;  4KQ7 A;  4IL7 A;  2NZ9 A;  5CAZ A;  5AC9 1;  2J1S A;  2JJ6 A;  3M7A A;  2KXL A;  4EN0 A;  1PX4 A;  3LEK A;  3JBG 2;  2PA7 A;  4DNY A;  1JYN A;  2DUQ A;  1QJZ A;  2XVL A;  4OYU A;  3SMH A;  3VZJ A;  1X50 A;  1AL2 3;  1UOF A;  1QF3 A;  3IDA A;  1X82 A;  4YGB A;  2PQQ A;  2G1M A;  2YMZ A;  4Z82 A;  4EWD A;  1JZ3 A;  1FMD 2;  1RMU 1;  1O8S A;  1VBD 2;  3TB0 A;  4XJW A;  5I0S A;  1FOD 2;  3ZPY A;  3RGB A;  5JI9 A;  1DDL A;  2HKX A;  4IV3 B;  3NAP B;  3VDA A;  3WZ1 A;  4E4H A;  4YW2 A;  1W06 A;  4LK7 A;  5JAX A;  1K5M B;  2J1E A;  4QPI B;  3ZMN A;  2VZP A;  4MO3 M;  2XKP A;  1QH6 A;  1ZX5 A;  4XFB A;  3N35 A;  4NRQ A;  4ORF A;  2ZPX A;  2EAA A;  4JZR A;  2I2S A;  2XXZ A;  5FZM A;  5JPN B;  3JBG 3;  3SCF A;  4HPK A;  2VL4 A;  2YY1 A;  4PJY A;  2W08 A;  3AMH A;  5F2W A;  4C0H A;  4AXO A;  2E7T A;  2DUO A;  4EQV A;  3KLS A;  4XBN A;  4LR4 A;  4E2Q A;  2GN3 A;  3VBU A;  5FO8 B;  1POQ A;  2ERF A;  3P1I A;  2KA3 A;  4Q1R A;  1SPP B;  3OSD A;  5KHI A;  3GHN A;  1IKP A;  2CWM A;  4AI8 A;  1A3K A;  2WNU A;  1HQL A;  4CEY B;  3MIB A;  3RZZ A;  5AFE A;  3SCH A;  2ENR A;  4I0A A;  3QAC A;  4IEY A;  1R09 1;  5FMD A;  3GNE A;  2EVX A;  5DPN A;  1NLS A;  3CIH A;  2A3X A;  2GP3 A;  3DUI A;  3HD8 B;  3UKN A;  1BVV A;  4IXL A;  1UY0 A;  5BV6 A;  2ZAC A;  3R4D B;  4ZU5 A;  5FZ6 A;  5T5L A;  1T6G C;  1XNC A;  2FDG A;  4KU8 A;  4QB1 A;  4XCA A;  1H1I A;  4B3N A;  3ETQ A;  3SIS A;  1JU4 A;  4E8C A;  2DVA A;  5IK4 A;  4ASM B;  1UO9 A;  1NA1 B;  3WUC A;  3VD3 A;  4K40 A;  2BJS A;  3TEZ A;  5I8T A;  2JEM A;  1K5J A;  1W0P A;  1FOD 3;  2JDU A;  3PVN A;  4N9I A;  1NG0 A;  3LPF A;  1AX1 A;  4O9G A;  4XUT A;  4MGT A;  2VVF A;  2WT1 A;  1QOT A;  4PDW C;  5FQ0 B;  4COV A;  4ZKT B;  4QB2 A;  1O5L A;  1E5R A;  2SLI A;  3CEW A;  1ALY A;  3VBH C;  2QCS B;  4GB3 2;  4CU6 A;  1T2X A;  1QQP 1;  1PZ8 A;  2V4A A;  4JKL A;  3C7G A;  2XWB B;  2VCC A;  2ZML A;  5GJ6 A;  2PN5 A;  4MX3 A;  3O1O A;  4UFI A;  2VNO A;  1GQP A;  4IEP A;  5J96 B;  1HLC A;  2XLA A;  4K3U A;  4BOW A;  4DUX A;  5FZE A;  3BUC A;  4OI0 A;  2EIB A;  4Q2F A;  2VJX A;  4XXP A;  2JG9 B;  1PZ7 A;  1W3V A;  3VZK A;  3DYP A;  4R52 A;  4PLM A;  3N7K A;  1QDO A;  5FRE A;  2OKX A;  3BVC A;  3TOJ A;  5FKC A;  2VVE A;  1E5S A;  1TMF 1;  1RUJ 1;  5IHR A;  3HOB A;  4RHV 3;  5DAV A;  2GZW A;  2EXI A;  4K21 A;  3QH6 A;  2BBV A;  3PVO A;  5FXW A;  1VAK A;  1RUI 3;  4KWL A;  3H8O A;  2JD9 A;  3GDB A;  1OLR A;  4OHW A;  2PFW A;  3Q9O A;  1PGW 1;  4XPV A;  1OI6 A;  3KT4 A;  3ZXG A;  2VC9 A;  3K2O A;  3GZA A;  5HCA A;  2VZR A;  5C4W C;  1Y9G A;  1GIC A;  2BRT A;  5GZG A;  4X6Q B;  2VNR A;  3VBO C;  3IDB B;  2C26 A;  3IPV B;  1YEW A;  1DQ6 A;  4XQD A;  3O1S A;  1H2N A;  1W6P B;  5GLT A;  2HWF 1;  2QVS B;  1JYC A;  1UMH A;  2A5Z A;  2YU1 A;  3D8C A;  1NX9 A;  4QXB A;  5CU1 A;  3S7E A;  4D6S A;  3MIH A;  4XIO A;  4FP3 A;  1B35 A;  5EJZ B;  3ZXF A;  2BGO A;  5I0D A;  1RUI 2;  4DO0 A;  4YM0 A;  4QKD A;  3S5A A;  3P6B A;  1Y9Q A;  1GZT A;  3A0N A;  5DUU A;  1W9S A;  4XCB A;  5FAX A;  2DWR A;  4LQR A;  3ZO0 B;  4Q4X 3;  2Y6J A;  1NCR C;  1BEV 2;  1YRZ A;  2ORZ A;  4Q4Y 3;  1ZNP A;  3IZO A;  4SBV A;  4D69 A;  2WRA A;  4QKB A;  2FDH A;  3NNL A;  2CYF A;  4UFM A;  4UFK A;  4YVS C;  1F4H A;  1LU2 A;  2JDY A;  4MYE A;  2PAM A;  4XF1 A;  4CEY A;  1ZRE A;  5FYZ A;  2X5I B;  3NNJ A;  1QOS A;  1UYY A;  4XJA A;  3U4X A;  1VRH 2;  2WS9 3;  4GJY A;  2WYF A;  2Y33 A;  4YGE A;  1NCR A;  2X53 S;  1AR7 2;  1C4R A;  3FN9 A;  3HBZ A;  1FPN 1;  3FHQ A;  3LFI A;  2D6M A;  5LK5 A;  5L9V A;  3NL1 A;  3LEI A;  3CJI A;  1OQ1 A;  4FO9 A;  2WWJ A;  5C3P A;  4MXW A;  4QU1 A;  5FP8 A;  4CUC A;  4UAP A;  1LOD A;  2JKX A;  3I2H A;  2GP5 A;  2Y6K A;  1AXY A;  3BB6 A;  3TN9 3;  1PGL 1;  1CD3 G;  3B7M A;  4PQ9 A;  4E27 A;  2AH2 A;  4PIZ A;  2VD7 A;  4HKL A;  1QJX 3;  4ZU7 A;  1N3P A;  3VKM A;  3TAY A;  1LEM A;  2HEY F;  4ISQ A;  5F3I A;  1V0A A;  1CAW B;  5K0U B;  4I3P A;  5CFC C;  2Y26 A;  1MZ6 A;  5IFT A;  2RR1 2;  3PU3 A;  5F2S A;  1AF9 A;  2R06 3;  3VL9 A;  2HEV F;  2D5F A;  5DUX A;  4N53 C;  2ZOE B;  1B35 C;  1YQ2 A;  4Q4Y 2;  2E7A A;  3I2O A;  4WM8 C;  1BLZ A;  2D6L X;  3HR9 A;  1UF2 C;  4HN1 A;  5FP3 A;  2NLR A;  1H6Y A;  3I4I A;  5FBJ A;  1CPM A;  1VP6 A;  1QMJ A;  2HWD 3;  5C3S A;  2VUJ A;  4CDQ A;  5FUN A;  1UPS A;  1JN2 P;  1N1Y A;  2JWP A;  1WCS A;  3IM0 A;  5FPV A;  3W21 A;  2IXH A;  5FY0 A;  5CBL A;  1GZ9 A;  1VRH 3;  1QOO A;  1RHI 3;  2Z4F A;  4H14 A;  4XXA A;  3V0B B;  1IPS A;  4FXK B;  4AHW A;  1QJU 2;  1S4C A;  3MBW A;  3GJB A;  4FOV A;  2Y6H A;  2MEV 2;  2D6O X;  1AYM 2;  2D43 A;  4Q0V A;  4FTE A;  4FCA A;  5FYC A;  3WR0 A;  1V6K A;  4PLO A;  4AGV A;  3T2Q A;  2ZX4 A;  1DQ2 A;  1VAL A;  3UL2 A;  2Z5W A;  4QXK A;  2QQI A;  4QQL A;  3OBT A;  4NAO A;  4AE2 A;  3K3N A;  1KJL A;  1RIT A;  2GMP A;  4XE9 A;  4Y4R A;  5HXM A;  3GBW A;  3T30 A;  4YW3 A;  3V64 A;  1RYY A;  5JIA A;  1RHI 2;  2VZQ A;  2BVB A;  4CDX A;  5HPO A;  4Q27 A;  3EYP A;  5K4L A;  1KGY A;  1W6M B;  2J1U A;  2IVI B;  2HYK A;  2R7E B;  1J1T A;  3HQU A;  3I54 A;  3S7I A;  2HWC 3;  5HI0 A;  2CGN A;  2YDE A;  1JZ2 A;  4Y1V A;  2OZ6 A;  1S0J A;  5DAB A;  3KWV A;  3UK9 A;  4MXW B;  2BPA 2;  1QXJ A;  1AXZ A;  3E6D A;  4J1W A;  4QU2 A;  4AWD A;  2D6N A;  2ILM A;  5FY5 A;  3WF4 A;  3SXW A;  3HPN A;  4M4P A;  1NCQ A;  4BQW A;  5JUV A;  5A6Q A;  4XF0 A;  1XND A;  1AJO A;  4PQQ A;  4DQA A;  3PU8 A;  2PEL A;  1G9B A;  4XFF A;  1PZ9 A;  3BTA A;  2JG9 C;  1DHK B;  5DQ0 A;  3ACH A;  3ORJ A;  3SLI A;  4BQ1 A;  3GM8 A;  4ATE A;  4FPL A;  1IOA A;  1AVB A;  2MNG A;  2K2S A;  1VRB A;  2ZX3 A;  4UBG A;  3MYX A;  3VD9 A;  4AQ2 A;  4HG6 B;  2D40 A;  1DZT A;  2XJV A;  5KHG A;  4P9X A;  2RS5 1;  1ZRD A;  4PT6 A;  2XVG A;  4BYY A;  3A22 A;  1VBC 1;  1ZBE 1;  5CFD A;  1Z7S 2;  1LEN A;  2DCT A;  2P37 A;  4D7S A;  2FDI A;  1AR6 1;  1SBD A;  4M3C F;  2RM2 2;  4FT8 A;  4F83 A;  5JOZ A;  5C5T A;  1W8U A;  2O14 A;  3PJQ A;  4P9I A;  3N7J A;  3U11 A;  1RUH 2;  2P4E A;  3ZX7 A;  1G9F A;  1UWW A;  1HRI 2;  3CQO A;  3NJY A;  3PHM A;  3AJZ A;  4C91 A;  1MEC 2;  4QDR A;  5A1L A;  1ODN A;  4PBO A;  1IQA A;  1O7F A;  2BFU L;  3NRU A;  4QMA A;  4UW3 A;  1JYV A;  1XU1 A;  1XNB A;  4JTO A;  1HB1 A;  4WVW A;  4HVO A;  1O91 A;  4PBP A;  2ID4 A;  2YZ4 A;  4GJZ A;  4AOC A;  4COZ A;  5A7S A;  1GWK A;  1I5Z A;  1VJ2 A;  4FTB A;  2J1A A;  3VDB A;  3RYK A;  2EIC A;  2VMH A;  4XZU G;  1OOP A;  4YGD A;  5JXH A;  1UKG A;  4LXL A;  3CZU A;  3AYE A;  1ZM1 A;  1WZX A;  3V0A B;  1CPN A;  2K0G A;  1QU0 A;  4X8N A;  4P00 B;  1Y9M A;  2VCB A;  2C9A A;  2DF7 A;  2Z69 A;  1HQW A;  4GH4 A;  3MLL A;  3EJK A;  2Q8O A;  1W9W A;  2W2I A;  4HKO A;  2QUO A;  2UUR A;  3RZL A;  1GOH A;  1UMZ A;  1W90 A;  1WKY A;  2R07 2;  3T09 A;  1TME 2;  3MPP G;  4LUL A;  4CPB D;  2XLG A;  4WVM B;  4LK6 A;  3P3N A;  1SMV A;  2VQU A;  4K9S A;  3ZFF C;  4DFS A;  2PQS A;  4QXC A;  3ZKY A;  4XDP A;  4LUM A;  1RUC 1;  2SBA A;  2VO5 A;  1PO1 2;  5DXD A;  4M3C B;  5A32 B;  1QGL A;  2AZ5 A;  4KBB A;  1Z7S 3;  2VOK A;  4AI9 A;  1WMD A;  1RXG A;  4WM7 C;  1XPW A;  2OII A;  1H2M A;  2OT7 A;  4JGY A;  1W8T A;  4AVB A;  1YC6 1;  3CHX A;  2E53 A;  4M0N A;  4Y1X A;  4EN7 B;  3KZ4 C;  3ZFF A;  2EAL A;  4Y20 B;  3IN9 A;  3MHZ A;  1RUG 1;  2XHN A;  1AR8 2;  1BKZ A;  1J3P A;  1UZY A;  3MF6 A;  2FDJ A;  5A3T A;  1JYW A;  5EJ1 B;  4QGM A;  1W8Z A;  4MHR A;  1PM4 A;  3UV9 A;  4RR3 B;  1GLH A;  3B3Q E;  4OI1 A;  5A3M A;  3RWK X;  5HV4 A;  2FZ2 A;  5KXC A;  1GNY A;  1JUH A;  4DXS A;  1DYO A;  1S0C A;  4LE4 A;  3KQR A;  2FQP A;  3HWJ A;  3ZYJ B;  4WM7 B;  4CDX C;  1OOP C;  5D1I A;  2XLF A;  3PUS A;  5T5O A;  2GH2 A;  4M3C A;  5ACA 1;  5C71 A;  5J36 A;  4NID A;  1VBE 2;  2AYH A;  5C9A B;  1GP4 A;  2HH9 A;  1SCR A;  1US3 A;  2HWC 2;  5I93 A;  4IEZ A;  1LHU A;  4BLI A;  5J7M A;  1R08 3;  2GNM A;  3WNP A;  3WIN E;  2EA7 A;  4XVH A;  5KHK A;  5K8S A;  1CX4 A;  1H30 A;  1F31 A;  1BEV 3;  1UIJ A;  3M3I A;  3ZXD A;  2HJI A;  5DAQ A;  1W9F A;  4MGQ A;  4A3X A;  3ZFF B;  1CX1 A;  3WDU A;  3ATG A;  3ZIX A;  3VUO A;  1YJL A;  1L7Q A;  3VB9 A;  1SBE A;  1QEX A;  1M06 G;  2CWS A;  4PHZ A;  4AFB A;  2WS9 2;  3HNB M;  1QHD A;  2PHX A;  4L97 A;  2XGX A;  1RGS A;  2L9L A;  2RMU 1;  2D97 A;  1RUF 2;  1ST8 A;  2QE3 A;  3MW3 A;  4CDQ C;  1ZZ7 A;  5F7U A;  4IET A;  4DB5 A;  1UCX A;  2ZX1 A;  4HFS A;  5LBE A;  3U78 A;  3WF1 A;  3ZVX A;  5L7O A;  2R16 A;  2OQ6 A;  2PXJ A;  1CAW A;  5K0U A;  1VBB 2;  3POG A;  4B8E A;  5LA0 A;  5BPX A;  3WQ7 A;  4ZXK A;  1GNH A;  2V73 A;  4OUE A;  2VZO A;  3C3V A;  1PO2 2;  2GSY A;  1CZS A;  2Q1F A;  4NN0 A;  4DOU A;  4PCR A;  1KFX L;  2R04 2;  3JBG 1;  1W39 A;  4CPB A;  3VBF B;  2PHW A;  2JD4 A;  3WT3 A;  3C7O A;  5C33 A;  2IXK A;  2P34 A;  2JDK A;  4AK3 A;  3BU0 A;  4E4Z A;  1KS4 A;  2AEY A;  1RUH 3;  1CAX A;  1ASJ 1;  1OQE A;  1E5I A;  1V00 A;  3K75 B;  4XC9 A;  4JRA A;  2B7Y A;  1W6N B;  1FOD 1;  3I3M A;  1V9U 3;  3MO4 A;  1AYN 3;  3FL7 A;  3POY A;  1RUG 3;  1IKQ A;  2ZKN A;  3P5B A;  4NIA A;  2MHF A;  2R06 2;  1YLL A;  5JMC A;  4OHZ A;  1NE6 A;  1EAH 1;  1RUE 1;  2VME A;  5IK7 A;  3AKR A;  4RGA A;  2YRO A;  3WNX A;  1RUO A;  1YQ6 A;  4EN6 B;  2FDK A;  4Y20 A;  4Q4X 1;  2XJR A;  2QJV A;  3B01 A;  5C8C C;  1OQD A;  2GMM A;  4IUG A;  2AAC A;  3C2U A;  3GGL A;  1CON A;  3AKS A;  2GU9 A;  1TG7 A;  1VBC 3;  1NE4 A;  1ZBE 3;  2VGD A;  2W46 A;  1BBT 2;  2EXH A;  4XUN A;  5H9S A;  2ZZJ A;  4OUL A;  2Q8C A;  3UT0 A;  1NZI A;  1ODM A;  4IGO A;  2VUA A;  5D8A C;  5ABJ A;  1F5J A;  2E33 A;  5A3N A;  5F3C A;  3BIW E;  3LPG A;  4R9C A;  4WVZ A;  4FFH A;  4L0P A;  3E97 A;  4OFG A;  2EAK A;  2AEN A;  1WUV A;  2D3S A;  4HN0 A;  2D44 A;  3J7N A;  2JG8 C;  1HKD A;  3PUQ A;  5CKN A;  3SHR A;  1TEI A;  1WLT A;  5T50 A;  3E1F 1;  1MQT B;  4O65 A;  2P6C A;  3H7Y A;  5KC5 A;  5FZG A;  2RVA A;  5JPM B;  4A6S A;  1Q5O A;  2HYX A;  2YHJ A;  1NZC A;  1GR3 A;  3AC0 A;  2YFU A;  2VM9 A;  1UYX A;  2ARC A;  4IV1 B;  1DGW A;  2WFF 3;  4GD4 A;  5EYY A;  2YB7 A;  1LJ7 A;  3JB4 C;  3LWC A;  1OUR A;  5A6Z A;  1ND2 B;  4KWU A;  4HK8 A;  3NJV A;  4EE2 A;  3AP7 A;  3PUI A;  1ZZB A;  1JH5 A;  4GB3 1;  2W87 A;  2CGP A;  2E51 A;  1DZR A;  1W8F A;  1WA6 X;  4R9D A;  2VR4 A;  2LW8 A;  3K4A A;  4QQO A;  4EN9 B;  3ZR6 A;  4NE9 A;  4P14 A;  4AI1 A;  1XE8 A;  3WDW A;  1QWR A;  3OY8 A;  3ZXA C;  1RIN A;  4QKN A;  1QQP 3;  3D0J A;  2QFE A;  3VKF C;  1IHM A;  1R08 2;  3WF3 A;  4NAM A;  3AKQ A;  4ATF A;  2IC1 A;  5FXX A;  3WP4 A;  1AUY A;  1ZYB A;  2ET7 A;  3ZFG B;  1SFP A;  4BK5 A;  3LQC A;  3N36 A;  5SV8 A;  2BVV A;  3T1L A;  2PHD A;  2WNV C;  1OVP A;  1YI9 A;  2UWB A;  1BK0 A;  3J4U H;  1N3O A;  2PHU A;  3I3E A;  4AGG A;  5I0R A;  1ZBA 2;  3O1V A;  4O9E A;  3I2F A;  1S55 A;  2XOM A;  4FPH A;  1YUD A;  1POV 0;  1LHO A;  1AJK A;  3ACG A;  4XAC A;  4CDU B;  5L9R A;  1AL2 2;  1UX6 A;  2GDF A;  3POI A;  4O61 A;  5F5Q A;  4FAG A;  3H50 A;  1WCK A;  1UX7 A;  3VHR A;  4HVQ A;  5GAL A;  3TNQ A;  4AVV A;  1S0D A;  3FE5 A;  2WN2 A;  4EJR A;  4XJU A;  2QQN A;  4I01 A;  2E32 A;  2XWJ B;  2IFR A;  5A7O A;  5LEJ A;  1K12 A;  2UYA A;  5DUV A;  2YYO A;  1VBA 1;  1MZ5 A;  3OGV A;  1IS6 A;  1N1S A;  4TZD A;  1QJX 1;  1MS1 A;  1V6I A;  4BDV B;  1WBF A;  3LOI A;  2QZ3 A;  5FPX A;  3ZYB A;  1UN1 A;  2BOJ A;  1LOC A;  5E6H A;  5LA9 A;  1V9U 2;  1XQN A;  3EHK A;  1P8J A;  2DU1 A;  2GNT A;  2VW1 A;  3DCQ A;  5FXV A;  5JXJ A;  1EP0 A;  3VZM A;  2ZGN A;  2WAO A;  2XQR A;  1Q8S A;  3AM2 A;  4NRP A;  2DVD A;  2R07 3;  5IFP A;  2LRP A;  3NJX A;  2CAU A;  1O8P A;  3I2D A;  4P9Y A;  3USU A;  3WW3 A;  1JZ6 A;  4IEV A;  3D3A A;  3RI8 A;  4UT5 A;  5FZD A;  3TEW A;  3FLR A;  1BHG A;  3BCW A;  1ZRR A;  4U2A A;  4B1L A;  5IVY A;  1W2O A;  3PTY A;  4BQ2 A;  1VRH 1;  2VE1 A;  3W58 A;  2VQA A;  1AR7 1;  2WYS A;  2B9U A;  4Z07 A;  4OQ8 A;  4Q5O A;  4A41 A;  2DCZ A;  4LBK A;  1MVQ A;  3B93 A;  4NHL A;  2F4P A;  2ZHN A;  2AUY A;  2WFP A;  5CZK A;  3LIH A;  4BM8 A;  4CCM A;  3R4S A;  1JZ7 A;  4CVU A;  1O3Q A;  1ND3 A;  5LZ6 A;  2XBO 2;  1MS3 A;  4OHY A;  3D0S A;  4CEW C;  1O3R A;  1KRI A;  2RS5 3;  3NNM A;  3ZSL A;  2C4X A;  2D3P A;  2HEW F;  2NMO A;  3HEI A;  5C6C A;  3OGS A;  2W94 A;  5C8C A;  4DPN A;  4GWN A;  2RS1 3;  4XTM A;  5FZ4 A;  2VQT A;  3H9A A;  3JU9 A;  4N7I A;  3B9I A;  3RG0 A;  4NHK A;  3T0B A;  4EWA A;  2C0Z A;  3B69 A;  2ZEW A;  1YI7 A;  4KL1 A;  3S5Q A;  4BB3 A;  1JW6 A;  5BNO C;  5LA1 A;  3O0X A;  4CU9 A;  1F8V A;  3OBA A;  2W3J A;  4XAE A;  2PLV 3;  3IDE A;  5FYS A;  3H3U A;  3SH3 A;  1UXZ A;  2TNF A;  5FTT C;  3L9J T;  3D82 A;  3OGJ A;  3M4F A;  1COV 2;  1S1A A;  2WQ8 A;  1VBA 3;  3AP6 A;  5IAV A;  4OZX A;  4BIS A;  1FV3 A;  2Y64 A;  2J1R A;  2VAU A;  2IVJ A;  4PLN A;  1DGL A;  3VBR A;  5BNP C;  5FYY A;  3OUH A;  4CDU A;  5K9Y A;  1YHF A;  1AR9 1;  1CZV A;  3LZZ A;  3HNY M;  5A7W B;  3P3P A;  4BQ3 A;  3BTX A;  1W8N A;  5T55 A;  5H9R A;  3H3Z A;  1I5P A;  5DAW A;  5F5A A;  2LM3 A;  3HQX A;  2ZGL A;  4JQR A;  1AYM 1;  3S0M A;  1ZA7 A;  4RHV 2;  1UY2 A;  2BUK A;  4P9W A;  4YVW B;  4AF9 A;  2J1T A;  2VZU A;  3D5O A;  1Y7B A;  4LKD A;  2HBU A;  2VTF A;  3AB0 A;  5FYU A;  3WHT A;  3ZPO A;  3BOD A;  1LHN A;  3U14 A;  1MS5 A;  2WNU C;  2GH8 A;  1HXS 2;  5JOY A;  1D2S A;  4XFG A;  3WQ1 A;  1WD4 A;  4ASK A;  2XML A;  1W2N A;  3T2T A;  3LAG A;  2I45 A;  4URA A;  2ZCW A;  3FX3 A;  3AFK A;  2VG9 A;  3BAL A;  4CCO A;  2WDB A;  1GV9 A;  1RHI 1;  2DVF A;  1MS8 A;  1G9A A;  4JV4 A;  1W6Q B;  2WO1 A;  4D0Q A;  4QX5 A;  3MZH A;  3RS6 A;  1OUX A;  3T2P A;  2WII B;  3NAP A;  1F9K A;  4IEQ A;  3VHN A;  1HRV 1;  2BDR A;  2WQ4 A;  3KT1 A;  4RR3 C;  4XMA A;  5D21 A;  4A4A A;  1GP6 A;  4RQP C;  4HSJ A;  4LEJ A;  1FI2 A;  4LIV A;  2D3R A;  1LRH A;  5CIR A;  1Y4W A;  4FOW A;  4P02 B;  3I3D A;  4AED C;  4NUB A;  3AL5 A;  3OGG A;  2WQZ C;  3V0B A;  2OUJ A;  2XUE A;  4FXG B;  1S2B A;  4YW6 A;  2BFU S;  5EPA A;  3C7H A;  1A6C A;  1SQ4 A;  2RV9 A;  1XYO A;  2G19 A;  2VMD A;  1RUN A;  1WGP A;  1YJK A;  4IV3 C;  2YPD A;  1UY1 A;  3CBN A;  2HWE 2;  2O1Q A;  3LEG A;  4AVS A;  5DAP A;  1NY7 1;  1ULC A;  3THD A;  1UU4 A;  1WD3 A;  3NW4 A;  5A3W A;  1EY2 A;  3K46 A;  5FY7 A;  4JDN A;  4Q4W 2;  3OTF A;  3NST A;  2RM2 1;  4CSW A;  1U5Z A;  4DIN B;  4A44 A;  2VXJ A;  3KSC A;  3K48 A;  2RMU 3;  1W6M A;  2RS1 1;  1S0F A;  2DFC A;  1DLC A;  1DP0 A;  1APN A;  4XAB A;  2WSV A;  3TYJ A;  4BHP A;  1GZC A;  1Q43 A;  4XJZ A;  5FZ9 A;  4AQS A;  2CNA A;  2A7A A;  3KV6 A;  1MEC 1;  4LHK A;  1WMF A;  1BXH A;  1NA1 A;  5A7Q A;  3VBR B;  2QQL A;  4B7K A;  3RZH A;  3HN3 A;  4R4Z A;  1GQG A;  5KXE A;  1SLC A;  2PAK A;  1URX A;  3O0W A;  3ZYF A;  2W9X A;  3ZSM A;  4F7Z A;  3OG2 A;  1HRV 3;  1HN1 A;  2ZX2 A;  2DBI A;  1RXF A;  4QDQ A;  5GZF A;  3VDC A;  2ETE A;  1FT9 A;  1BVP 1;  1FYU A;  5CA6 A;  3O12 A;  5ACA 3;  1WLC A;  4DEV A;  3E5Q A;  2VW0 A;  2ZS6 B;  3FFQ A;  4M3C E;  1IPJ A;  4OMC A;  1K42 A;  5A80 A;  2W5F A;  2IWG B;  4MSV A;  4MHU A;  2WNU B;  1S0G A;  4XMI A;  5FY8 A;  4D94 A;  2R07 1;  2JG8 B;  3ES1 A;  4LBJ A;  3WDT A;  1E5H A;  3O1R A;  4NPM A;  2DYC A;  1HJF A;  1Q8O A;  1YQ8 A;  3J8F 1;  4IER A;  2JE9 A;  5JWP A;  4NOT A;  2E6V A;  1WMX A;  3JXS A;  1OHF A;  2RJ2 A;  4NRO A;  4OUS A;  4QPG B;  2WSU A;  3RNS A;  1OSG A;  1RUC 2;  4MH0 E;  1DQ4 A;  4QX8 A;  5J98 B;  4CXY A;  3DPR C;  2XB6 C;  2UWC A;  2IXJ A;  3B94 A;  3DN7 A;  3WX5 A;  4AHX A;  5E1R A;  1CES A;  1DLL A;  4DMI A;  5A6Y A;  3RYP A;  3DXU A;  1SLB A;  4NRM A;  2F4L A;  2G9F A;  4Y5S A;  1YFX A;  2QQU A;  4YRD A;  5JZG C;  1O6U A;  5CKM A;  3NV2 A;  4YYO A;  4Y33 A;  4B7E A;  4E4D X;  1NLQ A;  4RQP A;  3SIT A;  2RS3 2;  2DUR A;  5BNN B;  3WQB A;  1ZA4 A;  2PAE A;  1RUG 2;  3QBQ A;  1AR8 1;  4KU7 A;  2VOT A;  4LO4 B;  5LA2 A;  3TRS B;  2W0X A;  1HJG A;  2D6P A;  5FV3 A;  1OLQ A;  3I3B A;  4UI9 L;  4KI5 M;  4YG3 A;  5BNP B;  3ES4 A;  1FMD 1;  4XF9 A;  3WG1 A;  1VBD 1;  2XJU A;  4IND A;  4CCE A;  4Q8K A;  3F95 A;  4NWW A;  3DEM A;  4QQH A;  1UQX A;  1MZF A;  4EWE A;  1UOJ A;  2GND A;  2BYV E;  2BWA A;  2VBB A;  2ZAA A;  5ACA 2;  4W6W A;  2FCU A;  2E9Q A;  2E63 A;  1D4M 3;  5BNN C;  5LY2 A;  2Y8K A;  2WZ8 A;  3MLK A;  4CCK A;  5F9T A;  3RI9 A;  3B02 A;  2RDR A;  2ZBJ A;  1JS9 A;  2BBA A;  2P3J A;  1POV 3;  1NUK A;  5LB6 A;  4FFG A;  3T08 A;  2TUN A;  2WR9 A;  5DUW A;  5JOX A;  5DG1 A;  1RTV A;  1C57 A;  3O5S A;  2A6Y A;  4YW5 A;  3LFM A;  4A7Z A;  4MVT A;  4YWA A;  3UES A;  3OBZ A;  1LOF A;  1ZVF A;  1H0B A;  3TBD A;  1DCS A;  4YM2 A;  3IB3 A;  1UAI A;  1RUF 1;  3KT7 A;  4AED A;  3C7E A;  3THT A;  1Z78 A;  4JQT A;  4OVE A;  1MS0 A;  1U0A A;  3SCG A;  2W91 A;  5F6L B;  3WDX A;  1CAX B;  3JD7 2;  4PDW B;  4RYD A;  1MEC 3;  3ILF A;  5F37 A;  5LAS A;  4BQX A;  1X7N A;  3KF5 A;  4TXW A;  4RR3 A;  4LPL A;  3H1W A;  3OUJ A;  2A3Y A;  2Y60 A;  5EYX A;  4K20 A;  1QJY 2;  3LDB A;  3WNM A;  2TBV A;  3WW2 A;  1JXN A;  3NO8 A;  4WM8 B;  1AZD A;  1S2E A;  1OFS A;  2E7Q A;  3ABZ A;  2BER A;  3KF3 A;  4KGQ A;  4Q8L A;  4YM1 A;  1XNT A;  1HB3 A;  2RDN A;  1GBG A;  4AQT A;  4BIF A;  3TN9 1;  3VV1 A;  4UFH A;  4XBQ A;  1GUI A;  3LGR A;  4UWD A;  4QPI A;  5IT6 A;  2KM2 A;  5JR2 A;  4Q4V 3;  1HX6 A;  4Q0S A;  2FMD A;  2R1B A;  5A3U A;  4HT1 T;  3I2K A;  1RUE 2;  4HET A;  4CDQ B;  4CXX A;  1O4Z A;  1QQP 2;  4AFC A;  3JZV A;  1DF0 A;  4JVA A;  4BMB A;  3IIA A;  1W2A X;  2WC2 A;  3DXT A;  4Q4X 2;  3CDZ B;  2R49 A;  4K1Z A;  4S2D A;  3S6P A;  3WLU A;  3IBM A;  1UXX X;  4PI2 A;  1C8M 2;  1OVS A;  4RSU A;  3UGH A;  1SPP A;  1E57 A;  5A32 A;  1BBT 1;  4RQP B;  1MQT A;  1XJA A;  4QQ2 A;  4Z8B A;  2W1U A;  4QHO A;  5FZF A;  5FLI A;  5A3O A;  2WNV B;  4CDU C;  4O7X A;  4MLO A;  2B42 B;  2PMW B;  2BTV C;  2Q1M A;  1RUE 3;  2B5H A;  3H7J A;  3CJI C;  1RUJ 2;  3FUO A;  3RMY A;  1OA2 A;  4FAH A;  1W6Q A;  1LOG A;  3H8R A;  1CAU A;  2G4I A;  3ZYH A;  1AYN 1;  2BQP A;  2J42 A;  3RJR A;  3FWE A;  1D4V B;  4ZXE A;  2PHL A;  4UOJ A;  1MVE A;  2P17 A;  3E5U A;  4MOA A;  4A7K A;  4JTN A;  2LAL A;  2WWU A;  1PGW 2;  4FPF A;  4Q0U A;  1W8H A;  3EQE A;  4W50 A;  2VXR A;  1BMV 1;  3ZFG C;  1RUD 2;  1C5H A;  4BH9 A;  4D6Q A;  4CTE A;  5JLV A;  4YW1 A;  2CSG A;  4HVR A;  3RZM A;  2NPI A;  3KD4 A;  4GB3 3;  1UZ0 A;  4UBH A;  4AZZ A;  3I8T A;  3WNL A;  4COU A;  2R32 A;  1DQ1 A;  2VBP A;  3G6J B;  3VD5 A;  4UF0 B;  1NCQ B;  4XUQ A;  2OW4 A;  5D8A B;  4CEW A;  1YFY A;  3ME2 A;  1RUI 1;  1OLM E;  4P9G A;  4FPK A;  1ND3 C;  1VBE 3;  2OS2 A;  3WNN A;  4IE7 A;  5EXO A;  3WG2 A;  2VH9 A;  3IKW A;  3O1M A;  1G86 A;  1ZZ8 A;  1BEV 1;  5ABJ B;  5JCT A;  1FNY A;  2N7G A;  1SLT A;  1UPI A;  3RPQ A;  4BK4 A;  5F1R A;  2LS6 A;  1R08 1;  3N7L A;  4E2G A;  4XUP A;  4TWT A;  2F17 A;  1CN1 A;  1XB9 A;  1UYP A;  3NNF A;  4LNV A;  1SEF A;  4K6B A;  5BUV A;  1MQT C;  1UL9 A;  1H8T A;  4UXA A;  4ZS2 A;  1X36 A;  3WDV A;  3RWN A;  5CFD B;  1IS4 A;  4JCK A;  5F6K A;  2Y34 A;  4LE3 A;  5C3O A;  1L7R A;  3B9C A;  2CTV A;  2GC3 A;  1W0N A;  4N53 A;  1H2L A;  2BNM A;  3JQX A;  2VNV A;  3AMM A;  3VL8 A;  1FPN 3;  3ZYG A;  1HIX A;  4B4R A;  3KCX A;  2E31 A;  2UYB A;  3WQ0 A;  1EYB A;  1PO2 3;  3ZXJ A;  1PNG A;  3GBF A;  4MGS A;  4XJ9 A;  4B29 A;  1OMI A;  5EZW A;  3GHM A;  5DZG A;  1HW5 A;  3JD7 3;  4Y24 A;  4FPY A;  3ROU A;  1A78 A;  3BI3 A;  5A1F A;  3PIJ A;  2QQP A;  1QJF A;  1NXM A;  1KS5 A;  3DPR B;  3ALQ A;  2RJK A;  1EAH 3;  1YQC A;  1IZ3 A;  5FUI A;  1D2Q A;  2DCK A;  2EIE A;  3U07 A;  5FYI A;  1FX5 A;  5FWJ A;  3ECQ A;  3VHO A;  2OPW A;  2XUM A;  5CAD A;  2EXK A;  1VBA 2;  5EIY B;  2JDM A;  1R1Z A;  1FNZ A;  2YC2 A;  1QJX 2;  3B00 A;  3ZSK A;  3EO6 A;  1Q3E A;  4M0H A;  2YBP A;  4I3G A;  1HRI 3;  3ZKU A;  3POB A;  2FMY A;  2CV6 A;  3RMX A;  5FY1 A;  2FD8 A;  3VBU B;  4FTS A;  3RJ2 X;  4W65 A;  1DQ5 A;  4FFI A;  4QX2 A;  4A6O A;  3GJA A;  4RFT 0;  1OA4 A;  1KJR A;  4Q26 A;  5BNN A;  4ONU A;  4XOG A;  3HMY A;  1VAV A;  1LOF C;  4P08 A;  1W04 A;  5D8A A;  4Y4Y A;  2FDF A;  4RL7 A;  5A7P A;  4C1W A;  5IVE A;  2WL1 A;  3BOP A;  4G4F A;  1HXS 3;  1QJE A;  1A8D A;  1D4M 2;  1Q56 A;  2ARE A;  2ARB A;  2Z42 A;  2LUW A;  3C7F A;  4QX0 A;  4S2H A;  4AFM A;  2XKO A;  4N43 B;  4XF3 A;  5LAT A;  3BN6 A;  4FSJ A;  2P3I A;  1I1E A;  2JX9 A;  5BY5 A;  2W52 A;  1DFQ A;  3I2J A;  4KWK A;  1RUJ 3;  5EWS A;  3ZFE C;  3O1T A;  1RUF 3;  4XFI A;  4QHB A;  1ND2 A;  4ZON A;  4DIQ A;  1JZ5 A;  3MW4 A;  4ZY9 A;  2A73 B;  1UYZ A;  4LIT A;  2LTN A;  4Y26 A;  5FZC A;  2DFB A;  4F8A A;  1W99 A;  4F3J A;  3VD4 A;  3VKO A;  1XNK A;  4H7L A;  3KVA A;  4CCC A;  1NLR A;  1PO1 3;  2DDU A;  3CO2 A;  1EV1 3;  3M70 A;  5CG9 A;  1K3I A;  5IK8 A;  5F3G A;  1N3Q A;  5FZ0 A;  5FO9 B;  1PVC 2;  3HQR A;  4DXR A;  1H6X A;  2RG4 A;  5JXI A;  4TLF A;  5C9A A;  4N53 B;  2PTM A;  3F2Z A;  4AW7 A;  2ZGT A;  3S30 A;  3HNM A;  4WZC A;  3VLB B;  5KXD A;  1QJY 3;  3MDP A;  4YZ4 A;  4JKM A;  4Y22 A;  1CAV B;  1SG3 A;  1W03 A;  1GNZ A;  2VNG A;  3ACI A;  4OLL A;  5AVP A;  5IVC A;  1R64 A;  3GZT B;  3DPR A;  2FZ1 A;  4KGG A;  4YVW A;  1W9T A;  1AYM 3;  4A42 A;  1AR9 2;  1G9D A;  3AZY A;  3FUQ A;  2VEC A;  3AKP A;  3BIE A;  2RJL A;  2PHR A;  1RB8 G;  2V4V A;  4CRQ A;  1VLN A;  1MAC A;  1W8W A;  3OD0 A;  1KEX A;  5EP9 A;  1VBC 2;  1ZBE 2;  3KHB A;  4RHV 1;  4L2N A;  4PI0 A;  4AFA A;  5B4N A;  1G9C A;  4OZO A;  2QQW A;  3NQH A;  3AXD A;  2C1F A;  4M00 A;  5CKQ A;  1HXS 1;  2Q8E A;  3NV3 A;  1OC1 A;  1OH3 A;  1NQD A;  4N90 A;  3V65 A;  4AEJ A;  1W6N A;  1ZZ9 A;  4DY3 A;  1D0G A;  2YG0 A;  3VZL A;  1TZO A;  1REE A;  2VZ3 A;  2W95 A;  3J7L A;  2JDH A;  4MGY E;  5FZ7 A;  4ZHN A;  4XUR A;  5APA A;  3WF0 A;  1H4G A;  3LA2 A;  5FJH A;  1TNF A;  5IK5 A;  4DUV A;  1FAT A;  4LBO A;  2AC1 A;  1W6P A;  3VZN A;  1DYP A;  1GZW B;  2ARX A;  4DS0 A;  2W92 A;  4LA3 A;  1RIR A;  3OD4 A;  4IV3 A;  5DDJ 2;  5CB7 A;  1U5Y A;  4IV1 C;  2OA2 A;  4DEQ A;  2UU8 A;  2CAV A;  4N43 A;  4CZS A;  4IGP A;  4R8H A;  3PUH A;  2WNE A;  4GXL A;  5ERL A;  1QDC A;  5LK7 B;  5FLJ A;  2D98 A;  4H7M A;  1YIP A;  3AL6 A;  3DYM A;  4LMF A;  4N7U A;  4LBL A;  5LBC A;  1TME 1;  3N9L A;  2ZAH A;  1ULP A;  2VZV A;  3I59 B;  3MUZ 1;  5E8A A;  4TTG A;  2DU0 A;  3ZLI A;  4B1M A;  3NMB A;  2HWE 1;  3I7D A;  2XVK A;  3WG4 A;  5C3Q A;  1ENR A;  4XFC A;  2HWB 2;  1N1T A;  3IAP A;  4YM3 A;  5KXB A;  1ZRC A;  2YUE A;  4N43 C;  4AVC A;  2ZHK A;  2VTX A;  4I0W B;  1DG6 A;  5IAX A;  4H2A A;  1GMM A;  3DYO A;  1VB2 A;  4UFL A;  1ZRF A;  5C8C B;  4GIQ A;  3BU7 A;  4COW A;  1GOF A;  5F5I A;  1O3T A;  2RS1 2;  1LGN A;  3DKQ A;  1JOJ A;  4QD2 A;  1YO8 A;  1H1M A;  1QY4 A;  2P5B A;  4A3Z A;  5L19 A;  4MG2 A;  1SHW B;  3IAQ A;  4BXF A;  2QQO A;  4CA9 A;  4Z1V A;  3TEX A;  4FPC A;  4Y5Z 0;  3WVJ A;  4HBN A;  5CFD C;  1B09 A;  1NKG A;  3OOX A;  2ARA A;  1O4Y A;  1ONA A;  4ARX A;  3AYC A;  2VCA A;  3GAL A;  2EXJ A;  1PIV 3;  4QPY A;  4EZ4 A;  3ILR A;  4IW3 A;  2WWS A;  3J26 N;  1WA4 A;  1V6N A;  5HXV A;  3GBG A;  1JYT A;  1GSL A;  4LLO A;  4P9J A;  3UKT A;  4JGY C;  5JSO A;  3BGA A;  3VKL A;  3WNK A;  5IAT A;  1VBE 1;  1OH4 A;  2HWC 1;  1TQ5 A;  4GMP 3;  4TSV A;  2XQX A;  4XW3 A;  3S57 A;  1H9W A;  2P2K A;  1H8T B;  4GUL A;  3M2M A;  3LSE A;  3LKJ A;  2R6Q A;  4I02 A;  1WW5 A;  3HAG A;  3PNA A;  3QCW A;  4LUK A;  1PVX A;  3K51 A;  4MET A;  3JUU A;  4IE6 A;  4SLI A;  2HWB 3;  3KV5 A;  3TEY A;  1H1A A;  3OPW A;  3BPS A;  3CMG A;  3J8F 3;  2VTX J;  3SH4 A;  1DYK A;  5JMO A;  5FBZ A;  1ULO A;  5ISL A;  1GZW A;  3OYW A;  2AGS A;  5BNO A;  5CIS A;  1W6O B;  4LOR A;  4DUW A;  2A6Z A;  1CZT A;  3J7H A;  3MIC A;  1O3S A;  3VKN A;  3MID A;  3SKJ E;  3VBR C;  1ENS A;  1NOV A;  5BNP A;  2XL9 A;  1UMI A;  1X9T A;  4I30 A;  4BQ5 A;  3PVB B;  1VBB 1;  1OD3 A;  1RJ7 A;  1NCQ C;  2WA3 A;  2Z2S B;  3JCI A;  2GN7 A;  3IT8 A;  4FPO B;  5FPZ A;  1CWP A;  3KVB A;  1R1A 3;  3ZR5 A;  2RS3 1;  5GLV A;  5IVV A;  4KG0 A;  4DXT A;  1C28 A;  5ANN A;  5FP4 A;  1X8M A;  2ADD A;  5HCF A;  1SAC A;  3FBY A;  3GZE A;  3ASI A;  5FZA A;  3A21 A;  3OYW B;  4DXZ A;  4FP2 A;  2ATF A;  3URF A;  1IQD C;  2TEP A;  4NIH A;  1LOB A;  2IUW A;  2R06 1;  1C3H A;  1B35 B;  4CXW A;  3ENR A;  1C1L A;  1OA3 A;  1K5M C;  4XHB A;  2JIJ A;  4BQY A;  4DY5 A;  2B39 A;  1SFY A;  5DN2 A;  3FLP A;  4GAL A;  5FQ0 A;  3AVR A;  4YFZ A;  2ADE A;  4WBB A;  3SNM A;  4OHV A;  3MW2 A;  3ST7 A;  1SLL A;  2XL7 A;  4QPG A;  2GAL A;  4BJ0 A;  1BJQ A;  1OD5 A;  1RED A;  3USU B;  2O0O A;  4Z2W A;  1RC6 A;  1VAM A;  1HQN A;  1XYP A;  1DIW A;  3NJZ A;  4RS5 C;  1AXK A;  2ZX0 A;  3UYJ A;  1FAY A;  4S2F A;  5F32 A;  5CEH A;  1G7Y A;  2JKB A;  5EQU A;  4C1X A;  1JUI A;  3ZYP A;  5GM0 A;  3AYD A;  5D2A A;  1SDW A;  1BK1 A;  2C5D A;  3WG3 A;  2R04 3;  3BYW A;  2BW8 A;  5DZE A;  5DAX A;  4YVS B;  5FYT A;  5FZO B;  1RUD 3;  2ZMK A;  2QTW B;  1PM7 A;  3ETP A;  2A3W A;  3HT2 A;  1GWL A;  3KQ4 B;  4KBZ A;  4LJH A;  5FZ8 A;  5FMB A;  1XSQ A;  1C8N A;  2ZGO A;  1WCD J;  2JE8 A;  3G7D A;  3QLQ A;  3HT1 A;  4FPG A;  4URT A;  4Y22 B;  3WNO A;  4LBN A;  5L9B A;  3O7O A;  1UIK A;  3QD6 A;  4KMQ A;  2P3Y A;  3Q8B A;  4LT5 A;  3M8L A;  2B45 X;  2OPK A;  3R0R A;  2EIG A;  1STM A;  2Y6F A;  4OCT A;  4UW5 A;  1RVF 1;  3W59 A;  2E26 A;  4CDW A;  1I9R A;  4DZG A;  2J1V A;  2ZGU A;  3KGZ A;  3POJ A;  4CU8 A;  3III A;  1EV1 2;  2XON A;  4CP9 A;  4FPE A;  1J3Q A;  4LO5 B;  3TN9 2;  1PIV 1;  4E9K A;  4LA2 A;  2V5D A;  1OF3 A;  1EPW A;  4XIL A;  4CP1 A;  2WZE A;  2A71 A;  2OQ7 A;  1XU2 A;  2XH6 A;  1OKO A;  5EFU A;  2IZW A;  2HWF 3;  5C5U A;  1H2K A;  4NMI A;  1JU3 A;  1F35 A;  1J1L A;  3MV0 1;  1JZ4 A;  3FHA A;  5FUP A;  3NWK A;  1H4H A;  1REF A;  1H8T C;  2BWC A;  5A7W A;  4QGL A;  4JGZ B;  1C8M 1;  3VN4 A;  2VMI A;  2OXB A;  4JKK A;  4Z2A A;  4K1Y A;  1D7P M;  1NT0 A;  2WZR 1;  3THP A;  4CUG A;  4LHL A;  2W1S A;  1UD1 A;  2VCM A;  1U12 A;  1BYH A;  4J25 A;  1UOG A;  5CYY A;  5IWF A;  4BXS V;  3DEC A;  4AFD A;  4IEX A;  5GZE A;  2HWD 2;  2Q5T A;  4AG4 A;  2DCY A;  2YBS A;  4CCJ A;  4PF5 A;  1FPN 2;  1GAN A;  2JB8 A;  3PLQ A;  4QX1 A;  5I0U A;  1RMU 3;  4ARY A;  2RHP A;  3PDQ A;  1GOG A;  4LLF A;  1ZBA 1;  1WBL A;  5FYM A;  5FPU A;  3CKH A;  1HV1 A;  4ZU4 A;  2WLP A;  2RS3 3;  1LU1 A;  4I2O A;  2BEO A;  1LNS A;  4MGK E;  5C4W A;  5JZG B;  3ZXK A;  4TLG A;  1AL2 1;  3SEE A;  2WN3 A;  5GLW A;  1PGL 2;  4B4Q A;  3OPZ A;  4GMP 0;  4COY A;  1RUD 1;  1BMV 2;  3CU7 A;  1VMH A;  4I09 A;  4LOT A;  4AI3 A;  3Q8F A;  1CGP A;  2Q8D A;  2BGC A;  2AR6 A;  2QDR A;  3KGL A;  2DV9 A;  1C5I A;  3AMN A;  1SLA A;  4LBQ D;  4XFA A;  3BKZ A;  3WHU A;  1PNF A;  4K8R B;  4EZH A;  4OUM A;  1AX0 A;  1ASJ 3;  1UW8 A;  1PMJ X;  1HB4 A;  2OZJ A;  2YBK A;  4HSL A;  4NPL A;  4P5H A;  3MUY 1;  3INA A;  4X8P A;  5IVF A;  3VBO A;  3PL0 A;  3IPV A;  3WW1 A;  2PLV 2;  2RR1 1;  3H8U A;  4AQ6 A;  4IE0 A;  1XSR A;  4XFH A;  2JIG A;  2B46 X;  3ZDV A;  3BOW A;  4AAX A;  1QNW A;  1OPO A;  1U5I A;  1JOB A;  2DTW A;  3RSJ A;  4IEW A;  1DBN A;  3FBM A;  4XEZ A;  1UY3 A;  1S0B A;  3ZMO A;  2O8O A;  3APB A;  2R0H A;  4QM8 A;  2WNV A;  1OUS A;  1VIW B;  1CIY A;  1JOP A;  2BNN A;  4LBQ A;  3SKV A;  4CDW B;  3AZZ A;  5A6X A;  1IG0 A;  3N9M A;  1T6B X;  2HBT A;  2VU9 A;  3WD5 A;  3ZFG A;  1IG3 A;  4YFW A;  4AAP A;  4BQ4 A;  1ZRI A;  2Y6G A;  1CAU B;  3RZG A;  5ABJ C;  4J6G A;  1PGS A;  3M3C A;  4PDW A;  1Q8P A;  1OBN A;  2H0B A;  5AFB A;  3A7Q A;  3N7M A;  2FCV A;  5FWE A;  3MIE A;  1ULG A;  2YFZ A;  4KNC A;  5A3P A;  5IYY A;  2CL2 A;  3TNP B;  3Q8E A;  4XHX A;  2YGL A;  3D6E A;  4BU2 A;  3AX4 A;  2FHR A;  2QZ2 A;  3ON7 A;  2XBO 1;  5SV5 A;  2W39 A;  2VOW A;  2JE7 A;  2ZGS A;  3PME A;  1BQP A;  4BE3 A;  4E2S A;  1U5X A;  1H9P A;  5F5C A;  4L8Q A;  5KR7 A;  4JC1 A;  1EPZ A;  4QXH A;  2XDV A;  3SQO A;  4Y1U A;  4YW4 A;  5LRS A;  3PUA A;  2VMC A;  2B9V A;  2GC0 A;  4FQ4 A;  2QNK A;  4BIO A;  3D4K A;  2X29 A;  3H42 B;  4Q4V 2;  4QB6 A;  5L7O C;  1LHW A;  3O1P A;  1OPM A;  3PMS A;  4CDX B;  4DRV A;  5JI7 A;  5CFC B;  1SDD B;  3PTR B;  3BTZ A;  2RDS A;  3NV1 A;  3NKG A;  4P9L A;  3MF9 A;  4Q4W 3;  2EF6 A;  3IMM A;  2D7F A;  4XZP A;  1W6O A;  2QKD A;  3SC7 X;  3U37 A;  4ZZ5 A;  5J48 A;  1XC6 A;  1I3H A;  3PUR A;  3VZO A;  5JSP A;  4QPI C;  3WCS A;  3T1M A;  2A6W A;  2JG8 A;  2QQM A;  5JVV A;  4OI4 A;  3EBR A;  2G9Z A;  3K77 A;  1XXN A;  5T5P A;  3RDI A;  1UU6 A;  4R4X A;  1S0I A;  1MPX A;  3M3Q A;  2WO3 A;  5FZI A;  1V6O A;  1KIT A;  1SZB A;  1Y3T A;  4NO4 A;  1F2N A;  2CDP A;  5FPA A;  2GME A;  3N9N A;  4QM9 A;  4CUB A;  4XQW A;  1K5M A;  1XNA A;  2VW2 A;  3VBS C;  4IEO A;  1JHJ A;  4TN7 A;  3DKW A;  3VDD B;  3K4Z A;  4MUV A;  1LGB A;  3EMR A;  2RS5 2;  1D4M 1;  1WCQ A;  3LB9 A;  1NYW A;  3POF A;  4GWJ A;  4JAA A;  4CYD A;  4QQP A;  5IVJ A;  1UZZ A;  5FZB A;  3OBR A;  4BZ4 A;  1L7L A;  1VMJ A;  3J7M A;  3VBO B;  4AVA A;  5A1A A;  4A7Y A;  3LDK A;  3HBK A;  3U1X A;  3DF0 A;  4Z92 B;  3DV8 A;  3N3H A;  5KHJ A;  2YC4 A;  3ZN6 B;  3O0V A;  5A33 A;  3ZXE A;  4YG0 A;  5FFO C;  2CY6 A;  4JDM A;  5CVR A;  5BXX A;  4AYU A;  1WME A;  4IV1 A;  1HRI 1;  5FIX A;  3WP6 A;  2NM1 A;  5C7G A;  2QBX A;  2WFF 1;  1YYN A;  4HON A;  4MGI E;  5DDJ 3;  1MZE A;  3O1U A;  2ZTN A;  2CHH A;  4CU7 A;  3QOP A;  5A3L A;  1HRV 2;  2IXC A;  4KWJ A;  5HCB A;  4FOQ A;  3KV9 A;  4YAR A;  3GYD A;  1UZW A;  4W6X A;  3WF2 A;  1J58 A;  1I6X A;  3THC A;  3ZDS A;  5L36 A;  5A70 A;  4D7T A;  1LES A;  2J7M A;  1R1A 1;  4AVT A;  1XE7 A;  2ZA9 A;  1QH7 A;  2DUP A;  3NNG A;  3U75 A;  3I49 A;  2BV4 A;  5JR7 B;  1N1V A;  3FFZ A;  1CJD A;  4Q0P A;  4CCL A;  3J9S A;  2BU9 A;  4QGN A;  3W5N A;  2Q0A A;  2NP0 A;  3RQ0 A;  4YZ1 A;  3AP4 A;  2LRO A;  2OX0 A;  4OHX A;  1NXD 1;  4XTP A;  5FYV A;  5KWR A;  3AK0 A;  4ZS3 A;  3VBU C;  5LW9 A;  1IS5 A;  5K7P A;  3V56 A;  4KG8 A;  4L11 A;  1WW7 A;  2NN8 A;  1PO1 1;  1VMF A;  3WY6 A;  3AMQ A;  4NJ4 A;  4YVW C;  3N9P A;  1J83 A;  2VZ1 A;  4KH9 A;  1W8O A;  3T3Y A;  1AR8 3;  4GWI A;  4CP0 A;  3I2I A;  3T2O A;  3OB8 A;  4JGZ C;  1KXG A;  4L92 A;  3NV4 A;  2Y0I A;  2ET1 A;  3WCR A;  3OJB A;  5AC9 2;  1ULD A;  2JDA A;  1BCX A;  1W28 A;  1QXP A;  4JGZ A;  2XG3 A;  1LGC A;  4E4S A;  3WP3 A;  3VBF C;  3ZM8 A;  1JBC A;  3QH7 A;  3TWI A;  3JQW A;  1KD7 A;  1EUT A;  2C24 A;  2FBE A;  1GFF 2;  3RFR A;  3PIG A;  2ZEX A;  5T54 A;  3GCX A;  1RMU 2;  2R30 A;  4EYU A;  3N4M A;  1JOD A;  2D6K A;  2UY8 A;  3LA3 A;  3MFA A;  2BNO A;  3LIG A;  4NR1 A;  3UGF A;  5JDB A;  4A45 A;  1C8M 3;  4WVV A;  3A4U A;  4L9B A;  1TNR A;  5I8Y A;  4WM7 A;  4AGR A;  1KFU L;  1SFN A;  5FOB B;  4W6Y A;  4IQP A;  3ZFE A;  1G8W A;  4V2W A;  2WBK A;  2W1Q A;  3ZN5 A;  5IW0 A;  5LEK A;  4QX7 A;  1SLI A;  4HAN A;  5LY1 A;  3AYA A;  5A33 B;  3MLJ A;  2K46 A;  2OYZ A;  3L2H A;  1C1F A;  3POE A;  3EB7 A;  3OPT A;  1KDM A;  4LIU A;  4OI2 A;  1CVN A;  1A34 A;  3CL1 A;  2WS9 1;  2WAB A;  5J1X A;  3VDD C;  2RMU 2;  3JB8 A;  1N47 A;  1R09 2;  2HWB 1;  4Q29 A;  1PHM A;  3OEB A;  3HJR A;  2QDN A;  4JDO A;  5KC6 A;  5LRR A;  5T3N A;  2AEZ A;  1BBT 3;  1ENX A;  2JG9 A;  2V09 A;  3AMP A;  1AR6 3;  2R0F A;  2Y38 A;  4W4Z A;  4PIX A;  1AR7 3;  1PMH X;  4XDO A;  5B2G B;  5FR3 A;  1ZZ6 A;  2FCT A;  2ORX A;  2A1X A;  2X09 A;  3DGT A;  4MXV A;  1PO2 1;  3UKV A;  5I0T A;  2GAU A;  4G3Y C;  2IXI A;  3OUI A;  2R04 1;  2ZMN A;  4LBQ B;  4IEU A;  4S2G A;  2RM2 3;  2WA4 A;  1A8M A;  3VBF A;  1R09 3;  4CCD A;  2VUL A;  1ASJ 2;  1VR3 A;  3CJI B;  4GH4 C;  2DVB A;  4P5Y A;  3AZX A;  4RA0 A;  3UET A;  1LKN A;  2VPV A;  1US2 A;  3IMN A;  1AHS A;  4M01 A;  3AXE A;  2YC0 A;  5C9A C;  2VUD A;  5JXG A;  4U36 A;  1EAH 2;  1OOP B;  1VBD 3;  3NAP C;  4UW6 A;  3I59 A;  1OXC A;  2ZZQ A;  5FDB A;  1S2K A;  3LOB A;  3ZXL A;  2HLE A;  1WCU A;  3LD8 A;  4GH4 B;  1GP5 A;  1RUC 3;  4UYB A;  1K45 A;  4Y1Y A;  3WEZ A;  3T0A A;  5CNA A;  3V0A A;  2VOX A;  4FPJ A;  1TVG A;  4H3W A;  2WT2 A;  4ES9 A;  4RD7 A;  4AEM A;  5LWB A;  3AZW A;  2RDQ A;  5H9P A;  4GKX A;  1GWM A;  2A6X A;  1LED A;  2WKK A;  4Q1P A;  5FY4 A;  2EID A;  5CFC A;  2BGP A;  3M3E A;  1QJU 3;  1TMF 2;  1XBF A;  1PMI A;  1TME 3;  2ZXQ A;  3E5X A;  1AX2 A;  4D6R A;  5T52 A;  2MEV 3;  1ACC A;  2I74 A;  2X5I A;  3AKT A;  2PHT A;  3JD7 1;  4LTA A;  1IGO A;  4AHY A;  2JDP A;  2OUH A;  2RR1 3;  1X8E A;  3H1M A;  1LB2 A;  1NCR B;  1VBB 3;  5M0T A;  2P3K A;  1ND2 C;  3AP9 A;  3LE0 A;  4WM8 A;  3ZFE B;  4LO8 A;  4ET7 A;  5FZH A;  1QJY 1;  2RE9 A;  3WW4 A;  3H1Y A;  2DTY A;  2XJT A;  1PK6 C;  4JHT A;  5FO7 B;  5L7O B;  4QDS A;  4QAW A;  1QXR A;  2WLQ A;  4JGY B;  1WWY A;  3AFG A;  1DQ0 A;  1RVF 3;  2ZKL A;  3ZN4 A;  3CNA A;  3EXU A;  2H6C A;  1HB2 A;  2HWF 2;  3LSD A;  4MAD A;  2Q30 A;  2ZJC A;  4ASL A;  1V70 A;  3MIF A;  4JRL A;  4YLZ A;  4HMZ A;  5BNQ A;  1LTE A;  2QQJ A;  4BCU A;  1FXZ A;  5DZF A;  2ZGK A;  4HL0 A;  5C3R A;  3T4V A;  1MS9 A;  4FBF A;  2V72 A;  3L2Y A;  3T0D A;  3OGR A;  2B8M A;  1EUU A;  2A75 A;  2CDO A;  3FJS A;  2VY0 A;  4GA9 A;  5EJ3 A;  2UWA A;  2BOI A;  4FI9 A;  4IGQ A;  4EV0 A;  3VBS A;  4LBM A;  5F8P A;  1TMF 3;  2A6V A;  1Q8Q A;  3LA7 A;  2BZD A;  2JEC A;  2UY9 A;  2WZR 3;  3MPB A;  3UGG A;  5FK8 A;  4ZZ8 A;  4HZF A;  3GXU A;  1F5F A;  3W5M A;  3U10 A;  5FZL A;  4E8D A;  4ES8 A;  1WLW A;  4QX3 A;  2W1W A;  1DGR A;  5FMO S;  5JIU A;  1XE0 A;  3UJQ A;  3ELN A;  1OT5 A;  3NVC A;  4UFJ A;  1AYN 2;  1WW4 A;  5CG8 A;  1PK6 B;  5IVB A;  1H8V A;  4TYS A;  5FZK A;  3ZYR A;  4AHZ A;  4OQ9 A;  1DGR N;  4MZU A;  4YW7 A;  2WIN B;  3POS A;  3RYR A;  5F39 A;  2R1D A;  3R05 A;  3KM5 A;  3IWZ A;  3N9Q A;  2CGO A;  4XDQ A;  4FFF A;  3KV4 A;  1YCI A;  3Q8A A;  5FZ1 A;  5FYH A;  1RJ8 A;  1RVF 2;  4LKE A;  5FPB A;  4XJ8 A;  2C9K A;  1XRU A;  1EV1 1;  2ZHM A;  5I8S A;  3HN1 A;  2IXL A;  3BPZ A;  4CEW B;  5FXZ A;  1PIV 2;  2V5Y A;  1YFW A;  2O8Q A;  3U0Z A;  1CAV A;  2D5H A;  3CLP A;  3LEM A;  2VMG A;  3VGI A;  1GQH A;  3LF7 A;  4GQ7 A;  4NIG A;  5ANQ A;  5KBF A;  4Q4Y 1;  1JHN A;  3RZJ A;  1PX3 A;  4NII A;  4XET A;  4AR2 A;  4YNI A;  3ACF A;  1ZZC A;  1ENQ A;  2WT0 A;  5BNO B;  1V9U 1;  1O5U A;  4RGG A;  2P6H A;  3E6B A;  3WDY A;  1G6N A;  1M4W A;  2G9G A;  2ZGM A;  4B4P A;  1SBF A;  3SH5 A;  4Y1Z A;  5H9Q A;  4FQZ A;  5LCW L;  3UJO A;  4R9B A;  1UZV A;  2ZGR A;  4LOS A;  4NVP A;  2DVG A;  3POW A;  5FLH A;  4D3W A;  3HVD A;  3OF1 A;  2WZR 2;  1W2U A;  1OF4 A;  1MR5 A;  4Q0Q A;  4RGK A;  4YVS A;  1WW6 A;  3ITQ A;  5EV7 A;  1YFU A;  3GZU C;  4PF1 A;  5FOJ B;  3GF6 A;  3FMG A;  2CU5 A;  2H6B A;  3IDC B;  3KS7 A;  3M1H A;  2XBO 3; 
#chains in the Genus database with same CATH homology
 1YQ6 A;  1YQ8 A;  1YQ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...