1YQ6A

Prd1 vertex protein p5
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
144
structure length
144
Chain Sequence
GGVTDALSLMYSTSTGGPASIAANALTDFDLSGALTVNSVGTGLTKSAAGIQLAAGKSGLYQITMTVKNNTVTTGNYLLRVKYGSSDFVVACPASSLTAGGTISLLIYCNVLGVVSLDVLKFSLCNDGAALSNYIINITAAKIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Minor capsid protein
publication title The structure of the bacteriophage PRD1 spike sheds light on the evolution of viral capsid architecture.
pubmed doi rcsb
source organism Enterobacteria phage prd1
molecule tags Viral protein
total genus 26
structure length 144
sequence length 144
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-02-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.670 Mainly Beta Sandwich Jelly Rolls Minor capsid protein. 1yq6A00
1YQ6A 1YQ8A 1YQ5A
chains in the Genus database with same CATH superfamily
2R32A 2P4EA 4M4PA 5AFBA 2CGOA 2X09A 1B35A 4AF9A 3OJBA 1Y9MA 1Y4WA 1LOBA 4TTGA 4RGAA 3CZUA 1QQP1 3WV6A 3BALA 4F3JA 3O1VA 2DBIA 1U5XA 1DLLA 3HPNA 4L92A 4EYUA 1R082 2G4IA 5CYYA 4FFIA 4D6QA 2NPIA 4Q0QA 2HYXA 3KT7A 3GBFA 5SV5A 4Q0SA 1SCRA 2PHXA 2AZ5A 2EAKA 1UQXA 2AENA 3PDQA 5JZGA 2VQUA 1EV11 1YIFA 3AXEA 3CO2A 4FPYA 4RL7A 4XFBA 3PTRB 5F8PA 2PYTA 3OD0A 1FV3A 3POWA 4XIKA 3VL8A 5KXEA 1IQAA 2C26A 2JDMA 2ZEWA 5A3PA 2ZMLA 3O12A 5KXDA 2FCTA 4D3WA 3V0BB 2VZVA 3SEEA 4H7MA 3KF3A 1JTZX 2JDPA 4QX0A 3RPQA 2GN3A 4IEXA 4FAGA 4OLLA 1FATA 2BNMA 2G9FA 5JDBA 1E5SA 3MIFA 2L9LA 4JGYC 5FXXA 3V0AB 3VD3A 1FPN3 1LOCA 1OPMA 2UYAA 1QWRA 1JYWA 4AQTA 3FUQA 4D6SA 1SCSA 4PT6A 2IXKA 1PK6A 1LTEA 5LK5A 1JUHA 2ZHMA 4Y20A 3ETQA 4GMP3 1RB8G 2ZMKA 4OUEA 1AYN1 4XFHA 3FBYA 1DGLA 2YDEA 4XOGA 1QKQA 1PM4A 5FYBA 4PF5A 4S2HA 3WQBA 3ZXAC 5CFDA 1GR3A 3OY8B 3THTA 2OQ7A 2HKXA 4XTMA 1U5ZA 5DUUA 4AOCA 4CSWA 3RWKX 3WX5A 2X8KA 4NAMA 4OHYA 1F4HA 3TN91 3B7MA 4ZZ8A 3WUCA 1FMD2 2K2SA 2XLAA 4LBJA 1N47A 1PVXA 1ND3A 2VY0A 2YUEA 4GWNA 3E6BA 1JXNA 4M0NA 4AEMA 4P08A 4UOJA 2QKDA 3KVAA 1YI9A 5BYNA 5DAQA 2HWD3 3BOWA 2Y8KA 4MGYE 2WQZC 3SKJE 2CU5A 1TQ5A 4RS5C 2OA2A 3K4ZA 4OMDA 5JXIA 2WS91 4NUBA 2PHUA 5E6HA 3JB8A 1WW4A 2X05A 2QDRA 1KXGA 1W8OA 2VXJA 4IE5A 3VBUA 2YPJA 1F31A 1OOPC 3N35A 4KBZA 3GM8A 4K8FA 4XBLA 4COVA 2GMPA 1VJ2A 2JDZA 1PVC2 2R1DA 4JKLA 3NAPC 4LK7A 4QDRA 4XVHA 2Q8OA 4AAXA 3JZVA 1AJKA 3WP5A 1UL9A 4XW3A 4CXXA 5C5TA 2XKOA 3BIWE 5JXHA 1JYTA 2XBO2 4IV1A 4CDWC 3ES1A 3WNMA 2UY8A 1VE0A 3O0XA 2PLV2 4CE8A 4Z2WA 3WDVA 1QOTA 5IAXA 5FKBA 3JD71 2J1UA 4NHYA 4GH4A 3U37A 2W1QA 2HWF1 4ZS3A 4C0BA 4YM3A 3U0ZA 1HQNA 3AB0A 3M8LA 2RMU2 4QAWA 3E5QA 2P2KA 2XVLA 4QHOA 2Q8EA 2E53A 2QJVA 4D7YA 5L9BA 1H2KA 4FP3A 1STMA 4N53C 1MS5A 3C2UA 3DPRA 3T2TA 2YYOA 4LUMA 4CCDA 4CP9B 3FFZA 2LUWA 4QB6A 4BDVB 1IS3A 2VZ3A 5FIXA 2B7YA 1RUC1 1HJGA 1ZZCA 2YFUA 3FHIB 4JKMA 5DAXA 3AZZA 3EHKA 2H0BA 1GP5A 4COYA 3C7GA 2VC9A 4A3ZA 1OVPA 4LT5A 2GMMA 1H9PA 1LEMA 3D8CA 4RR3C 3M7AA 2YY1A 5EP9A 4K40A 3VZKA 5ACA2 3ILRA 1DG6A 1RUG2 2R30A 1AF9A 2BYVE 5AC93 5A1AA 3FLPA 1RVF1 4XEZA 3T2OA 1TEIA 5FP7A 3KCYA 5FPZA 3LFMA 1VRBA 2X5IC 2ZGUA 1JHJA 4IQPA 3AKPA 5F5QA 1V9U2 3U4SA 2KD7A 3M3IA 1H2MA 4EWDA 5FY5A 4XJWA 1AX0A 2YGLA 5E1RA 5FZ7A 2YGMA 1WCSA 1ZZBA 1MZFA 2YBSA 3ZO0B 3ZYPA 1VB4A 4SLIA 3MFCA 2JG8B 3ALQA 4Q4W2 5GLVA 3PJYA 1FOD2 4XJ8A 3QH6A 2D44A 3RZGA 4JGYA 4HONA 4CDUB 4GMP0 2D5HA 5ABJB 4OHVA 3RZJA 1W6QB 4U2AA 3UGFA 1W3VA 2B4KA 1F2NA 2J1EA 3NSTA 5FP9A 2ES3A 2EXJA 4JDNA 4YW7A 3TBDA 3J8F3 1FXZA 2D6PA 2GH2A 4RSUA 3VGIA 1ZBA2 5E16A 3WVJA 3LEKA 3RZHA 1DZRA 2ZACA 5IUQA 1CAXB 3POFA 4NPLA 4UBGA 1O91A 4P9JA 3H8RA 4QKBA 1NE4A 2HEVF 3P3NA 5E89A 5FPLA 5CB7A 1DU3D 1NCRA 1RIRA 1SLLA 2ZAAA 3INAA 1CX4A 3AP4A 1M4WA 4QMAA 1UY1A 4W6XA 3WSOA 3VD7A 1VBA1 1BZWA 1J3PA 1CONA 2Q1ZB 3ZFEB 1CZVA 2B9UA 4GWMA 4TN7A 5FKCA 1KJLA 1YEWA 1DQ0A 2VOWA 2BRTA 5LZ6A 2Y6GA 3KV5A 2BBVA 2H6BA 3MPPG 4H7LA 5BUVA 5H9SA 1JZ7A 1PIV1 4YW6A 4CCKA 4RS5A 1QOOA 4ARXA 5BNPB 3IT8A 4A42A 1E57A 1ASJ1 2IZWA 4BMBA 3VDCA 2A70A 2LROA 3O0VA 1OI6A 1YQ2A 2WSUA 5FUIA 1QMJA 3K75B 2WUHA 2PHTA 1X33A 2VR4A 3NAPA 4LBQA 5IVEA 4XFIA 4AEKA 5K0UB 1AL0G 1J59A 3OPTA 1T6GC 3QH7A 4QX3A 1GP4A 3AMHA 3J7LA 3MW2A 4Q4Y1 1BXHA 1S0BA 3DF0A 5CZKA 4XZUG 1ENRA 1IQDC 1POV3 2VL4A 4I02A 1AUYA 3WG4A 5I0SA 3NW4A 4JC1A 4Z82A 3VUOA 1GANA 3GBGA 2VMHA 2JG9C 4J1XA 1TME3 3BTAA 1UZWA 2YBKA 1Q5OA 1OH3A 4QX2A 1U12A 3AZWA 3IMNA 4X6RB 3LZZA 3RI8A 5B4NA 1JMUB 1LGNA 1TNFA 1SLCA 1W8UA 1ZZ7A 2DBNA 2QQUA 3PNAA 4X8PA 3D3AA 5DUXA 1ZM1A 1XYNA 3DECA 2QQKA 5BNNC 2A75A 1H8TA 4JKKA 4AFMA 3PU3A 1VBE1 2AH2A 4RYDA 2R072 2Z42A 3AZYA 3FC0A 2X29A 4XAAA 3EB7A 1E5HA 1Q8SA 4ORFA 3NVCA 4I0BA 5FYUA 1QHDA 4WVWA 3RMXA 1AR83 1LCLA 2JB4A 1OQDA 3H3LA 3POJA 4NMIA 5FMDA 1K5MB 3IDBB 3RS6A 1L7RA 1JYVA 1AXZA 2ETEA 4M3CA 4QXCA 1VRH1 3WNNA 1GZCA 4IERA 4A7KA 1IKPA 3WP6A 1ULPA 4C1XA 4DXTA 3KV9A 3KSCA 2B9VA 2XLGA 4GB32 1W0PA 1CAVB 1JOBA 1LEDA 3IIIA 1R64A 1QJU1 1S2BA 4NWWA 3VBSC 3VKFC 1W28A 4AL9A 1MS4A 1GOGA 3UKNA 2JJ6A 5A6YA 4YPJA 2NP0A 4LE3A 1AZDA 1H6XA 2ZZJA 4MGQA 5C9AB 1DGRA 1R081 4YGCA 1SFYA 1ZYBA 2HWC3 2ZBJA 3BN6A 1H9WA 3SEPA 5FJKA 2RHPA 5GKAC 4DEVA 1JS9A 3G7DA 2E51A 5IK8A 5T5OA 1FV2A 4XHXA 2WN2A 3GJAA 1UZ0A 2ARBA 4PDWA 4HT1T 2VGDA 1V6IA 1QU0A 1QOSA 2GP5A 4W50A 2VMGA 4B1LA 4EWEA 3D6EA 5LY2A 1HJFA 3VL9A 2JE7A 4P5YA 4QKDA 1XPWA 1C3HA 1RC6A 4BHPA 2RS13 5LBCA 1DYOA 3CJIA 2J42A 3OGVA 3VB9A 5IHRA 3N9LA 4KWUA 1RXFA 2HWD2 3KF5A 4DXSA 5FO9B 4PLMA 1G86A 4TWTA 4MADA 2WFF2 2XL9A 1EYBA 3C7EA 4UFIA 4NRMA 4QQOA 4DY3A 3RNSA 4O9EA 5CFCC 5D2AA 2E7AA 1MACA 5GM0A 4DO0A 2BBAA 2Y6HA 4OMCA 2A6ZA 4ZU5A 3GXUA 1RUD1 4B4RA 3ZFFB 5C8CC 3LPGA 3AL6A 3LA2A 3CMGA 3MGUA 1UYZA 1RL3A 4NVPA 4UBHA 4AWDA 2VOTA 3NV3A 1EPZA 3O5SA 1G8WA 5J98B 2V4AA 4B8EA 2WT0A 3H8UA 4ZKTB 1PMHX 3UJOA 1EAH2 1AR93 1UMZA 1VMJA 1W6NA 2XVKA 2W2IA 4LA3A 4BOWA 1G9FA 3NKTA 2JXAA 5A32B 1W2AX 5IVBA 5JMOA 5JOWA 3DEMA 1AYM3 1DYPA 4LMFA 1V00A 4LBKA 5ERLA 1ULDA 5M0TA 3M2MA 3I8TA 3E6CC 4UFJA 4G3YC 5GALA 3KB5A 1RUH1 1F15A 3B3QE 4Z8BA 4RD7A 4IV3C 3CEWA 2OVUA 4BLJA 4LORA 5FY7A 3F95A 1UW8A 3PIJA 4Y3OA 1WBLA 5F32A 2WYFA 2IVIB 4XBQA 4MXVA 1JHNA 5KWRA 3J7MA 3GNEA 2YROA 5F5IA 4L8QA 2JG9A 2JD9A 3SCGA 1C8M2 5FPUA 2UWCA 2VMIA 3GZEA 4K1ZA 1DP0A 1H30A 3WDWA 2P3YA 2WNVA 2PLV1 1Q56A 1NAEA 1PX3A 2VQTA 3AVSA 5LATA 1UYXA 2ZHKA 1W9SA 4ZXKA 1A8DA 4H55A 1CJPA 5JPNB 1MVEA 4F7ZA 4YSFA 1GP6A 3UNPA 2DCYA 2E9QA 4Q4X1 4BIOA 4N7UA 4XFCA 1AX1A 2Q0AA 2UYBA 1QNYA 3BOPA 3X29B 1NA1A 4QWNA 4MXWA 2PFWA 1JOJA 3DL3A 1PGW2 2DVDA 3F2ZA 3KWVA 3HD8B 2O8QA 4FVVA 3KT4A 3OUIA 4EZ4A 2HBUA 2VZSA 2R16A 4AQ2A 5LWBA 1JZ8A 4YW3A 4LLFA 4HK9A 4MGZE 3O7OA 2TNFA 4XF4A 5A1LA 4CYDA 3H1YA 2VW0A 2ZEZA 3VHOA 2WNUB 4IL7A 4AK3A 1S2KA 3PVNA 4XURA 5DDJ2 3N3HA 2G9GA 2LM3A 3T1LA 5FV3A 1O8SA 5T52A 3VBFB 4NHXA 4W6YA 3RJRA 5EFUA 4CDQB 5GLZA 3OGRA 5FQ0A 1JODA 1SFNA 2C9KA 4FQ4A 5ACA1 4AVAA 2IVJA 2BV4A 4CEYC 3HT1A 3NJXA 3H8XA 2VH9A 1RUE1 2R041 4QPYA 3APBA 4QDQA 4AGVA 4FPLA 4XF9A 1OLQA 3GJBA 1V9U1 2VNRA 1PZ9A 2DU1A 3VKOA 4MX3A 4KI5M 3HMYA 2CDPA 5LBEA 4WVMA 4GKXA 3V0BA 2ZEYA 3JB4C 1QJZA 1G9BA 1WW5A 1NZCA 3ZYGA 2QQNA 2ZCWA 3IAPA 3PTYA 2OKXA 2DVFA 3ZFGC 1SMVA 4AEDC 3V0AA 1UYYA 5CVRA 4JGZC 1KDKA 3MW3A 2CL2A 1FMD3 4LUKA 2RDSA 1IGOA 1DYKA 1RUI1 3IDEA 1XC6A 4Q2FA 4YVWC 5LRRA 4E2SA 3LOBA 4WM7B 3AZXA 5JSOA 2R0FA 2DCTA 3WNOA 5BY5A 3I2JA 1WWYA 5FYMA 3VBOB 3J26N 3FHAA 1ZBA1 5FAXA 1QJX3 2HWB3 2AREA 1S0JA 2EAAA 1VB2A 3OY8A 1X50A 5C8CA 1GOFA 3WQ7A 5LCWL 4BLIA 3HBKA 1OLME 1RUJ2 1I6XA 5KHGA 5KR7A 3FMGA 4N9IA 3JQXA 3SXWA 5KXBA 4HLTA 4QKFA 5JSPA 1OFNA 4IEUA 3POBA 1PO13 4PI2A 3VDBA 4YLZA 4D8MA 4P9XA 3VBHB 5IK4A 1JZ4A 1XBFA 3ILNA 1AR61 4XBNA 1PVC3 1Z0HA 4CP2A 4I01A 1AR71 5A3TA 1UAIA 1W04A 2WIIB 1SBEA 1W2UA 2HWE2 4LLOA 4Q0PA 2XBO3 3HNYM 3TNPB 2B8MA 5LBFA 1MS1A 3K2OA 3ZDSA 5BV6A 5LK7B 3W59A 1C28A 3AKTA 3H3UA 4KGGA 4COWA 5C6CA 2VZOA 2ZTNA 5C70A 2UWAA 2AYHA 3MF9A 5FOBB 1UPIA 1JBCA 5DAWA 1WKYA 2HEYF 2RMU3 4XETA 1W90A 3ZLIA 4Y1VA 3FN9A 2Y6JA 3WP4A 1ZRIA 2DCKA 3VBRB 1ALYA 4BQXA 4XCAA 1AR82 1RMU2 1QXRA 3ZYIB 2WKKA 3E1F1 1O3SA 3OB8A 2VPVA 4OZOA 1D4VB 4CU6A 3POGA 4HMZA 4J1WA 5DXDA 2PXJA 3ZN5A 4AHXA 3WOGA 2B46X 3H7JA 3KQ4B 5EJZB 3ACIA 4OI0A 1T2XA 2VULA 3WCRA 1BLZA 1TMF3 3V64A 5IVFA 2WO1A 1SDWA 3NNJA 3RI9A 5KHIA 1K45A 2BDRA 2DFBA 4NE9A 4XTPA 4KWKA 5DPNA 1BMV2 3WG1A 4Q4V2 4CP9A 5C8WA 1S0GA 4L97A 2ZKLA 1RUG3 4LBNA 3AKSA 3MO4A 2PELA 4M01A 1IPSA 4BQWA 1RHI2 1VALA 1PK6C 3QBQA 5FZ3A 4CU8A 4C91A 4K9SA 5FY1A 4NHLA 4NR1A 4DMIA 4XF0A 3U14A 2RG4A 2VVDA 2WQ8A 4QX8A 5KHHA 1YQ5A 2Q4SA 4FAHA 2WZR3 4BWOA 4FOVA 5CFDC 4RFT0 2PHLA 2PQQA 2WZ8A 4Q4W3 1S0DA 2J7MA 1FOD3 5H9RA 4OI2A 2C24A 3MIDA 4ZXEA 4URTA 5IW0A 4WV8A 4NIHA 1FPN1 3VZJA 4RQPB 4ASMB 5FZLA 4OCTA 1ND3C 3GBWA 1HQWA 2CSGA 1O59A 3BYWA 4GMP1 5L9VA 2ID4A 4FI9A 5DZEA 2VUDA 4FFGA 4KWJA 3WG2A 1D4M2 2PMWB 1WCQA 4WZCA 5KHJA 1HN1A 1KRIA 4LTAA 4UW4A 2JG8A 2FMYA 1PGL2 1G9DA 1SLTA 2W46A 3I3DA 3QCWA 1TZOA 2LRPA 3VBUC 3K3OA 2CDOA 4COZA 3N9QA 2OPWA 2A1XA 3JUUA 3Q8EA 3T09A 4CDUA 5IFPA 1SLAA 3T4HB 5ABJA 4FTEA 1D2QA 1AR92 3GGLA 5KXCA 1KGYA 4YM2A 2QQVA 1XU2A 2Z2SB 3DV8A 4YGDA 3OGJA 1MS0A 4DQAA 2HWD1 1XU1A 4IV1C 3WUDA 3ZXLA 4CEWB 1CAXA 3MUZ1 2F4LA 1AL23 1OPOA 4E8CA 1MEC2 1DCSA 1JU3A 1X7NA 2VE1A 4CCEA 5JSRA 3NNMA 2AR6A 3I59B 4JTNA 4R4XA 5CKMA 5A7PA 1NXD1 1XE0A 1N3OA 3I97A 4WZFA 3HNBM 4M0HA 5CEHA 4BISA 2CHHA 2W1UA 3DPRC 5J96B 1UD1A 3HT2A 4EE2A 1AJOA 4X8NA 5D1IA 5FMOS 3ZMOA 5J1XA 2XJVA 4B29A 3JXSA 2ET7A 4DNYA 2KXLA 4DFSA 3IAQA 3H3ZA 3T2PA 4D94A 5BNPA 2C6SA 2BZDA 5FZAA 3LSDA 1PM7A 5FZHA 5LRSA 1G9CA 1W03A 1RJ7A 3OGSA 4YW2A 3I3MA 1W05A 2K46A 3BU0A 1OA2A 4Q1PA 5DG2A 2WA3A 1RUNA 2KA3A 2NQYA 5K0UA 3ZYFA 4MYEA 3MIBA 2XDVA 1W39A 1QJEA 4LO8A 4YW5A 1W0NA 3T30A 1O5UA 2FMDA 1XXNA 1GZ9A 1JYNA 3NNLA 1S0FA 5AVAA 1ZBE2 5A3UA 4K1YA 1N3PA 2R073 5C4WC 4CDXB 4WM8B 4DOUA 3RYPA 2PA7A 3BGAA 1G7YA 1ST8A 3SCFA 5FUPA 4JV4A 1UXXX 2J1RA 3EQEA 3PU8A 3LAGA 5F6LB 3ILFA 4LHLA 1L7LA 1GWLA 1J84A 3DGTA 1IZ3A 1NLSA 2R6QA 4QPGB 2Y34A 2ZAHA 3S30A 4GB33 1IG3A 3LDBA 5AC91 1GUIA 5CKQA 1KS5A 2WLPA 2YBPA 3LPFA 4CPBD 2LW8A 3GZTB 2BFUL 1WBFA 3VZNA 1HRV3 1OUSA 3WEZA 3C7OA 3O14A 1WW6A 5BNQA 3SHRA 4YGBA 4QX7A 1K5MA 1UCXA 1SQ4A 4BQ2A 4O65A 3GZAA 4JQRA 4X6QB 5DZFA 2WN3A 2GAUA 4INDA 4AFDA 5A7WB 3RSJA 4D7TA 5FUNA 1CJDA 1V6KA 3I3BA 5FK7A 2QQMA 1LOAA 3LEIA 2VCCA 5CA6A 3R6SA 1NCRC 1CAVA 3HIFA 3ATGA 5F7UA 4QQHA 3N7KA 2VTFA 5FPBA 1SBFA 3CU7A 1D0GA 3IN9A 4AYUA 5C3PA 4NIDA 4FSJA 4RGKA 2V09A 1SACA 1MPXA 1Y7BA 3PUAA 5B2GB 4Y26A 5C9AA 3LA3A 4QDSA 3HEIA 3IPVB 3KM5A 2W1SA 2HJIA 2E7TA 3J8F1 2FDGA 3PVEA 3WINE 3NNGA 3ZXDA 1QJX2 2HWB2 4Z2AA 4XFGA 2VOVA 4UWDA 5LA1A 2WAAA 2ZGQA 5IJRA 4HN0A 2WFF3 2XMLA 1EUUA 1SFPA 3LSEA 4R9BA 4DIQA 3QOPA 1IKQA 3UT0A 2VOKA 2ZX0A 3HJRA 4Q8KA 1PO12 4CRQA 2ZA9A 1UY0A 5FXWA 1W8NA 5J3UA 5F3GA 2DURA 3KV6A 4W8JA 1NCQB 3ZSLA 1CR7A 4Q26A 3MUY1 4AE2A 2P34A 2YC4A 4XCBA 4B1MA 4N43B 3OYWB 1GYKA 5ANQA 4XIOA 4E8DA 3C8XA 2QBXA 1R093 3NL1A 4NIAA 3PURA 2VXRA 3A23A 3I2OA 3PL0A 1BEV2 5FO7B 2VW2A 2JD4A 1YWKA 4CUBA 1YJKA 1TVGA 2JDYA 2FDFA 1EAH3 1KFUL 1MS8A 3A0KA 3M3CA 4KWLA 3CHXA 1S4CA 2SLIA 2R1BA 5FFOC 1BBT3 4IGPA 4MZUA 4AGRA 4QPWA 1Z78A 4CUGA 2VZRA 1RGSA 2YMZA 5L36A 4OQ8A 3ZFFA 1QEXA 1YRZA 2RM22 4UW6A 2ADEA 3OF1A 3K46A 2FCUA 2WSVA 3BB6A 1O4TA 1RUJ1 4AI9A 2WABA 4HN1A 3B94A 1PNGA 1U5IA 1V6LA 4Q0UA 3RMYA 1UZVA 1H8TC 4L9BA 3WNPA 2LTNA 2C4XA 3MPBA 3GZUC 2YC2A 3LEMA 1I3HA 4XF1A 1POV1 4JQTA 3TEYA 4LA2A 4M3CE 4AHZA 5A32A 1ND2C 4I0WB 5FLHA 1LECA 4LKEA 1DIWA 3DCQA 1J1LA 1W3XA 1C8M3 1TME1 1ULOA 3OG2A 1TMF2 4A7ZA 2JDNA 2RVAA 5FYZA 4MSVA 5FYTA 1YQ6A 1LHVA 1QJY2 4HSJA 4JRLA 3BKZA 2A6YA 4BMEA 5FYIA 3OBRA 4AI0A 4BJ0A 4QQPA 3TB0A 3VDAA 4K6BA 2VOXA 3PVOA 5I0UA 1NY71 5C4WA 2Q1FA 5FMOL 3LIHA 3J9SA 1ULEA 3BVCA 4HL0A 5FWEA 4ASLA 2QVSB 1IOAA 1AR81 1OT5A 3FBMA 4K8RB 1RUF3 1UOJA 2WZR2 4YRDA 2A71A 5FYHA 3MIEA 5A7QA 1POQA 3K4DA 4E9KA 2ZXQA 2W92A 3N7JA 5H9PA 2HYKA 2VTXJ 5CIRA 4L99A 1CN1A 4PDWC 3ZYBA 5EIYB 1RXGA 1HXS2 1Q43A 1S1AA 1ACCA 2OT7A 5DDJ3 3CIHA 1WMFA 3LE0A 2ZHNA 1OD3A 2BP6A 4B3NA 4ES8A 2FZ2A 1S2EA 5EQUA 3CJIC 3AXDA 1BMV1 2VTXA 5LEKA 4QGMA 3AFKA 3CQOA 5L7OB 2D3PA 2EALA 2HWC1 1WLTA 2JX9A 1R1A2 3WQ0A 5JAXA 5KC5A 1H2NA 4O61A 4NROA 2PHFA 2VBBA 4EZHA 1URXA 1HB1A 1ODNA 2FHRA 1OHFA 3FLRA 1AHSA 1DBNA 3PLQA 4QHBA 5A1FA 1FYUA 2FCVA 2WNUA 1ULGA 1N1YA 4Y22B 5KC6A 3VBFA 2ZGNA 1REEA 1UU5A 1Y43B 4YGEA 5BNOB 4CDQA 1Q8QA 2RS11 1WW7A 4UYBA 3AC0A 3ON7A 5F5CA 2AEYA 5LY1A 4O9GA 4NRPA 4DPNA 2X53S 3GYDA 2VECA 3VKNA 4RHV2 5JWPA 3Q8BA 4AI1A 2OYZA 4QHZA 3CZJA 1AL22 4YVSC 4XUOA 2EXKA 1X8MA 3OUHA 4I2OA 3LGRA 4ZU4A 3AP5A 3WF4A 5GLTA 3ZIWA 1YQ8A 1FNYA 2CTVA 2DVBA 2I07B 2W91A 2WT1A 3ETPA 4NWVA 1GQGA 1UOBA 4YM1A 3GCXA 5CADA 2B5HA 1EUTA 4YZ4A 1RUJ3 4XJAA 5JPMB 1ZREA 3AKQA 1H2LA 1LU1A 4ATEA 5EPAA 1DQ6A 5D21A 1GZWB 4FPHA 2PN5A 1W6OB 4NAOA 2DU0A 1MQTB 2VNVA 2VZQA 3ROUA 4F83A 4BH9A 1HRI2 1AR91 1JW6A 3MDPA 2WC2A 4HVOA 4B7EA 3VBOA 1AYM1 2D5FA 3T1MA 2HWE3 4BA6A 1H6YA 3BCWA 1VBB3 2QDNA 3AYAA 2WNVC 2JDKA 3Q8CA 4KG0A 4QM9A 3WY6A 4AEJA 4XJUA 3WW1A 4DRVA 1CGPA 1WLWA 5FZ1A 3VDDB 2B39A 4WVZA 4CXYA 5LW9A 2GN7A 3VBHA 1YJLA 4XDOA 3N7LA 1GOHA 5F2SA 5JZGB 3BIEA 3I3QA 3SC7X 1NA1C 2P3IA 1ND2A 1XNKA 4E4HA 1BK1A 1UF2C 3AK0A 1REFA 1VBC3 1RMU3 4GZ9A 2BWCA 4XUPA 1W9YA 5G04L 5F3CA 3GHNA 4PBOA 3KMHA 4IEZA 4QPIB 4UXAA 5F1RA 1XE7A 3Q9OA 4FTSA 1NZIA 1QF3A 1ULCA 5JOZA 1JZ3A 3RZMA 4S2GA 5D8AB 4GJYA 2ARCA 1SPPB 4KH9A 2B42B 1OURA 1CIYA 3MYXA 4KNCA 2GC2A 1YLLA 3U75A 5A33B 4QD2A 1LULA 3BPZA 1HRV2 4XDPA 4IDZA 3VBRA 4CU7A 4FPFA 1K42A 4Q4V3 3IDAA 3I7DA 1V6OA 2WR9A 4QB2A 1YFUA 5IAVA 4LJHA 3SQOA 1GZTA 1KS4A 3WZ1A 5JIUA 3A0NA 5I0RA 1WMDA 1GV9A 1ZBE1 2C5DA 1GWMA 5EXOA 1RHI3 3ENRA 3WNXA 2OXBA 3A21A 4HOOA 1OFSA 1D7PM 4Y4RA 5J48A 5T5JA 2CWMA 1XYOA 1OKOA 3C7FA 3B01A 4BCUA 1YQCA 3WLUA 1LHNA 4PHZA 3D5OA 2C0ZA 2BVVA 1C1FA 1W6PA 1C4RA 2W3JA 2ZGTA 3FL7A 5JI7A 1D2SA 4M4RA 2BTVC 2ZZQA 4TXWA 1QH7A 3ZSMA 1YI7A 2CAUA 4B4PA 4A44A 4J25A 5GZFA 4YZ5A 3I2IA 4AZZA 3S5QA 1UIKA 5DUVA 2EA7A 3BPSA 4W4ZA 5DMYA 5IVCA 3MV01 1UWWA 4K21A 5FZFA 3MZHA 3RG0A 1D4M3 2QQIA 3N4MA 2R49A 5FPVA 4NHMA 4LO4B 3ZDVA 1SEFA 4LNVA 4B4QA 3UGGA 1ZZ6A 2RR13 4FXGB 2IFRA 4BPZA 4JDOA 4LBQD 2UY9A 2EXHA 2ADDA 2DDUA 4GXLA 4F8AA 1R092 3W5MA 4RQPA 1FMD1 2UWBA 3NJYA 4ARYA 4YVSA 4IUGA 3FX3A 4JVAA 3RQ0A 1W2NA 3VD4A 1OD5A 1C1LA 1BBT2 2JENA 2XJUA 3B69A 3CNAA 4A6OA 1PNFA 1SLIA 3AP9A 4GH4B 4JHTA 2QQWA 4CCLA 2BVBA 1NKGA 1QJX1 2HWB1 4UI9L 1YUDA 3CL1A 1NLRA 3LD8A 4AR2A 1MEC3 4CP0A 4WBBA 3HOBA 1LHOA 2V5DA 3FUOA 2E31A 1PO11 2A73B 2GC3A 2BNOA 4I09A 1M06G 2OZJA 1V0AA 3FWEA 5C3RA 2VZPA 4MLOA 1RJ8A 1DGRN 1PVC1 2D6NA 2FDKA 1IS4A 3T0AA 4XJZA 1UIJA 2VUAA 1LHWA 2DF7A 2OZ6A 2BGCA 4HVQA 3T0DA 5F3EA 4CEWA 4PCRA 4AFAA 1MZ5A 2ZGMA 2Q5TA 2XBO1 3OTFA 5I8TA 2VG9A 4LHNA 2G19A 1CAUB 2RS33 4YG0A 5LB6A 3JBG3 3K77A 3MV11 2HLEA 4TLGA 3S5AA 1GNYA 1C57A 2EIEA 1CQ9A 5C3QA 4UFMA 3LIGA 3QACA 2DVAA 3CJXA 3J7HA 3RJ2X 1NUKA 1K3IA 2FQPA 3E5XA 3I59A 4AQ6A 2NYYA 4EN9B 1LENA 4QQ2A 4QT6A 2RMU1 5FMBA 5LA2A 4KQ7A 2P5BA 2VUCA 1IHMA 4YYOA 4XZPA 4XUTA 1ZRCA 4XMIA 5FZDA 4ITCA 1E5IA 3U11A 4CTEA 4QXHA 2WNEA 1RUF2 1SLBA 1V6NA 5JR7B 2W94A 4GD4A 4BQ4A 1IS6A 1VAVA 2P1BA 1ZBE3 3ZSJA 2R063 1CD3G 2WDBA 1ZNPA 2W1WA 3MW4A 2A3XA 2V73A 5F6KA 3W21A 4LR4A 3P6BA 4P9GA 3BI3A 2ZX3A 4JGYB 2RJKA 2VZTA 1TMF1 5FXVA 3CLPA 3CKHA 4QB1A 4IEVA 3MEPA 1O7FA 1OA3A 5FYVA 1PZ7A 4XC9A 5FZOB 3MLKA 2E6VA 1NXMA 4XXPA 3NV1A 4XXAA 1RUG1 5I8SA 3AMQA 1LB2A 4MGTA 4CDXA 4WM8A 4META 2D6LX 3M1HA 1OMIA 3I2FA 4PLNA 5FZ8A 2UU8A 4G9SB 3PUQA 4OFGA 3TN92 4D7SA 4LIUA 4ISQA 3AFGA 3OEBA 5A6XA 2IUWA 2R7EB 4EJRA 4LEJA 3ZM8A 1F35A 2WZR1 4RA0A 2JDHA 4AW7A 4BE3A 1CZTA 2JG8C 2NMOA 5FCCA 4LOTA 2ZX4A 2OW4A 4P5HA 4Q4W1 4XABA 4Y5Z0 1FOD1 3U07A 3SCHA 1B09A 2EVXA 4DUXA 2VBDA 4ZONA 4NPRA 4CDUC 3WR0A 3ZIXA 2XQXA 5ABJC 3AKRA 3HQUA 3ZVXA 4RS5B 4UAPA 2A5ZA 5DQ0A 2ZS6B 1GKBA 1OVSA 2GZWA 2IXIA 4UFLA 1OOPB 2ZABA 3IDCB 1IG0A 4LIVA 4EWAA 5A7WA 1WGPA 2NM1A 2D6KA 4YG3A 4XJ9A 3NAPB 3AJYA 4NJ4A 5T5LA 5FWJA 1OSGA 5J09A 1HB4A 3ZFEC 4CDWB 2XUMA 1VAMA 3RVHA 1A78A 3D4KA 3IPVA 4TYSA 3JD72 2DUQA 2VCBA 3ZN4A 3T2QA 5I0TA 5A6ZA 2D93A 2VW1A 3KGZA 4ZU7A 1VBB2 1BHGA 1S0CA 4ZHNA 2DWRA 1Y3TA 5BNPC 5CISA 2Z79A 4NOTA 1AL21 1BEV3 1GBGA 3WDYA 1SHWB 4N53B 5FZMA 5C71A 1CWPA 1UOFA 1P8JA 2B45X 4XUNA 4YZ1A 4QX1A 1COV3 1C5IA 3ZN6B 1F5JA 4LO6B 1SG3A 1REDA 1NCQA 1RUC2 2RM23 4Y24A 1UX7A 2A6XA 2NMNA 1VAKA 5K0UC 2YFZA 1SBDA 1LHUA 2BFUS 2BU9A 1PMJX 1VBC2 3EMRA 1I5PA 3THDA 3UV9A 1RUOA 1QXJA 3SKVA 1OQEA 4JDMA 4YNIA 5CG9A 3NQHA 1AVBA 5FTTC 4CXWA 5ISLA 3VD5A 2A3YA 1WA6X 5FBZA 3O1PA 1H4HA 3ZOIA 1F8VA 2BGPA 2WWSA 2W9XA 2VU9A 2W95A 3MIHA 3VV1A 4BK4A 1AXYA 4RR3B 5FY9A 4C90A 1QNWA 2UURA 3ZYJB 4IEPA 1CIWA 5A7NA 1RVF2 2EIBA 2DCZA 4CUCA 4BB3A 3POYA 2DFCA 5IK7A 2WO2A 2QQLA 2Q1MA 4FPJA 2EF6A 3EO6A 4Y1YA 3U78A 1QJY3 3KT1A 3RGBA 2HH9A 4LE4A 2X5IB 3MBWA 3D0SA 4HVRA 5A6QA 3LDRA 2WO3A 1NQJA 4AVTA 1BKZA 1UMIA 1NE6A 4BU2A 2R071 1OA4A 1UZYA 2BQPA 1FI2A 2E33A 4V2WA 2WZPP 3OPWA 3HR9A 2FD8A 1J58A 1MS9A 1K5MC 2Y6FA 3TEXA 3WHUA 1F5FA 4QGNA 5EJ3A 1GQPA 4A7YA 2A3WA 3ECQA 4KG8A 2D97A 4HPKB 1LOEA 1QGLA 4MGIE 1YYNA 2JB8A 1ULFA 4Z92B 1Y9QA 2XQRA 3AP7A 4O7XA 2WFPA 5A3WA 2IXCA 3WNLA 4AVCA 2FDJA 5FR3A 5L9RA 3TRSB 2ORXA 4TLFA 2ATFA 1QDCA 5F9TA 2CGPA 1HXS3 3L2YA 4GB31 2ZEXA 4DINB 5K8SA 3O1RA 1JYCA 1RTVA 1S55A 4EN7B 4YWAA 4PQ9A 5C9AC 3RZLA 1HRV1 4BK5A 3NV4A 1KEXA 2P6CA 1CESA 3I3EA 4BQ3A 1UY4A 3N36A 2ENRA 2XJTA 1LKNA 3VHNA 3VD9A 1VBA2 1XRUA 1QIQA 1R1A3 2BOIA 2BPA2 1GQHA 1S0IA 2R0HA 3LWCA 4PLOA 4XE9A 3TYJA 2IWGB 4AG4A 3CBNA 4LKSA 2RR12 3OBAA 3CDZB 1BYHA 1KITA 1OF3A 4XDQA 2VVEA 4YW4A 4QU2A 1ZA7A 5TSWA 3I2HA 4CPBA 3EYPA 4XAEA 1Q3EA 3LKJA 2XJQA 3LDKA 1W8ZA 4PQQA 3A22A 3AMPA 2IXLA 1W6QA 3HWJA 1FT9A 1XSRA 3O1SA 2GNDA 4ISRA 1ZRDA 4G4FA 4ATFA 1GICA 1VR3A 1W8WA 3ACHA 1ASJ2 3VZOA 5L7OA 3WXPA 5JXJA 2NN8A 4I0AA 3TEWA 2A6VA 3LB9A 3VHRA 2BNNA 3AL5A 1CZSA 2VBPA 4PIZA 4RHV3 2ZKNA 3WDUA 1Z7S3 2QQJA 2WFF1 3RYRA 5IYYA 4IEOA 2MNGA 3KVBA 3K3NA 4J6GA 4ZPIA 1W8FA 4Y22A 4Q4Y2 2RE9A 3ZFEA 3ZFFC 4AFBA 5BNOA 2GALA 2XB6C 4L0PA 5FZBA 1LGBA 2W68A 3IB3A 4D0QA 4QX5A 5FZ0A 2AACA 4OI1A 2P6HA 2JECA 3MLLA 3UKVA 2ZGSA 3ZR5A 1U0AA 5F39A 1R091 2JG9B 3ZXEA 2RS32 1XB9A 4C1WA 3JBG2 4L11A 4DY5A 2DUPA 1X9PA 4Y1ZA 3EJKA 5FYCA 4NRQA 3FZ3A 1EAH1 1HRI3 4IXLA 3H0OA 4I3PA 3SH5A 1BBT1 4S2DA 3U10A 1WCUA 1JZ2A 4LQRA 2ZOEB 1JZ6A 5BNNB 4R52A 2D3SA 2J1SA 3R4DB 3WNKA 4JX0A 1X9TA 3ZX7A 5GJ6A 3NJVA 3H42B 1W8TA 1ZZ8A 4R9CA 4XQDA 3S7IA 2XWJB 5I93A 1GZWA 4OQ9A 4NIGA 1T6BX 1MQTA 1O4YA 1QY4A 1Y9GA 4BXFA 1CPNA 4Z07A 4FPKA 2W08A 1VRH2 1YXWA 2OX0A 2YHJA 2R062 1W0OA 2XXZA 3GHMA 4FPGA 5FY4A 4HK8A 4IE4A 4FFHA 5LA9A 3DYMA 3WW2A 2VAUA 4IETA 1YFYA 3AYCA 1FX5A 1K5JA 2H0VA 1C8M1 1QJU2 2XONA 2Z69A 3ZKUA 2DVGA 2BW8A 3VBSB 3BODA 4LKDA 3OGGA 2ET1A 3VDDA 1WUVA 2RS53 4EN6B 3WG3A 4V1PA 1H8VA 3MHZA 4UW5A 2W47A 3PUIA 5FQ0B 3BU7A 4P9YA 2YU2A 2E32A 1UY3A 1UY2A 5CBLA 4NHKA 4BQ5A 4P9WA 4Y5SA 5BPXA 1HN0A 5JLVA 5A3MA 1VBD3 1HQLA 2JE8A 2JE9A 3HQXA 2IC1A 1PGW1 4AVSA 1RUF1 1UOGA 4QPIA 3WW4A 1PO22 4XMAA 4MO3M 3T4VA 2VMCA 1I1EA 3GALA 2ZGLA 1GNHA 5D8AA 4WVMB 1SPPA 2I74A 5JIAA 1H1IA 5A80A 1WD3A 3RDIA 4HSLA 1BVVA 4Y5TA 4E4DX 2WNUC 4GALA 1MS3A 1HDKA 2VUJA 4FP2A 2Q8CA 3DKQA 5DABA 5A33A 1KJRA 3VBFC 1WMEA 5DDJ1 3H8OA 3SLIA 5E8AA 2Y60A 4UW3A 4CDQC 2XWBB 1C5HA 2CGNA 3D0JA 3V65A 2BOJA 2P3JA 1MVQA 3KCXA 4OUMA 5C3SA 5I91A 5CFCB 1NT0A 2CYFA 2MEV3 1N1TA 1UKRA 1RUD2 1HLCA 4AGGA 4SBVA 3S7EA 5FY0A 2ZHLA 1HX6A 2JEMA 4HFSA 4Y1UA 5C8CB 1X82A 5IK5A 4JAAA 1IPJA 1LU2A 3SMHA 4XFAA 5IFTA 3O1OA 4JTOA 4WVVA 3KCCA 1US2A 3SH3A 1UN1A 4Q27A 2MPFA 3I2KA 5DG1A 4K3UA 3L9JT 1H0BA 3E5UA 5FLJA 1XJAA 3A7QA 5F3IA 4KU7A 1CAWB 1O3RA 3OEAA 4AHWA 2GNBA 1FNZA 2HEWF 1W9TA 2OPKA 3BUCA 1AXKA 1VMFA 2WWUA 4YARA 1I9RA 1UXZA 2D6OX 4DXZA 2XJPA 4WM7C 1XNBA 3VKMA 2O14A 3POSA 1KFXL 5GZDA 4COUA 3VBOC 1HB2A 1RUH2 3W58A 4CCCA 1K12A 3ZMNA 1ZZ9A 1COV2 5GZCA 1DQ5A 5A7OA 1WCDJ 5JR2A 1HIXA 4IV3B 3D82A 2JKXA 3P5BA 2FDIA 5A70A 2PHRA 5CNAA 4I3GA 3TEZA 1W6MB 2QNKA 5FREA 3M3QA 5GZEA 2ZGPA 1N1SA 3VN4A 2BWAA 4Q8LA 3VBHC 1ENQA 3E6DA 1DQ4A 5K4LA 1OUXA 1YFXA 2G9ZA 5IVVA 4BQYA 2GC1A 2PHWA 4D6RA 3KHBA 2XJSA 2WLQA 4TZDA 5CU1A 1DQ1A 2HWE1 2GDFA 1QQP3 1KDMA 3ZR6A 4Q4X2 3N9PA 4IEWA 4W65A 1VBB1 3KGLA 4IEYA 4LITA 3RYKA 4HBNA 4DRRA 2Y6LA 5LA0A 3Q8FA 4GIQA 4NO4A 3N7MA 3IM0A 2BJSA 2ZX2A 4W6WA 5E88A 5GZGA 2W5FA 2VZ1A 4I30A 4OHWA 3FHQA 1EV13 4FOQA 3H50A 2EICA 3VBRC 2K0GA 3ACGA 5IVYA 4DEQA 3WT3A 2IXHA 1MZ6A 3IIAA 1ZRRA 1VBC1 1RMU1 2AUYA 1CAUA 4YZ2A 3K4AA 5KBFA 3URFA 1KQRA 3PHMA 5FYYA 5FZKA 4FPEA 1ZRFA 1ZA4A 1V6JA 3NO8A 5EZWA 5BXXA 3MLJA 1EP0A 3ACLA 5IWFA 1QXPA 3S0MA 1HKDA 4MG2A 1BQPA 3MIGA 5IT6A 1RUE2 2R042 2WRAA 1YHFA 1FAYA 4IW3A 4Q5OA 3WD5A 4CEYB 4DB5A 5K7PA 2CV6A 2NLRA 2CWSA 2PAKA 2RJLA 4Q4V1 3USUB 1AYN3 4M3CF 3RRDA 1WLCA 2RV9A 4Q0VA 3BTYA 5CG8A 1OKQA 1OF4A 3NV2A 3ZKYA 1QH6A 4CCMA 4HZFA 3KHCA 2ERFA 1DLCA 1RHI1 3E97A 2AC1A 1BVP1 4ASKA 4BXSV 1SDDB 2J1TA 3AMNA 5J7MA 4QXBA 1GNZA 3TN93 5FPXA 5J37A 3ZFGB 2IFWA 4AEDB 4UF0B 4EQVA 4JGZB 3WDTA 1RUI2 2KR2A 1APNA 1KD7A 2WAOA 4OI4A 1IS5A 1V70A 2XKPA 1PHMA 4YG6A 4YVWB 5FZOA 2F17A 4IEQA 1PMIA 2JICA 3HBZA 2OS2A 4H3WA 3AM2A 3NNFA 4OVEA 2OUHA 1X36A 4R9DA 2V72A 3LEGA 3W20A 4RQPC 2JKBA 3M3OA 4HKWA 1O8PA 1Z7S2 2K9ZA 4K7JA 1XYPA 4DUVA 2WS93 3PUHA 4GJZA 2W52A 4P00B 1JN2P 4YFWA 2XJRA 1RINA 3O0WA 1D4M1 3W9AA 4MGKE 2W0XA 4XFFA 4N9HA 3ABZA 1AR62 1GWKA 2WZEA 4E27A 2F6BA 4GQ7A 3SH4A 5HCAA 2RR11 1PGL1 1AR72 5FDBA 3OCPA 4HKLA 2OUJA 2V4VA 4KU8A 3TOJA 3UESA 3UETA 5K9YA 2LS6A 2XL7A 4AAPA 1O3TA 5FZ9A 5LBBA 2ZGRA 1OXCA 1HV1A 2J1AA 3MICA 5DAVA 5FP8A 4IE0A 4XF3A 4HG6B 4LOSA 5HXVA 1G9AA 1JYIA 4WM7A 3K48A 2XGXA 3JD73 2XH6A 1B35B 1YC61 2HWF3 3THPA 2JDAA 1ENXA 1OOPA 1UPSA 5EYXA 4CEWC 2DTYA 1J3RA 5C5UA 2Q30A 4BZ4A 2AGSA 4QKNA 4XACA 4YFZA 1MEC1 4BIFA 2ZX1A 5AVPA 4CDWA 1NG0A 3ITQA 1DF0A 4TSVA 4AVBA 4FCAA 5C3OA 3TAYA 4YZ3A 1RUC3 2WA4A 5GLWA 5A3NA 3GDBA 3PJQA 3WCSA 4Q29A 2TUNA 2C1FA 4AHYA 3ZSKA 2IXJA 1JU4A 2DV9A 2CY6A 1HB3A 4A45A 2D98A 2RS31 3UGHA 3JBG1 5HBAA 1W99A 2YXSA 4LHSA 5FMCA 4N53A 4CP1A 2RS52 1OC1A 2VNOA 3KV4A 2WNOA 2EXIA 3ZXKA 2EIGA 3ZN6A 1W9FA 3WW3A 5KHKA 5AFEA 4AVVA 1BCXA 1RVF3 3TWIA 1UX6A 1OBNA 2VM9A 1W2OA 3FJSA 4RN5A 2Y64A 1PK6B 1VBD2 2GP3A 4P02B 4Y20B 3B93A 3H1MA 4RFRB 2VVFA 5FOJB 2YV8A 2RDRA 4IE6A 3OBTA 1O6UA 3VZLA 3DXTA 4WM8C 4CDXC 1A6CA 2LALA 1DFQA 4Z1VA 4RR3A 2R061 5CFDB 5JVVA 5HXMA 1LR5A 4LHKA 5HV0A 3H1WA 1YO8A 4IE7A 1LRHA 4URAA 1FPN2 5LASA 4MHUA 3R4SA 3LQCA 4NIIA 1BK0A 1I5ZA 3KD4A 1ND3B 2EIDA 1Q8PA 3AYDA 3GF6A 5DUWA 4YW1A 2YB7A 2X5IA 4QPGC 1H4GA 2MEV2 1XNCA 3POEA 4FOWA 3RZZA 1CX1A 5T3NA 1TNRA 3VZMA 4AI3A 5EJ1B 2XG3A 3VKLA 4GKYA 4S2FA 3KQRA 5B4XA 4LXLA 1V6MA 1LNSA 5G05L 2ZGKA 3I54A 4PIXA 3VBUB 3ZYRA 4DZGA 4HPKA 1VBA3 1RYYA 3OUJA 2D7FA 1N1VA 3G6JB 1PO21 2A6WA 3GCWA 3WF1A 1DGWX 3PMSA 1WCKA 5FZEA 2W39A 5JOYA 4IESA 2VD7A 4C8DA 3P1IA 2QQOA 1PIV3 4IV1B 4EN0A 3OSDA 4CA9A 4AI2A 3MF6A 4B7KA 3FLTA 1N3QA 1L7QA 1WLDA 1BJQA 1O4ZA 5GLUA 3ZXJA 1DZQA 1ASJ3 1J1TA 2YU1A 1VMHA 5FBJA 1W06A 3ACFA 3R4UA 2Z5WA 2OIIA 2ILMA 3I2GA 4DS0A 3S57A 3SNMA 1US3A 2ARXA 3ES4A 5FZ4A 3AVRA 1Q8OA 1DQ2A 2CAVA 2QTWB 3AZVA 4AQSA 3DPRB 5ANNA 1VIWB 2P37A 3T08A 4MVTA 2ORZA 2W87A 4N7IA 4Q4Y3 1SZBA 4CU9A 2ZMNA 1NCQC 2Z4FA 5FPAA 2XOMA 4MUVA 2ZPXA 4FXKB 4N43C 2YC0A 2OQ6A 5T54A 5IVJA 3C7HA 1QQP2 1UU4A 4FPOB 5L73A 1UU6A 2QQPA 4Y33A 4CCJA 5JXGA 4N8MA 3U4XA 1LOFC 2GH8A 4H2AA 1A3KA 3DYPA 2PHDA 3PUSA 1BEV1 3FFQA 4HANA 1LESA 5DN2A 2SBAA 1ENSA 4M00A 4DXRA 1COV1 1GMMA 2XVGA 1POV0 4Y1XA 5FZCA 1GSLA 2RM21 1VBE3 1EV12 4MHRA 2TBVA 5C4WB 1OLRA 3PVBB 3RFRA 2CNAA 1C8NA 4LULA 2VCAA 1NLQA 2QUOA 3DXUA 3K51A 3KLSA 4PI0A 4CCOA 4N90A 2ZJCA 4PF1A 2X10A 4LBLA 1VRH3 1YFWA 4XHBA 4JHZA 3ZPYA 3C3VA 3J7NA 1TG7A 3HAGA 4E4ZA 1O3QA 1EPWA 2WL1A 3I2DA 2PAMA 4IGQA 1R1ZA 5HCBA 5AC92 5HV4A 1J3QA 2PQSA 3ME2A 5BNNA 1QJU3 1W2TA 3FE5A 4YM0A 3OOXA 5C7GA 2BGOA 5JUVA 1QJY1 2E26A 1R083 1AYN2 2WYSA 3NKGA 4OULA 5T55A 3JCIA 1JUIA 3WF2A 5H9QA 2VJXA 2RDQA 5I0DA 4ES9A 4D69A 2BEOA 4ZZ5A 1MZEA 4XQ4A 5FZGA 2QZ3A 2XHKA 3IZOA 3AMMA 4BM8A 1NCRB 1UMHA 3HN3A 2O8OA 4GULA 4OUSA 4A4AA 1JOPA 1NQDA 2E63A 4OYUA 1PO23 3VBSA 1GFF2 4MOAA 1CVNA 2I2SA 1NOVA 3QD6A 1GU3A 4LPLA 4QPGA 1DZTA 3J8F2 3MFAA 4L2NA 4QQLA 3HQRA 4R8HA 4Q1RA 3I49A 1HXS1 1XNTA 2GC0A 1D0HA 5SV8A 2KM2A 2WS92 3NJZA 4CZSA 3AP6A 3ASIA 1JI6A 3W5NA 5L7OC 2YG0A 2QCSB 4LO7A 2J1VA 3OPZA 4PJYA 3TNQA 4OHZA 2D3RA 1R1A1 4GAZA 1RUD3 2A7AA 5FK8A 3RZKA 2E7QA 3OBZA 4KGQA 2JWPA 3ORJA 4GA9A 3Q8AA 3AYEA 4QXKA 3ELNA 4AFCA 2WWJA 2YZ4A 4LBQB 4CVUA 3EXUA 3ZXFA 1H1AA 1LAJA 3BTXA 4P9LA 1L3JA 4UT5A 2JIGA 2QE3A 2WO7A 2O1QA 3WP3A 4NPMA 4QGLA 2J22A 4ZY9A 2VMDA 5BNOC 4FTBA 3DUIA 5T5PA 2VMEA 4FOYA 3USSA 3THCA 4FBFA 3KZ4C 5DAPA 1CPMA 2C9AA 2WQ4A 3ZSEA 4CCNA 4GWIA 2HWF2 5CFCA 3M3EA 1JYXA 3HVDA 3SISA 4H14A 2P3KA 4XUQA 5A3OA 3WF0A 4EV0A 3BTZA 1DDLA 1PGSA 3H9AA 4RHV1 5J36A 4NN0A 4MV2A 1Z7S1 3ZXGA 5T50A 5FZ6A 3UJQA 5JOXA 4FPCA 3B9IA 4BQ1A 1LGCA 2DTWA 2D43A 1WD4A 2VO5A 1G6NA 5JCTA 2WINB 1RUH3 2FBEA 4U36A 1XNDA 3IKWA 2GNMA 2ARAA 5F5AA 3UK9A 3J4UH 3QLQA 4BYYA 3CF6E 1H8TB 5FJHA 1ZX5A 3VHPA 1CAWA 1XE8A 3KS7A 4N43A 1LODA 3OYWA 4E2GA 1MR5A 3WDXA 1ND2B 2GNTA 1MQTC 1WA4A 1TME2 4OHXA 1YIPA 1LOFA 3SITA 1E5RA 1X8EA 1JZ5A 2PLV3 2WBKA 2H6CA 1S0EA 3VLBB 4M3CB 3M4FA 1HRI1 4R4ZA 4MGSA 1B35C 3AJZA 1RITA 1YCIA 1VP6A 4UFKA 3B00A 5HI0A 2Y33A 3LA7A 4IV3A 4JZRA 3MI8A 5EV7A 4Q4X3 3ZYHA 1NY72 3LFIA 1W6MA 2RJ2A 4FT8A 4GWJA 4FFFA 3EBRA 3VDDC 4R9AA 4JRAA 4UFHA 4E4SA 1DHKB 3IBMA 3M70A 3AX4A 2GMEA 2N7GA 2TEPA 3IWZA 5JZGC 5A3LA 1J83A 4EROA 2PTMA 1OQ1A 3I4IA 3IMMA 4Y4YA 3V56A 5FZIA 4IGOA 5HCHA 5FY8A 3O1UA 2FZ1A 1ZVFA 5FXZA 1A34A 1O5LA 1XOYA 3NWKA 2DYCA 4LBOA 4PDWB 4QPIC 3O1MA 2VQAA 1ODMA 1GLHA 2D6MA 2GU9A 3S6PA 1F9KA 2DUOA 5D8AC 3PIGA 1UNBA 1F4AA 3ST7A 5DZGA 3JU9A 1XSQA 1NX9A 3R0RA 1HV0A 2RS51 3OD4A 2F4PA 2Y38A 3DN7A 3CJIB 2O0OA 1LJ7A 1H1MA 1W9WA 2HWC2 4JCKA 4XYXA 5ACA3 2BUKA 2D40A 2XLFA 5JMCA 1W6PB 1Q8VA 2PAEA 2MHFA 4XQWA 4LO5B 3WHTA 4KBBA 1RUE3 1AX2A 2GSYA 2R043 4OZXA 4ET7A 2XHNA 3B9CA 1VBD1 2XR4A 3JQWA 5FYSA 4AI8A 5EYYA 2Q8DA 2Y6KA 1W8HA 3B5LB 1V9U3 4P14A 2ZGOA 2Y0IA 2NZ9A 1PZ8A 1UYPA 2JDUA 3PMEA 1QDOA 5APAA 3L2HA 2RS12 3T3YA 5FP3A 4HXCA 5A7SA 2Y26A 2WJSA 4LK6A 2XUEA 1PIV2 4CUAA 2DCJA 3UYJA 4KMQA 1RUI3 2Y0OA 4CEYA 5F2WA 2QFEA 5FP4A 5JI9A 4YVSB 3A4UA 4ZS2A 4PIYA 3DKWA 4XILA 3USUA 1U5YA 1W6NB 4EN8B 1PX4A 3NRUA 2G1MA 1OH4A 4K20A 3UKTA 2MEV1 4DUWA 2VCMA 2VNGA 3R05A 4V2VA 4C0HA 1ZBA3 1HW5A 3U1XA 4LBMA 1TE1B 2YPDA 4HKOA 4PBPA 4A3XA 4HETA 3N9NA 1ONAA 5L19A 4AXOA 1UKGA 4KL1A 1XNAA 5FLIA 1WZXA 1DGWA 3ZFGA 4AEDA 5I8YA 2RDNA 4UF0A 4JGZA 3B02A 3ZPOA 2JIJA 3WF3A 5C33A 1WMXA 3LOIA 1VPHA 1JH5A 4YVWA 1AR63 4QM8A 5FRAA 5LEJA 2QZ2A 3WQ1A 1NYWA 2VQ0A 2AEZA 1AR73 2I45A 4A6SA 3O1TA 1AYM2 2V5YA 5EHDA 5IATA 3NMBA 4P9IA 4MH0E 1XQNA 3LF7A 1YNAA 3RWNA 3HNMA 2XPJA 1IPKA 1UZZA 5HCFA 5EWSA 5FO8B 3POIA 1VLNA 2VZUA 4A2UA 2FDHA 2WNVB 2WT2A 3HN1A 3T0BA 3UL2A 4GH4C 3P3PA 2HBTA 4LKFA 4FO9A 2VMFA 3H7YA 2P17A 4ONUA 1VBE2 3N9MA 1OLMA 3N9OA 4QU1A 4FQZA 3DYOA 4XPVA 1UO9A 5CAZA 3LCPA 1A8MA 4E2QA 1QJFA 1NA1B 1LOGA 1W6OA 4MXWB 4A41A 2BERA 1EY2A 5CKNA 5F37A 5HPOA 4RGGA
chains in the Genus database with same CATH topology
1YQ6A 1YQ8A 1YQ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YQ6 A;  1YQ8 A;  1YQ5 A; 
#chains in the Genus database with same CATH topology
 2R32 A;  2P4E A;  4M4P A;  5AFB A;  2CGO A;  2X09 A;  1B35 A;  4AF9 A;  3OJB A;  1Y9M A;  1Y4W A;  1LOB A;  4TTG A;  4RGA A;  3CZU A;  1QQP 1;  3WV6 A;  3BAL A;  4F3J A;  3O1V A;  2DBI A;  1U5X A;  1DLL A;  3HPN A;  4L92 A;  4EYU A;  1R08 2;  2G4I A;  5CYY A;  4FFI A;  4D6Q A;  2NPI A;  4Q0Q A;  2HYX A;  3KT7 A;  3GBF A;  5SV5 A;  4Q0S A;  1SCR A;  2PHX A;  2AZ5 A;  2EAK A;  1UQX A;  2AEN A;  3PDQ A;  5JZG A;  2VQU A;  1EV1 1;  1YIF A;  3AXE A;  3CO2 A;  4FPY A;  4RL7 A;  4XFB A;  3PTR B;  5F8P A;  2PYT A;  3OD0 A;  1FV3 A;  3POW A;  4XIK A;  3VL8 A;  5KXE A;  1IQA A;  2C26 A;  2JDM A;  2ZEW A;  5A3P A;  2ZML A;  3O12 A;  5KXD A;  2FCT A;  4D3W A;  3V0B B;  2VZV A;  3SEE A;  4H7M A;  3KF3 A;  1JTZ X;  2JDP A;  4QX0 A;  3RPQ A;  2GN3 A;  4IEX A;  4FAG A;  4OLL A;  1FAT A;  2BNM A;  2G9F A;  5JDB A;  1E5S A;  3MIF A;  2L9L A;  4JGY C;  5FXX A;  3V0A B;  3VD3 A;  1FPN 3;  1LOC A;  1OPM A;  2UYA A;  1QWR A;  1JYW A;  4AQT A;  3FUQ A;  4D6S A;  1SCS A;  4PT6 A;  2IXK A;  1PK6 A;  1LTE A;  5LK5 A;  1JUH A;  2ZHM A;  4Y20 A;  3ETQ A;  4GMP 3;  1RB8 G;  2ZMK A;  4OUE A;  1AYN 1;  4XFH A;  3FBY A;  1DGL A;  2YDE A;  4XOG A;  1QKQ A;  1PM4 A;  5FYB A;  4PF5 A;  4S2H A;  3WQB A;  3ZXA C;  5CFD A;  1GR3 A;  3OY8 B;  3THT A;  2OQ7 A;  2HKX A;  4XTM A;  1U5Z A;  5DUU A;  4AOC A;  4CSW A;  3RWK X;  3WX5 A;  2X8K A;  4NAM A;  4OHY A;  1F4H A;  3TN9 1;  3B7M A;  4ZZ8 A;  3WUC A;  1FMD 2;  2K2S A;  2XLA A;  4LBJ A;  1N47 A;  1PVX A;  1ND3 A;  2VY0 A;  2YUE A;  4GWN A;  3E6B A;  1JXN A;  4M0N A;  4AEM A;  4P08 A;  4UOJ A;  2QKD A;  3KVA A;  1YI9 A;  5BYN A;  5DAQ A;  2HWD 3;  3BOW A;  2Y8K A;  4MGY E;  2WQZ C;  3SKJ E;  2CU5 A;  1TQ5 A;  4RS5 C;  2OA2 A;  3K4Z A;  4OMD A;  5JXI A;  2WS9 1;  4NUB A;  2PHU A;  5E6H A;  3JB8 A;  1WW4 A;  2X05 A;  2QDR A;  1KXG A;  1W8O A;  2VXJ A;  4IE5 A;  3VBU A;  2YPJ A;  1F31 A;  1OOP C;  3N35 A;  4KBZ A;  3GM8 A;  4K8F A;  4XBL A;  4COV A;  2GMP A;  1VJ2 A;  2JDZ A;  1PVC 2;  2R1D A;  4JKL A;  3NAP C;  4LK7 A;  4QDR A;  4XVH A;  2Q8O A;  4AAX A;  3JZV A;  1AJK A;  3WP5 A;  1UL9 A;  4XW3 A;  4CXX A;  5C5T A;  2XKO A;  3BIW E;  5JXH A;  1JYT A;  2XBO 2;  4IV1 A;  4CDW C;  3ES1 A;  3WNM A;  2UY8 A;  1VE0 A;  3O0X A;  2PLV 2;  4CE8 A;  4Z2W A;  3WDV A;  1QOT A;  5IAX A;  5FKB A;  3JD7 1;  2J1U A;  4NHY A;  4GH4 A;  3U37 A;  2W1Q A;  2HWF 1;  4ZS3 A;  4C0B A;  4YM3 A;  3U0Z A;  1HQN A;  3AB0 A;  3M8L A;  2RMU 2;  4QAW A;  3E5Q A;  2P2K A;  2XVL A;  4QHO A;  2Q8E A;  2E53 A;  2QJV A;  4D7Y A;  5L9B A;  1H2K A;  4FP3 A;  1STM A;  4N53 C;  1MS5 A;  3C2U A;  3DPR A;  3T2T A;  2YYO A;  4LUM A;  4CCD A;  4CP9 B;  3FFZ A;  2LUW A;  4QB6 A;  4BDV B;  1IS3 A;  2VZ3 A;  5FIX A;  2B7Y A;  1RUC 1;  1HJG A;  1ZZC A;  2YFU A;  3FHI B;  4JKM A;  5DAX A;  3AZZ A;  3EHK A;  2H0B A;  1GP5 A;  4COY A;  3C7G A;  2VC9 A;  4A3Z A;  1OVP A;  4LT5 A;  2GMM A;  1H9P A;  1LEM A;  3D8C A;  4RR3 C;  3M7A A;  2YY1 A;  5EP9 A;  4K40 A;  3VZK A;  5ACA 2;  3ILR A;  1DG6 A;  1RUG 2;  2R30 A;  1AF9 A;  2BYV E;  5AC9 3;  5A1A A;  3FLP A;  1RVF 1;  4XEZ A;  3T2O A;  1TEI A;  5FP7 A;  3KCY A;  5FPZ A;  3LFM A;  1VRB A;  2X5I C;  2ZGU A;  1JHJ A;  4IQP A;  3AKP A;  5F5Q A;  1V9U 2;  3U4S A;  2KD7 A;  3M3I A;  1H2M A;  4EWD A;  5FY5 A;  4XJW A;  1AX0 A;  2YGL A;  5E1R A;  5FZ7 A;  2YGM A;  1WCS A;  1ZZB A;  1MZF A;  2YBS A;  3ZO0 B;  3ZYP A;  1VB4 A;  4SLI A;  3MFC A;  2JG8 B;  3ALQ A;  4Q4W 2;  5GLV A;  3PJY A;  1FOD 2;  4XJ8 A;  3QH6 A;  2D44 A;  3RZG A;  4JGY A;  4HON A;  4CDU B;  4GMP 0;  2D5H A;  5ABJ B;  4OHV A;  3RZJ A;  1W6Q B;  4U2A A;  3UGF A;  1W3V A;  2B4K A;  1F2N A;  2J1E A;  3NST A;  5FP9 A;  2ES3 A;  2EXJ A;  4JDN A;  4YW7 A;  3TBD A;  3J8F 3;  1FXZ A;  2D6P A;  2GH2 A;  4RSU A;  3VGI A;  1ZBA 2;  5E16 A;  3WVJ A;  3LEK A;  3RZH A;  1DZR A;  2ZAC A;  5IUQ A;  1CAX B;  3POF A;  4NPL A;  4UBG A;  1O91 A;  4P9J A;  3H8R A;  4QKB A;  1NE4 A;  2HEV F;  3P3N A;  5E89 A;  5FPL A;  5CB7 A;  1DU3 D;  1NCR A;  1RIR A;  1SLL A;  2ZAA A;  3INA A;  1CX4 A;  3AP4 A;  1M4W A;  4QMA A;  1UY1 A;  4W6X A;  3WSO A;  3VD7 A;  1VBA 1;  1BZW A;  1J3P A;  1CON A;  2Q1Z B;  3ZFE B;  1CZV A;  2B9U A;  4GWM A;  4TN7 A;  5FKC A;  1KJL A;  1YEW A;  1DQ0 A;  2VOW A;  2BRT A;  5LZ6 A;  2Y6G A;  3KV5 A;  2BBV A;  2H6B A;  3MPP G;  4H7L A;  5BUV A;  5H9S A;  1JZ7 A;  1PIV 1;  4YW6 A;  4CCK A;  4RS5 A;  1QOO A;  4ARX A;  5BNP B;  3IT8 A;  4A42 A;  1E57 A;  1ASJ 1;  2IZW A;  4BMB A;  3VDC A;  2A70 A;  2LRO A;  3O0V A;  1OI6 A;  1YQ2 A;  2WSU A;  5FUI A;  1QMJ A;  3K75 B;  2WUH A;  2PHT A;  1X33 A;  2VR4 A;  3NAP A;  4LBQ A;  5IVE A;  4XFI A;  4AEK A;  5K0U B;  1AL0 G;  1J59 A;  3OPT A;  1T6G C;  3QH7 A;  4QX3 A;  1GP4 A;  3AMH A;  3J7L A;  3MW2 A;  4Q4Y 1;  1BXH A;  1S0B A;  3DF0 A;  5CZK A;  4XZU G;  1ENR A;  1IQD C;  1POV 3;  2VL4 A;  4I02 A;  1AUY A;  3WG4 A;  5I0S A;  3NW4 A;  4JC1 A;  4Z82 A;  3VUO A;  1GAN A;  3GBG A;  2VMH A;  2JG9 C;  4J1X A;  1TME 3;  3BTA A;  1UZW A;  2YBK A;  1Q5O A;  1OH3 A;  4QX2 A;  1U12 A;  3AZW A;  3IMN A;  4X6R B;  3LZZ A;  3RI8 A;  5B4N A;  1JMU B;  1LGN A;  1TNF A;  1SLC A;  1W8U A;  1ZZ7 A;  2DBN A;  2QQU A;  3PNA A;  4X8P A;  3D3A A;  5DUX A;  1ZM1 A;  1XYN A;  3DEC A;  2QQK A;  5BNN C;  2A75 A;  1H8T A;  4JKK A;  4AFM A;  3PU3 A;  1VBE 1;  2AH2 A;  4RYD A;  2R07 2;  2Z42 A;  3AZY A;  3FC0 A;  2X29 A;  4XAA A;  3EB7 A;  1E5H A;  1Q8S A;  4ORF A;  3NVC A;  4I0B A;  5FYU A;  1QHD A;  4WVW A;  3RMX A;  1AR8 3;  1LCL A;  2JB4 A;  1OQD A;  3H3L A;  3POJ A;  4NMI A;  5FMD A;  1K5M B;  3IDB B;  3RS6 A;  1L7R A;  1JYV A;  1AXZ A;  2ETE A;  4M3C A;  4QXC A;  1VRH 1;  3WNN A;  1GZC A;  4IER A;  4A7K A;  1IKP A;  3WP6 A;  1ULP A;  4C1X A;  4DXT A;  3KV9 A;  3KSC A;  2B9V A;  2XLG A;  4GB3 2;  1W0P A;  1CAV B;  1JOB A;  1LED A;  3III A;  1R64 A;  1QJU 1;  1S2B A;  4NWW A;  3VBS C;  3VKF C;  1W28 A;  4AL9 A;  1MS4 A;  1GOG A;  3UKN A;  2JJ6 A;  5A6Y A;  4YPJ A;  2NP0 A;  4LE3 A;  1AZD A;  1H6X A;  2ZZJ A;  4MGQ A;  5C9A B;  1DGR A;  1R08 1;  4YGC A;  1SFY A;  1ZYB A;  2HWC 3;  2ZBJ A;  3BN6 A;  1H9W A;  3SEP A;  5FJK A;  2RHP A;  5GKA C;  4DEV A;  1JS9 A;  3G7D A;  2E51 A;  5IK8 A;  5T5O A;  1FV2 A;  4XHX A;  2WN2 A;  3GJA A;  1UZ0 A;  2ARB A;  4PDW A;  4HT1 T;  2VGD A;  1V6I A;  1QU0 A;  1QOS A;  2GP5 A;  4W50 A;  2VMG A;  4B1L A;  4EWE A;  3D6E A;  5LY2 A;  1HJF A;  3VL9 A;  2JE7 A;  4P5Y A;  4QKD A;  1XPW A;  1C3H A;  1RC6 A;  4BHP A;  2RS1 3;  5LBC A;  1DYO A;  3CJI A;  2J42 A;  3OGV A;  3VB9 A;  5IHR A;  3N9L A;  4KWU A;  1RXF A;  2HWD 2;  3KF5 A;  4DXS A;  5FO9 B;  4PLM A;  1G86 A;  4TWT A;  4MAD A;  2WFF 2;  2XL9 A;  1EYB A;  3C7E A;  4UFI A;  4NRM A;  4QQO A;  4DY3 A;  3RNS A;  4O9E A;  5CFC C;  5D2A A;  2E7A A;  1MAC A;  5GM0 A;  4DO0 A;  2BBA A;  2Y6H A;  4OMC A;  2A6Z A;  4ZU5 A;  3GXU A;  1RUD 1;  4B4R A;  3ZFF B;  5C8C C;  3LPG A;  3AL6 A;  3LA2 A;  3CMG A;  3MGU A;  1UYZ A;  1RL3 A;  4NVP A;  4UBH A;  4AWD A;  2VOT A;  3NV3 A;  1EPZ A;  3O5S A;  1G8W A;  5J98 B;  2V4A A;  4B8E A;  2WT0 A;  3H8U A;  4ZKT B;  1PMH X;  3UJO A;  1EAH 2;  1AR9 3;  1UMZ A;  1VMJ A;  1W6N A;  2XVK A;  2W2I A;  4LA3 A;  4BOW A;  1G9F A;  3NKT A;  2JXA A;  5A32 B;  1W2A X;  5IVB A;  5JMO A;  5JOW A;  3DEM A;  1AYM 3;  1DYP A;  4LMF A;  1V00 A;  4LBK A;  5ERL A;  1ULD A;  5M0T A;  3M2M A;  3I8T A;  3E6C C;  4UFJ A;  4G3Y C;  5GAL A;  3KB5 A;  1RUH 1;  1F15 A;  3B3Q E;  4Z8B A;  4RD7 A;  4IV3 C;  3CEW A;  2OVU A;  4BLJ A;  4LOR A;  5FY7 A;  3F95 A;  1UW8 A;  3PIJ A;  4Y3O A;  1WBL A;  5F32 A;  2WYF A;  2IVI B;  4XBQ A;  4MXV A;  1JHN A;  5KWR A;  3J7M A;  3GNE A;  2YRO A;  5F5I A;  4L8Q A;  2JG9 A;  2JD9 A;  3SCG A;  1C8M 2;  5FPU A;  2UWC A;  2VMI A;  3GZE A;  4K1Z A;  1DP0 A;  1H30 A;  3WDW A;  2P3Y A;  2WNV A;  2PLV 1;  1Q56 A;  1NAE A;  1PX3 A;  2VQT A;  3AVS A;  5LAT A;  1UYX A;  2ZHK A;  1W9S A;  4ZXK A;  1A8D A;  4H55 A;  1CJP A;  5JPN B;  1MVE A;  4F7Z A;  4YSF A;  1GP6 A;  3UNP A;  2DCY A;  2E9Q A;  4Q4X 1;  4BIO A;  4N7U A;  4XFC A;  1AX1 A;  2Q0A A;  2UYB A;  1QNY A;  3BOP A;  3X29 B;  1NA1 A;  4QWN A;  4MXW A;  2PFW A;  1JOJ A;  3DL3 A;  1PGW 2;  2DVD A;  3F2Z A;  3KWV A;  3HD8 B;  2O8Q A;  4FVV A;  3KT4 A;  3OUI A;  4EZ4 A;  2HBU A;  2VZS A;  2R16 A;  4AQ2 A;  5LWB A;  1JZ8 A;  4YW3 A;  4LLF A;  4HK9 A;  4MGZ E;  3O7O A;  2TNF A;  4XF4 A;  5A1L A;  4CYD A;  3H1Y A;  2VW0 A;  2ZEZ A;  3VHO A;  2WNU B;  4IL7 A;  4AK3 A;  1S2K A;  3PVN A;  4XUR A;  5DDJ 2;  3N3H A;  2G9G A;  2LM3 A;  3T1L A;  5FV3 A;  1O8S A;  5T52 A;  3VBF B;  4NHX A;  4W6Y A;  3RJR A;  5EFU A;  4CDQ B;  5GLZ A;  3OGR A;  5FQ0 A;  1JOD A;  1SFN A;  2C9K A;  4FQ4 A;  5ACA 1;  4AVA A;  2IVJ A;  2BV4 A;  4CEY C;  3HT1 A;  3NJX A;  3H8X A;  2VH9 A;  1RUE 1;  2R04 1;  4QPY A;  3APB A;  4QDQ A;  4AGV A;  4FPL A;  4XF9 A;  1OLQ A;  3GJB A;  1V9U 1;  2VNR A;  1PZ9 A;  2DU1 A;  3VKO A;  4MX3 A;  4KI5 M;  3HMY A;  2CDP A;  5LBE A;  4WVM A;  4GKX A;  3V0B A;  2ZEY A;  3JB4 C;  1QJZ A;  1G9B A;  1WW5 A;  1NZC A;  3ZYG A;  2QQN A;  2ZCW A;  3IAP A;  3PTY A;  2OKX A;  2DVF A;  3ZFG C;  1SMV A;  4AED C;  3V0A A;  1UYY A;  5CVR A;  4JGZ C;  1KDK A;  3MW3 A;  2CL2 A;  1FMD 3;  4LUK A;  2RDS A;  1IGO A;  1DYK A;  1RUI 1;  3IDE A;  1XC6 A;  4Q2F A;  4YVW C;  5LRR A;  4E2S A;  3LOB A;  4WM7 B;  3AZX A;  5JSO A;  2R0F A;  2DCT A;  3WNO A;  5BY5 A;  3I2J A;  1WWY A;  5FYM A;  3VBO B;  3J26 N;  3FHA A;  1ZBA 1;  5FAX A;  1QJX 3;  2HWB 3;  2ARE A;  1S0J A;  2EAA A;  1VB2 A;  3OY8 A;  1X50 A;  5C8C A;  1GOF A;  3WQ7 A;  5LCW L;  4BLI A;  3HBK A;  1OLM E;  1RUJ 2;  1I6X A;  5KHG A;  5KR7 A;  3FMG A;  4N9I A;  3JQX A;  3SXW A;  5KXB A;  4HLT A;  4QKF A;  5JSP A;  1OFN A;  4IEU A;  3POB A;  1PO1 3;  4PI2 A;  3VDB A;  4YLZ A;  4D8M A;  4P9X A;  3VBH B;  5IK4 A;  1JZ4 A;  1XBF A;  3ILN A;  1AR6 1;  4XBN A;  1PVC 3;  1Z0H A;  4CP2 A;  4I01 A;  1AR7 1;  5A3T A;  1UAI A;  1W04 A;  2WII B;  1SBE A;  1W2U A;  2HWE 2;  4LLO A;  4Q0P A;  2XBO 3;  3HNY M;  3TNP B;  2B8M A;  5LBF A;  1MS1 A;  3K2O A;  3ZDS A;  5BV6 A;  5LK7 B;  3W59 A;  1C28 A;  3AKT A;  3H3U A;  4KGG A;  4COW A;  5C6C A;  2VZO A;  2ZTN A;  5C70 A;  2UWA A;  2AYH A;  3MF9 A;  5FOB B;  1UPI A;  1JBC A;  5DAW A;  1WKY A;  2HEY F;  2RMU 3;  4XET A;  1W90 A;  3ZLI A;  4Y1V A;  3FN9 A;  2Y6J A;  3WP4 A;  1ZRI A;  2DCK A;  3VBR B;  1ALY A;  4BQX A;  4XCA A;  1AR8 2;  1RMU 2;  1QXR A;  3ZYI B;  2WKK A;  3E1F 1;  1O3S A;  3OB8 A;  2VPV A;  4OZO A;  1D4V B;  4CU6 A;  3POG A;  4HMZ A;  4J1W A;  5DXD A;  2PXJ A;  3ZN5 A;  4AHX A;  3WOG A;  2B46 X;  3H7J A;  3KQ4 B;  5EJZ B;  3ACI A;  4OI0 A;  1T2X A;  2VUL A;  3WCR A;  1BLZ A;  1TMF 3;  3V64 A;  5IVF A;  2WO1 A;  1SDW A;  3NNJ A;  3RI9 A;  5KHI A;  1K45 A;  2BDR A;  2DFB A;  4NE9 A;  4XTP A;  4KWK A;  5DPN A;  1BMV 2;  3WG1 A;  4Q4V 2;  4CP9 A;  5C8W A;  1S0G A;  4L97 A;  2ZKL A;  1RUG 3;  4LBN A;  3AKS A;  3MO4 A;  2PEL A;  4M01 A;  1IPS A;  4BQW A;  1RHI 2;  1VAL A;  1PK6 C;  3QBQ A;  5FZ3 A;  4CU8 A;  4C91 A;  4K9S A;  5FY1 A;  4NHL A;  4NR1 A;  4DMI A;  4XF0 A;  3U14 A;  2RG4 A;  2VVD A;  2WQ8 A;  4QX8 A;  5KHH A;  1YQ5 A;  2Q4S A;  4FAH A;  2WZR 3;  4BWO A;  4FOV A;  5CFD C;  4RFT 0;  2PHL A;  2PQQ A;  2WZ8 A;  4Q4W 3;  1S0D A;  2J7M A;  1FOD 3;  5H9R A;  4OI2 A;  2C24 A;  3MID A;  4ZXE A;  4URT A;  5IW0 A;  4WV8 A;  4NIH A;  1FPN 1;  3VZJ A;  4RQP B;  4ASM B;  5FZL A;  4OCT A;  1ND3 C;  3GBW A;  1HQW A;  2CSG A;  1O59 A;  3BYW A;  4GMP 1;  5L9V A;  2ID4 A;  4FI9 A;  5DZE A;  2VUD A;  4FFG A;  4KWJ A;  3WG2 A;  1D4M 2;  2PMW B;  1WCQ A;  4WZC A;  5KHJ A;  1HN1 A;  1KRI A;  4LTA A;  4UW4 A;  2JG8 A;  2FMY A;  1PGL 2;  1G9D A;  1SLT A;  2W46 A;  3I3D A;  3QCW A;  1TZO A;  2LRP A;  3VBU C;  3K3O A;  2CDO A;  4COZ A;  3N9Q A;  2OPW A;  2A1X A;  3JUU A;  3Q8E A;  3T09 A;  4CDU A;  5IFP A;  1SLA A;  3T4H B;  5ABJ A;  4FTE A;  1D2Q A;  1AR9 2;  3GGL A;  5KXC A;  1KGY A;  4YM2 A;  2QQV A;  1XU2 A;  2Z2S B;  3DV8 A;  4YGD A;  3OGJ A;  1MS0 A;  4DQA A;  2HWD 1;  1XU1 A;  4IV1 C;  3WUD A;  3ZXL A;  4CEW B;  1CAX A;  3MUZ 1;  2F4L A;  1AL2 3;  1OPO A;  4E8C A;  1MEC 2;  1DCS A;  1JU3 A;  1X7N A;  2VE1 A;  4CCE A;  5JSR A;  3NNM A;  2AR6 A;  3I59 B;  4JTN A;  4R4X A;  5CKM A;  5A7P A;  1NXD 1;  1XE0 A;  1N3O A;  3I97 A;  4WZF A;  3HNB M;  4M0H A;  5CEH A;  4BIS A;  2CHH A;  2W1U A;  3DPR C;  5J96 B;  1UD1 A;  3HT2 A;  4EE2 A;  1AJO A;  4X8N A;  5D1I A;  5FMO S;  3ZMO A;  5J1X A;  2XJV A;  4B29 A;  3JXS A;  2ET7 A;  4DNY A;  2KXL A;  4DFS A;  3IAQ A;  3H3Z A;  3T2P A;  4D94 A;  5BNP A;  2C6S A;  2BZD A;  5FZA A;  3LSD A;  1PM7 A;  5FZH A;  5LRS A;  1G9C A;  1W03 A;  1RJ7 A;  3OGS A;  4YW2 A;  3I3M A;  1W05 A;  2K46 A;  3BU0 A;  1OA2 A;  4Q1P A;  5DG2 A;  2WA3 A;  1RUN A;  2KA3 A;  2NQY A;  5K0U A;  3ZYF A;  4MYE A;  3MIB A;  2XDV A;  1W39 A;  1QJE A;  4LO8 A;  4YW5 A;  1W0N A;  3T30 A;  1O5U A;  2FMD A;  1XXN A;  1GZ9 A;  1JYN A;  3NNL A;  1S0F A;  5AVA A;  1ZBE 2;  5A3U A;  4K1Y A;  1N3P A;  2R07 3;  5C4W C;  4CDX B;  4WM8 B;  4DOU A;  3RYP A;  2PA7 A;  3BGA A;  1G7Y A;  1ST8 A;  3SCF A;  5FUP A;  4JV4 A;  1UXX X;  2J1R A;  3EQE A;  3PU8 A;  3LAG A;  5F6L B;  3ILF A;  4LHL A;  1L7L A;  1GWL A;  1J84 A;  3DGT A;  1IZ3 A;  1NLS A;  2R6Q A;  4QPG B;  2Y34 A;  2ZAH A;  3S30 A;  4GB3 3;  1IG3 A;  3LDB A;  5AC9 1;  1GUI A;  5CKQ A;  1KS5 A;  2WLP A;  2YBP A;  3LPF A;  4CPB D;  2LW8 A;  3GZT B;  2BFU L;  1WBF A;  3VZN A;  1HRV 3;  1OUS A;  3WEZ A;  3C7O A;  3O14 A;  1WW6 A;  5BNQ A;  3SHR A;  4YGB A;  4QX7 A;  1K5M A;  1UCX A;  1SQ4 A;  4BQ2 A;  4O65 A;  3GZA A;  4JQR A;  4X6Q B;  5DZF A;  2WN3 A;  2GAU A;  4IND A;  4AFD A;  5A7W B;  3RSJ A;  4D7T A;  5FUN A;  1CJD A;  1V6K A;  3I3B A;  5FK7 A;  2QQM A;  1LOA A;  3LEI A;  2VCC A;  5CA6 A;  3R6S A;  1NCR C;  1CAV A;  3HIF A;  3ATG A;  5F7U A;  4QQH A;  3N7K A;  2VTF A;  5FPB A;  1SBF A;  3CU7 A;  1D0G A;  3IN9 A;  4AYU A;  5C3P A;  4NID A;  4FSJ A;  4RGK A;  2V09 A;  1SAC A;  1MPX A;  1Y7B A;  3PUA A;  5B2G B;  4Y26 A;  5C9A A;  3LA3 A;  4QDS A;  3HEI A;  3IPV B;  3KM5 A;  2W1S A;  2HJI A;  2E7T A;  3J8F 1;  2FDG A;  3PVE A;  3WIN E;  3NNG A;  3ZXD A;  1QJX 2;  2HWB 2;  4Z2A A;  4XFG A;  2VOV A;  4UWD A;  5LA1 A;  2WAA A;  2ZGQ A;  5IJR A;  4HN0 A;  2WFF 3;  2XML A;  1EUU A;  1SFP A;  3LSE A;  4R9B A;  4DIQ A;  3QOP A;  1IKQ A;  3UT0 A;  2VOK A;  2ZX0 A;  3HJR A;  4Q8K A;  1PO1 2;  4CRQ A;  2ZA9 A;  1UY0 A;  5FXW A;  1W8N A;  5J3U A;  5F3G A;  2DUR A;  3KV6 A;  4W8J A;  1NCQ B;  3ZSL A;  1CR7 A;  4Q26 A;  3MUY 1;  4AE2 A;  2P34 A;  2YC4 A;  4XCB A;  4B1M A;  4N43 B;  3OYW B;  1GYK A;  5ANQ A;  4XIO A;  4E8D A;  3C8X A;  2QBX A;  1R09 3;  3NL1 A;  4NIA A;  3PUR A;  2VXR A;  3A23 A;  3I2O A;  3PL0 A;  1BEV 2;  5FO7 B;  2VW2 A;  2JD4 A;  1YWK A;  4CUB A;  1YJK A;  1TVG A;  2JDY A;  2FDF A;  1EAH 3;  1KFU L;  1MS8 A;  3A0K A;  3M3C A;  4KWL A;  3CHX A;  1S4C A;  2SLI A;  2R1B A;  5FFO C;  1BBT 3;  4IGP A;  4MZU A;  4AGR A;  4QPW A;  1Z78 A;  4CUG A;  2VZR A;  1RGS A;  2YMZ A;  5L36 A;  4OQ8 A;  3ZFF A;  1QEX A;  1YRZ A;  2RM2 2;  4UW6 A;  2ADE A;  3OF1 A;  3K46 A;  2FCU A;  2WSV A;  3BB6 A;  1O4T A;  1RUJ 1;  4AI9 A;  2WAB A;  4HN1 A;  3B94 A;  1PNG A;  1U5I A;  1V6L A;  4Q0U A;  3RMY A;  1UZV A;  1H8T C;  4L9B A;  3WNP A;  2LTN A;  2C4X A;  3MPB A;  3GZU C;  2YC2 A;  3LEM A;  1I3H A;  4XF1 A;  1POV 1;  4JQT A;  3TEY A;  4LA2 A;  4M3C E;  4AHZ A;  5A32 A;  1ND2 C;  4I0W B;  5FLH A;  1LEC A;  4LKE A;  1DIW A;  3DCQ A;  1J1L A;  1W3X A;  1C8M 3;  1TME 1;  1ULO A;  3OG2 A;  1TMF 2;  4A7Z A;  2JDN A;  2RVA A;  5FYZ A;  4MSV A;  5FYT A;  1YQ6 A;  1LHV A;  1QJY 2;  4HSJ A;  4JRL A;  3BKZ A;  2A6Y A;  4BME A;  5FYI A;  3OBR A;  4AI0 A;  4BJ0 A;  4QQP A;  3TB0 A;  3VDA A;  4K6B A;  2VOX A;  3PVO A;  5I0U A;  1NY7 1;  5C4W A;  2Q1F A;  5FMO L;  3LIH A;  3J9S A;  1ULE A;  3BVC A;  4HL0 A;  5FWE A;  4ASL A;  2QVS B;  1IOA A;  1AR8 1;  1OT5 A;  3FBM A;  4K8R B;  1RUF 3;  1UOJ A;  2WZR 2;  4YRD A;  2A71 A;  5FYH A;  3MIE A;  5A7Q A;  1POQ A;  3K4D A;  4E9K A;  2ZXQ A;  2W92 A;  3N7J A;  5H9P A;  2HYK A;  2VTX J;  5CIR A;  4L99 A;  1CN1 A;  4PDW C;  3ZYB A;  5EIY B;  1RXG A;  1HXS 2;  1Q43 A;  1S1A A;  1ACC A;  2OT7 A;  5DDJ 3;  3CIH A;  1WMF A;  3LE0 A;  2ZHN A;  1OD3 A;  2BP6 A;  4B3N A;  4ES8 A;  2FZ2 A;  1S2E A;  5EQU A;  3CJI C;  3AXD A;  1BMV 1;  2VTX A;  5LEK A;  4QGM A;  3AFK A;  3CQO A;  5L7O B;  2D3P A;  2EAL A;  2HWC 1;  1WLT A;  2JX9 A;  1R1A 2;  3WQ0 A;  5JAX A;  5KC5 A;  1H2N A;  4O61 A;  4NRO A;  2PHF A;  2VBB A;  4EZH A;  1URX A;  1HB1 A;  1ODN A;  2FHR A;  1OHF A;  3FLR A;  1AHS A;  1DBN A;  3PLQ A;  4QHB A;  5A1F A;  1FYU A;  2FCV A;  2WNU A;  1ULG A;  1N1Y A;  4Y22 B;  5KC6 A;  3VBF A;  2ZGN A;  1REE A;  1UU5 A;  1Y43 B;  4YGE A;  5BNO B;  4CDQ A;  1Q8Q A;  2RS1 1;  1WW7 A;  4UYB A;  3AC0 A;  3ON7 A;  5F5C A;  2AEY A;  5LY1 A;  4O9G A;  4NRP A;  4DPN A;  2X53 S;  3GYD A;  2VEC A;  3VKN A;  4RHV 2;  5JWP A;  3Q8B A;  4AI1 A;  2OYZ A;  4QHZ A;  3CZJ A;  1AL2 2;  4YVS C;  4XUO A;  2EXK A;  1X8M A;  3OUH A;  4I2O A;  3LGR A;  4ZU4 A;  3AP5 A;  3WF4 A;  5GLT A;  3ZIW A;  1YQ8 A;  1FNY A;  2CTV A;  2DVB A;  2I07 B;  2W91 A;  2WT1 A;  3ETP A;  4NWV A;  1GQG A;  1UOB A;  4YM1 A;  3GCX A;  5CAD A;  2B5H A;  1EUT A;  4YZ4 A;  1RUJ 3;  4XJA A;  5JPM B;  1ZRE A;  3AKQ A;  1H2L A;  1LU1 A;  4ATE A;  5EPA A;  1DQ6 A;  5D21 A;  1GZW B;  4FPH A;  2PN5 A;  1W6O B;  4NAO A;  2DU0 A;  1MQT B;  2VNV A;  2VZQ A;  3ROU A;  4F83 A;  4BH9 A;  1HRI 2;  1AR9 1;  1JW6 A;  3MDP A;  2WC2 A;  4HVO A;  4B7E A;  3VBO A;  1AYM 1;  2D5F A;  3T1M A;  2HWE 3;  4BA6 A;  1H6Y A;  3BCW A;  1VBB 3;  2QDN A;  3AYA A;  2WNV C;  2JDK A;  3Q8C A;  4KG0 A;  4QM9 A;  3WY6 A;  4AEJ A;  4XJU A;  3WW1 A;  4DRV A;  1CGP A;  1WLW A;  5FZ1 A;  3VDD B;  2B39 A;  4WVZ A;  4CXY A;  5LW9 A;  2GN7 A;  3VBH A;  1YJL A;  4XDO A;  3N7L A;  1GOH A;  5F2S A;  5JZG B;  3BIE A;  3I3Q A;  3SC7 X;  1NA1 C;  2P3I A;  1ND2 A;  1XNK A;  4E4H A;  1BK1 A;  1UF2 C;  3AK0 A;  1REF A;  1VBC 3;  1RMU 3;  4GZ9 A;  2BWC A;  4XUP A;  1W9Y A;  5G04 L;  5F3C A;  3GHN A;  4PBO A;  3KMH A;  4IEZ A;  4QPI B;  4UXA A;  5F1R A;  1XE7 A;  3Q9O A;  4FTS A;  1NZI A;  1QF3 A;  1ULC A;  5JOZ A;  1JZ3 A;  3RZM A;  4S2G A;  5D8A B;  4GJY A;  2ARC A;  1SPP B;  4KH9 A;  2B42 B;  1OUR A;  1CIY A;  3MYX A;  4KNC A;  2GC2 A;  1YLL A;  3U75 A;  5A33 B;  4QD2 A;  1LUL A;  3BPZ A;  1HRV 2;  4XDP A;  4IDZ A;  3VBR A;  4CU7 A;  4FPF A;  1K42 A;  4Q4V 3;  3IDA A;  3I7D A;  1V6O A;  2WR9 A;  4QB2 A;  1YFU A;  5IAV A;  4LJH A;  3SQO A;  1GZT A;  1KS4 A;  3WZ1 A;  5JIU A;  3A0N A;  5I0R A;  1WMD A;  1GV9 A;  1ZBE 1;  2C5D A;  1GWM A;  5EXO A;  1RHI 3;  3ENR A;  3WNX A;  2OXB A;  3A21 A;  4HOO A;  1OFS A;  1D7P M;  4Y4R A;  5J48 A;  5T5J A;  2CWM A;  1XYO A;  1OKO A;  3C7F A;  3B01 A;  4BCU A;  1YQC A;  3WLU A;  1LHN A;  4PHZ A;  3D5O A;  2C0Z A;  2BVV A;  1C1F A;  1W6P A;  1C4R A;  2W3J A;  2ZGT A;  3FL7 A;  5JI7 A;  1D2S A;  4M4R A;  2BTV C;  2ZZQ A;  4TXW A;  1QH7 A;  3ZSM A;  1YI7 A;  2CAU A;  4B4P A;  4A44 A;  4J25 A;  5GZF A;  4YZ5 A;  3I2I A;  4AZZ A;  3S5Q A;  1UIK A;  5DUV A;  2EA7 A;  3BPS A;  4W4Z A;  5DMY A;  5IVC A;  3MV0 1;  1UWW A;  4K21 A;  5FZF A;  3MZH A;  3RG0 A;  1D4M 3;  2QQI A;  3N4M A;  2R49 A;  5FPV A;  4NHM A;  4LO4 B;  3ZDV A;  1SEF A;  4LNV A;  4B4Q A;  3UGG A;  1ZZ6 A;  2RR1 3;  4FXG B;  2IFR A;  4BPZ A;  4JDO A;  4LBQ D;  2UY9 A;  2EXH A;  2ADD A;  2DDU A;  4GXL A;  4F8A A;  1R09 2;  3W5M A;  4RQP A;  1FMD 1;  2UWB A;  3NJY A;  4ARY A;  4YVS A;  4IUG A;  3FX3 A;  4JVA A;  3RQ0 A;  1W2N A;  3VD4 A;  1OD5 A;  1C1L A;  1BBT 2;  2JEN A;  2XJU A;  3B69 A;  3CNA A;  4A6O A;  1PNF A;  1SLI A;  3AP9 A;  4GH4 B;  4JHT A;  2QQW A;  4CCL A;  2BVB A;  1NKG A;  1QJX 1;  2HWB 1;  4UI9 L;  1YUD A;  3CL1 A;  1NLR A;  3LD8 A;  4AR2 A;  1MEC 3;  4CP0 A;  4WBB A;  3HOB A;  1LHO A;  2V5D A;  3FUO A;  2E31 A;  1PO1 1;  2A73 B;  2GC3 A;  2BNO A;  4I09 A;  1M06 G;  2OZJ A;  1V0A A;  3FWE A;  5C3R A;  2VZP A;  4MLO A;  1RJ8 A;  1DGR N;  1PVC 1;  2D6N A;  2FDK A;  1IS4 A;  3T0A A;  4XJZ A;  1UIJ A;  2VUA A;  1LHW A;  2DF7 A;  2OZ6 A;  2BGC A;  4HVQ A;  3T0D A;  5F3E A;  4CEW A;  4PCR A;  4AFA A;  1MZ5 A;  2ZGM A;  2Q5T A;  2XBO 1;  3OTF A;  5I8T A;  2VG9 A;  4LHN A;  2G19 A;  1CAU B;  2RS3 3;  4YG0 A;  5LB6 A;  3JBG 3;  3K77 A;  3MV1 1;  2HLE A;  4TLG A;  3S5A A;  1GNY A;  1C57 A;  2EIE A;  1CQ9 A;  5C3Q A;  4UFM A;  3LIG A;  3QAC A;  2DVA A;  3CJX A;  3J7H A;  3RJ2 X;  1NUK A;  1K3I A;  2FQP A;  3E5X A;  3I59 A;  4AQ6 A;  2NYY A;  4EN9 B;  1LEN A;  4QQ2 A;  4QT6 A;  2RMU 1;  5FMB A;  5LA2 A;  4KQ7 A;  2P5B A;  2VUC A;  1IHM A;  4YYO A;  4XZP A;  4XUT A;  1ZRC A;  4XMI A;  5FZD A;  4ITC A;  1E5I A;  3U11 A;  4CTE A;  4QXH A;  2WNE A;  1RUF 2;  1SLB A;  1V6N A;  5JR7 B;  2W94 A;  4GD4 A;  4BQ4 A;  1IS6 A;  1VAV A;  2P1B A;  1ZBE 3;  3ZSJ A;  2R06 3;  1CD3 G;  2WDB A;  1ZNP A;  2W1W A;  3MW4 A;  2A3X A;  2V73 A;  5F6K A;  3W21 A;  4LR4 A;  3P6B A;  4P9G A;  3BI3 A;  2ZX3 A;  4JGY B;  2RJK A;  2VZT A;  1TMF 1;  5FXV A;  3CLP A;  3CKH A;  4QB1 A;  4IEV A;  3MEP A;  1O7F A;  1OA3 A;  5FYV A;  1PZ7 A;  4XC9 A;  5FZO B;  3MLK A;  2E6V A;  1NXM A;  4XXP A;  3NV1 A;  4XXA A;  1RUG 1;  5I8S A;  3AMQ A;  1LB2 A;  4MGT A;  4CDX A;  4WM8 A;  4MET A;  2D6L X;  3M1H A;  1OMI A;  3I2F A;  4PLN A;  5FZ8 A;  2UU8 A;  4G9S B;  3PUQ A;  4OFG A;  3TN9 2;  4D7S A;  4LIU A;  4ISQ A;  3AFG A;  3OEB A;  5A6X A;  2IUW A;  2R7E B;  4EJR A;  4LEJ A;  3ZM8 A;  1F35 A;  2WZR 1;  4RA0 A;  2JDH A;  4AW7 A;  4BE3 A;  1CZT A;  2JG8 C;  2NMO A;  5FCC A;  4LOT A;  2ZX4 A;  2OW4 A;  4P5H A;  4Q4W 1;  4XAB A;  4Y5Z 0;  1FOD 1;  3U07 A;  3SCH A;  1B09 A;  2EVX A;  4DUX A;  2VBD A;  4ZON A;  4NPR A;  4CDU C;  3WR0 A;  3ZIX A;  2XQX A;  5ABJ C;  3AKR A;  3HQU A;  3ZVX A;  4RS5 B;  4UAP A;  2A5Z A;  5DQ0 A;  2ZS6 B;  1GKB A;  1OVS A;  2GZW A;  2IXI A;  4UFL A;  1OOP B;  2ZAB A;  3IDC B;  1IG0 A;  4LIV A;  4EWA A;  5A7W A;  1WGP A;  2NM1 A;  2D6K A;  4YG3 A;  4XJ9 A;  3NAP B;  3AJY A;  4NJ4 A;  5T5L A;  5FWJ A;  1OSG A;  5J09 A;  1HB4 A;  3ZFE C;  4CDW B;  2XUM A;  1VAM A;  3RVH A;  1A78 A;  3D4K A;  3IPV A;  4TYS A;  3JD7 2;  2DUQ A;  2VCB A;  3ZN4 A;  3T2Q A;  5I0T A;  5A6Z A;  2D93 A;  2VW1 A;  3KGZ A;  4ZU7 A;  1VBB 2;  1BHG A;  1S0C A;  4ZHN A;  2DWR A;  1Y3T A;  5BNP C;  5CIS A;  2Z79 A;  4NOT A;  1AL2 1;  1BEV 3;  1GBG A;  3WDY A;  1SHW B;  4N53 B;  5FZM A;  5C71 A;  1CWP A;  1UOF A;  1P8J A;  2B45 X;  4XUN A;  4YZ1 A;  4QX1 A;  1COV 3;  1C5I A;  3ZN6 B;  1F5J A;  4LO6 B;  1SG3 A;  1RED A;  1NCQ A;  1RUC 2;  2RM2 3;  4Y24 A;  1UX7 A;  2A6X A;  2NMN A;  1VAK A;  5K0U C;  2YFZ A;  1SBD A;  1LHU A;  2BFU S;  2BU9 A;  1PMJ X;  1VBC 2;  3EMR A;  1I5P A;  3THD A;  3UV9 A;  1RUO A;  1QXJ A;  3SKV A;  1OQE A;  4JDM A;  4YNI A;  5CG9 A;  3NQH A;  1AVB A;  5FTT C;  4CXW A;  5ISL A;  3VD5 A;  2A3Y A;  1WA6 X;  5FBZ A;  3O1P A;  1H4H A;  3ZOI A;  1F8V A;  2BGP A;  2WWS A;  2W9X A;  2VU9 A;  2W95 A;  3MIH A;  3VV1 A;  4BK4 A;  1AXY A;  4RR3 B;  5FY9 A;  4C90 A;  1QNW A;  2UUR A;  3ZYJ B;  4IEP A;  1CIW A;  5A7N A;  1RVF 2;  2EIB A;  2DCZ A;  4CUC A;  4BB3 A;  3POY A;  2DFC A;  5IK7 A;  2WO2 A;  2QQL A;  2Q1M A;  4FPJ A;  2EF6 A;  3EO6 A;  4Y1Y A;  3U78 A;  1QJY 3;  3KT1 A;  3RGB A;  2HH9 A;  4LE4 A;  2X5I B;  3MBW A;  3D0S A;  4HVR A;  5A6Q A;  3LDR A;  2WO3 A;  1NQJ A;  4AVT A;  1BKZ A;  1UMI A;  1NE6 A;  4BU2 A;  2R07 1;  1OA4 A;  1UZY A;  2BQP A;  1FI2 A;  2E33 A;  4V2W A;  2WZP P;  3OPW A;  3HR9 A;  2FD8 A;  1J58 A;  1MS9 A;  1K5M C;  2Y6F A;  3TEX A;  3WHU A;  1F5F A;  4QGN A;  5EJ3 A;  1GQP A;  4A7Y A;  2A3W A;  3ECQ A;  4KG8 A;  2D97 A;  4HPK B;  1LOE A;  1QGL A;  4MGI E;  1YYN A;  2JB8 A;  1ULF A;  4Z92 B;  1Y9Q A;  2XQR A;  3AP7 A;  4O7X A;  2WFP A;  5A3W A;  2IXC A;  3WNL A;  4AVC A;  2FDJ A;  5FR3 A;  5L9R A;  3TRS B;  2ORX A;  4TLF A;  2ATF A;  1QDC A;  5F9T A;  2CGP A;  1HXS 3;  3L2Y A;  4GB3 1;  2ZEX A;  4DIN B;  5K8S A;  3O1R A;  1JYC A;  1RTV A;  1S55 A;  4EN7 B;  4YWA A;  4PQ9 A;  5C9A C;  3RZL A;  1HRV 1;  4BK5 A;  3NV4 A;  1KEX A;  2P6C A;  1CES A;  3I3E A;  4BQ3 A;  1UY4 A;  3N36 A;  2ENR A;  2XJT A;  1LKN A;  3VHN A;  3VD9 A;  1VBA 2;  1XRU A;  1QIQ A;  1R1A 3;  2BOI A;  2BPA 2;  1GQH A;  1S0I A;  2R0H A;  3LWC A;  4PLO A;  4XE9 A;  3TYJ A;  2IWG B;  4AG4 A;  3CBN A;  4LKS A;  2RR1 2;  3OBA A;  3CDZ B;  1BYH A;  1KIT A;  1OF3 A;  4XDQ A;  2VVE A;  4YW4 A;  4QU2 A;  1ZA7 A;  5TSW A;  3I2H A;  4CPB A;  3EYP A;  4XAE A;  1Q3E A;  3LKJ A;  2XJQ A;  3LDK A;  1W8Z A;  4PQQ A;  3A22 A;  3AMP A;  2IXL A;  1W6Q A;  3HWJ A;  1FT9 A;  1XSR A;  3O1S A;  2GND A;  4ISR A;  1ZRD A;  4G4F A;  4ATF A;  1GIC A;  1VR3 A;  1W8W A;  3ACH A;  1ASJ 2;  3VZO A;  5L7O A;  3WXP A;  5JXJ A;  2NN8 A;  4I0A A;  3TEW A;  2A6V A;  3LB9 A;  3VHR A;  2BNN A;  3AL5 A;  1CZS A;  2VBP A;  4PIZ A;  4RHV 3;  2ZKN A;  3WDU A;  1Z7S 3;  2QQJ A;  2WFF 1;  3RYR A;  5IYY A;  4IEO A;  2MNG A;  3KVB A;  3K3N A;  4J6G A;  4ZPI A;  1W8F A;  4Y22 A;  4Q4Y 2;  2RE9 A;  3ZFE A;  3ZFF C;  4AFB A;  5BNO A;  2GAL A;  2XB6 C;  4L0P A;  5FZB A;  1LGB A;  2W68 A;  3IB3 A;  4D0Q A;  4QX5 A;  5FZ0 A;  2AAC A;  4OI1 A;  2P6H A;  2JEC A;  3MLL A;  3UKV A;  2ZGS A;  3ZR5 A;  1U0A A;  5F39 A;  1R09 1;  2JG9 B;  3ZXE A;  2RS3 2;  1XB9 A;  4C1W A;  3JBG 2;  4L11 A;  4DY5 A;  2DUP A;  1X9P A;  4Y1Z A;  3EJK A;  5FYC A;  4NRQ A;  3FZ3 A;  1EAH 1;  1HRI 3;  4IXL A;  3H0O A;  4I3P A;  3SH5 A;  1BBT 1;  4S2D A;  3U10 A;  1WCU A;  1JZ2 A;  4LQR A;  2ZOE B;  1JZ6 A;  5BNN B;  4R52 A;  2D3S A;  2J1S A;  3R4D B;  3WNK A;  4JX0 A;  1X9T A;  3ZX7 A;  5GJ6 A;  3NJV A;  3H42 B;  1W8T A;  1ZZ8 A;  4R9C A;  4XQD A;  3S7I A;  2XWJ B;  5I93 A;  1GZW A;  4OQ9 A;  4NIG A;  1T6B X;  1MQT A;  1O4Y A;  1QY4 A;  1Y9G A;  4BXF A;  1CPN A;  4Z07 A;  4FPK A;  2W08 A;  1VRH 2;  1YXW A;  2OX0 A;  2YHJ A;  2R06 2;  1W0O A;  2XXZ A;  3GHM A;  4FPG A;  5FY4 A;  4HK8 A;  4IE4 A;  4FFH A;  5LA9 A;  3DYM A;  3WW2 A;  2VAU A;  4IET A;  1YFY A;  3AYC A;  1FX5 A;  1K5J A;  2H0V A;  1C8M 1;  1QJU 2;  2XON A;  2Z69 A;  3ZKU A;  2DVG A;  2BW8 A;  3VBS B;  3BOD A;  4LKD A;  3OGG A;  2ET1 A;  3VDD A;  1WUV A;  2RS5 3;  4EN6 B;  3WG3 A;  4V1P A;  1H8V A;  3MHZ A;  4UW5 A;  2W47 A;  3PUI A;  5FQ0 B;  3BU7 A;  4P9Y A;  2YU2 A;  2E32 A;  1UY3 A;  1UY2 A;  5CBL A;  4NHK A;  4BQ5 A;  4P9W A;  4Y5S A;  5BPX A;  1HN0 A;  5JLV A;  5A3M A;  1VBD 3;  1HQL A;  2JE8 A;  2JE9 A;  3HQX A;  2IC1 A;  1PGW 1;  4AVS A;  1RUF 1;  1UOG A;  4QPI A;  3WW4 A;  1PO2 2;  4XMA A;  4MO3 M;  3T4V A;  2VMC A;  1I1E A;  3GAL A;  2ZGL A;  1GNH A;  5D8A A;  4WVM B;  1SPP A;  2I74 A;  5JIA A;  1H1I A;  5A80 A;  1WD3 A;  3RDI A;  4HSL A;  1BVV A;  4Y5T A;  4E4D X;  2WNU C;  4GAL A;  1MS3 A;  1HDK A;  2VUJ A;  4FP2 A;  2Q8C A;  3DKQ A;  5DAB A;  5A33 A;  1KJR A;  3VBF C;  1WME A;  5DDJ 1;  3H8O A;  3SLI A;  5E8A A;  2Y60 A;  4UW3 A;  4CDQ C;  2XWB B;  1C5H A;  2CGN A;  3D0J A;  3V65 A;  2BOJ A;  2P3J A;  1MVQ A;  3KCX A;  4OUM A;  5C3S A;  5I91 A;  5CFC B;  1NT0 A;  2CYF A;  2MEV 3;  1N1T A;  1UKR A;  1RUD 2;  1HLC A;  4AGG A;  4SBV A;  3S7E A;  5FY0 A;  2ZHL A;  1HX6 A;  2JEM A;  4HFS A;  4Y1U A;  5C8C B;  1X82 A;  5IK5 A;  4JAA A;  1IPJ A;  1LU2 A;  3SMH A;  4XFA A;  5IFT A;  3O1O A;  4JTO A;  4WVV A;  3KCC A;  1US2 A;  3SH3 A;  1UN1 A;  4Q27 A;  2MPF A;  3I2K A;  5DG1 A;  4K3U A;  3L9J T;  1H0B A;  3E5U A;  5FLJ A;  1XJA A;  3A7Q A;  5F3I A;  4KU7 A;  1CAW B;  1O3R A;  3OEA A;  4AHW A;  2GNB A;  1FNZ A;  2HEW F;  1W9T A;  2OPK A;  3BUC A;  1AXK A;  1VMF A;  2WWU A;  4YAR A;  1I9R A;  1UXZ A;  2D6O X;  4DXZ A;  2XJP A;  4WM7 C;  1XNB A;  3VKM A;  2O14 A;  3POS A;  1KFX L;  5GZD A;  4COU A;  3VBO C;  1HB2 A;  1RUH 2;  3W58 A;  4CCC A;  1K12 A;  3ZMN A;  1ZZ9 A;  1COV 2;  5GZC A;  1DQ5 A;  5A7O A;  1WCD J;  5JR2 A;  1HIX A;  4IV3 B;  3D82 A;  2JKX A;  3P5B A;  2FDI A;  5A70 A;  2PHR A;  5CNA A;  4I3G A;  3TEZ A;  1W6M B;  2QNK A;  5FRE A;  3M3Q A;  5GZE A;  2ZGP A;  1N1S A;  3VN4 A;  2BWA A;  4Q8L A;  3VBH C;  1ENQ A;  3E6D A;  1DQ4 A;  5K4L A;  1OUX A;  1YFX A;  2G9Z A;  5IVV A;  4BQY A;  2GC1 A;  2PHW A;  4D6R A;  3KHB A;  2XJS A;  2WLQ A;  4TZD A;  5CU1 A;  1DQ1 A;  2HWE 1;  2GDF A;  1QQP 3;  1KDM A;  3ZR6 A;  4Q4X 2;  3N9P A;  4IEW A;  4W65 A;  1VBB 1;  3KGL A;  4IEY A;  4LIT A;  3RYK A;  4HBN A;  4DRR A;  2Y6L A;  5LA0 A;  3Q8F A;  4GIQ A;  4NO4 A;  3N7M A;  3IM0 A;  2BJS A;  2ZX2 A;  4W6W A;  5E88 A;  5GZG A;  2W5F A;  2VZ1 A;  4I30 A;  4OHW A;  3FHQ A;  1EV1 3;  4FOQ A;  3H50 A;  2EIC A;  3VBR C;  2K0G A;  3ACG A;  5IVY A;  4DEQ A;  3WT3 A;  2IXH A;  1MZ6 A;  3IIA A;  1ZRR A;  1VBC 1;  1RMU 1;  2AUY A;  1CAU A;  4YZ2 A;  3K4A A;  5KBF A;  3URF A;  1KQR A;  3PHM A;  5FYY A;  5FZK A;  4FPE A;  1ZRF A;  1ZA4 A;  1V6J A;  3NO8 A;  5EZW A;  5BXX A;  3MLJ A;  1EP0 A;  3ACL A;  5IWF A;  1QXP A;  3S0M A;  1HKD A;  4MG2 A;  1BQP A;  3MIG A;  5IT6 A;  1RUE 2;  2R04 2;  2WRA A;  1YHF A;  1FAY A;  4IW3 A;  4Q5O A;  3WD5 A;  4CEY B;  4DB5 A;  5K7P A;  2CV6 A;  2NLR A;  2CWS A;  2PAK A;  2RJL A;  4Q4V 1;  3USU B;  1AYN 3;  4M3C F;  3RRD A;  1WLC A;  2RV9 A;  4Q0V A;  3BTY A;  5CG8 A;  1OKQ A;  1OF4 A;  3NV2 A;  3ZKY A;  1QH6 A;  4CCM A;  4HZF A;  3KHC A;  2ERF A;  1DLC A;  1RHI 1;  3E97 A;  2AC1 A;  1BVP 1;  4ASK A;  4BXS V;  1SDD B;  2J1T A;  3AMN A;  5J7M A;  4QXB A;  1GNZ A;  3TN9 3;  5FPX A;  5J37 A;  3ZFG B;  2IFW A;  4AED B;  4UF0 B;  4EQV A;  4JGZ B;  3WDT A;  1RUI 2;  2KR2 A;  1APN A;  1KD7 A;  2WAO A;  4OI4 A;  1IS5 A;  1V70 A;  2XKP A;  1PHM A;  4YG6 A;  4YVW B;  5FZO A;  2F17 A;  4IEQ A;  1PMI A;  2JIC A;  3HBZ A;  2OS2 A;  4H3W A;  3AM2 A;  3NNF A;  4OVE A;  2OUH A;  1X36 A;  4R9D A;  2V72 A;  3LEG A;  3W20 A;  4RQP C;  2JKB A;  3M3O A;  4HKW A;  1O8P A;  1Z7S 2;  2K9Z A;  4K7J A;  1XYP A;  4DUV A;  2WS9 3;  3PUH A;  4GJZ A;  2W52 A;  4P00 B;  1JN2 P;  4YFW A;  2XJR A;  1RIN A;  3O0W A;  1D4M 1;  3W9A A;  4MGK E;  2W0X A;  4XFF A;  4N9H A;  3ABZ A;  1AR6 2;  1GWK A;  2WZE A;  4E27 A;  2F6B A;  4GQ7 A;  3SH4 A;  5HCA A;  2RR1 1;  1PGL 1;  1AR7 2;  5FDB A;  3OCP A;  4HKL A;  2OUJ A;  2V4V A;  4KU8 A;  3TOJ A;  3UES A;  3UET A;  5K9Y A;  2LS6 A;  2XL7 A;  4AAP A;  1O3T A;  5FZ9 A;  5LBB A;  2ZGR A;  1OXC A;  1HV1 A;  2J1A A;  3MIC A;  5DAV A;  5FP8 A;  4IE0 A;  4XF3 A;  4HG6 B;  4LOS A;  5HXV A;  1G9A A;  1JYI A;  4WM7 A;  3K48 A;  2XGX A;  3JD7 3;  2XH6 A;  1B35 B;  1YC6 1;  2HWF 3;  3THP A;  2JDA A;  1ENX A;  1OOP A;  1UPS A;  5EYX A;  4CEW C;  2DTY A;  1J3R A;  5C5U A;  2Q30 A;  4BZ4 A;  2AGS A;  4QKN A;  4XAC A;  4YFZ A;  1MEC 1;  4BIF A;  2ZX1 A;  5AVP A;  4CDW A;  1NG0 A;  3ITQ A;  1DF0 A;  4TSV A;  4AVB A;  4FCA A;  5C3O A;  3TAY A;  4YZ3 A;  1RUC 3;  2WA4 A;  5GLW A;  5A3N A;  3GDB A;  3PJQ A;  3WCS A;  4Q29 A;  2TUN A;  2C1F A;  4AHY A;  3ZSK A;  2IXJ A;  1JU4 A;  2DV9 A;  2CY6 A;  1HB3 A;  4A45 A;  2D98 A;  2RS3 1;  3UGH A;  3JBG 1;  5HBA A;  1W99 A;  2YXS A;  4LHS A;  5FMC A;  4N53 A;  4CP1 A;  2RS5 2;  1OC1 A;  2VNO A;  3KV4 A;  2WNO A;  2EXI A;  3ZXK A;  2EIG A;  3ZN6 A;  1W9F A;  3WW3 A;  5KHK A;  5AFE A;  4AVV A;  1BCX A;  1RVF 3;  3TWI A;  1UX6 A;  1OBN A;  2VM9 A;  1W2O A;  3FJS A;  4RN5 A;  2Y64 A;  1PK6 B;  1VBD 2;  2GP3 A;  4P02 B;  4Y20 B;  3B93 A;  3H1M A;  4RFR B;  2VVF A;  5FOJ B;  2YV8 A;  2RDR A;  4IE6 A;  3OBT A;  1O6U A;  3VZL A;  3DXT A;  4WM8 C;  4CDX C;  1A6C A;  2LAL A;  1DFQ A;  4Z1V A;  4RR3 A;  2R06 1;  5CFD B;  5JVV A;  5HXM A;  1LR5 A;  4LHK A;  5HV0 A;  3H1W A;  1YO8 A;  4IE7 A;  1LRH A;  4URA A;  1FPN 2;  5LAS A;  4MHU A;  3R4S A;  3LQC A;  4NII A;  1BK0 A;  1I5Z A;  3KD4 A;  1ND3 B;  2EID A;  1Q8P A;  3AYD A;  3GF6 A;  5DUW A;  4YW1 A;  2YB7 A;  2X5I A;  4QPG C;  1H4G A;  2MEV 2;  1XNC A;  3POE A;  4FOW A;  3RZZ A;  1CX1 A;  5T3N A;  1TNR A;  3VZM A;  4AI3 A;  5EJ1 B;  2XG3 A;  3VKL A;  4GKY A;  4S2F A;  3KQR A;  5B4X A;  4LXL A;  1V6M A;  1LNS A;  5G05 L;  2ZGK A;  3I54 A;  4PIX A;  3VBU B;  3ZYR A;  4DZG A;  4HPK A;  1VBA 3;  1RYY A;  3OUJ A;  2D7F A;  1N1V A;  3G6J B;  1PO2 1;  2A6W A;  3GCW A;  3WF1 A;  1DGW X;  3PMS A;  1WCK A;  5FZE A;  2W39 A;  5JOY A;  4IES A;  2VD7 A;  4C8D A;  3P1I A;  2QQO A;  1PIV 3;  4IV1 B;  4EN0 A;  3OSD A;  4CA9 A;  4AI2 A;  3MF6 A;  4B7K A;  3FLT A;  1N3Q A;  1L7Q A;  1WLD A;  1BJQ A;  1O4Z A;  5GLU A;  3ZXJ A;  1DZQ A;  1ASJ 3;  1J1T A;  2YU1 A;  1VMH A;  5FBJ A;  1W06 A;  3ACF A;  3R4U A;  2Z5W A;  2OII A;  2ILM A;  3I2G A;  4DS0 A;  3S57 A;  3SNM A;  1US3 A;  2ARX A;  3ES4 A;  5FZ4 A;  3AVR A;  1Q8O A;  1DQ2 A;  2CAV A;  2QTW B;  3AZV A;  4AQS A;  3DPR B;  5ANN A;  1VIW B;  2P37 A;  3T08 A;  4MVT A;  2ORZ A;  2W87 A;  4N7I A;  4Q4Y 3;  1SZB A;  4CU9 A;  2ZMN A;  1NCQ C;  2Z4F A;  5FPA A;  2XOM A;  4MUV A;  2ZPX A;  4FXK B;  4N43 C;  2YC0 A;  2OQ6 A;  5T54 A;  5IVJ A;  3C7H A;  1QQP 2;  1UU4 A;  4FPO B;  5L73 A;  1UU6 A;  2QQP A;  4Y33 A;  4CCJ A;  5JXG A;  4N8M A;  3U4X A;  1LOF C;  2GH8 A;  4H2A A;  1A3K A;  3DYP A;  2PHD A;  3PUS A;  1BEV 1;  3FFQ A;  4HAN A;  1LES A;  5DN2 A;  2SBA A;  1ENS A;  4M00 A;  4DXR A;  1COV 1;  1GMM A;  2XVG A;  1POV 0;  4Y1X A;  5FZC A;  1GSL A;  2RM2 1;  1VBE 3;  1EV1 2;  4MHR A;  2TBV A;  5C4W B;  1OLR A;  3PVB B;  3RFR A;  2CNA A;  1C8N A;  4LUL A;  2VCA A;  1NLQ A;  2QUO A;  3DXU A;  3K51 A;  3KLS A;  4PI0 A;  4CCO A;  4N90 A;  2ZJC A;  4PF1 A;  2X10 A;  4LBL A;  1VRH 3;  1YFW A;  4XHB A;  4JHZ A;  3ZPY A;  3C3V A;  3J7N A;  1TG7 A;  3HAG A;  4E4Z A;  1O3Q A;  1EPW A;  2WL1 A;  3I2D A;  2PAM A;  4IGQ A;  1R1Z A;  5HCB A;  5AC9 2;  5HV4 A;  1J3Q A;  2PQS A;  3ME2 A;  5BNN A;  1QJU 3;  1W2T A;  3FE5 A;  4YM0 A;  3OOX A;  5C7G A;  2BGO A;  5JUV A;  1QJY 1;  2E26 A;  1R08 3;  1AYN 2;  2WYS A;  3NKG A;  4OUL A;  5T55 A;  3JCI A;  1JUI A;  3WF2 A;  5H9Q A;  2VJX A;  2RDQ A;  5I0D A;  4ES9 A;  4D69 A;  2BEO A;  4ZZ5 A;  1MZE A;  4XQ4 A;  5FZG A;  2QZ3 A;  2XHK A;  3IZO A;  3AMM A;  4BM8 A;  1NCR B;  1UMH A;  3HN3 A;  2O8O A;  4GUL A;  4OUS A;  4A4A A;  1JOP A;  1NQD A;  2E63 A;  4OYU A;  1PO2 3;  3VBS A;  1GFF 2;  4MOA A;  1CVN A;  2I2S A;  1NOV A;  3QD6 A;  1GU3 A;  4LPL A;  4QPG A;  1DZT A;  3J8F 2;  3MFA A;  4L2N A;  4QQL A;  3HQR A;  4R8H A;  4Q1R A;  3I49 A;  1HXS 1;  1XNT A;  2GC0 A;  1D0H A;  5SV8 A;  2KM2 A;  2WS9 2;  3NJZ A;  4CZS A;  3AP6 A;  3ASI A;  1JI6 A;  3W5N A;  5L7O C;  2YG0 A;  2QCS B;  4LO7 A;  2J1V A;  3OPZ A;  4PJY A;  3TNQ A;  4OHZ A;  2D3R A;  1R1A 1;  4GAZ A;  1RUD 3;  2A7A A;  5FK8 A;  3RZK A;  2E7Q A;  3OBZ A;  4KGQ A;  2JWP A;  3ORJ A;  4GA9 A;  3Q8A A;  3AYE A;  4QXK A;  3ELN A;  4AFC A;  2WWJ A;  2YZ4 A;  4LBQ B;  4CVU A;  3EXU A;  3ZXF A;  1H1A A;  1LAJ A;  3BTX A;  4P9L A;  1L3J A;  4UT5 A;  2JIG A;  2QE3 A;  2WO7 A;  2O1Q A;  3WP3 A;  4NPM A;  4QGL A;  2J22 A;  4ZY9 A;  2VMD A;  5BNO C;  4FTB A;  3DUI A;  5T5P A;  2VME A;  4FOY A;  3USS A;  3THC A;  4FBF A;  3KZ4 C;  5DAP A;  1CPM A;  2C9A A;  2WQ4 A;  3ZSE A;  4CCN A;  4GWI A;  2HWF 2;  5CFC A;  3M3E A;  1JYX A;  3HVD A;  3SIS A;  4H14 A;  2P3K A;  4XUQ A;  5A3O A;  3WF0 A;  4EV0 A;  3BTZ A;  1DDL A;  1PGS A;  3H9A A;  4RHV 1;  5J36 A;  4NN0 A;  4MV2 A;  1Z7S 1;  3ZXG A;  5T50 A;  5FZ6 A;  3UJQ A;  5JOX A;  4FPC A;  3B9I A;  4BQ1 A;  1LGC A;  2DTW A;  2D43 A;  1WD4 A;  2VO5 A;  1G6N A;  5JCT A;  2WIN B;  1RUH 3;  2FBE A;  4U36 A;  1XND A;  3IKW A;  2GNM A;  2ARA A;  5F5A A;  3UK9 A;  3J4U H;  3QLQ A;  4BYY A;  3CF6 E;  1H8T B;  5FJH A;  1ZX5 A;  3VHP A;  1CAW A;  1XE8 A;  3KS7 A;  4N43 A;  1LOD A;  3OYW A;  4E2G A;  1MR5 A;  3WDX A;  1ND2 B;  2GNT A;  1MQT C;  1WA4 A;  1TME 2;  4OHX A;  1YIP A;  1LOF A;  3SIT A;  1E5R A;  1X8E A;  1JZ5 A;  2PLV 3;  2WBK A;  2H6C A;  1S0E A;  3VLB B;  4M3C B;  3M4F A;  1HRI 1;  4R4Z A;  4MGS A;  1B35 C;  3AJZ A;  1RIT A;  1YCI A;  1VP6 A;  4UFK A;  3B00 A;  5HI0 A;  2Y33 A;  3LA7 A;  4IV3 A;  4JZR A;  3MI8 A;  5EV7 A;  4Q4X 3;  3ZYH A;  1NY7 2;  3LFI A;  1W6M A;  2RJ2 A;  4FT8 A;  4GWJ A;  4FFF A;  3EBR A;  3VDD C;  4R9A A;  4JRA A;  4UFH A;  4E4S A;  1DHK B;  3IBM A;  3M70 A;  3AX4 A;  2GME A;  2N7G A;  2TEP A;  3IWZ A;  5JZG C;  5A3L A;  1J83 A;  4ERO A;  2PTM A;  1OQ1 A;  3I4I A;  3IMM A;  4Y4Y A;  3V56 A;  5FZI A;  4IGO A;  5HCH A;  5FY8 A;  3O1U A;  2FZ1 A;  1ZVF A;  5FXZ A;  1A34 A;  1O5L A;  1XOY A;  3NWK A;  2DYC A;  4LBO A;  4PDW B;  4QPI C;  3O1M A;  2VQA A;  1ODM A;  1GLH A;  2D6M A;  2GU9 A;  3S6P A;  1F9K A;  2DUO A;  5D8A C;  3PIG A;  1UNB A;  1F4A A;  3ST7 A;  5DZG A;  3JU9 A;  1XSQ A;  1NX9 A;  3R0R A;  1HV0 A;  2RS5 1;  3OD4 A;  2F4P A;  2Y38 A;  3DN7 A;  3CJI B;  2O0O A;  1LJ7 A;  1H1M A;  1W9W A;  2HWC 2;  4JCK A;  4XYX A;  5ACA 3;  2BUK A;  2D40 A;  2XLF A;  5JMC A;  1W6P B;  1Q8V A;  2PAE A;  2MHF A;  4XQW A;  4LO5 B;  3WHT A;  4KBB A;  1RUE 3;  1AX2 A;  2GSY A;  2R04 3;  4OZX A;  4ET7 A;  2XHN A;  3B9C A;  1VBD 1;  2XR4 A;  3JQW A;  5FYS A;  4AI8 A;  5EYY A;  2Q8D A;  2Y6K A;  1W8H A;  3B5L B;  1V9U 3;  4P14 A;  2ZGO A;  2Y0I A;  2NZ9 A;  1PZ8 A;  1UYP A;  2JDU A;  3PME A;  1QDO A;  5APA A;  3L2H A;  2RS1 2;  3T3Y A;  5FP3 A;  4HXC A;  5A7S A;  2Y26 A;  2WJS A;  4LK6 A;  2XUE A;  1PIV 2;  4CUA A;  2DCJ A;  3UYJ A;  4KMQ A;  1RUI 3;  2Y0O A;  4CEY A;  5F2W A;  2QFE A;  5FP4 A;  5JI9 A;  4YVS B;  3A4U A;  4ZS2 A;  4PIY A;  3DKW A;  4XIL A;  3USU A;  1U5Y A;  1W6N B;  4EN8 B;  1PX4 A;  3NRU A;  2G1M A;  1OH4 A;  4K20 A;  3UKT A;  2MEV 1;  4DUW A;  2VCM A;  2VNG A;  3R05 A;  4V2V A;  4C0H A;  1ZBA 3;  1HW5 A;  3U1X A;  4LBM A;  1TE1 B;  2YPD A;  4HKO A;  4PBP A;  4A3X A;  4HET A;  3N9N A;  1ONA A;  5L19 A;  4AXO A;  1UKG A;  4KL1 A;  1XNA A;  5FLI A;  1WZX A;  1DGW A;  3ZFG A;  4AED A;  5I8Y A;  2RDN A;  4UF0 A;  4JGZ A;  3B02 A;  3ZPO A;  2JIJ A;  3WF3 A;  5C33 A;  1WMX A;  3LOI A;  1VPH A;  1JH5 A;  4YVW A;  1AR6 3;  4QM8 A;  5FRA A;  5LEJ A;  2QZ2 A;  3WQ1 A;  1NYW A;  2VQ0 A;  2AEZ A;  1AR7 3;  2I45 A;  4A6S A;  3O1T A;  1AYM 2;  2V5Y A;  5EHD A;  5IAT A;  3NMB A;  4P9I A;  4MH0 E;  1XQN A;  3LF7 A;  1YNA A;  3RWN A;  3HNM A;  2XPJ A;  1IPK A;  1UZZ A;  5HCF A;  5EWS A;  5FO8 B;  3POI A;  1VLN A;  2VZU A;  4A2U A;  2FDH A;  2WNV B;  2WT2 A;  3HN1 A;  3T0B A;  3UL2 A;  4GH4 C;  3P3P A;  2HBT A;  4LKF A;  4FO9 A;  2VMF A;  3H7Y A;  2P17 A;  4ONU A;  1VBE 2;  3N9M A;  1OLM A;  3N9O A;  4QU1 A;  4FQZ A;  3DYO A;  4XPV A;  1UO9 A;  5CAZ A;  3LCP A;  1A8M A;  4E2Q A;  1QJF A;  1NA1 B;  1LOG A;  1W6O A;  4MXW B;  4A41 A;  2BER A;  1EY2 A;  5CKN A;  5F37 A;  5HPO A;  4RGG A; 
#chains in the Genus database with same CATH homology
 1YQ6 A;  1YQ8 A;  1YQ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...