1YQAA

Engineering the structural stability and functional properties of the gi domain into the intrinsically unfolded gii domain of the yeast linker histone hho1p
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
87
structure length
87
Chain Sequence
KASSPSSLTYKEMILKSMPQLNDGKGSSRIVLKKYVKDTYPIVGSASNFDYLFNSAIKKCVENGELVQPKGPSGIIKLNKKKVKLST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Engineering the Structural Stability and Functional Properties of the GI Domain into the Intrinsically Unfolded GII Domain of the Yeast Linker Histone Hho1p.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
molecule keywords Histone H1
total genus 23
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2005-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00538 Linker_histone linker histone H1 and H5 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1yqaA00
5D5VB 2RVCA 4I01A 2FF4A 2P6TA 4R1HA 2DK8A 3OV8A 3CUQB 1CF7A 1J5YA 3WTXC 4L18B 1IXCA 2VXZA 5BS6A 3V7CA 5D5WB 1KU7A 2VE9A 2V6CA 1FNNA 2VONA 4KN4X 1W5TA 3IHUA 1OPCA 1LJ9A 1OYIA 5D5XB 3VODA 1ZGAA 2OU2A 3TO6A 2EB7A 3RPQA 2IA0A 3HSEA 5ERIA 2R7DA 2Q8KA 5CVRA 2KIUA 2XAHA 1HW5A 1MJBA 1EH6A 4OIOF 3GW2A 2KJCA 4A0YA 2PI0A 2ELHA 2Q0OA 3CDHA 4CICA 4LLGF 1AWCA 3N4MA 3GZ6A 1SD6A 1R23A 2OD5A 1O3SA 3O3KA 4RB1A 1R7JA 2XAQA 3FXRA 4GYGA 3V7RA 1BOAA 1XMKA 2YU3A 4RB0A 3BY6A 4A12A 1XDUA 3EETA 3JW4A 1WI9A 4KICA 4ZYDA 3I0TA 4BAYA 2PJPA 1DPUA 2DO7A 1UHWA 3JSOA 4OIPF 2BGCA 5LHGA 2VBWA 1XCBA 3C3WA 2F5DA 3K1NA 4A0XA 4U0YA 3G3ZA 2O8XA 4LLNA 4LB5A 5IT9K 1KYWA 5EEHA 2GA2A 1ONVA 3FWEA 2MLGA 3WTYC 5HLIA 3LA3A 4ESFA 2YX4A 3ZMZA 2MD5A 1RUNA 5K5OA 3E6CC 1QQIA 2EK5A 1BM9A 3WG9A 3LFKA 4IXAA 3IRRA 3TOBA 5F6FA 5ICEA 2IJLA 3QPTA 4I7HA 1TBXA 3T8TA 2RV8A 5ICGA 5DDGA 4UVAA 1V3FA 5F1RA 2O0YA 3T1BA 1YS6A 2OAZA 3FM3A 3PFIA 1ZG3A 1B59A 2O6GE 3E3VA 4L9TA 3F6VA 4OINF 5L3DA 2UZKA 2V1DA 5HDGA 4MTEA 1FY7A 2Z99A 1XGSA 5DEQA 4RGUA 3E5QA 4PZJA 5E1WA 2QYOA 1TLHB 2QWWA 1YW9A 1R5GA 3SFZA 2GAUA 1DUXC 1HXDA 4Q5SF 3BP8A 3CLOA 1VTNC 1FLIA 4EJWA 1G3TA 1U5TA 1MGTA 3R0JA 3KP2A 3O6BB 2OA4A 1QBJA 2LSOA 3EYIA 1W4MA 2V79A 4RAZA 5L3CA 1IN6A 1O57A 1BC8C 1FX7A 4A5NA 4UUVA 3BPXA 3MZHA 1BN5A 2RNJA 3MFKA 1HKQA 2XASA 1LEBA 3BJ6A 3F8FA 3Q9VA 4E70A 3G73A 2YPRA 2MLKA 4XBFA 4MGRA 1XCVA 1ZG1A 1U3EM 1IZ1A 1SD7A 4AWXB 2ZMEB 2EV6A 4A2UA 5E1ZB 2CW0F 3BZ6A 1HSTA 2K4BA 3EDPA 4HF2A 4XSZF 4EJVA 2P7VB 1GXPA 4ENJA 2Y0MA 4MTDA 3QU6A 3R0AA 5JFRA 2H27A 3ERED 3NEUA 3KZZA 2EFOA 2XROA 4OMYA 2CYYA 4ZYHA 2OZ6A 2X4HA 1DDNA 4F7ZA 4UVCA 1XSXA 1ZYRF 3EQLF 2VC1A 4BNCA 1XGNA 2YSRA 1JGSA 4L9VA 2FBHA 2PQ8A 5TRDA 1E17A 2QUFA 1QNTA 3DKWA 2ZNYA 3QPHA 5E8GA 4OIQF 3HRTA 1IN4A 4YIFA 3J80K 1J0RA 3HTSB 2FMLA 1P6RA 3E97A 4RB3C 2W57A 1L0OC 4YFNF 2DPDA 3OOPA 2QBYA 3MWMA 4PDKA 1OR7A 5F64A 1Z6RA 6PAXA 5CVUA 1TW2A 3GX4X 3ABUA 1PDNC 1ZLJA 1GXQA 2AS5F 4P9FA 3RI4A 3ZN0A 3KFWX 2GQQA 1I1GA 1O3QA 4BHCA 2FXAA 4EJTA 1FYKA 2G9WA 3KP7A 1L3LA 1F4KA 1B4AA 4UV8A 3GFLA 2Z9OA 3RYRA 3FX3A 4UV9A 2OQGA 4CXFA 1R1UA 1SAXA 2VOOA 4IF4A 2FMYA 5L3GA 1CGPA 3ML6A 5BPDA 4KNYA 2Y48A 1YIOA 2PBIA 4KMFA 5E18F 2HQNA 2A69F 4LFUA 2FOKA 5ED4A 3KE2A 2XHKA 2IA1A 4HQEA 2EWNA 2L02A 3D5LA 4M9SA 2DQRA 1C0WA 5LLQA 5ILSA 1BC7C 3JAMK 3TO7A 3LSTA 2VBZA 3F8CA 4YFKF 4ENMA 2D2WA 1I1SA 3HTUA 4LMYA 3TDUC 1ON1A 1QGPA 1H9TA 2FU4A 1QPMA 3PQJA 2ACJA 4FX4A 4LGWA 3CUQA 3R61A 5K1YA 4I98B 3IWFA 1EH8A 1YW8A 3GWZA 5FD6A 3QU3A 1MJAA 4P9UA 1PP7U 3BPVA 1R36A 2CQKA 3KEQA 4N0BA 2L4MA 1FSEA 1HW1A 1SFXA 4QLCU 1HW2A 3FMQA 1JHFA 2V9VA 1IUYA 1ZHFA 2VBYA 4DNCA 1IW7F 3ZQ7A 2Z5UA 3CO7C 5LRRA 3DP7A 2E7WA 4I02A 3RPUA 4GXOA 4KMUX 1P4XA 2QBYB 3MZYA 2DW4A 1XB4A 3GFJA 4BXUA 1BBYA 1F9NA 3CTAA 3GXOA 4L5IA 1XN7A 3P9KA 2A6EF 4IRGA 2QENA 2ADUA 3H3ZA 1LDKB 4HLXA 4EJOA 5CVIA 3ZMTA 4UVBA 4ZYEA 3E6DA 1XDSA 3EYYA 1JXSA 5DUKA 4PCQA 2CWEA 3WGIA 4FHTA 1B9MA 1DP7P 1S29A 2MBFA 2ZJ2A 4TV7A 3LQRA 1Z7UA 4I2OA 1ZGJA 5A2QK 2G7HA 1GVJA 2BBYA 1USTA 5HOOA 1Z91A 3BOQA 1HKSA 2L01A 2O03A 2W85A 3ZP5A 4LK0F 3VEPA 2DT5A 1FC3A 2H6CA 3ECHA 3L09A 5D5UB 1OMIA 2XAFA 3WTWC 2IRFG 2TDXA 3HRUA 3PQKA 1RUOA 1D3YA 4LJZF 1HSJA 4RGSA 3GVAA 3HOTA 2YX7A 1MDMA 3HSRA 3RKYA 4BHPA 2HDCA 4L5JA 5H6QA 2A07F 3FXQA 3L7WA 5IT9Z 1KA8A 1RZ4A 2VC0A 3ZMSA 2HZTA 2Q2EA 3FHZA 3LAJA 4EQQA 3VB2A 2Z33A 1ULYA 3BWGA 3RJPA 5LHIA 1KQ0A 5ICFA 4ESJA 2DI3A 1WSUA 2W84A 4N9IA 4CDGA 1K78B 2DTRA 4S04A 3I5UA 2K4JA 3M8EA 4CHUA 1R5HA 1WRJA 2LF8A 2VE8A 3E5XA 3QP5A 4M71A 5ICCA 4LB6B 1IAWA 4WXCA 4OMZA 2DFIA 2GZWA 1STZA 2PLYA 1S3JA 2VT2A 1FYMA 2HEOA 2Z3YA 2DPUA 5LRSA 5D6EA 5LEKA 2E1NA 3CUOA 1UB9A 3WTTC 1D5VA 4M72A 2A6HF 1J7KA 1G3YA 4KIGA 1XMAA 5AIPA 2P4WA 4ENKA 1U2WA 2VBXA 2G7UA 2VODA 2A61A 3KZYA 1V4RA 4D0PA 3F8NA 1ZARA 5FGMA 2L3DA 3R4KA 3I58A 3DPLC 4Y15A 3J7AO 4EV0A 4IRIA 4BHBA 3REOA 4JBAA 3I71A 4P5OA 2STTA 1RI7A 4QWQA 4G6DA 1R22A 4HX8A 3I53A 5E1XA 5D4SA 1U5TB 2HFHA 1K79A 4HF0A 3ZMVA 2MH9A 2IA2A 3JSPA 4S05A 2OZUA 4OIRF 2COMA 2QQ9A 4HV6A 2ISYA 2P6SA 5ILVA 3K9TA 1ZN2A 4HZFA 2VN2A 1U5TC 3KCCA 1P92A 3FMSA 1K78A 3GO5A 2B0LA 2WV0A 2DLLA 5CVVA 1X3UA 2NNNA 3WODF 3FF5A 5J6XA 2D1VA 3V4GA 1SMYF 3DEUA 3JAMZ 3LA7A 4EMSA 1FP1D 1FBQA 5AONA 1BIAA 3EUHA 5E20A 3TDZC 2PG4A 4WCGA 1BIBA 4IHTA 3AAFA 3QOPA 2BEOA 2M87A 3HRMA 3N97A 2HKOA 5FB2A 4IJAA 1R1TA 1S6LA 3WTVC 2VT3A 2FEZA 2QQBA 4U7DA 3ZPLA 4AIKA 3MAJA 1K6OA 4EM1A 2PMHA 1Z05A 4P96A 5E17F 5LEJA 2WWYA 2F5CA 3E5UA 1T38A 2A3SA 2V1XA 1FYLA 1FSHA 1WQ2A 5CYVA 1TTYA 5FFZA 3H92A 1FWZA 4MEXF 3C1DA 1KU9A 5DUIA 4Y17A 4KN7X 4CZZA 3E6BA 1FT9A 4ZH4F 3V8LA 2M45A 5IT3A 2HTSA 1D8JA 1TQMA 2EV5A 5H6RA 2EA2A 3WGHA 2W25A 1LVAA 1JE8A 5FD5A 2UXXA 2L4AA 1BI3A 2ETHA 5ILUA 4RGRA 1IRGA 3HIFA 2F5EA 1MJ9A 1G3WA 2XIGA 1Y0UA 3R6SA 2M30A 3KP6A 4AD9A 1W7PD 3BJOA 4RGXA 4HDVA 4M73A 4ENNA 1TW3A 4IHSA 2QLZA 5HS9A 3COAC 2QVOA 1ZH5A 4O3MA 3F72A 4ON0A 5HVQC 1HQCA 3HYIA 3WGGA 3J81K 3KEOA 2ZCWA 2E1CA 2P5LC 1J9IA 2L54A 5J8CA 5L3EA 2FE3A 4KYWA 4G7OF 2A68F 2IP2A 4L0ZB 2JPCA 1P4WA 2QQAA 3KLNA 3DV8A 4CO8A 5JVTA 1ZREA 4HF1A 2RC4A 1UHMA 4OOIA 2HS5A 1E2XA 1P2FA 4HX4A 4FX0A 2CSOA 1SFEA 3SXYA 4MQ9F 4WK8F 2M8EA 2WC2A 2GWRA 5J8FA 3I54A 1EH7A 3NRVA 1B9NA 4G7ZF 2E7XA 1J75A 2P5KA 2H94A 3M7GA 5AIQA 1IF1A 4UNOA 1O7FA 2QM3A 2CG4A 1J59A 2A5YB 3KLOA 2IW5A 4L0YB 4LLLA 4EJUA 2EFPA 2NAZA 4OU0A 2GIVA 1FBSA 2XKOA 4M6XA 3IKTA 4I0AA 3QAHA 2FQ3A 3K69A 3ZN1A 1R00A 1T2KA 1G4DA 2ZFWA 1R58A 2HYGD 2ZO4A 1SD5A 3F8MA 1OYYA 4XRFA 4A6DA 2EJRA 1YQAA 4BH9A 3E6MA 1KU2A 3WE3A 2HGCA 1FZPB 2GXBA 3TOAA 1XSDA 3I64A 3KP4A 5D8KB 1BI2A 2JTVA 4KIFA 1EV7A 4IRHA 2LKPA 2EA4A 2BE5F 3K0LA 4YG2F 4BYYA 3MCZA 3TGNA 2ZBKA 4GGGA 3WU0A 3I59B 2NYXA 3WTZA 5DD8A 1W5SA 3DF8A 1MKMA 3FZVA 1YS7A 1ZG5A 4EGZA 2ZNZA 1I27A 4LK1F 5DYMA 2CO5A 3GEZA 4LD5A 1F1ZA 5LGTA 4HOBA 1H9GA 5HLGA 1H0MA 5TJJA 4RAYA 2KIFA 4M74A 1WWXA 4AIJA 5BQTA 4NB5A 1P4AA 3ABTA 1GHCA 3TKYA 3P9CA 2R7FA 1ZRCA 2FRHA 2HWVA 5BMZA 1YG2A 3L9FA 3W6KB 3W6JB 3V8JA 3SZPA 4O5VA 3WE2A 3S2WA 5DCFA 1UCRA 3IC7A 1BJAA 2EFWA 4ZYGA 3KETA 2CFXA 2K02A 5CVJA 1F5TA 1OYWA 4KA4A 3B73A 4GYIA 4HA8A 2O61A 3LWFA 2LDUA 5KK1A 5CLSA 2BV6A 1AOYA 5DD4A 2IPQX 2JT1A 3R60A 2JPBA 2PEXA 4ZZLA 5D8LB 2H6BA 3P9IA 2ZXJA 2HTJA 1ZLKA 1U78A 2BYVE 1QZZA 4UHTA 4BQAA 2FNPA 2FSWA 3GZ5A 2HKXA 4HQMA 1ZRFA 3GF2A 2XGXA 3Q9SA 1MDMB 2XRNA 1O3RA 2P5VA 3HRSA 2NS0A 2O3FA 2K7LA 3M9AA 4CYDA 2MA3A 3FXUA 3FMRA 4G9YA 4ETSA 3HHGA 5LHHA 3WTUC 1IXRC 4IVNA 1YTYA 1YFHA 3RKWA 3C7JA 1LB2A 2KKOA 3IL2A 2C6YA 1XSVA 2DAOA 2EV0A 1O7LA 2IVMA 2RDPA 4MHGA 5CJ9A 1LDJA 2XVCA 5L3BA 1K7AA 4XSXF 2PN6A 2CGPA 3T8RA 1IN8A 3K2ZA 2RQPA 1TNTA 1ON2A 3DFGA 3RKXA 2HR3A 3QRFF 5DCMA 4M9ZA 4Q47A 4HW0A 2W24A 1KQ8A 2NNYA 1T98A 3F8BA 2Y75A 3F23A 4N9HA 1D8KA 1S7OA 5KVRA 1W7PA 2ZKZA 4G8XA 3M1EA 5FO5A 3VOEA 4I09A 2P7CB 4HV5A 1PUEE 3CJNA 3ROUA 4GO1A 2JZYA 1XGMA 5JHUA 4L9NA 4GCVA 1ZRDA 4DQ2A 3RTRA 2PMUA 5EEGA 3NQOA 4UXNA 5A2QZ 4NQWA 4EM0B 2XAJA 2XAGA 4KFCA 5HDKA 5JI6A 1LQ1A 4O6JA 4H0EA 4Q4ZF 4IPAA 4PGHA 4Y13A 3V8KA 4U0VA 2J5PA 3U2RA 4G7HF 1G3SA 1XD7A 4JQFA 3F3XA 2FBKA 3CO6C 3ECOA 2IT0A 3P7NA 1FOKA 2WTEA 5HS7A 4ZZDA 1HKTA 2XUBA 2AXLA 1B1BA 3IKVA 3KP3A 4A0ZA 1IRFA 2YR2A 4HX7A 3KP5A 1U8RA 1BI0A 4EM2A 1W7PB 2X0LA 3WU1B 3B02A 3GYHX 1YYVA 4HYEA 1R1VA 2JRTA 2GXGA 4B8XA 4KT5C 1YO5C 1JHHA 1B6AA 3K1PA 4I0BA 4WF2A 1TQPA 2F5FA 1S8NA 3J81Z 3IRQA 2ZMEA 4G94A 2UWMA 4L9JA 5FLXZ 2KIMA 1BI1A 2ESNA 1ODDA 4WXHA 2DK5A 4EVIA 2PFBA 1RNLA 1IXSB 1FPQA 4XLNF 5D6FA 5K5QA 1MD0A 2KRFA 2MH2A 2EFQA 3DXJF 1Z1DA 3SQNA 1G6NA 3IWZA 4PGGA 3GFIA 4WX9A 1FBUA 5HLHA 2P8TA 1KYZA 2ISZA 4HLYA 1I5ZA 4KIBA 1ZAOA 3FM5A 3T5XA 1TNSA 1KQ9A 2LF7A 4B09A 1T0FA 3SHFA 4WXDA 2HYFA 3LQQA 1DPRA 3T0YA 3RIRA 2M5WA 3GLXA 4RB2C 3VFZA 4FT8A 3DQVC 2DBBA 3SZTA 4MQVA 4LG0A 3MEXA 3GFMA 1LDDA 4U0WA 5D4RA 1USSA 5HDNA 2VOPA 3U9GA 2K27A 1A04A 4Q48A 1REPC 4MEYF 2D1HA 3ELKA 1Q1HA 4LG0B 5FLXK 4G6QA 4U7BA 5HS8A 4R8HA 2RGVA 2UXNA 4CGZA 5BOXA 2MC3A 5E8IA 5FFXA 4KUMA 1UFMA 1YLFA 2D45A 3ZMDA 1Z9CA 5H20A 2FBIA 1CF7B 2NRAC 1I6XA 3BROA 1MZBA 4NHJA 4ESBA 3L00A 5L3FA 2DU9A 4ASNA 2QZ8A 5LBQA 2M1BA 2STWA 2EFNA 1SFUA 4U88A 4AVPA 3K1MA 5DCMB 3M8FA 3L2CA 3TQNA 3J80Z 1QO0D 1WKMA 2LNBA 3BJAA 4A5MA 4EGYA 3QP6A 5DV5A 3BDDA 2H09A 4P55A 2OBPA 3I4PA 3HSFA 3HUGA 2HOEA 2KJBA 3U1DA 1XGOA 4MNUA 3DPTA 1PP8F 3HHHA 3F22A 1HBXG 2RKHA 2ESHA 4M9XA 1T6SA 1S7AA 1QZYA 3C18A 1U6GA 2HQRA 4YIIA 3I59A 3ZMUA 4WWCA 1IN5A 1Z6TA 4K2EA 1IN7A 5LGUA 2R3SA 1O3TA 1RIOH 3RDIA 4JK1X 4KDPA 1NHAA 1FP2A 3D0SA 5K5RA 1LEAA 2F2EA 2RN7A 1OKRA 1SMTA 3LA2A 3LAPA 1TQIA 2GA1A 2OQRA 3WTSC 5BPIA 1T39A 4R79A 2J5OA 4HBLA 3ISPA 2XV4S 3F6OA 4RS8A 3TO9A 3H3UA 1LNWA 3F21A 3ULQB 2JSCA 3HOSA 4HDUA 1J2XA 2K86A 3RYPA 1KGSA 4A6EA 2V1UA 4Z2YA 2FA5A 3O2PE 2XKPA 4HAMA 3CUQC 4M6YA 1KU3A 3MQ0A 3JTGA 2DQLA 2FNAA 3Q5FA 3GUDA 3V7SA 1YW7A 1SD4A 4YFXF 3JTHA 5LGNA 4AIHA 5JR3A 4XLPF
chains in the Genus database with same CATH superfamily
5F27A 2RVCA 5D5VB 4I01A 2FF4A 1FTTA 2P6TA 4R1HA 2DK8A 2DFHA 4LITA 4M3EA 3OV8A 3CUQB 1CF7A 4HNVA 3ZQHA 1E3OC 2CW8A 1J5YA 2I10A 5J4VA 3E7LA 3HDDA 3EUHC 3PNYA 3WTXC 4L18B 2E2HJ 1WCMJ 4IL6C 1IXCA 2VXZA 3SDBA 5BS6A 3OR2C 3S2DJ 3V7CA 5D5WB 1KU7A 4I99C 2VE9A 2WBMA 3BR3A 2V6CA 1MMAA 1FNNA 5DTDA 4DGWB 3VYTB 4XM3A 1IRZA 1SFOJ 3WHBA 2VONA 3OYIA 4KN4X 1W5TA 1ACIA 3IHUA 1OPCA 1LJ9A 3H35A 2B63J 3BTCA 1QVTA 1BA5A 3JRAA 1OYIA 5D5XB 1V5GA 3VODA 1ZGAA 2OU2A 2VJ4A 2IGNA 3TO6A 2EB7A 4XONA 2IA0A 3RPQA 3HSEA 4E7IA 1BW5A 5ERIA 3MMYB 2R7DA 3BG6A 4I76A 2Q8KA 4KITB 1SVMA 2BHZA 5CVRA 2KIUA 2Y2ZA 2XAHA 1HW5A 1ETOA 4DZPA 1MJBA 2CQXA 2LLKA 1EH6A 2R0QC 4QPQA 4OIOF 4M3DA 3GW2A 2KJCA 4A0YA 2PI0A 2ELHA 2Q0OA 3CDHA 4CICA 1R9TJ 2VKHA 3H5NA 2HOAA 4LLGF 4W97A 1AWCA 2E71A 2ME0A 5BNGA 3N4MA 4V19K 1ZR4A 5FJ8J 3GZ6A 1SD6A 4X6AJ 1R23A 2OD5A 1O3SA 3O3KA 1G8XA 4RB1A 1QA6A 1R7JA 2DA1A 2XAQA 3FXRA 4GYGA 4BQOA 3G6EI 3V7RA 1BOAA 1XMKA 2YU3A 4RB0A 2EZLA 3BY6A 4A12A 1XDUA 3EETA 3JW4A 1I39A 1WI9A 1JKPC 4KICA 4ZYDA 2BY2A 3I0TA 4BAYA 4IHYA 2PJPA 4UY8I 3W6VA 1DPUA 2DO7A 1UHWA 3OS1A 3JSOA 1VQOI 4C30A 4OIPF 2BGCA 5LHGA 1XS9A 4DOZA 2VBWA 1XCBA 3C3WA 2M4KA 2W48A 3CCJI 2F5DA 3K1NA 4A0XA 4U0YA 3G3ZA 5GAEJ 3ASNH 1ZGWA 4OWRB 2IGOA 2O8XA 2EQRA 4C2MJ 2X6WA 3J7YJ 4LLNA 1IV6A 1DGRM 4LB5A 5IT9K 2UUZA 1KYWA 5EEHA 2GA2A 1ONVA 1X58A 3FWEA 5J4YA 5M5XJ 2MLGA 3OYDA 3WTYC 5HLIA 3TBIA 4ABZA 3LA3A 4IQ4A 4ESFA 5IYDJ 3ZQQA 2XF5A 5M3MJ 2YX4A 2X1CA 2P81A 4Y7NJ 3ZMZA 4BE1A 2MD5A 1RUNA 4IX7A 3Q0WA 5K5OA 3E6CC 2HI3A 5E3MA 1QQIA 2DOEA 2NXNB 4A3JJ 2EK5A 1BM9A 3AG4H 2CQNA 4F3QA 1VF9A 3WG9A 3LFKA 4IXAA 3IRRA 3TOBA 5F6FA 5ICEA 2IJLA 2L7KA 3CCQI 4X1EA 3D5RC 3QPTA 4MIMA 4I7HA 1TBXA 3T8TA 3GTGJ 2RV8A 5ICGA 5DDGA 4UVAA 3S1NJ 1V3FA 5H2FC 5F1RA 2O0YA 2W00A 3T1BA 5EDNA 2ZJRF 1YS6A 4BY7J 2OAZA 3FM3A 1YJWI 2R7XA 2OJED 4MO7A 5TISC 3PFIA 1WVRA 1ZG3A 3SDGA 4F92B 3A2KA 1IC8A 1B59A 2O6GE 3E3VA 4L9TA 3F6VA 2IEKA 4OINF 3M4OJ 5L3DA 2UZKA 4D5CA 2JK3A 2BZTA 5IOYA 3TW6A 4E7KA 1JKQC 2V1DA 5HDGA 4BACA 3DKXA 3O8HA 4MTEA 1FY7A 3BC8A 5K7ZA 2Z99A 1XGSA 1FMWA 3I55I 1TL8A 5DEQA 4RGUA 4UUTA 3S8PA 1JUPA 3E5QA 4PZJA 5E1WA 2QYOA 1TLHB 5JVGF 4QPOA 1MH4A 2QWWA 1YW9A 4S0HB 1R5GA 3SFZA 4XNFA 1BJZA 2GAUA 1DUXC 1E0EA 1XPXA 4HRIA 2M7AA 2DFEA 1GVDA 1HXDA 4Q5SF 3BP8A 5F08A 2K9NA 3CLOA 1VTNC 1K6YA 4EJWA 1FLIA 1G3TA 4DYQA 1U5TA 5GADJ 3S14J 1MGTA 3R0JA 2LK2A 3KP2A 3O6BB 2OA4A 1JKRC 5F04A 1QBJA 3LSKA 2LSOA 3EYIA 1W4MA 4LG3A 2V79A 4RAZA 4A3FJ 1LFBA 1T0FC 1IN6A 3LOCA 5L3CA 1RKWA 1O57A 1OR7C 4U87A 1BC8C 1FX7A 3HM5A 3RCOA 2GLOA 4A5NA 4UUVA 4CCOA 3BPXA 1M1EB 2DN0A 3MZHA 4BEHB 1HLVA 1BN5A 2RNJA 3MFKA 3CC7I 1HKQA 2XASA 2DCEA 1LEBA 2JA6J 3BJ6A 3VDXA 3F8FA 3Q9VA 4E70A 3G73A 2YPRA 4DJAA 2O8KA 2MLKA 1FOYA 5EG0A 3CC2I 4XBFA 4XR6A 4MFEA 2WAEA 4MGRA 1XCVA 1ZG1A 3ZQIA 1U3EM 1IZ1A 1SD7A 3NAUA 2XPVA 2ZMEB 4AWXB 5J1YA 2EV6A 4AUXA 4Y33A 1YHQI 4A2UA 4B48A 1RKTA 1T33A 2CW0F 3BZ6A 5E1ZB 1HSTA 2K4BA 1MNMC 1Y1WJ 2DA5A 5FROA 3RKQA 3EDPA 4HF2A 3PO2J 4HNUA 4XSZF 5DM6F 4XLEA 4EJVA 2P7VB 4NDLA 1GXPA 2QEXI 4GFBA 4ENJA 3OMYA 1JI8A 1VQ6I 1LE8B 2Y0MA 3TMOA 4MTDA 3JRIA 3FKJA 1OCTC 4AM3A 2DDBA 2QCOA 3QU6A 3R0AA 2FX0A 1MMGA 1A5JA 4HEA2 5JFRA 3ERED 1FJLA 2KRCA 2H27A 3NEUA 3KZZA 4XN3A 2YS9A 1FIAA 2EFOA 3FXJA 2XROA 4OMYA 1KONA 2CYYA 4ZYHA 4BBRJ 2EZIA 2OZ6A 2X4HA 1DDNA 4F7ZA 4UVCA 2X6XA 2I5UA 1MIJA 4Y3OA 1XSXA 1BR4A 1ZYRF 2R7SA 5EZGA 2L5QA 2VPLA 3EQLF 2CJJA 2R92J 2VC1A 2QSGX 1LPQA 4BNCA 2ZSIB 1XGNA 2QKLB 2YSRA 1WH5A 4IHVA 3G4SI 1JGSA 1GV5A 4L9VA 4E7SA 2FBHA 2PQ8A 2ID3A 4HSRA 5TRDA 1E17A 1X3WB 2QUFA 1QNTA 3DKWA 2ZNYA 2OCEA 3QPHA 3ASOH 5E8GA 5B66C 2D5VA 3J7ZI 3LSGA 4OIQF 3HRTA 1IN4A 4YIFA 3J80K 5J1RA 1J0RA 3HTSB 3QOEA 2FMLA 1P6RA 3GLLA 3OYBA 3E97A 1R49A 2LYCA 4RB3C 3DTEA 2GIZA 2CV0A 2W57A 1L0OC 3IH2A 4YFNF 2DPDA 1ZK8A 3OOPA 2EIMH 2QBYA 4C2TA 3MWMA 3S17J 2Q2EB 3HXLA 3ESWB 4PDKA 1OR7A 1KZHA 2NVYJ 9ANTA 5F64A 1PUFB 1Z6RA 3ABLH 2X6YA 2MD0A 6PAXA 1GV2A 2HDDA 5CVUA 3BZKA 3MZ8A 2BW3B 1TW2A 2M2EA 3GX4X 3ABUA 1PDNC 1ZLJA 1GXQA 2DA3A 2AS5F 4P9FA 3K4CA 5KCMA 1RETA 3LSPA 3HEFA 3RI4A 5IY5H 3ZN0A 3KFWX 1T56A 2GQQA 1I1GA 1O3QA 4BHCA 3F9KA 2FXAA 2PMZA 2G9WA 3KP7A 1L3LA 1FYKA 1F4KA 1B4AA 4EJTA 2BHYA 4UV8A 2EZHA 2X1DA 3GFLA 2Z9OA 5C4XJ 2KIQA 3QWLA 3RYRA 2V1NA 3GBGA 3FX3A 2HOSA 4UV9A 3DBHB 2HVQA 2OQGA 2MC4A 2R5YA 2K5CA 4CXFA 1R1UA 2XSJC 3TW7A 1SAXA 1D0XA 2R5ZB 2LOOA 2VOOA 4IF4A 2FMYA 2HQAA 5L3GA 3RZOJ 4NC8A 2K9QA 1CGPA 3ML6A 1VQMI 5BPDA 3LNQA 4KNYA 4V2GA 3S1MJ 1AHDP 2K40A 1TWAJ 2KMUA 2Y48A 1YIOA 1O4XA 2PBIA 2R5YB 4KMFA 5E18F 2HQNA 2A69F 4LFUA 3HB9A 2FOKA 1WJDA 1POGA 5ED4A 3KE2A 2XHKA 2IA1A 3GTMJ 4BL0B 1MBJA 3H9QA 1ITYA 4HQEA 3S3MA 3AG2H 3UNGC 1JGGA 3KYDB 4Y52J 4HPQA 4ZTFA 1MW7A 1XG1A 3M8JA 3DCFA 2OTJI 3CJQB 2EWNA 2L02A 3D5LA 4M9SA 1TWCJ 3S3OA 3DLAA 3I4NJ 2DQRA 4BGDA 4BJTA 5LLQA 1C0WA 2L7MP 2NVQJ 5ILSA 1G59A 5CQEA 2M0MA 2VASA 1BC7C 3JAMK 3TO7A 2HDWA 1SFKA 4RAFA 3LSTA 2M0CA 2VBZA 3F8CA 4YFKF 4ENMA 2D2WA 1I1SA 2MW8A 1RPWA 2VJ5A 3HTUA 5B1AH 4LMYA 3TDUC 3PNTA 1ON1A 1WPKA 1QGPA 2OC6A 2BW3A 4LIVA 1H9TA 2ZB9A 2K85A 2FU4A 1QPMA 3PQJA 2L2OA 4LOCA 2ELJA 1OISA 2ACJA 4FX4A 4LGWA 3CUQA 3DTKA 3R61A 5K1YA 2NVTJ 1LFUP 3DWLE 4I98B 2L9VA 1OQYA 2VUMJ 3IWFA 1V5EA 2O5RA 1PYVA 2GM4A 4W1UA 1RC9A 1S7EA 3DTIA 3PSIA 1JJ6C 1B72A 1PUFA 1EH8A 1YW8A 4X0GA 3GWZA 5FD6A 1YI2I 3QU3A 1MJAA 1GUUA 4P9UA 1PP7U 3VSLA 3BPVA 4AYBN 2X85A 1NTCA 1R36A 2CQKA 4XLFA 2VL8A 3ABMH 3AFHA 3LSHA 2HNHA 5K7FA 3KEQA 2NS8A 4N0BA 2M34A 2L4MA 2HYJA 4FE7A 1YIJI 4XQFA 1FSEA 2DMPA 2VKVA 1HW1A 1SFXA 4QLCU 2IS2A 1HW2A 3OSFA 3FMQA 1JHFA 2V9VA 3N05A 1IUYA 1P7JA 3QYEA 3VSKA 2Y9ZA 1ZHFA 2KT0A 1R4NB 2EH3A 3FK7A 3H1CA 1Y8RB 5B5EC 4CH7A 2VBYA 3GTPJ 4XMYA 4DNCA 3BG5A 1H89C 1IW7F 2LKXA 3ZQ7A 4ANJA 2Z5UA 3O8GA 3QPLA 3CO7C 2Z2SB 5LRRA 3DP7A 4BS9A 2FD5A 2E7WA 2ECBA 4I02A 1FTZA 4ZYAA 2WY7Q 3PJRA 3RPUA 2VB6A 4GXOA 3FXMA 4KMUX 3C2BA 5EEAA 1P4XA 2QBYB 4DYCA 3JRBA 2CRGA 3MZYA 2DW4A 1XB4A 4BUPA 1WHUA 1SEUA 3GFJA 1FOXA 3BZCA 1X4OA 4BXUA 1BBYA 1F9NA 3CTAA 3GXOA 1H88C 1HCRA 3CZ6A 4L5IA 1XN7A 3P9KA 3K4KA 2H1LA 4D7NA 2A6EF 4IRGA 3KYCB 2QENA 3H36A 3E0JB 2ADUA 1D1AA 4JX4A 4KISA 1R71A 3H3ZA 4D5FA 2X48A 1LDKB 4HLXA 4EJOA 5CVIA 4ZTJA 1EF4A 2DYSH 1UAAA 3ZMTA 2NS7A 3UR3C 3D1NI 4UVBA 2L9NA 2B7EA 4ZYEA 3E6DA 1XDSA 3EYYA 3CC4I 4V2FA 2PMZN 2EIKH 4N4NB 5DUKA 4XOPA 1JXSA 2E5ZA 3L2WA 4PCQA 2JA8J 2CWEA 3WGIA 2IS6A 3FXOA 1Z21A 4FHTA 3DKYA 1B9MA 1DP7P 2XC7A 1ETWA 3BT9A 1GT0C 4A93J 1S29A 2MBFA 1UJ8A 2ZJ2A 3FXKA 4TV7A 5F1JA 3LQRA 1Z7UA 1QRYA 2DA6A 3K4MA 2LKSA 4I2OA 1ZGJA 4EEFG 5A2QK 3GTLJ 3HOZJ 2G7HA 2CV2A 1AU7A 1GVJA 2BBYA 1USTA 1SC7A 5HOOA 1Z91A 2F4MB 3MKZA 1Y8QB 3BOQA 4PJLA 1LUJB 2V9PA 4FCYA 1HKSA 2L01A 2O03A 2W85A 4PUSA 2R5ZA 3ZP5A 1UHSA 1MBKA 2GOMA 5EZHA 3OYJA 3OYGA 1IJWC 4LK0F 3VEPA 2DT5A 1FC3A 2X9DA 5IP6A 2H6CA 3ECHA 3L09A 4XKWA 1OMIA 5D5UB 2XAFA 1HDDC 3QPSA 3WTWC 2IRFG 2TDXA 5IYBJ 3CDIA 2AQFA 3HRUA 3PQKA 1RUOA 1D3YA 4LJZF 1HSJA 4RGSA 3GVAA 3HL2A 3HOTA 2YX7A 4PJ0C 2DMUA 4DBRA 3HKZA 4IO9F 1MDMA 3HSRA 5IP7J 4XORA 2DT7B 3A4CA 2VKDA 1D1BA 4MLOA 3RKYA 4BHPA 1TWFJ 4L5JA 1DU0A 3CMEI 2HDCA 1NK3P 5H6QA 2A07F 2BY3A 3FXQA 1E3PA 3L7WA 5IT9Z 1KA8A 1Q1VA 1YJ9I 1RZ4A 2VC0A 5GAHJ 2M9HA 3ZMSA 2HZTA 2HU9A 2LY9A 4AVZA 2Q2EA 2QKMB 1MSFC 2MG4A 3FHZA 3LAJA 4XICA 4YRVA 4NNJA 2W4SA 3VB2A 4BQQA 4EQQA 2Z33A 4BU2A 5TGTA 1ULYA 3BWGA 3RJPA 3MKYB 3J7AY 2W1OA 3K4BA 4F52A 4ZJZA 5LHIA 3SJMA 1KQ0A 4BDZA 5ICFA 4M6VA 1H8AC 4Z6YA 4ESJA 2H1KA 2DI3A 3CMAI 2W84A 3OWTA 1WSUA 1OLTA 2XB0X 4N9IA 4CDGA 2EILH 1K78B 2DTRA 3TP3A 4S04A 3I5UA 3JRGA 1MNDA 1AKHA 1MNEA 1D0YA 2K4JA 2K9LA 3M8EA 3VWBA 4CHUA 1APLC 1R5HA 1JUMA 2BVLA 1QVUA 1WRJA 1WFXA 4XKVA 2LF8A 2BOLA 1YX5A 2VE8A 3S3NA 3E5XA 2KHMA 4UUSA 3QP5A 4M71A 5LFAA 2VLAA 4IKFA 5ICCA 1I50J 1DQUA 2HQ5A 1X1AA 3SYTA 4GRIA 3M07A 4LB6B 1IAWA 4F91B 4ZDOA 4PJMA 2COBA 3EUAA 1FMVA 4G6TB 4OMZA 4WXCA 2DFIA 2GZWA 1STZA 2LBFB 2PLYA 1S3JA 1P9QC 1WJEA 4IEJA 2W7NA 2R7WA 5E3LA 2K9MA 1MBFA 2VT2A 1FYMA 1Y0NA 2HEOA 2Z3YA 2DPUA 2R7UA 1E3HA 5D6EA 5LRSA 2E1NA 5LEKA 3CUOA 1UB9A 3WTTC 1D5VA 3ERMA 4M72A 2PJRB 3EPZA 3OR1C 2A6HF 1J7KA 2DJNA 4UB6C 1LE8A 1G3YA 3G71I 4KIGA 5B3SH 1XMAA 2MSYA 5AIPA 1Z3XA 2P4WA 4ENKA 1U2WA 3RQIA 2VBXA 1HOMA 3GZNB 2M8GX 2HPIA 1Y1VJ 2G7UA 4FASD 1OCCH 3RZDJ 1UELB 1GDTA 2GBYA 2KFDA 2VODA 2A61A 1BL0A 3KZYA 1IO2A 2OTLI 1V4RA 3CMMA 4PJNA 2E60A 4D0PA 3F8NA 1U9NA 1ZARA 5FGMA 2L3DA 5C44J 3R4KA 2VXDA 3IAM2 4D7MA 3I58A 3DPLC 3EUKL 4J00A 1XTAA 4Y15A 3DEWA 3J7AO 4EV0A 2Z16A 4IRIA 2Z1DA 4BHBA 3REOA 4JBAA 3KIOA 3I71A 5DS9A 2Y30A 5DM7F 1NH3A 4P5OA 2STTA 4HNTA 1RI7A 3CCRI 5F0CA 5EYRA 4QWQA 4G6DA 1QZEA 2XAUA 3A1YA 4M3BA 1R22A 4HX8A 2F4IA 2WADA 3I53A 5E1XA 5D4SA 1U5TB 2HFHA 4ZDLA 2JQ7A 2Y0SA 2OV7A 1K79A 5FLVA 4HF0A 1DP3A 1WJAA 3ZMVA 1N78A 4DYRA 2MH9A 2IA2A 3JSPA 5GTIC 3CMYA 2Y0SN 4S05A 2OZUA 4OIRF 4NUBA 2COMA 4XKCA 2OUMA 4M3GA 2R7ZJ 1ETXA 3CF2A 2QQ9A 2EINH 4HV6A 2ISYA 4CCKA 2P6SA 2KPMA 3DBRB 5ILVA 3K9TA 5HNFA 1ZN2A 4HZFA 4II3A 2VN2A 1U5TC 3KCCA 1W36C 1P92A 3FMSA 1K78A 3PIPF 2XB5A 3GO5A 4AYBA 3I56I 2JMWA 2B0LA 2WV0A 1G2HA 2DLLA 3OYCA 1X3ZB 5CVVA 4CZCA 1X3UA 2NNNA 2VQCA 3WODF 3FF5A 3H5AA 4IOCF 4UUSB 5J6XA 2D1VA 3K4JA 1SMYF 3DEUA 3V4GA 3TL4X 3OYEA 1IDZA 3JAMZ 3LA7A 4EMSA 1FP1D 3ABKH 3FIWA 1YITI 3KYLA 1FBQA 1TC3C 5AONA 1BIAA 2VQLA 3DBLB 3EUHA 5E20A 3MVPA 2A6TA 3TDZC 2PG4A 3HOUJ 1SANA 4WCGA 1BIBA 1VQNI 4IHTA 3AAFA 2X51A 2KRHA 3QOPA 2BEOA 2M87A 3HRMA 3N97A 2HKOA 2ECCA 5FB2A 1NG6A 4IJAA 1R1TA 2LY1A 1S6LA 2K3PA 3WTVC 3CCVI 3BG3A 4G12A 2VJJA 2VT3A 2FEZA 2QQBA 3K2AA 4U7DA 3ZPLA 1D1CA 1F36A 2L9RA 4AIKA 2WAQN 5FLMJ 4DZJA 5IYCJ 3CD6I 3MAJA 5IOZA 1K6OA 4EM1A 2PMHA 3OSGA 1Z05A 3OY9A 3G1MA 5E3NA 4BY1J 5E79C 3MKWB 4P96A 5E17F 4XKBA 3DPUA 5LEJA 2WWYA 2F5CA 4XIDA 1I6HJ 3E5UA 1EJ9A 1T38A 1JT6A 2A3SA 2V1XA 3A0HC 1FYLA 3HOWJ 1FSHA 1WQ2A 5CYVA 1TTYA 3I3LA 1X1BA 5FFZA 3H92A 4RM2A 2FUG2 2N8GA 1FWZA 1WJ5A 4MEXF 3C1DA 2KDZA 1KU9A 3WHCA 5KAFC 5DUIA 1A6IA 1Y56A 4Y17A 4KN7X 4CZZA 1YJNI 3E6BA 1FT9A 4ZH4F 2FQ4A 3V8LA 3CCUI 2ZC2A 2M45A 2VJIA 5IT3A 2HTSA 1D8JA 4IOAF 1TQMA 2EV5A 1QPIA 3GCMA 2TCTA 5H6RA 1N77A 1BOBA 1LKXA 2EA2A 3D5SC 3ZRGA 2R7RA 3WGHA 3K10A 3PSFA 1UZCA 4J19A 2W25A 2JUCA 3OYNA 2BY0A 1LVAA 2LVSA 5FD5A 1JE8A 2UXXA 1HDPA 1W1WE 2QF7A 2L4AA 1BI3A 2LMDA 2ETHA 5ILUA 4RGRA 1IRGA 3HIFA 4RBOA 2F5EA 2TRTA 1MJ9A 1G3WA 2XIGA 1Y0UA 3R6SA 2BXZA 1YE9A 2M30A 3KP6A 1WH7A 1MBGA 4AD9A 1VQLI 1W7PD 1VQ5I 3BJOA 4RGXA 4HDVA 4M73A 3A01B 4ENNA 2DOAA 3L2UA 1TW3A 2PX9A 2R93J 4IHSA 2QLZA 3PUBA 5EF6A 3HJEA 5HNHA 2YUSA 5HS9A 5FKMA 1U8BA 2JVGA 3COAC 2QVOA 4FE4A 4O3MA 1ZH5A 2DDAA 3CCSI 3F72A 3G1OA 4ON0A 2E1OA 5HVQC 1HQCA 3HYIA 3WGGA 3J81K 1YOVB 2XDVA 2V26A 3KEOA 2ZCWA 2E1CA 1VZ0A 2P5LC 3CCLI 3LFUA 2DA7A 1J9IA 4P1WA 5EGOB 2L54A 1JJ8C 1W0UA 3IH4A 2HVSA 2G0EA 3CP8A 5J8CA 5L3EA 2FE3A 4RM3A 3K4NA 2NOJB 4KYWA 3LL7A 4XRSG 4G7OF 2A68F 2K9SA 2IP2A 4L0ZB 3OYMA 3A03A 4N4OB 2R7QA 1ZKGA 2JPCA 1P4WA 4BE2A 2QQAA 3KLNA 3DV8A 4XLAA 1RRJA 4CO8A 5JVTA 1A35A 4HG2A 2DJIA 1ZREA 2R7VA 4HF1A 2V6EA 2FJ1A 1ENHA 2RC4A 3S16J 2VI6A 1UHMA 3ZXSA 4OOIA 2HS5A 1E2XA 2M3AA 1P2FA 2CS3A 4FTHA 4HX4A 4FX0A 2CSOA 4B44A 2JA7J 1UG2A 1SFEA 3SXYA 3VPRA 2HZDA 3H9JA 4MQ9F 4WK8F 2XSDC 2M8EA 2WC2A 2DT6A 2GWRA 5J8FA 3I54A 1EH7A 3NRVA 1B9NA 4E4HA 4G7ZF 5J40A 1XC5A 2E7XA 1UG0A 1J75A 2P5KA 2H94A 4NBQA 3M7GA 2LC2A 5AIQA 1IF1A 4CYCA 1O7FA 4UNOA 2QM3A 4CA0A 2CG4A 1WJBA 2A5WA 1J59A 2A5YB 1ZQ3P 3KLOA 3L2VA 2IW5A 3OIPA 4L0YB 3CQZJ 4LLLA 4EJUA 1JTYA 2EFPA 2NAZA 3HPGA 4OU0A 2NVUB 1OCRH 2GIVA 1K61A 1GLNA 1NK2P 1FBSA 2KZVA 2XKOA 3E1SA 1BR2A 3S93A 2XGCA 5M3FJ 3CCYA 4OAZA 4M6XA 3IKTA 4I0AA 3QAHA 2FQ3A 3K69A 3ZN1A 3RSNA 3CCMI 1W0TA 1NG7A 1R00A 3OIOA 1T2KA 2DA4A 3OS2A 1A6QA 4LIUA 1G4DA 3H0DA 2ZFWA 1R58A 1UMQA 2DODA 2HYGD 1SD5A 2ZO4A 1OYYA 3F8MA 3HZJA 4XRFA 5IPAA 4A6DA 2EJRA 2AHQA 4A3GJ 3MD2A 3HKZN 1K4SA 3GTQJ 1YQAA 4BH9A 4KT6A 3E6MA 1KU2A 3WE3A 5HODA 2HGCA 2E5NA 3FKIJ 1FZPB 2GXBA 3TOAA 1XSDA 4A3CJ 3I64A 1K83J 3ZGKA 3KP4A 5D8KB 4NC6A 1U9OA 5C3EJ 1BI2A 2JTVA 4KIFA 1EV7A 4IRHA 1X1DA 2LKPA 3GMEA 1QU3A 2VQHA 2EA4A 2BE5F 2IGMA 2WAQA 3U21A 3K0LA 4XLCA 3JCUC 2BY1A 2QA4I 1FOWA 4YG2F 4BYYA 5GTHC 3MCZA 3A01A 2I8DA 2ZBKA 4GGGA 3TGNA 3W2VA 2KISA 3NWTA 3WU0A 1SVLA 3ZQLA 3I59B 2JWTA 3ZQGA 2NYXA 3WTZA 5DD8A 1PJRA 3LSJA 1W5SA 3CDLA 3DF8A 3X2QH 4BEHA 4IHWA 1MKMA 3FZVA 1YS7A 1OCZH 2HXIA 2L0KA 1ZG5A 4EGZA 2ZNZA 2ID6A 1I27A 4LK1F 5DYMA 1ETQA 3SEZA 1BR1A 2ZXHA 3CJTB 2CO5A 3VYRB 3GEZA 3PUFA 1F1ZA 4LD5A 5LGTA 4HOBA 4BBSJ 2W82A 1H9GA 1MSEC 4JOMA 5HLGA 1EA3A 1H0MA 5TJJA 3U1KA 4RAYA 1VI0A 2KIFA 4M74A 1WWXA 5FKLA 5BQTA 2K3FA 4AIJA 3OL4A 4NB5A 1P4AA 3BR2A 3ABTA 2HVRA 1GHCA 2XGEA 3TKYA 3P9CA 3HOYJ 2R7FA 1ZRCA 3OS0A 2FRHA 2HWVA 5BMZA 4QIWN 1YG2A 5FRNA 3VYUB 2ZSHB 3L9FA 4EATA 3W6KB 3BLYA 4ITVA 3W6JB 3KX2A 3V8JA 4PSXA 2DOFA 3SZPA 1MBEA 3CJRB 3BR6A 3HBLA 2YU9J 4O5VA 3WE2A 2CW7A 3S2WA 5DCFA 1OJLA 5GPCA 3OIQA 4OAYA 3H9GA 3LSRA 1UCRA 4I6ZA 3IC7A 1BJAA 2EFWA 3HPHA 4ZYGA 4Y4RA 3KETA 2CFXA 3K4LA 1X1CA 2K02A 1T8IA 3BTIA 5CVJA 2JUGA 4XRMA 1F5TA 1OYWA 4KA4A 3B73A 3C2HA 4GYIA 4HA8A 2O61A 1AKHB 3LWFA 2LDUA 1D0ZA 5KK1A 5CLSA 4CCMA 4XN0A 2BV6A 2VIXA 2WAFA 1RESA 1AOYA 5DD4A 2E1MC 2IPQX 2JT1A 3R60A 1YRNB 2MFZA 4B4CA 2JPBA 2PEXA 4ZZLA 2MGQA 2L7FP 5D8LB 2H6BA 3L1PA 2O7OA 2Y9YA 3P9IA 4UB8C 1ETKA 3PFYA 5GPAA 2ZXJA 2HTJA 4QSHA 3JREA 1ZLKA 2CQ7A 1Y6IA 3LMMA 1U78A 2BYVE 1U0JA 3IV5A 1QZZA 4UHTA 2B9SA 4BQAA 3BQZA 2FNPA 2FSWA 3GZ5A 4RLQA 2HKXA 4HQMA 1ZRFA 3GF2A 3MN2A 3BQYA 2E1MB 1XMXA 3ZR8X 3QODA 2XGXA 3Q9SA 1MDMB 2XRNA 1ZTRA 3DEEA 3W2AA 2E36A 1O3RA 2P5VA 3HRSA 1IRXA 2NS0A 2QGUA 1Z67A 2O3FA 2K7LA 3M9AA 2L9SA 3K7AJ 4CYDA 2MA3A 2OPTA 2ZMEC 3FXUA 2VPRA 3FMRA 4G9YA 4ETSA 3HHGA 5LHHA 3WTUC 4RA2A 5CPRB 2O9LA 1IXRC 4IVNA 3QQAA 3ZQFA 4RAGA 4C3IJ 1YTYA 3DU6A 1P7IA 4CCLA 1YFHA 2KDOA 3RKWA 3C7JA 1LB2A 2KKOA 2JA2A 3IL2A 1X2MA 1Z0XA 3OYLA 4F55A 4JX5A 2C6YA 4KJZA 1XSVA 4A3BJ 2DAOA 2EV0A 2R4GA 1O7LA 2IVMA 2JJ7A 3JRDA 1OCOH 2RDPA 5KHDA 1R6RA 2CUFA 4MHGA 2R7TA 5CJ9A 1LDJA 2XVCA 5L3BA 1K7AA 2E2JJ 1WJCA 5M5YJ 1WZ2A 4AIDA 4XSXF 2PN6A 2AQEA 2CGPA 4XRSA 3CLQA 1IN8A 3T8RA 1Z7LA 5F0FA 5JLWA 3K2ZA 2CQQA 2KZGA 2WB1N 1WJFA 3RPUD 3ZCOA 1MMNA 4BDYA 1CQTA 1TZLA 2DMQA 2RQPA 1BW6A 1TNTA 1ON2A 2LBFA 5CQGA 3DFGA 3RKXA 5M5WJ 4FQGA 2HR3A 1DU6A 2LR8A 3QRFF 3L2QA 5DCMA 3LSIA 4M9ZA 4PFOA 1TWHJ 4Q47A 5FKNA 4HW0A 1IGNA 3IAS2 2W24A 1KQ8A 4RMNA 2NNYA 4YELA 1T98A 3F8BA 2Y75A 3FK6A 3FISA 3F23A 1IV8A 2Y69H 4N9HA 1D8KA 1S7OA 2AO9A 3A0BC 3G2BA 1MH3A 5KVRA 1W7PA 2ZKZA 3P5JA 5B1BH 2QQ8A 1I3AA 4YEJA 4G8XA 3M1EA 3VYSB 3AKZA 2WY8Q 2DMTA 5FO5A 3VOEA 4I09A 2P7CB 4HV5A 1PUEE 4GDFA 5EG0B 1VQ4I 1MMSA 2IS1A 4NQWB 3CJNA 4BE0A 3ROUA 3K6GA 3KZIC 4GO1A 2JZYA 2EZKA 1XGMA 3FBIB 5C4JJ 4XL9A 5JHUA 4XOTA 2EBIA 4L9NA 4GCVA 3IP4B 1ZRDA 4DQ2A 1OCPA 3RTRA 4CCNA 1I3QJ 2PMUA 5CKTA 3H0GJ 1ZR2A 1B8IB 5EEGA 3NQOA 4UXNA 4B3XA 4DIQA 5A2QZ 4NQWA 2LFBA 4EM0B 1X19A 1HA8A 2ME6A 2XAJA 2XAGA 4KFCA 1HF0A 5HDKA 5JI6A 1LQ1A 5J3LA 1A31A 4O6JA 4PJJA 5EJCA 4H0EA 4Q4ZF 3OOUA 1WGXA 4IPAA 4PGHA 3AG3H 1K4TA 2IGKA 2E19A 2F4OB 4CUGA 4Y13A 1WI3A 3V8KA 4U0VA 2LD5A 2J5PA 3U2RA 3SEQA 4G7HF 3S1RJ 2E35A 1IDYA 1G3SA 4RDUA 2GXAA 4A3LJ 2LRDA 1PVEA 5J47A 3OYHA 1EKEA 1XD7A 3Q0UA 4JQFA 2ICWG 3F3XA 2FBKA 3M1CA 3CO6C 3ECOA 1DGWY 2IT0A 3FXLA 3P7NA 1FOKA 1XX5A 2WTEA 2XPUA 5HS7A 2AXTC 3JRCA 2EPFA 4ZZDA 1HKTA 2XUBA 5FRMA 2FOWA 2AXLA 4RLFA 4L5EA 5HLTA 1B1BA 3IKVA 1X4PA 3KP3A 4A0ZA 3I4MJ 3S15J 2V4JC 1IRFA 1LVKA 2YR2A 4HX7A 2LH9A 4A3MJ 3KP5A 1U8RA 3AL0C 1BI0A 1ORKA 4EM2A 1W7PB 2X0LA 3WU1B 1VQ8I 3B02A 3GYHX 1YYVA 2ZXIA 4AC0A 4HYEA 3S2HJ 1R1VA 3S32A 2CUEA 2XGDA 2JRTA 2GXGA 2JRMA 4B8XA 3JR9A 4KT5C 1YO5C 1JHHA 2X6OA 1B6AA 1J09A 1VNDA 3K1PA 2X1EA 4I0BA 4WF2A 3G1LA 4BQNA 4IHXA 3AL0B 2CMPA 1TQPA 2VQGA 2F5FA 3Q3SA 1S8NA 2F48A 3J81Z 3OYAA 2OF7A 4NC7A 3IRQA 2ZMEA 1MMDA 4G94A 4JX6A 2UWMA 4L9JA 1VFCA 2JVHA 5FLXZ 1S5LC 2KIMA 1BI1A 3WG7H 2ESNA 3I9V2 1ODDA 4WXHA 3BR0A 2DK5A 4A3KJ 3HOVJ 2LREA 4EVIA 2QSHX 2ELKA 3FBNB 2PFBA 1RNLA 1FIPA 1IXSB 1S9HA 2KQRA 3PNVA 1FPQA 2E2IJ 4XLNF 1MBHA 5GP9A 5D6FA 2XRLA 1RR8C 4A3IJ 5JHFA 5K5QA 1MD0A 2WB1A 2KRFA 2MH2A 2EFQA 4ZC3A 3DXJF 1T95A 3DU5A 1Z1DA 4CCJA 3SQNA 1G6NA 3IWZA 4PGGA 3BTJA 3GFIA 2DTZA 5F0HA 4WX9A 4A3DJ 4BXXJ 3HG9A 1ERDA 1FBUA 2JA5J 5HLHA 1V54H 2P8TA 1KYZA 3HUGB 5FKOA 2ISZA 2VKEA 4HLYA 2KL4A 1I5ZA 5J1UA 4KIBA 1ZAOA 4B3AA 4XK4A 3FM5A 2R7OA 2WV1A 2CH0A 4H4KC 4QTRA 1A36A 3T5XA 3HOXJ 1TNSA 1KQ9A 2LF7A 2MABA 1T0FA 3SZGA 4B09A 4B43A 3SHFA 4WXDA 2HYFA 1X2NA 4PFPA 1JKOC 3LQQA 4JP0A 1DPRA 3T0YA 1ETYA 2XPWA 2RAEA 3RIRA 2M5WA 4BJ6C 3GLXA 4RB2C 2KP6A 2LTPA 3VFZA 4DBQA 4FT8A 4C2UA 3W2WA 3DLLF 3DQVC 1VQ7I 4YIRX 4E7JA 2DBBA 4XLHA 3SZTA 4MQVA 3JRHA 4LG0A 3MEXA 4ZDPA 3GFMA 3CESA 4IQJA 1LFPA 1LDDA 1AA7A 2F6CA 4U0WA 4C3HJ 5D4RA 1TT0A 1USSA 2IXSA 5HDNA 1TP4A 4E7HA 2DXIA 2VOPA 3U9GA 2LY2A 2K27A 4PSWA 1A04A 4Q48A 5FKKA 3HC7A 2Y31A 1REPC 4MEYF 3Q0VA 5JLXA 2D1HA 1JT0A 3HGYA 3ELKA 1Q1HA 4LG0B 5FLXK 3S1QJ 4E7ZA 3OL3A 3CP2A 3NWSA 3JRFA 4G6QA 3WU2C 4BXFA 1IG7A 4U7BA 4HSTA 5K7HA 5E3OA 5HS8A 4R8HA 1TT5B 2RGVA 2UXNA 1ETVA 5GAGJ 1ZELA 3BCAA 2XF6A 3V42A 2CFOA 4CGZA 5BOXA 2MC3A 5E8IA 4PK4A 5FFXA 1D5YA 3KPHA 4KUMA 1UFMA 4IZZA 1YLFA 2D45A 3ZMDA 1Z9CA 5H20A 2FBIA 3B6CA 1CF7B 2XF7A 4AU7A 1I6XA 2NRAC 3BROA 2IBDA 2V7FA 1MZBA 3L2RA 1W36D 3PO3J 4NHJA 3NARA 4DW6A 4FETA 4ESBA 3GTOJ 3L00A 5L3FA 2DU9A 3PIOF 3BR1A 1T08B 1OFCX 4ASNA 4D9JA 3B6AA 2QZ8A 5LBQA 2M1BA 3PM1A 3UKGA 2STWA 2LG4A 2EFNA 3MKLA 1SFUA 4U88A 4AVPA 1V5FA 2WA0A 3K1MA 1SAUA 2F5VA 1RR7A 3M8FA 5DCMB 3TQNA 3L2CA 1YRNA 3J80Z 1QO0D 2JN6A 4II2A 2ZXWH 3LSMA 2H8RA 1WKMA 2PJRA 2LNBA 3F0CA 3BJAA 4A5MA 4EGYA 3IUOA 3GTJJ 2DFFA 4D1QA 3QP6A 5DV5A 3K70C 3BDDA 2P0WA 2RQQA 2M7BA 1N75A 4B1RA 2H09A 4P55A 3TEDA 2OBPA 2L7ZA 4C9YA 2V9KA 2DA2A 3I4PA 1F43A 3HSFA 3A02A 4BJ5C 3QYFA 3BG7A 3HUGA 2HOEA 3ZOBA 2ZJQF 2KJBA 2LP0A 3PL8A 1X1PA 3U1DA 4BKXA 1XGOA 4MNUA 3DPTA 1PP8F 1N25A 3HHHA 3F22A 3W3CA 1HBXG 2RKHA 2ESHA 4M9XA 1T6SA 1S7AA 1QZYA 3C18A 1U6GA 2HQRA 4YIIA 1VQPI 3I59A 5KNLA 1V55H 3ZMUA 2BXYA 4M3FA 4A3EJ 4FISA 2DMNA 3ONQA 1QHHD 5LD2C 4WWCA 3K70D 2A05A 1IN5A 1Z6TA 4K2EA 1R4MB 2Q1ZB 1IN7A 5LGUA 2R3SA 1O3TA 3TP0A 3BG9A 1RIOH 3RDIA 3AG1H 4J01A 5IP9J 3M3YJ 4JK1X 2CU7A 1NHAA 4KDPA 1FP2A 1TWGJ 3IH3A 2GOXB 2IAIA 3D0SA 5K5RA 1LEAA 1R5ID 3QYBA 1S72I 2HOTA 2F2EA 3BCBA 2HPMA 2BVMA 2CUZA 2RN7A 1VQKI 2RREA 1OKRA 1SMTA 3LA2A 2OCCH 3LAPA 2H8WA 3FHNA 1TQIA 1FEXA 4A69C 4F93B 3FDYA 2E34A 2HXOA 2GA1A 1VQ9I 2OQRA 3WTSC 2DYRH 2NOGA 2NVXJ 5BPIA 1T39A 3OYKA 4E6KG 1W5CC 3C2GA 4MFDA 2J5OA 4R79A 4HBLA 4B47A 3ISPA 2UV1A 1SVOA 2XV4S 3F6OA 4RS8A 3TO9A 3H3UA 1LNWA 3F21A 3CCEI 3ULQB 4CSWA 2JSCA 3HOSA 3RQ4A 3BR5A 4JYKA 4HDUA 2EIJH 1J2XA 2K86A 3KEYA 1YX3A 5KAIC 1Z77A 2CV1A 4E7LA 3ZQCA 3RYPA 1Y39A 1KGSA 2CUJA 3OYFA 4A6EA 3H3VK 3SFIA 2V1UA 3BTLA 4Z2YA 1Z3YA 4CYCB 2FA5A 3O2PE 2XKPA 4HAMA 1HC8A 3CUQC 4M6YA 1KU3A 3MQ0A 3JTGA 2DQLA 2FNAA 3HGGA 1B8IA 2M4GA 2ZJPF 3Q5FA 3GUDA 3V7SA 1YW7A 2RNGA 2KLOA 3CF5F 1SD4A 1IUFA 3H5RA 4YFXF 1B72B 2IS4A 3JTHA 5LGNA 2ZFUA 1JTXA 4C3JJ 1QHGA 2JSPA 1JUSA 4AIHA 5JR3A 4XLPF 5EGOA 3GTKJ 2MYSA 2QSFX
chains in the Genus database with same CATH topology
5D5VB 2RVCA 4I01A 2FF4A 2P6TA 4R1HA 2DK8A 3OV8A 3CUQB 1CF7A 1J5YA 3WTXC 4L18B 1IXCA 2VXZA 5BS6A 3V7CA 5D5WB 1KU7A 2VE9A 2V6CA 1FNNA 2VONA 4KN4X 1W5TA 3IHUA 1OPCA 1LJ9A 1OYIA 5D5XB 3VODA 1ZGAA 2OU2A 3TO6A 2EB7A 3RPQA 2IA0A 3HSEA 5ERIA 2R7DA 2Q8KA 5CVRA 2KIUA 2XAHA 1HW5A 1MJBA 1EH6A 4OIOF 3GW2A 2KJCA 4A0YA 2PI0A 2ELHA 2Q0OA 3CDHA 4CICA 4LLGF 1AWCA 3N4MA 3GZ6A 1SD6A 1R23A 2OD5A 1O3SA 3O3KA 4RB1A 1R7JA 2XAQA 3FXRA 4GYGA 3V7RA 1BOAA 1XMKA 2YU3A 4RB0A 3BY6A 4A12A 1XDUA 3EETA 3JW4A 1WI9A 4KICA 4ZYDA 3I0TA 4BAYA 2PJPA 1DPUA 2DO7A 1UHWA 3JSOA 4OIPF 2BGCA 5LHGA 2VBWA 1XCBA 3C3WA 2F5DA 3K1NA 4A0XA 4U0YA 3G3ZA 2O8XA 4LLNA 4LB5A 5IT9K 1KYWA 5EEHA 2GA2A 1ONVA 3FWEA 2MLGA 3WTYC 5HLIA 3LA3A 4ESFA 2YX4A 3ZMZA 2MD5A 1RUNA 5K5OA 3E6CC 1QQIA 2EK5A 1BM9A 3WG9A 3LFKA 4IXAA 3IRRA 3TOBA 5F6FA 5ICEA 2IJLA 3QPTA 4I7HA 1TBXA 3T8TA 2RV8A 5ICGA 5DDGA 4UVAA 1V3FA 5F1RA 2O0YA 3T1BA 1YS6A 2OAZA 3FM3A 3PFIA 1ZG3A 1B59A 2O6GE 3E3VA 4L9TA 3F6VA 4OINF 5L3DA 2UZKA 2V1DA 5HDGA 4MTEA 1FY7A 2Z99A 1XGSA 5DEQA 4RGUA 3E5QA 4PZJA 5E1WA 2QYOA 1TLHB 2QWWA 1YW9A 1R5GA 3SFZA 2GAUA 1DUXC 1HXDA 4Q5SF 3BP8A 3CLOA 1VTNC 1FLIA 4EJWA 1G3TA 1U5TA 1MGTA 3R0JA 3KP2A 3O6BB 2OA4A 1QBJA 2LSOA 3EYIA 1W4MA 2V79A 4RAZA 5L3CA 1IN6A 1O57A 1BC8C 1FX7A 4A5NA 4UUVA 3BPXA 3MZHA 1BN5A 2RNJA 3MFKA 1HKQA 2XASA 1LEBA 3BJ6A 3F8FA 3Q9VA 4E70A 3G73A 2YPRA 2MLKA 4XBFA 4MGRA 1XCVA 1ZG1A 1U3EM 1IZ1A 1SD7A 4AWXB 2ZMEB 2EV6A 4A2UA 5E1ZB 2CW0F 3BZ6A 1HSTA 2K4BA 3EDPA 4HF2A 4XSZF 4EJVA 2P7VB 1GXPA 4ENJA 2Y0MA 4MTDA 3QU6A 3R0AA 5JFRA 2H27A 3ERED 3NEUA 3KZZA 2EFOA 2XROA 4OMYA 2CYYA 4ZYHA 2OZ6A 2X4HA 1DDNA 4F7ZA 4UVCA 1XSXA 1ZYRF 3EQLF 2VC1A 4BNCA 1XGNA 2YSRA 1JGSA 4L9VA 2FBHA 2PQ8A 5TRDA 1E17A 2QUFA 1QNTA 3DKWA 2ZNYA 3QPHA 5E8GA 4OIQF 3HRTA 1IN4A 4YIFA 3J80K 1J0RA 3HTSB 2FMLA 1P6RA 3E97A 4RB3C 2W57A 1L0OC 4YFNF 2DPDA 3OOPA 2QBYA 3MWMA 4PDKA 1OR7A 5F64A 1Z6RA 6PAXA 5CVUA 1TW2A 3GX4X 3ABUA 1PDNC 1ZLJA 1GXQA 2AS5F 4P9FA 3RI4A 3ZN0A 3KFWX 2GQQA 1I1GA 1O3QA 4BHCA 2FXAA 4EJTA 1FYKA 2G9WA 3KP7A 1L3LA 1F4KA 1B4AA 4UV8A 3GFLA 2Z9OA 3RYRA 3FX3A 4UV9A 2OQGA 4CXFA 1R1UA 1SAXA 2VOOA 4IF4A 2FMYA 5L3GA 1CGPA 3ML6A 5BPDA 4KNYA 2Y48A 1YIOA 2PBIA 4KMFA 5E18F 2HQNA 2A69F 4LFUA 2FOKA 5ED4A 3KE2A 2XHKA 2IA1A 4HQEA 2EWNA 2L02A 3D5LA 4M9SA 2DQRA 1C0WA 5LLQA 5ILSA 1BC7C 3JAMK 3TO7A 3LSTA 2VBZA 3F8CA 4YFKF 4ENMA 2D2WA 1I1SA 3HTUA 4LMYA 3TDUC 1ON1A 1QGPA 1H9TA 2FU4A 1QPMA 3PQJA 2ACJA 4FX4A 4LGWA 3CUQA 3R61A 5K1YA 4I98B 3IWFA 1EH8A 1YW8A 3GWZA 5FD6A 3QU3A 1MJAA 4P9UA 1PP7U 3BPVA 1R36A 2CQKA 3KEQA 4N0BA 2L4MA 1FSEA 1HW1A 1SFXA 4QLCU 1HW2A 3FMQA 1JHFA 2V9VA 1IUYA 1ZHFA 2VBYA 4DNCA 1IW7F 3ZQ7A 2Z5UA 3CO7C 5LRRA 3DP7A 2E7WA 4I02A 3RPUA 4GXOA 4KMUX 1P4XA 2QBYB 3MZYA 2DW4A 1XB4A 3GFJA 4BXUA 1BBYA 1F9NA 3CTAA 3GXOA 4L5IA 1XN7A 3P9KA 2A6EF 4IRGA 2QENA 2ADUA 3H3ZA 1LDKB 4HLXA 4EJOA 5CVIA 3ZMTA 4UVBA 4ZYEA 3E6DA 1XDSA 3EYYA 1JXSA 5DUKA 4PCQA 2CWEA 3WGIA 4FHTA 1B9MA 1DP7P 1S29A 2MBFA 2ZJ2A 4TV7A 3LQRA 1Z7UA 4I2OA 1ZGJA 5A2QK 2G7HA 1GVJA 2BBYA 1USTA 5HOOA 1Z91A 3BOQA 1HKSA 2L01A 2O03A 2W85A 3ZP5A 4LK0F 3VEPA 2DT5A 1FC3A 2H6CA 3ECHA 3L09A 5D5UB 1OMIA 2XAFA 3WTWC 2IRFG 2TDXA 3HRUA 3PQKA 1RUOA 1D3YA 4LJZF 1HSJA 4RGSA 3GVAA 3HOTA 2YX7A 1MDMA 3HSRA 3RKYA 4BHPA 2HDCA 4L5JA 5H6QA 2A07F 3FXQA 3L7WA 5IT9Z 1KA8A 1RZ4A 2VC0A 3ZMSA 2HZTA 2Q2EA 3FHZA 3LAJA 4EQQA 3VB2A 2Z33A 1ULYA 3BWGA 3RJPA 5LHIA 1KQ0A 5ICFA 4ESJA 2DI3A 1WSUA 2W84A 4N9IA 4CDGA 1K78B 2DTRA 4S04A 3I5UA 2K4JA 3M8EA 4CHUA 1R5HA 1WRJA 2LF8A 2VE8A 3E5XA 3QP5A 4M71A 5ICCA 4LB6B 1IAWA 4WXCA 4OMZA 2DFIA 2GZWA 1STZA 2PLYA 1S3JA 2VT2A 1FYMA 2HEOA 2Z3YA 2DPUA 5LRSA 5D6EA 5LEKA 2E1NA 3CUOA 1UB9A 3WTTC 1D5VA 4M72A 2A6HF 1J7KA 1G3YA 4KIGA 1XMAA 5AIPA 2P4WA 4ENKA 1U2WA 2VBXA 2G7UA 2VODA 2A61A 3KZYA 1V4RA 4D0PA 3F8NA 1ZARA 5FGMA 2L3DA 3R4KA 3I58A 3DPLC 4Y15A 3J7AO 4EV0A 4IRIA 4BHBA 3REOA 4JBAA 3I71A 4P5OA 2STTA 1RI7A 4QWQA 4G6DA 1R22A 4HX8A 3I53A 5E1XA 5D4SA 1U5TB 2HFHA 1K79A 4HF0A 3ZMVA 2MH9A 2IA2A 3JSPA 4S05A 2OZUA 4OIRF 2COMA 2QQ9A 4HV6A 2ISYA 2P6SA 5ILVA 3K9TA 1ZN2A 4HZFA 2VN2A 1U5TC 3KCCA 1P92A 3FMSA 1K78A 3GO5A 2B0LA 2WV0A 2DLLA 5CVVA 1X3UA 2NNNA 3WODF 3FF5A 5J6XA 2D1VA 3V4GA 1SMYF 3DEUA 3JAMZ 3LA7A 4EMSA 1FP1D 1FBQA 5AONA 1BIAA 3EUHA 5E20A 3TDZC 2PG4A 4WCGA 1BIBA 4IHTA 3AAFA 3QOPA 2BEOA 2M87A 3HRMA 3N97A 2HKOA 5FB2A 4IJAA 1R1TA 1S6LA 3WTVC 2VT3A 2FEZA 2QQBA 4U7DA 3ZPLA 4AIKA 3MAJA 1K6OA 4EM1A 2PMHA 1Z05A 4P96A 5E17F 5LEJA 2WWYA 2F5CA 3E5UA 1T38A 2A3SA 2V1XA 1FYLA 1FSHA 1WQ2A 5CYVA 1TTYA 5FFZA 3H92A 1FWZA 4MEXF 3C1DA 1KU9A 5DUIA 4Y17A 4KN7X 4CZZA 3E6BA 1FT9A 4ZH4F 3V8LA 2M45A 5IT3A 2HTSA 1D8JA 1TQMA 2EV5A 5H6RA 2EA2A 3WGHA 2W25A 1LVAA 1JE8A 5FD5A 2UXXA 2L4AA 1BI3A 2ETHA 5ILUA 4RGRA 1IRGA 3HIFA 2F5EA 1MJ9A 1G3WA 2XIGA 1Y0UA 3R6SA 2M30A 3KP6A 4AD9A 1W7PD 3BJOA 4RGXA 4HDVA 4M73A 4ENNA 1TW3A 4IHSA 2QLZA 5HS9A 3COAC 2QVOA 1ZH5A 4O3MA 3F72A 4ON0A 5HVQC 1HQCA 3HYIA 3WGGA 3J81K 3KEOA 2ZCWA 2E1CA 2P5LC 1J9IA 2L54A 5J8CA 5L3EA 2FE3A 4KYWA 4G7OF 2A68F 2IP2A 4L0ZB 2JPCA 1P4WA 2QQAA 3KLNA 3DV8A 4CO8A 5JVTA 1ZREA 4HF1A 2RC4A 1UHMA 4OOIA 2HS5A 1E2XA 1P2FA 4HX4A 4FX0A 2CSOA 1SFEA 3SXYA 4MQ9F 4WK8F 2M8EA 2WC2A 2GWRA 5J8FA 3I54A 1EH7A 3NRVA 1B9NA 4G7ZF 2E7XA 1J75A 2P5KA 2H94A 3M7GA 5AIQA 1IF1A 4UNOA 1O7FA 2QM3A 2CG4A 1J59A 2A5YB 3KLOA 2IW5A 4L0YB 4LLLA 4EJUA 2EFPA 2NAZA 4OU0A 2GIVA 1FBSA 2XKOA 4M6XA 3IKTA 4I0AA 3QAHA 2FQ3A 3K69A 3ZN1A 1R00A 1T2KA 1G4DA 2ZFWA 1R58A 2HYGD 2ZO4A 1SD5A 3F8MA 1OYYA 4XRFA 4A6DA 2EJRA 1YQAA 4BH9A 3E6MA 1KU2A 3WE3A 2HGCA 1FZPB 2GXBA 3TOAA 1XSDA 3I64A 3KP4A 5D8KB 1BI2A 2JTVA 4KIFA 1EV7A 4IRHA 2LKPA 2EA4A 2BE5F 3K0LA 4YG2F 4BYYA 3MCZA 3TGNA 2ZBKA 4GGGA 3WU0A 3I59B 2NYXA 3WTZA 5DD8A 1W5SA 3DF8A 1MKMA 3FZVA 1YS7A 1ZG5A 4EGZA 2ZNZA 1I27A 4LK1F 5DYMA 2CO5A 3GEZA 4LD5A 1F1ZA 5LGTA 4HOBA 1H9GA 5HLGA 1H0MA 5TJJA 4RAYA 2KIFA 4M74A 1WWXA 4AIJA 5BQTA 4NB5A 1P4AA 3ABTA 1GHCA 3TKYA 3P9CA 2R7FA 1ZRCA 2FRHA 2HWVA 5BMZA 1YG2A 3L9FA 3W6KB 3W6JB 3V8JA 3SZPA 4O5VA 3WE2A 3S2WA 5DCFA 1UCRA 3IC7A 1BJAA 2EFWA 4ZYGA 3KETA 2CFXA 2K02A 5CVJA 1F5TA 1OYWA 4KA4A 3B73A 4GYIA 4HA8A 2O61A 3LWFA 2LDUA 5KK1A 5CLSA 2BV6A 1AOYA 5DD4A 2IPQX 2JT1A 3R60A 2JPBA 2PEXA 4ZZLA 5D8LB 2H6BA 3P9IA 2ZXJA 2HTJA 1ZLKA 1U78A 2BYVE 1QZZA 4UHTA 4BQAA 2FNPA 2FSWA 3GZ5A 2HKXA 4HQMA 1ZRFA 3GF2A 2XGXA 3Q9SA 1MDMB 2XRNA 1O3RA 2P5VA 3HRSA 2NS0A 2O3FA 2K7LA 3M9AA 4CYDA 2MA3A 3FXUA 3FMRA 4G9YA 4ETSA 3HHGA 5LHHA 3WTUC 1IXRC 4IVNA 1YTYA 1YFHA 3RKWA 3C7JA 1LB2A 2KKOA 3IL2A 2C6YA 1XSVA 2DAOA 2EV0A 1O7LA 2IVMA 2RDPA 4MHGA 5CJ9A 1LDJA 2XVCA 5L3BA 1K7AA 4XSXF 2PN6A 2CGPA 3T8RA 1IN8A 3K2ZA 2RQPA 1TNTA 1ON2A 3DFGA 3RKXA 2HR3A 3QRFF 5DCMA 4M9ZA 4Q47A 4HW0A 2W24A 1KQ8A 2NNYA 1T98A 3F8BA 2Y75A 3F23A 4N9HA 1D8KA 1S7OA 5KVRA 1W7PA 2ZKZA 4G8XA 3M1EA 5FO5A 3VOEA 4I09A 2P7CB 4HV5A 1PUEE 3CJNA 3ROUA 4GO1A 2JZYA 1XGMA 5JHUA 4L9NA 4GCVA 1ZRDA 4DQ2A 3RTRA 2PMUA 5EEGA 3NQOA 4UXNA 5A2QZ 4NQWA 4EM0B 2XAJA 2XAGA 4KFCA 5HDKA 5JI6A 1LQ1A 4O6JA 4H0EA 4Q4ZF 4IPAA 4PGHA 4Y13A 3V8KA 4U0VA 2J5PA 3U2RA 4G7HF 1G3SA 1XD7A 4JQFA 3F3XA 2FBKA 3CO6C 3ECOA 2IT0A 3P7NA 1FOKA 2WTEA 5HS7A 4ZZDA 1HKTA 2XUBA 2AXLA 1B1BA 3IKVA 3KP3A 4A0ZA 1IRFA 2YR2A 4HX7A 3KP5A 1U8RA 1BI0A 4EM2A 1W7PB 2X0LA 3WU1B 3B02A 3GYHX 1YYVA 4HYEA 1R1VA 2JRTA 2GXGA 4B8XA 4KT5C 1YO5C 1JHHA 1B6AA 3K1PA 4I0BA 4WF2A 1TQPA 2F5FA 1S8NA 3J81Z 3IRQA 2ZMEA 4G94A 2UWMA 4L9JA 5FLXZ 2KIMA 1BI1A 2ESNA 1ODDA 4WXHA 2DK5A 4EVIA 2PFBA 1RNLA 1IXSB 1FPQA 4XLNF 5D6FA 5K5QA 1MD0A 2KRFA 2MH2A 2EFQA 3DXJF 1Z1DA 3SQNA 1G6NA 3IWZA 4PGGA 3GFIA 4WX9A 1FBUA 5HLHA 2P8TA 1KYZA 2ISZA 4HLYA 1I5ZA 4KIBA 1ZAOA 3FM5A 3T5XA 1TNSA 1KQ9A 2LF7A 4B09A 1T0FA 3SHFA 4WXDA 2HYFA 3LQQA 1DPRA 3T0YA 3RIRA 2M5WA 3GLXA 4RB2C 3VFZA 4FT8A 3DQVC 2DBBA 3SZTA 4MQVA 4LG0A 3MEXA 3GFMA 1LDDA 4U0WA 5D4RA 1USSA 5HDNA 2VOPA 3U9GA 2K27A 1A04A 4Q48A 1REPC 4MEYF 2D1HA 3ELKA 1Q1HA 4LG0B 5FLXK 4G6QA 4U7BA 5HS8A 4R8HA 2RGVA 2UXNA 4CGZA 5BOXA 2MC3A 5E8IA 5FFXA 4KUMA 1UFMA 1YLFA 2D45A 3ZMDA 1Z9CA 5H20A 2FBIA 1CF7B 2NRAC 1I6XA 3BROA 1MZBA 4NHJA 4ESBA 3L00A 5L3FA 2DU9A 4ASNA 2QZ8A 5LBQA 2M1BA 2STWA 2EFNA 1SFUA 4U88A 4AVPA 3K1MA 5DCMB 3M8FA 3L2CA 3TQNA 3J80Z 1QO0D 1WKMA 2LNBA 3BJAA 4A5MA 4EGYA 3QP6A 5DV5A 3BDDA 2H09A 4P55A 2OBPA 3I4PA 3HSFA 3HUGA 2HOEA 2KJBA 3U1DA 1XGOA 4MNUA 3DPTA 1PP8F 3HHHA 3F22A 1HBXG 2RKHA 2ESHA 4M9XA 1T6SA 1S7AA 1QZYA 3C18A 1U6GA 2HQRA 4YIIA 3I59A 3ZMUA 4WWCA 1IN5A 1Z6TA 4K2EA 1IN7A 5LGUA 2R3SA 1O3TA 1RIOH 3RDIA 4JK1X 4KDPA 1NHAA 1FP2A 3D0SA 5K5RA 1LEAA 2F2EA 2RN7A 1OKRA 1SMTA 3LA2A 3LAPA 1TQIA 2GA1A 2OQRA 3WTSC 5BPIA 1T39A 4R79A 2J5OA 4HBLA 3ISPA 2XV4S 3F6OA 4RS8A 3TO9A 3H3UA 1LNWA 3F21A 3ULQB 2JSCA 3HOSA 4HDUA 1J2XA 2K86A 3RYPA 1KGSA 4A6EA 2V1UA 4Z2YA 2FA5A 3O2PE 2XKPA 4HAMA 3CUQC 4M6YA 1KU3A 3MQ0A 3JTGA 2DQLA 2FNAA 3Q5FA 3GUDA 3V7SA 1YW7A 1SD4A 4YFXF 3JTHA 5LGNA 4AIHA 5JR3A 4XLPF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D5V B;  2RVC A;  4I01 A;  2FF4 A;  2P6T A;  4R1H A;  2DK8 A;  3OV8 A;  3CUQ B;  1CF7 A;  1J5Y A;  3WTX C;  4L18 B;  1IXC A;  2VXZ A;  5BS6 A;  3V7C A;  5D5W B;  1KU7 A;  2VE9 A;  2V6C A;  1FNN A;  2VON A;  4KN4 X;  1W5T A;  3IHU A;  1OPC A;  1LJ9 A;  1OYI A;  5D5X B;  3VOD A;  1ZGA A;  2OU2 A;  3TO6 A;  2EB7 A;  3RPQ A;  2IA0 A;  3HSE A;  5ERI A;  2R7D A;  2Q8K A;  5CVR A;  2KIU A;  2XAH A;  1HW5 A;  1MJB A;  1EH6 A;  4OIO F;  3GW2 A;  2KJC A;  4A0Y A;  2PI0 A;  2ELH A;  2Q0O A;  3CDH A;  4CIC A;  4LLG F;  1AWC A;  3N4M A;  3GZ6 A;  1SD6 A;  1R23 A;  2OD5 A;  1O3S A;  3O3K A;  4RB1 A;  1R7J A;  2XAQ A;  3FXR A;  4GYG A;  3V7R A;  1BOA A;  1XMK A;  2YU3 A;  4RB0 A;  3BY6 A;  4A12 A;  1XDU A;  3EET A;  3JW4 A;  1WI9 A;  4KIC A;  4ZYD A;  3I0T A;  4BAY A;  2PJP A;  1DPU A;  2DO7 A;  1UHW A;  3JSO A;  4OIP F;  2BGC A;  5LHG A;  2VBW A;  1XCB A;  3C3W A;  2F5D A;  3K1N A;  4A0X A;  4U0Y A;  3G3Z A;  2O8X A;  4LLN A;  4LB5 A;  5IT9 K;  1KYW A;  5EEH A;  2GA2 A;  1ONV A;  3FWE A;  2MLG A;  3WTY C;  5HLI A;  3LA3 A;  4ESF A;  2YX4 A;  3ZMZ A;  2MD5 A;  1RUN A;  5K5O A;  3E6C C;  1QQI A;  2EK5 A;  1BM9 A;  3WG9 A;  3LFK A;  4IXA A;  3IRR A;  3TOB A;  5F6F A;  5ICE A;  2IJL A;  3QPT A;  4I7H A;  1TBX A;  3T8T A;  2RV8 A;  5ICG A;  5DDG A;  4UVA A;  1V3F A;  5F1R A;  2O0Y A;  3T1B A;  1YS6 A;  2OAZ A;  3FM3 A;  3PFI A;  1ZG3 A;  1B59 A;  2O6G E;  3E3V A;  4L9T A;  3F6V A;  4OIN F;  5L3D A;  2UZK A;  2V1D A;  5HDG A;  4MTE A;  1FY7 A;  2Z99 A;  1XGS A;  5DEQ A;  4RGU A;  3E5Q A;  4PZJ A;  5E1W A;  2QYO A;  1TLH B;  2QWW A;  1YW9 A;  1R5G A;  3SFZ A;  2GAU A;  1DUX C;  1HXD A;  4Q5S F;  3BP8 A;  3CLO A;  1VTN C;  1FLI A;  4EJW A;  1G3T A;  1U5T A;  1MGT A;  3R0J A;  3KP2 A;  3O6B B;  2OA4 A;  1QBJ A;  2LSO A;  3EYI A;  1W4M A;  2V79 A;  4RAZ A;  5L3C A;  1IN6 A;  1O57 A;  1BC8 C;  1FX7 A;  4A5N A;  4UUV A;  3BPX A;  3MZH A;  1BN5 A;  2RNJ A;  3MFK A;  1HKQ A;  2XAS A;  1LEB A;  3BJ6 A;  3F8F A;  3Q9V A;  4E70 A;  3G73 A;  2YPR A;  2MLK A;  4XBF A;  4MGR A;  1XCV A;  1ZG1 A;  1U3E M;  1IZ1 A;  1SD7 A;  4AWX B;  2ZME B;  2EV6 A;  4A2U A;  5E1Z B;  2CW0 F;  3BZ6 A;  1HST A;  2K4B A;  3EDP A;  4HF2 A;  4XSZ F;  4EJV A;  2P7V B;  1GXP A;  4ENJ A;  2Y0M A;  4MTD A;  3QU6 A;  3R0A A;  5JFR A;  2H27 A;  3ERE D;  3NEU A;  3KZZ A;  2EFO A;  2XRO A;  4OMY A;  2CYY A;  4ZYH A;  2OZ6 A;  2X4H A;  1DDN A;  4F7Z A;  4UVC A;  1XSX A;  1ZYR F;  3EQL F;  2VC1 A;  4BNC A;  1XGN A;  2YSR A;  1JGS A;  4L9V A;  2FBH A;  2PQ8 A;  5TRD A;  1E17 A;  2QUF A;  1QNT A;  3DKW A;  2ZNY A;  3QPH A;  5E8G A;  4OIQ F;  3HRT A;  1IN4 A;  4YIF A;  3J80 K;  1J0R A;  3HTS B;  2FML A;  1P6R A;  3E97 A;  4RB3 C;  2W57 A;  1L0O C;  4YFN F;  2DPD A;  3OOP A;  2QBY A;  3MWM A;  4PDK A;  1OR7 A;  5F64 A;  1Z6R A;  6PAX A;  5CVU A;  1TW2 A;  3GX4 X;  3ABU A;  1PDN C;  1ZLJ A;  1GXQ A;  2AS5 F;  4P9F A;  3RI4 A;  3ZN0 A;  3KFW X;  2GQQ A;  1I1G A;  1O3Q A;  4BHC A;  2FXA A;  4EJT A;  1FYK A;  2G9W A;  3KP7 A;  1L3L A;  1F4K A;  1B4A A;  4UV8 A;  3GFL A;  2Z9O A;  3RYR A;  3FX3 A;  4UV9 A;  2OQG A;  4CXF A;  1R1U A;  1SAX A;  2VOO A;  4IF4 A;  2FMY A;  5L3G A;  1CGP A;  3ML6 A;  5BPD A;  4KNY A;  2Y48 A;  1YIO A;  2PBI A;  4KMF A;  5E18 F;  2HQN A;  2A69 F;  4LFU A;  2FOK A;  5ED4 A;  3KE2 A;  2XHK A;  2IA1 A;  4HQE A;  2EWN A;  2L02 A;  3D5L A;  4M9S A;  2DQR A;  1C0W A;  5LLQ A;  5ILS A;  1BC7 C;  3JAM K;  3TO7 A;  3LST A;  2VBZ A;  3F8C A;  4YFK F;  4ENM A;  2D2W A;  1I1S A;  3HTU A;  4LMY A;  3TDU C;  1ON1 A;  1QGP A;  1H9T A;  2FU4 A;  1QPM A;  3PQJ A;  2ACJ A;  4FX4 A;  4LGW A;  3CUQ A;  3R61 A;  5K1Y A;  4I98 B;  3IWF A;  1EH8 A;  1YW8 A;  3GWZ A;  5FD6 A;  3QU3 A;  1MJA A;  4P9U A;  1PP7 U;  3BPV A;  1R36 A;  2CQK A;  3KEQ A;  4N0B A;  2L4M A;  1FSE A;  1HW1 A;  1SFX A;  4QLC U;  1HW2 A;  3FMQ A;  1JHF A;  2V9V A;  1IUY A;  1ZHF A;  2VBY A;  4DNC A;  1IW7 F;  3ZQ7 A;  2Z5U A;  3CO7 C;  5LRR A;  3DP7 A;  2E7W A;  4I02 A;  3RPU A;  4GXO A;  4KMU X;  1P4X A;  2QBY B;  3MZY A;  2DW4 A;  1XB4 A;  3GFJ A;  4BXU A;  1BBY A;  1F9N A;  3CTA A;  3GXO A;  4L5I A;  1XN7 A;  3P9K A;  2A6E F;  4IRG A;  2QEN A;  2ADU A;  3H3Z A;  1LDK B;  4HLX A;  4EJO A;  5CVI A;  3ZMT A;  4UVB A;  4ZYE A;  3E6D A;  1XDS A;  3EYY A;  1JXS A;  5DUK A;  4PCQ A;  2CWE A;  3WGI A;  4FHT A;  1B9M A;  1DP7 P;  1S29 A;  2MBF A;  2ZJ2 A;  4TV7 A;  3LQR A;  1Z7U A;  4I2O A;  1ZGJ A;  5A2Q K;  2G7H A;  1GVJ A;  2BBY A;  1UST A;  5HOO A;  1Z91 A;  3BOQ A;  1HKS A;  2L01 A;  2O03 A;  2W85 A;  3ZP5 A;  4LK0 F;  3VEP A;  2DT5 A;  1FC3 A;  2H6C A;  3ECH A;  3L09 A;  5D5U B;  1OMI A;  2XAF A;  3WTW C;  2IRF G;  2TDX A;  3HRU A;  3PQK A;  1RUO A;  1D3Y A;  4LJZ F;  1HSJ A;  4RGS A;  3GVA A;  3HOT A;  2YX7 A;  1MDM A;  3HSR A;  3RKY A;  4BHP A;  2HDC A;  4L5J A;  5H6Q A;  2A07 F;  3FXQ A;  3L7W A;  5IT9 Z;  1KA8 A;  1RZ4 A;  2VC0 A;  3ZMS A;  2HZT A;  2Q2E A;  3FHZ A;  3LAJ A;  4EQQ A;  3VB2 A;  2Z33 A;  1ULY A;  3BWG A;  3RJP A;  5LHI A;  1KQ0 A;  5ICF A;  4ESJ A;  2DI3 A;  1WSU A;  2W84 A;  4N9I A;  4CDG A;  1K78 B;  2DTR A;  4S04 A;  3I5U A;  2K4J A;  3M8E A;  4CHU A;  1R5H A;  1WRJ A;  2LF8 A;  2VE8 A;  3E5X A;  3QP5 A;  4M71 A;  5ICC A;  4LB6 B;  1IAW A;  4WXC A;  4OMZ A;  2DFI A;  2GZW A;  1STZ A;  2PLY A;  1S3J A;  2VT2 A;  1FYM A;  2HEO A;  2Z3Y A;  2DPU A;  5LRS A;  5D6E A;  5LEK A;  2E1N A;  3CUO A;  1UB9 A;  3WTT C;  1D5V A;  4M72 A;  2A6H F;  1J7K A;  1G3Y A;  4KIG A;  1XMA A;  5AIP A;  2P4W A;  4ENK A;  1U2W A;  2VBX A;  2G7U A;  2VOD A;  2A61 A;  3KZY A;  1V4R A;  4D0P A;  3F8N A;  1ZAR A;  5FGM A;  2L3D A;  3R4K A;  3I58 A;  3DPL C;  4Y15 A;  3J7A O;  4EV0 A;  4IRI A;  4BHB A;  3REO A;  4JBA A;  3I71 A;  4P5O A;  2STT A;  1RI7 A;  4QWQ A;  4G6D A;  1R22 A;  4HX8 A;  3I53 A;  5E1X A;  5D4S A;  1U5T B;  2HFH A;  1K79 A;  4HF0 A;  3ZMV A;  2MH9 A;  2IA2 A;  3JSP A;  4S05 A;  2OZU A;  4OIR F;  2COM A;  2QQ9 A;  4HV6 A;  2ISY A;  2P6S A;  5ILV A;  3K9T A;  1ZN2 A;  4HZF A;  2VN2 A;  1U5T C;  3KCC A;  1P92 A;  3FMS A;  1K78 A;  3GO5 A;  2B0L A;  2WV0 A;  2DLL A;  5CVV A;  1X3U A;  2NNN A;  3WOD F;  3FF5 A;  5J6X A;  2D1V A;  3V4G A;  1SMY F;  3DEU A;  3JAM Z;  3LA7 A;  4EMS A;  1FP1 D;  1FBQ A;  5AON A;  1BIA A;  3EUH A;  5E20 A;  3TDZ C;  2PG4 A;  4WCG A;  1BIB A;  4IHT A;  3AAF A;  3QOP A;  2BEO A;  2M87 A;  3HRM A;  3N97 A;  2HKO A;  5FB2 A;  4IJA A;  1R1T A;  1S6L A;  3WTV C;  2VT3 A;  2FEZ A;  2QQB A;  4U7D A;  3ZPL A;  4AIK A;  3MAJ A;  1K6O A;  4EM1 A;  2PMH A;  1Z05 A;  4P96 A;  5E17 F;  5LEJ A;  2WWY A;  2F5C A;  3E5U A;  1T38 A;  2A3S A;  2V1X A;  1FYL A;  1FSH A;  1WQ2 A;  5CYV A;  1TTY A;  5FFZ A;  3H92 A;  1FWZ A;  4MEX F;  3C1D A;  1KU9 A;  5DUI A;  4Y17 A;  4KN7 X;  4CZZ A;  3E6B A;  1FT9 A;  4ZH4 F;  3V8L A;  2M45 A;  5IT3 A;  2HTS A;  1D8J A;  1TQM A;  2EV5 A;  5H6R A;  2EA2 A;  3WGH A;  2W25 A;  1LVA A;  1JE8 A;  5FD5 A;  2UXX A;  2L4A A;  1BI3 A;  2ETH A;  5ILU A;  4RGR A;  1IRG A;  3HIF A;  2F5E A;  1MJ9 A;  1G3W A;  2XIG A;  1Y0U A;  3R6S A;  2M30 A;  3KP6 A;  4AD9 A;  1W7P D;  3BJO A;  4RGX A;  4HDV A;  4M73 A;  4ENN A;  1TW3 A;  4IHS A;  2QLZ A;  5HS9 A;  3COA C;  2QVO A;  1ZH5 A;  4O3M A;  3F72 A;  4ON0 A;  5HVQ C;  1HQC A;  3HYI A;  3WGG A;  3J81 K;  3KEO A;  2ZCW A;  2E1C A;  2P5L C;  1J9I A;  2L54 A;  5J8C A;  5L3E A;  2FE3 A;  4KYW A;  4G7O F;  2A68 F;  2IP2 A;  4L0Z B;  2JPC A;  1P4W A;  2QQA A;  3KLN A;  3DV8 A;  4CO8 A;  5JVT A;  1ZRE A;  4HF1 A;  2RC4 A;  1UHM A;  4OOI A;  2HS5 A;  1E2X A;  1P2F A;  4HX4 A;  4FX0 A;  2CSO A;  1SFE A;  3SXY A;  4MQ9 F;  4WK8 F;  2M8E A;  2WC2 A;  2GWR A;  5J8F A;  3I54 A;  1EH7 A;  3NRV A;  1B9N A;  4G7Z F;  2E7X A;  1J75 A;  2P5K A;  2H94 A;  3M7G A;  5AIQ A;  1IF1 A;  4UNO A;  1O7F A;  2QM3 A;  2CG4 A;  1J59 A;  2A5Y B;  3KLO A;  2IW5 A;  4L0Y B;  4LLL A;  4EJU A;  2EFP A;  2NAZ A;  4OU0 A;  2GIV A;  1FBS A;  2XKO A;  4M6X A;  3IKT A;  4I0A A;  3QAH A;  2FQ3 A;  3K69 A;  3ZN1 A;  1R00 A;  1T2K A;  1G4D A;  2ZFW A;  1R58 A;  2HYG D;  2ZO4 A;  1SD5 A;  3F8M A;  1OYY A;  4XRF A;  4A6D A;  2EJR A;  1YQA A;  4BH9 A;  3E6M A;  1KU2 A;  3WE3 A;  2HGC A;  1FZP B;  2GXB A;  3TOA A;  1XSD A;  3I64 A;  3KP4 A;  5D8K B;  1BI2 A;  2JTV A;  4KIF A;  1EV7 A;  4IRH A;  2LKP A;  2EA4 A;  2BE5 F;  3K0L A;  4YG2 F;  4BYY A;  3MCZ A;  3TGN A;  2ZBK A;  4GGG A;  3WU0 A;  3I59 B;  2NYX A;  3WTZ A;  5DD8 A;  1W5S A;  3DF8 A;  1MKM A;  3FZV A;  1YS7 A;  1ZG5 A;  4EGZ A;  2ZNZ A;  1I27 A;  4LK1 F;  5DYM A;  2CO5 A;  3GEZ A;  4LD5 A;  1F1Z A;  5LGT A;  4HOB A;  1H9G A;  5HLG A;  1H0M A;  5TJJ A;  4RAY A;  2KIF A;  4M74 A;  1WWX A;  4AIJ A;  5BQT A;  4NB5 A;  1P4A A;  3ABT A;  1GHC A;  3TKY A;  3P9C A;  2R7F A;  1ZRC A;  2FRH A;  2HWV A;  5BMZ A;  1YG2 A;  3L9F A;  3W6K B;  3W6J B;  3V8J A;  3SZP A;  4O5V A;  3WE2 A;  3S2W A;  5DCF A;  1UCR A;  3IC7 A;  1BJA A;  2EFW A;  4ZYG A;  3KET A;  2CFX A;  2K02 A;  5CVJ A;  1F5T A;  1OYW A;  4KA4 A;  3B73 A;  4GYI A;  4HA8 A;  2O61 A;  3LWF A;  2LDU A;  5KK1 A;  5CLS A;  2BV6 A;  1AOY A;  5DD4 A;  2IPQ X;  2JT1 A;  3R60 A;  2JPB A;  2PEX A;  4ZZL A;  5D8L B;  2H6B A;  3P9I A;  2ZXJ A;  2HTJ A;  1ZLK A;  1U78 A;  2BYV E;  1QZZ A;  4UHT A;  4BQA A;  2FNP A;  2FSW A;  3GZ5 A;  2HKX A;  4HQM A;  1ZRF A;  3GF2 A;  2XGX A;  3Q9S A;  1MDM B;  2XRN A;  1O3R A;  2P5V A;  3HRS A;  2NS0 A;  2O3F A;  2K7L A;  3M9A A;  4CYD A;  2MA3 A;  3FXU A;  3FMR A;  4G9Y A;  4ETS A;  3HHG A;  5LHH A;  3WTU C;  1IXR C;  4IVN A;  1YTY A;  1YFH A;  3RKW A;  3C7J A;  1LB2 A;  2KKO A;  3IL2 A;  2C6Y A;  1XSV A;  2DAO A;  2EV0 A;  1O7L A;  2IVM A;  2RDP A;  4MHG A;  5CJ9 A;  1LDJ A;  2XVC A;  5L3B A;  1K7A A;  4XSX F;  2PN6 A;  2CGP A;  3T8R A;  1IN8 A;  3K2Z A;  2RQP A;  1TNT A;  1ON2 A;  3DFG A;  3RKX A;  2HR3 A;  3QRF F;  5DCM A;  4M9Z A;  4Q47 A;  4HW0 A;  2W24 A;  1KQ8 A;  2NNY A;  1T98 A;  3F8B A;  2Y75 A;  3F23 A;  4N9H A;  1D8K A;  1S7O A;  5KVR A;  1W7P A;  2ZKZ A;  4G8X A;  3M1E A;  5FO5 A;  3VOE A;  4I09 A;  2P7C B;  4HV5 A;  1PUE E;  3CJN A;  3ROU A;  4GO1 A;  2JZY A;  1XGM A;  5JHU A;  4L9N A;  4GCV A;  1ZRD A;  4DQ2 A;  3RTR A;  2PMU A;  5EEG A;  3NQO A;  4UXN A;  5A2Q Z;  4NQW A;  4EM0 B;  2XAJ A;  2XAG A;  4KFC A;  5HDK A;  5JI6 A;  1LQ1 A;  4O6J A;  4H0E A;  4Q4Z F;  4IPA A;  4PGH A;  4Y13 A;  3V8K A;  4U0V A;  2J5P A;  3U2R A;  4G7H F;  1G3S A;  1XD7 A;  4JQF A;  3F3X A;  2FBK A;  3CO6 C;  3ECO A;  2IT0 A;  3P7N A;  1FOK A;  2WTE A;  5HS7 A;  4ZZD A;  1HKT A;  2XUB A;  2AXL A;  1B1B A;  3IKV A;  3KP3 A;  4A0Z A;  1IRF A;  2YR2 A;  4HX7 A;  3KP5 A;  1U8R A;  1BI0 A;  4EM2 A;  1W7P B;  2X0L A;  3WU1 B;  3B02 A;  3GYH X;  1YYV A;  4HYE A;  1R1V A;  2JRT A;  2GXG A;  4B8X A;  4KT5 C;  1YO5 C;  1JHH A;  1B6A A;  3K1P A;  4I0B A;  4WF2 A;  1TQP A;  2F5F A;  1S8N A;  3J81 Z;  3IRQ A;  2ZME A;  4G94 A;  2UWM A;  4L9J A;  5FLX Z;  2KIM A;  1BI1 A;  2ESN A;  1ODD A;  4WXH A;  2DK5 A;  4EVI A;  2PFB A;  1RNL A;  1IXS B;  1FPQ A;  4XLN F;  5D6F A;  5K5Q A;  1MD0 A;  2KRF A;  2MH2 A;  2EFQ A;  3DXJ F;  1Z1D A;  3SQN A;  1G6N A;  3IWZ A;  4PGG A;  3GFI A;  4WX9 A;  1FBU A;  5HLH A;  2P8T A;  1KYZ A;  2ISZ A;  4HLY A;  1I5Z A;  4KIB A;  1ZAO A;  3FM5 A;  3T5X A;  1TNS A;  1KQ9 A;  2LF7 A;  4B09 A;  1T0F A;  3SHF A;  4WXD A;  2HYF A;  3LQQ A;  1DPR A;  3T0Y A;  3RIR A;  2M5W A;  3GLX A;  4RB2 C;  3VFZ A;  4FT8 A;  3DQV C;  2DBB A;  3SZT A;  4MQV A;  4LG0 A;  3MEX A;  3GFM A;  1LDD A;  4U0W A;  5D4R A;  1USS A;  5HDN A;  2VOP A;  3U9G A;  2K27 A;  1A04 A;  4Q48 A;  1REP C;  4MEY F;  2D1H A;  3ELK A;  1Q1H A;  4LG0 B;  5FLX K;  4G6Q A;  4U7B A;  5HS8 A;  4R8H A;  2RGV A;  2UXN A;  4CGZ A;  5BOX A;  2MC3 A;  5E8I A;  5FFX A;  4KUM A;  1UFM A;  1YLF A;  2D45 A;  3ZMD A;  1Z9C A;  5H20 A;  2FBI A;  1CF7 B;  2NRA C;  1I6X A;  3BRO A;  1MZB A;  4NHJ A;  4ESB A;  3L00 A;  5L3F A;  2DU9 A;  4ASN A;  2QZ8 A;  5LBQ A;  2M1B A;  2STW A;  2EFN A;  1SFU A;  4U88 A;  4AVP A;  3K1M A;  5DCM B;  3M8F A;  3L2C A;  3TQN A;  3J80 Z;  1QO0 D;  1WKM A;  2LNB A;  3BJA A;  4A5M A;  4EGY A;  3QP6 A;  5DV5 A;  3BDD A;  2H09 A;  4P55 A;  2OBP A;  3I4P A;  3HSF A;  3HUG A;  2HOE A;  2KJB A;  3U1D A;  1XGO A;  4MNU A;  3DPT A;  1PP8 F;  3HHH A;  3F22 A;  1HBX G;  2RKH A;  2ESH A;  4M9X A;  1T6S A;  1S7A A;  1QZY A;  3C18 A;  1U6G A;  2HQR A;  4YII A;  3I59 A;  3ZMU A;  4WWC A;  1IN5 A;  1Z6T A;  4K2E A;  1IN7 A;  5LGU A;  2R3S A;  1O3T A;  1RIO H;  3RDI A;  4JK1 X;  4KDP A;  1NHA A;  1FP2 A;  3D0S A;  5K5R A;  1LEA A;  2F2E A;  2RN7 A;  1OKR A;  1SMT A;  3LA2 A;  3LAP A;  1TQI A;  2GA1 A;  2OQR A;  3WTS C;  5BPI A;  1T39 A;  4R79 A;  2J5O A;  4HBL A;  3ISP A;  2XV4 S;  3F6O A;  4RS8 A;  3TO9 A;  3H3U A;  1LNW A;  3F21 A;  3ULQ B;  2JSC A;  3HOS A;  4HDU A;  1J2X A;  2K86 A;  3RYP A;  1KGS A;  4A6E A;  2V1U A;  4Z2Y A;  2FA5 A;  3O2P E;  2XKP A;  4HAM A;  3CUQ C;  4M6Y A;  1KU3 A;  3MQ0 A;  3JTG A;  2DQL A;  2FNA A;  3Q5F A;  3GUD A;  3V7S A;  1YW7 A;  1SD4 A;  4YFX F;  3JTH A;  5LGN A;  4AIH A;  5JR3 A;  4XLP F; 
#chains in the Genus database with same CATH topology
 5F27 A;  2RVC A;  5D5V B;  4I01 A;  2FF4 A;  1FTT A;  2P6T A;  4R1H A;  2DK8 A;  2DFH A;  4LIT A;  4M3E A;  3OV8 A;  3CUQ B;  1CF7 A;  4HNV A;  3ZQH A;  1E3O C;  2CW8 A;  1J5Y A;  2I10 A;  5J4V A;  3E7L A;  3HDD A;  3EUH C;  3PNY A;  3WTX C;  4L18 B;  2E2H J;  1WCM J;  4IL6 C;  1IXC A;  2VXZ A;  3SDB A;  5BS6 A;  3OR2 C;  3S2D J;  3V7C A;  5D5W B;  1KU7 A;  4I99 C;  2VE9 A;  2WBM A;  3BR3 A;  2V6C A;  1MMA A;  1FNN A;  5DTD A;  4DGW B;  3VYT B;  4XM3 A;  1IRZ A;  1SFO J;  3WHB A;  2VON A;  3OYI A;  4KN4 X;  1W5T A;  1ACI A;  3IHU A;  1OPC A;  1LJ9 A;  3H35 A;  2B63 J;  3BTC A;  1QVT A;  1BA5 A;  3JRA A;  1OYI A;  5D5X B;  1V5G A;  3VOD A;  1ZGA A;  2OU2 A;  2VJ4 A;  2IGN A;  3TO6 A;  2EB7 A;  4XON A;  2IA0 A;  3RPQ A;  3HSE A;  4E7I A;  1BW5 A;  5ERI A;  3MMY B;  2R7D A;  3BG6 A;  4I76 A;  2Q8K A;  4KIT B;  1SVM A;  2BHZ A;  5CVR A;  2KIU A;  2Y2Z A;  2XAH A;  1HW5 A;  1ETO A;  4DZP A;  1MJB A;  2CQX A;  2LLK A;  1EH6 A;  2R0Q C;  4QPQ A;  4OIO F;  4M3D A;  3GW2 A;  2KJC A;  4A0Y A;  2PI0 A;  2ELH A;  2Q0O A;  3CDH A;  4CIC A;  1R9T J;  2VKH A;  3H5N A;  2HOA A;  4LLG F;  4W97 A;  1AWC A;  2E71 A;  2ME0 A;  5BNG A;  3N4M A;  4V19 K;  1ZR4 A;  5FJ8 J;  3GZ6 A;  1SD6 A;  4X6A J;  1R23 A;  2OD5 A;  1O3S A;  3O3K A;  1G8X A;  4RB1 A;  1QA6 A;  1R7J A;  2DA1 A;  2XAQ A;  3FXR A;  4GYG A;  4BQO A;  3G6E I;  3V7R A;  1BOA A;  1XMK A;  2YU3 A;  4RB0 A;  2EZL A;  3BY6 A;  4A12 A;  1XDU A;  3EET A;  3JW4 A;  1I39 A;  1WI9 A;  1JKP C;  4KIC A;  4ZYD A;  2BY2 A;  3I0T A;  4BAY A;  4IHY A;  2PJP A;  4UY8 I;  3W6V A;  1DPU A;  2DO7 A;  1UHW A;  3OS1 A;  3JSO A;  1VQO I;  4C30 A;  4OIP F;  2BGC A;  5LHG A;  1XS9 A;  4DOZ A;  2VBW A;  1XCB A;  3C3W A;  2M4K A;  2W48 A;  3CCJ I;  2F5D A;  3K1N A;  4A0X A;  4U0Y A;  3G3Z A;  5GAE J;  3ASN H;  1ZGW A;  4OWR B;  2IGO A;  2O8X A;  2EQR A;  4C2M J;  2X6W A;  3J7Y J;  4LLN A;  1IV6 A;  1DGR M;  4LB5 A;  5IT9 K;  2UUZ A;  1KYW A;  5EEH A;  2GA2 A;  1ONV A;  1X58 A;  3FWE A;  5J4Y A;  5M5X J;  2MLG A;  3OYD A;  3WTY C;  5HLI A;  3TBI A;  4ABZ A;  3LA3 A;  4IQ4 A;  4ESF A;  5IYD J;  3ZQQ A;  2XF5 A;  5M3M J;  2YX4 A;  2X1C A;  2P81 A;  4Y7N J;  3ZMZ A;  4BE1 A;  2MD5 A;  1RUN A;  4IX7 A;  3Q0W A;  5K5O A;  3E6C C;  2HI3 A;  5E3M A;  1QQI A;  2DOE A;  2NXN B;  4A3J J;  2EK5 A;  1BM9 A;  3AG4 H;  2CQN A;  4F3Q A;  1VF9 A;  3WG9 A;  3LFK A;  4IXA A;  3IRR A;  3TOB A;  5F6F A;  5ICE A;  2IJL A;  2L7K A;  3CCQ I;  4X1E A;  3D5R C;  3QPT A;  4MIM A;  4I7H A;  1TBX A;  3T8T A;  3GTG J;  2RV8 A;  5ICG A;  5DDG A;  4UVA A;  3S1N J;  1V3F A;  5H2F C;  5F1R A;  2O0Y A;  2W00 A;  3T1B A;  5EDN A;  2ZJR F;  1YS6 A;  4BY7 J;  2OAZ A;  3FM3 A;  1YJW I;  2R7X A;  2OJE D;  4MO7 A;  5TIS C;  3PFI A;  1WVR A;  1ZG3 A;  3SDG A;  4F92 B;  3A2K A;  1IC8 A;  1B59 A;  2O6G E;  3E3V A;  4L9T A;  3F6V A;  2IEK A;  4OIN F;  3M4O J;  5L3D A;  2UZK A;  4D5C A;  2JK3 A;  2BZT A;  5IOY A;  3TW6 A;  4E7K A;  1JKQ C;  2V1D A;  5HDG A;  4BAC A;  3DKX A;  3O8H A;  4MTE A;  1FY7 A;  3BC8 A;  5K7Z A;  2Z99 A;  1XGS A;  1FMW A;  3I55 I;  1TL8 A;  5DEQ A;  4RGU A;  4UUT A;  3S8P A;  1JUP A;  3E5Q A;  4PZJ A;  5E1W A;  2QYO A;  1TLH B;  5JVG F;  4QPO A;  1MH4 A;  2QWW A;  1YW9 A;  4S0H B;  1R5G A;  3SFZ A;  4XNF A;  1BJZ A;  2GAU A;  1DUX C;  1E0E A;  1XPX A;  4HRI A;  2M7A A;  2DFE A;  1GVD A;  1HXD A;  4Q5S F;  3BP8 A;  5F08 A;  2K9N A;  3CLO A;  1VTN C;  1K6Y A;  4EJW A;  1FLI A;  1G3T A;  4DYQ A;  1U5T A;  5GAD J;  3S14 J;  1MGT A;  3R0J A;  2LK2 A;  3KP2 A;  3O6B B;  2OA4 A;  1JKR C;  5F04 A;  1QBJ A;  3LSK A;  2LSO A;  3EYI A;  1W4M A;  4LG3 A;  2V79 A;  4RAZ A;  4A3F J;  1LFB A;  1T0F C;  1IN6 A;  3LOC A;  5L3C A;  1RKW A;  1O57 A;  1OR7 C;  4U87 A;  1BC8 C;  1FX7 A;  3HM5 A;  3RCO A;  2GLO A;  4A5N A;  4UUV A;  4CCO A;  3BPX A;  1M1E B;  2DN0 A;  3MZH A;  4BEH B;  1HLV A;  1BN5 A;  2RNJ A;  3MFK A;  3CC7 I;  1HKQ A;  2XAS A;  2DCE A;  1LEB A;  2JA6 J;  3BJ6 A;  3VDX A;  3F8F A;  3Q9V A;  4E70 A;  3G73 A;  2YPR A;  4DJA A;  2O8K A;  2MLK A;  1FOY A;  5EG0 A;  3CC2 I;  4XBF A;  4XR6 A;  4MFE A;  2WAE A;  4MGR A;  1XCV A;  1ZG1 A;  3ZQI A;  1U3E M;  1IZ1 A;  1SD7 A;  3NAU A;  2XPV A;  2ZME B;  4AWX B;  5J1Y A;  2EV6 A;  4AUX A;  4Y33 A;  1YHQ I;  4A2U A;  4B48 A;  1RKT A;  1T33 A;  2CW0 F;  3BZ6 A;  5E1Z B;  1HST A;  2K4B A;  1MNM C;  1Y1W J;  2DA5 A;  5FRO A;  3RKQ A;  3EDP A;  4HF2 A;  3PO2 J;  4HNU A;  4XSZ F;  5DM6 F;  4XLE A;  4EJV A;  2P7V B;  4NDL A;  1GXP A;  2QEX I;  4GFB A;  4ENJ A;  3OMY A;  1JI8 A;  1VQ6 I;  1LE8 B;  2Y0M A;  3TMO A;  4MTD A;  3JRI A;  3FKJ A;  1OCT C;  4AM3 A;  2DDB A;  2QCO A;  3QU6 A;  3R0A A;  2FX0 A;  1MMG A;  1A5J A;  4HEA 2;  5JFR A;  3ERE D;  1FJL A;  2KRC A;  2H27 A;  3NEU A;  3KZZ A;  4XN3 A;  2YS9 A;  1FIA A;  2EFO A;  3FXJ A;  2XRO A;  4OMY A;  1KON A;  2CYY A;  4ZYH A;  4BBR J;  2EZI A;  2OZ6 A;  2X4H A;  1DDN A;  4F7Z A;  4UVC A;  2X6X A;  2I5U A;  1MIJ A;  4Y3O A;  1XSX A;  1BR4 A;  1ZYR F;  2R7S A;  5EZG A;  2L5Q A;  2VPL A;  3EQL F;  2CJJ A;  2R92 J;  2VC1 A;  2QSG X;  1LPQ A;  4BNC A;  2ZSI B;  1XGN A;  2QKL B;  2YSR A;  1WH5 A;  4IHV A;  3G4S I;  1JGS A;  1GV5 A;  4L9V A;  4E7S A;  2FBH A;  2PQ8 A;  2ID3 A;  4HSR A;  5TRD A;  1E17 A;  1X3W B;  2QUF A;  1QNT A;  3DKW A;  2ZNY A;  2OCE A;  3QPH A;  3ASO H;  5E8G A;  5B66 C;  2D5V A;  3J7Z I;  3LSG A;  4OIQ F;  3HRT A;  1IN4 A;  4YIF A;  3J80 K;  5J1R A;  1J0R A;  3HTS B;  3QOE A;  2FML A;  1P6R A;  3GLL A;  3OYB A;  3E97 A;  1R49 A;  2LYC A;  4RB3 C;  3DTE A;  2GIZ A;  2CV0 A;  2W57 A;  1L0O C;  3IH2 A;  4YFN F;  2DPD A;  1ZK8 A;  3OOP A;  2EIM H;  2QBY A;  4C2T A;  3MWM A;  3S17 J;  2Q2E B;  3HXL A;  3ESW B;  4PDK A;  1OR7 A;  1KZH A;  2NVY J;  9ANT A;  5F64 A;  1PUF B;  1Z6R A;  3ABL H;  2X6Y A;  2MD0 A;  6PAX A;  1GV2 A;  2HDD A;  5CVU A;  3BZK A;  3MZ8 A;  2BW3 B;  1TW2 A;  2M2E A;  3GX4 X;  3ABU A;  1PDN C;  1ZLJ A;  1GXQ A;  2DA3 A;  2AS5 F;  4P9F A;  3K4C A;  5KCM A;  1RET A;  3LSP A;  3HEF A;  3RI4 A;  5IY5 H;  3ZN0 A;  3KFW X;  1T56 A;  2GQQ A;  1I1G A;  1O3Q A;  4BHC A;  3F9K A;  2FXA A;  2PMZ A;  2G9W A;  3KP7 A;  1L3L A;  1FYK A;  1F4K A;  1B4A A;  4EJT A;  2BHY A;  4UV8 A;  2EZH A;  2X1D A;  3GFL A;  2Z9O A;  5C4X J;  2KIQ A;  3QWL A;  3RYR A;  2V1N A;  3GBG A;  3FX3 A;  2HOS A;  4UV9 A;  3DBH B;  2HVQ A;  2OQG A;  2MC4 A;  2R5Y A;  2K5C A;  4CXF A;  1R1U A;  2XSJ C;  3TW7 A;  1SAX A;  1D0X A;  2R5Z B;  2LOO A;  2VOO A;  4IF4 A;  2FMY A;  2HQA A;  5L3G A;  3RZO J;  4NC8 A;  2K9Q A;  1CGP A;  3ML6 A;  1VQM I;  5BPD A;  3LNQ A;  4KNY A;  4V2G A;  3S1M J;  1AHD P;  2K40 A;  1TWA J;  2KMU A;  2Y48 A;  1YIO A;  1O4X A;  2PBI A;  2R5Y B;  4KMF A;  5E18 F;  2HQN A;  2A69 F;  4LFU A;  3HB9 A;  2FOK A;  1WJD A;  1POG A;  5ED4 A;  3KE2 A;  2XHK A;  2IA1 A;  3GTM J;  4BL0 B;  1MBJ A;  3H9Q A;  1ITY A;  4HQE A;  3S3M A;  3AG2 H;  3UNG C;  1JGG A;  3KYD B;  4Y52 J;  4HPQ A;  4ZTF A;  1MW7 A;  1XG1 A;  3M8J A;  3DCF A;  2OTJ I;  3CJQ B;  2EWN A;  2L02 A;  3D5L A;  4M9S A;  1TWC J;  3S3O A;  3DLA A;  3I4N J;  2DQR A;  4BGD A;  4BJT A;  5LLQ A;  1C0W A;  2L7M P;  2NVQ J;  5ILS A;  1G59 A;  5CQE A;  2M0M A;  2VAS A;  1BC7 C;  3JAM K;  3TO7 A;  2HDW A;  1SFK A;  4RAF A;  3LST A;  2M0C A;  2VBZ A;  3F8C A;  4YFK F;  4ENM A;  2D2W A;  1I1S A;  2MW8 A;  1RPW A;  2VJ5 A;  3HTU A;  5B1A H;  4LMY A;  3TDU C;  3PNT A;  1ON1 A;  1WPK A;  1QGP A;  2OC6 A;  2BW3 A;  4LIV A;  1H9T A;  2ZB9 A;  2K85 A;  2FU4 A;  1QPM A;  3PQJ A;  2L2O A;  4LOC A;  2ELJ A;  1OIS A;  2ACJ A;  4FX4 A;  4LGW A;  3CUQ A;  3DTK A;  3R61 A;  5K1Y A;  2NVT J;  1LFU P;  3DWL E;  4I98 B;  2L9V A;  1OQY A;  2VUM J;  3IWF A;  1V5E A;  2O5R A;  1PYV A;  2GM4 A;  4W1U A;  1RC9 A;  1S7E A;  3DTI A;  3PSI A;  1JJ6 C;  1B72 A;  1PUF A;  1EH8 A;  1YW8 A;  4X0G A;  3GWZ A;  5FD6 A;  1YI2 I;  3QU3 A;  1MJA A;  1GUU A;  4P9U A;  1PP7 U;  3VSL A;  3BPV A;  4AYB N;  2X85 A;  1NTC A;  1R36 A;  2CQK A;  4XLF A;  2VL8 A;  3ABM H;  3AFH A;  3LSH A;  2HNH A;  5K7F A;  3KEQ A;  2NS8 A;  4N0B A;  2M34 A;  2L4M A;  2HYJ A;  4FE7 A;  1YIJ I;  4XQF A;  1FSE A;  2DMP A;  2VKV A;  1HW1 A;  1SFX A;  4QLC U;  2IS2 A;  1HW2 A;  3OSF A;  3FMQ A;  1JHF A;  2V9V A;  3N05 A;  1IUY A;  1P7J A;  3QYE A;  3VSK A;  2Y9Z A;  1ZHF A;  2KT0 A;  1R4N B;  2EH3 A;  3FK7 A;  3H1C A;  1Y8R B;  5B5E C;  4CH7 A;  2VBY A;  3GTP J;  4XMY A;  4DNC A;  3BG5 A;  1H89 C;  1IW7 F;  2LKX A;  3ZQ7 A;  4ANJ A;  2Z5U A;  3O8G A;  3QPL A;  3CO7 C;  2Z2S B;  5LRR A;  3DP7 A;  4BS9 A;  2FD5 A;  2E7W A;  2ECB A;  4I02 A;  1FTZ A;  4ZYA A;  2WY7 Q;  3PJR A;  3RPU A;  2VB6 A;  4GXO A;  3FXM A;  4KMU X;  3C2B A;  5EEA A;  1P4X A;  2QBY B;  4DYC A;  3JRB A;  2CRG A;  3MZY A;  2DW4 A;  1XB4 A;  4BUP A;  1WHU A;  1SEU A;  3GFJ A;  1FOX A;  3BZC A;  1X4O A;  4BXU A;  1BBY A;  1F9N A;  3CTA A;  3GXO A;  1H88 C;  1HCR A;  3CZ6 A;  4L5I A;  1XN7 A;  3P9K A;  3K4K A;  2H1L A;  4D7N A;  2A6E F;  4IRG A;  3KYC B;  2QEN A;  3H36 A;  3E0J B;  2ADU A;  1D1A A;  4JX4 A;  4KIS A;  1R71 A;  3H3Z A;  4D5F A;  2X48 A;  1LDK B;  4HLX A;  4EJO A;  5CVI A;  4ZTJ A;  1EF4 A;  2DYS H;  1UAA A;  3ZMT A;  2NS7 A;  3UR3 C;  3D1N I;  4UVB A;  2L9N A;  2B7E A;  4ZYE A;  3E6D A;  1XDS A;  3EYY A;  3CC4 I;  4V2F A;  2PMZ N;  2EIK H;  4N4N B;  5DUK A;  4XOP A;  1JXS A;  2E5Z A;  3L2W A;  4PCQ A;  2JA8 J;  2CWE A;  3WGI A;  2IS6 A;  3FXO A;  1Z21 A;  4FHT A;  3DKY A;  1B9M A;  1DP7 P;  2XC7 A;  1ETW A;  3BT9 A;  1GT0 C;  4A93 J;  1S29 A;  2MBF A;  1UJ8 A;  2ZJ2 A;  3FXK A;  4TV7 A;  5F1J A;  3LQR A;  1Z7U A;  1QRY A;  2DA6 A;  3K4M A;  2LKS A;  4I2O A;  1ZGJ A;  4EEF G;  5A2Q K;  3GTL J;  3HOZ J;  2G7H A;  2CV2 A;  1AU7 A;  1GVJ A;  2BBY A;  1UST A;  1SC7 A;  5HOO A;  1Z91 A;  2F4M B;  3MKZ A;  1Y8Q B;  3BOQ A;  4PJL A;  1LUJ B;  2V9P A;  4FCY A;  1HKS A;  2L01 A;  2O03 A;  2W85 A;  4PUS A;  2R5Z A;  3ZP5 A;  1UHS A;  1MBK A;  2GOM A;  5EZH A;  3OYJ A;  3OYG A;  1IJW C;  4LK0 F;  3VEP A;  2DT5 A;  1FC3 A;  2X9D A;  5IP6 A;  2H6C A;  3ECH A;  3L09 A;  4XKW A;  1OMI A;  5D5U B;  2XAF A;  1HDD C;  3QPS A;  3WTW C;  2IRF G;  2TDX A;  5IYB J;  3CDI A;  2AQF A;  3HRU A;  3PQK A;  1RUO A;  1D3Y A;  4LJZ F;  1HSJ A;  4RGS A;  3GVA A;  3HL2 A;  3HOT A;  2YX7 A;  4PJ0 C;  2DMU A;  4DBR A;  3HKZ A;  4IO9 F;  1MDM A;  3HSR A;  5IP7 J;  4XOR A;  2DT7 B;  3A4C A;  2VKD A;  1D1B A;  4MLO A;  3RKY A;  4BHP A;  1TWF J;  4L5J A;  1DU0 A;  3CME I;  2HDC A;  1NK3 P;  5H6Q A;  2A07 F;  2BY3 A;  3FXQ A;  1E3P A;  3L7W A;  5IT9 Z;  1KA8 A;  1Q1V A;  1YJ9 I;  1RZ4 A;  2VC0 A;  5GAH J;  2M9H A;  3ZMS A;  2HZT A;  2HU9 A;  2LY9 A;  4AVZ A;  2Q2E A;  2QKM B;  1MSF C;  2MG4 A;  3FHZ A;  3LAJ A;  4XIC A;  4YRV A;  4NNJ A;  2W4S A;  3VB2 A;  4BQQ A;  4EQQ A;  2Z33 A;  4BU2 A;  5TGT A;  1ULY A;  3BWG A;  3RJP A;  3MKY B;  3J7A Y;  2W1O A;  3K4B A;  4F52 A;  4ZJZ A;  5LHI A;  3SJM A;  1KQ0 A;  4BDZ A;  5ICF A;  4M6V A;  1H8A C;  4Z6Y A;  4ESJ A;  2H1K A;  2DI3 A;  3CMA I;  2W84 A;  3OWT A;  1WSU A;  1OLT A;  2XB0 X;  4N9I A;  4CDG A;  2EIL H;  1K78 B;  2DTR A;  3TP3 A;  4S04 A;  3I5U A;  3JRG A;  1MND A;  1AKH A;  1MNE A;  1D0Y A;  2K4J A;  2K9L A;  3M8E A;  3VWB A;  4CHU A;  1APL C;  1R5H A;  1JUM A;  2BVL A;  1QVU A;  1WRJ A;  1WFX A;  4XKV A;  2LF8 A;  2BOL A;  1YX5 A;  2VE8 A;  3S3N A;  3E5X A;  2KHM A;  4UUS A;  3QP5 A;  4M71 A;  5LFA A;  2VLA A;  4IKF A;  5ICC A;  1I50 J;  1DQU A;  2HQ5 A;  1X1A A;  3SYT A;  4GRI A;  3M07 A;  4LB6 B;  1IAW A;  4F91 B;  4ZDO A;  4PJM A;  2COB A;  3EUA A;  1FMV A;  4G6T B;  4OMZ A;  4WXC A;  2DFI A;  2GZW A;  1STZ A;  2LBF B;  2PLY A;  1S3J A;  1P9Q C;  1WJE A;  4IEJ A;  2W7N A;  2R7W A;  5E3L A;  2K9M A;  1MBF A;  2VT2 A;  1FYM A;  1Y0N A;  2HEO A;  2Z3Y A;  2DPU A;  2R7U A;  1E3H A;  5D6E A;  5LRS A;  2E1N A;  5LEK A;  3CUO A;  1UB9 A;  3WTT C;  1D5V A;  3ERM A;  4M72 A;  2PJR B;  3EPZ A;  3OR1 C;  2A6H F;  1J7K A;  2DJN A;  4UB6 C;  1LE8 A;  1G3Y A;  3G71 I;  4KIG A;  5B3S H;  1XMA A;  2MSY A;  5AIP A;  1Z3X A;  2P4W A;  4ENK A;  1U2W A;  3RQI A;  2VBX A;  1HOM A;  3GZN B;  2M8G X;  2HPI A;  1Y1V J;  2G7U A;  4FAS D;  1OCC H;  3RZD J;  1UEL B;  1GDT A;  2GBY A;  2KFD A;  2VOD A;  2A61 A;  1BL0 A;  3KZY A;  1IO2 A;  2OTL I;  1V4R A;  3CMM A;  4PJN A;  2E60 A;  4D0P A;  3F8N A;  1U9N A;  1ZAR A;  5FGM A;  2L3D A;  5C44 J;  3R4K A;  2VXD A;  3IAM 2;  4D7M A;  3I58 A;  3DPL C;  3EUK L;  4J00 A;  1XTA A;  4Y15 A;  3DEW A;  3J7A O;  4EV0 A;  2Z16 A;  4IRI A;  2Z1D A;  4BHB A;  3REO A;  4JBA A;  3KIO A;  3I71 A;  5DS9 A;  2Y30 A;  5DM7 F;  1NH3 A;  4P5O A;  2STT A;  4HNT A;  1RI7 A;  3CCR I;  5F0C A;  5EYR A;  4QWQ A;  4G6D A;  1QZE A;  2XAU A;  3A1Y A;  4M3B A;  1R22 A;  4HX8 A;  2F4I A;  2WAD A;  3I53 A;  5E1X A;  5D4S A;  1U5T B;  2HFH A;  4ZDL A;  2JQ7 A;  2Y0S A;  2OV7 A;  1K79 A;  5FLV A;  4HF0 A;  1DP3 A;  1WJA A;  3ZMV A;  1N78 A;  4DYR A;  2MH9 A;  2IA2 A;  3JSP A;  5GTI C;  3CMY A;  2Y0S N;  4S05 A;  2OZU A;  4OIR F;  4NUB A;  2COM A;  4XKC A;  2OUM A;  4M3G A;  2R7Z J;  1ETX A;  3CF2 A;  2QQ9 A;  2EIN H;  4HV6 A;  2ISY A;  4CCK A;  2P6S A;  2KPM A;  3DBR B;  5ILV A;  3K9T A;  5HNF A;  1ZN2 A;  4HZF A;  4II3 A;  2VN2 A;  1U5T C;  3KCC A;  1W36 C;  1P92 A;  3FMS A;  1K78 A;  3PIP F;  2XB5 A;  3GO5 A;  4AYB A;  3I56 I;  2JMW A;  2B0L A;  2WV0 A;  1G2H A;  2DLL A;  3OYC A;  1X3Z B;  5CVV A;  4CZC A;  1X3U A;  2NNN A;  2VQC A;  3WOD F;  3FF5 A;  3H5A A;  4IOC F;  4UUS B;  5J6X A;  2D1V A;  3K4J A;  1SMY F;  3DEU A;  3V4G A;  3TL4 X;  3OYE A;  1IDZ A;  3JAM Z;  3LA7 A;  4EMS A;  1FP1 D;  3ABK H;  3FIW A;  1YIT I;  3KYL A;  1FBQ A;  1TC3 C;  5AON A;  1BIA A;  2VQL A;  3DBL B;  3EUH A;  5E20 A;  3MVP A;  2A6T A;  3TDZ C;  2PG4 A;  3HOU J;  1SAN A;  4WCG A;  1BIB A;  1VQN I;  4IHT A;  3AAF A;  2X51 A;  2KRH A;  3QOP A;  2BEO A;  2M87 A;  3HRM A;  3N97 A;  2HKO A;  2ECC A;  5FB2 A;  1NG6 A;  4IJA A;  1R1T A;  2LY1 A;  1S6L A;  2K3P A;  3WTV C;  3CCV I;  3BG3 A;  4G12 A;  2VJJ A;  2VT3 A;  2FEZ A;  2QQB A;  3K2A A;  4U7D A;  3ZPL A;  1D1C A;  1F36 A;  2L9R A;  4AIK A;  2WAQ N;  5FLM J;  4DZJ A;  5IYC J;  3CD6 I;  3MAJ A;  5IOZ A;  1K6O A;  4EM1 A;  2PMH A;  3OSG A;  1Z05 A;  3OY9 A;  3G1M A;  5E3N A;  4BY1 J;  5E79 C;  3MKW B;  4P96 A;  5E17 F;  4XKB A;  3DPU A;  5LEJ A;  2WWY A;  2F5C A;  4XID A;  1I6H J;  3E5U A;  1EJ9 A;  1T38 A;  1JT6 A;  2A3S A;  2V1X A;  3A0H C;  1FYL A;  3HOW J;  1FSH A;  1WQ2 A;  5CYV A;  1TTY A;  3I3L A;  1X1B A;  5FFZ A;  3H92 A;  4RM2 A;  2FUG 2;  2N8G A;  1FWZ A;  1WJ5 A;  4MEX F;  3C1D A;  2KDZ A;  1KU9 A;  3WHC A;  5KAF C;  5DUI A;  1A6I A;  1Y56 A;  4Y17 A;  4KN7 X;  4CZZ A;  1YJN I;  3E6B A;  1FT9 A;  4ZH4 F;  2FQ4 A;  3V8L A;  3CCU I;  2ZC2 A;  2M45 A;  2VJI A;  5IT3 A;  2HTS A;  1D8J A;  4IOA F;  1TQM A;  2EV5 A;  1QPI A;  3GCM A;  2TCT A;  5H6R A;  1N77 A;  1BOB A;  1LKX A;  2EA2 A;  3D5S C;  3ZRG A;  2R7R A;  3WGH A;  3K10 A;  3PSF A;  1UZC A;  4J19 A;  2W25 A;  2JUC A;  3OYN A;  2BY0 A;  1LVA A;  2LVS A;  5FD5 A;  1JE8 A;  2UXX A;  1HDP A;  1W1W E;  2QF7 A;  2L4A A;  1BI3 A;  2LMD A;  2ETH A;  5ILU A;  4RGR A;  1IRG A;  3HIF A;  4RBO A;  2F5E A;  2TRT A;  1MJ9 A;  1G3W A;  2XIG A;  1Y0U A;  3R6S A;  2BXZ A;  1YE9 A;  2M30 A;  3KP6 A;  1WH7 A;  1MBG A;  4AD9 A;  1VQL I;  1W7P D;  1VQ5 I;  3BJO A;  4RGX A;  4HDV A;  4M73 A;  3A01 B;  4ENN A;  2DOA A;  3L2U A;  1TW3 A;  2PX9 A;  2R93 J;  4IHS A;  2QLZ A;  3PUB A;  5EF6 A;  3HJE A;  5HNH A;  2YUS A;  5HS9 A;  5FKM A;  1U8B A;  2JVG A;  3COA C;  2QVO A;  4FE4 A;  4O3M A;  1ZH5 A;  2DDA A;  3CCS I;  3F72 A;  3G1O A;  4ON0 A;  2E1O A;  5HVQ C;  1HQC A;  3HYI A;  3WGG A;  3J81 K;  1YOV B;  2XDV A;  2V26 A;  3KEO A;  2ZCW A;  2E1C A;  1VZ0 A;  2P5L C;  3CCL I;  3LFU A;  2DA7 A;  1J9I A;  4P1W A;  5EGO B;  2L54 A;  1JJ8 C;  1W0U A;  3IH4 A;  2HVS A;  2G0E A;  3CP8 A;  5J8C A;  5L3E A;  2FE3 A;  4RM3 A;  3K4N A;  2NOJ B;  4KYW A;  3LL7 A;  4XRS G;  4G7O F;  2A68 F;  2K9S A;  2IP2 A;  4L0Z B;  3OYM A;  3A03 A;  4N4O B;  2R7Q A;  1ZKG A;  2JPC A;  1P4W A;  4BE2 A;  2QQA A;  3KLN A;  3DV8 A;  4XLA A;  1RRJ A;  4CO8 A;  5JVT A;  1A35 A;  4HG2 A;  2DJI A;  1ZRE A;  2R7V A;  4HF1 A;  2V6E A;  2FJ1 A;  1ENH A;  2RC4 A;  3S16 J;  2VI6 A;  1UHM A;  3ZXS A;  4OOI A;  2HS5 A;  1E2X A;  2M3A A;  1P2F A;  2CS3 A;  4FTH A;  4HX4 A;  4FX0 A;  2CSO A;  4B44 A;  2JA7 J;  1UG2 A;  1SFE A;  3SXY A;  3VPR A;  2HZD A;  3H9J A;  4MQ9 F;  4WK8 F;  2XSD C;  2M8E A;  2WC2 A;  2DT6 A;  2GWR A;  5J8F A;  3I54 A;  1EH7 A;  3NRV A;  1B9N A;  4E4H A;  4G7Z F;  5J40 A;  1XC5 A;  2E7X A;  1UG0 A;  1J75 A;  2P5K A;  2H94 A;  4NBQ A;  3M7G A;  2LC2 A;  5AIQ A;  1IF1 A;  4CYC A;  1O7F A;  4UNO A;  2QM3 A;  4CA0 A;  2CG4 A;  1WJB A;  2A5W A;  1J59 A;  2A5Y B;  1ZQ3 P;  3KLO A;  3L2V A;  2IW5 A;  3OIP A;  4L0Y B;  3CQZ J;  4LLL A;  4EJU A;  1JTY A;  2EFP A;  2NAZ A;  3HPG A;  4OU0 A;  2NVU B;  1OCR H;  2GIV A;  1K61 A;  1GLN A;  1NK2 P;  1FBS A;  2KZV A;  2XKO A;  3E1S A;  1BR2 A;  3S93 A;  2XGC A;  5M3F J;  3CCY A;  4OAZ A;  4M6X A;  3IKT A;  4I0A A;  3QAH A;  2FQ3 A;  3K69 A;  3ZN1 A;  3RSN A;  3CCM I;  1W0T A;  1NG7 A;  1R00 A;  3OIO A;  1T2K A;  2DA4 A;  3OS2 A;  1A6Q A;  4LIU A;  1G4D A;  3H0D A;  2ZFW A;  1R58 A;  1UMQ A;  2DOD A;  2HYG D;  1SD5 A;  2ZO4 A;  1OYY A;  3F8M A;  3HZJ A;  4XRF A;  5IPA A;  4A6D A;  2EJR A;  2AHQ A;  4A3G J;  3MD2 A;  3HKZ N;  1K4S A;  3GTQ J;  1YQA A;  4BH9 A;  4KT6 A;  3E6M A;  1KU2 A;  3WE3 A;  5HOD A;  2HGC A;  2E5N A;  3FKI J;  1FZP B;  2GXB A;  3TOA A;  1XSD A;  4A3C J;  3I64 A;  1K83 J;  3ZGK A;  3KP4 A;  5D8K B;  4NC6 A;  1U9O A;  5C3E J;  1BI2 A;  2JTV A;  4KIF A;  1EV7 A;  4IRH A;  1X1D A;  2LKP A;  3GME A;  1QU3 A;  2VQH A;  2EA4 A;  2BE5 F;  2IGM A;  2WAQ A;  3U21 A;  3K0L A;  4XLC A;  3JCU C;  2BY1 A;  2QA4 I;  1FOW A;  4YG2 F;  4BYY A;  5GTH C;  3MCZ A;  3A01 A;  2I8D A;  2ZBK A;  4GGG A;  3TGN A;  3W2V A;  2KIS A;  3NWT A;  3WU0 A;  1SVL A;  3ZQL A;  3I59 B;  2JWT A;  3ZQG A;  2NYX A;  3WTZ A;  5DD8 A;  1PJR A;  3LSJ A;  1W5S A;  3CDL A;  3DF8 A;  3X2Q H;  4BEH A;  4IHW A;  1MKM A;  3FZV A;  1YS7 A;  1OCZ H;  2HXI A;  2L0K A;  1ZG5 A;  4EGZ A;  2ZNZ A;  2ID6 A;  1I27 A;  4LK1 F;  5DYM A;  1ETQ A;  3SEZ A;  1BR1 A;  2ZXH A;  3CJT B;  2CO5 A;  3VYR B;  3GEZ A;  3PUF A;  1F1Z A;  4LD5 A;  5LGT A;  4HOB A;  4BBS J;  2W82 A;  1H9G A;  1MSE C;  4JOM A;  5HLG A;  1EA3 A;  1H0M A;  5TJJ A;  3U1K A;  4RAY A;  1VI0 A;  2KIF A;  4M74 A;  1WWX A;  5FKL A;  5BQT A;  2K3F A;  4AIJ A;  3OL4 A;  4NB5 A;  1P4A A;  3BR2 A;  3ABT A;  2HVR A;  1GHC A;  2XGE A;  3TKY A;  3P9C A;  3HOY J;  2R7F A;  1ZRC A;  3OS0 A;  2FRH A;  2HWV A;  5BMZ A;  4QIW N;  1YG2 A;  5FRN A;  3VYU B;  2ZSH B;  3L9F A;  4EAT A;  3W6K B;  3BLY A;  4ITV A;  3W6J B;  3KX2 A;  3V8J A;  4PSX A;  2DOF A;  3SZP A;  1MBE A;  3CJR B;  3BR6 A;  3HBL A;  2YU9 J;  4O5V A;  3WE2 A;  2CW7 A;  3S2W A;  5DCF A;  1OJL A;  5GPC A;  3OIQ A;  4OAY A;  3H9G A;  3LSR A;  1UCR A;  4I6Z A;  3IC7 A;  1BJA A;  2EFW A;  3HPH A;  4ZYG A;  4Y4R A;  3KET A;  2CFX A;  3K4L A;  1X1C A;  2K02 A;  1T8I A;  3BTI A;  5CVJ A;  2JUG A;  4XRM A;  1F5T A;  1OYW A;  4KA4 A;  3B73 A;  3C2H A;  4GYI A;  4HA8 A;  2O61 A;  1AKH B;  3LWF A;  2LDU A;  1D0Z A;  5KK1 A;  5CLS A;  4CCM A;  4XN0 A;  2BV6 A;  2VIX A;  2WAF A;  1RES A;  1AOY A;  5DD4 A;  2E1M C;  2IPQ X;  2JT1 A;  3R60 A;  1YRN B;  2MFZ A;  4B4C A;  2JPB A;  2PEX A;  4ZZL A;  2MGQ A;  2L7F P;  5D8L B;  2H6B A;  3L1P A;  2O7O A;  2Y9Y A;  3P9I A;  4UB8 C;  1ETK A;  3PFY A;  5GPA A;  2ZXJ A;  2HTJ A;  4QSH A;  3JRE A;  1ZLK A;  2CQ7 A;  1Y6I A;  3LMM A;  1U78 A;  2BYV E;  1U0J A;  3IV5 A;  1QZZ A;  4UHT A;  2B9S A;  4BQA A;  3BQZ A;  2FNP A;  2FSW A;  3GZ5 A;  4RLQ A;  2HKX A;  4HQM A;  1ZRF A;  3GF2 A;  3MN2 A;  3BQY A;  2E1M B;  1XMX A;  3ZR8 X;  3QOD A;  2XGX A;  3Q9S A;  1MDM B;  2XRN A;  1ZTR A;  3DEE A;  3W2A A;  2E36 A;  1O3R A;  2P5V A;  3HRS A;  1IRX A;  2NS0 A;  2QGU A;  1Z67 A;  2O3F A;  2K7L A;  3M9A A;  2L9S A;  3K7A J;  4CYD A;  2MA3 A;  2OPT A;  2ZME C;  3FXU A;  2VPR A;  3FMR A;  4G9Y A;  4ETS A;  3HHG A;  5LHH A;  3WTU C;  4RA2 A;  5CPR B;  2O9L A;  1IXR C;  4IVN A;  3QQA A;  3ZQF A;  4RAG A;  4C3I J;  1YTY A;  3DU6 A;  1P7I A;  4CCL A;  1YFH A;  2KDO A;  3RKW A;  3C7J A;  1LB2 A;  2KKO A;  2JA2 A;  3IL2 A;  1X2M A;  1Z0X A;  3OYL A;  4F55 A;  4JX5 A;  2C6Y A;  4KJZ A;  1XSV A;  4A3B J;  2DAO A;  2EV0 A;  2R4G A;  1O7L A;  2IVM A;  2JJ7 A;  3JRD A;  1OCO H;  2RDP A;  5KHD A;  1R6R A;  2CUF A;  4MHG A;  2R7T A;  5CJ9 A;  1LDJ A;  2XVC A;  5L3B A;  1K7A A;  2E2J J;  1WJC A;  5M5Y J;  1WZ2 A;  4AID A;  4XSX F;  2PN6 A;  2AQE A;  2CGP A;  4XRS A;  3CLQ A;  1IN8 A;  3T8R A;  1Z7L A;  5F0F A;  5JLW A;  3K2Z A;  2CQQ A;  2KZG A;  2WB1 N;  1WJF A;  3RPU D;  3ZCO A;  1MMN A;  4BDY A;  1CQT A;  1TZL A;  2DMQ A;  2RQP A;  1BW6 A;  1TNT A;  1ON2 A;  2LBF A;  5CQG A;  3DFG A;  3RKX A;  5M5W J;  4FQG A;  2HR3 A;  1DU6 A;  2LR8 A;  3QRF F;  3L2Q A;  5DCM A;  3LSI A;  4M9Z A;  4PFO A;  1TWH J;  4Q47 A;  5FKN A;  4HW0 A;  1IGN A;  3IAS 2;  2W24 A;  1KQ8 A;  4RMN A;  2NNY A;  4YEL A;  1T98 A;  3F8B A;  2Y75 A;  3FK6 A;  3FIS A;  3F23 A;  1IV8 A;  2Y69 H;  4N9H A;  1D8K A;  1S7O A;  2AO9 A;  3A0B C;  3G2B A;  1MH3 A;  5KVR A;  1W7P A;  2ZKZ A;  3P5J A;  5B1B H;  2QQ8 A;  1I3A A;  4YEJ A;  4G8X A;  3M1E A;  3VYS B;  3AKZ A;  2WY8 Q;  2DMT A;  5FO5 A;  3VOE A;  4I09 A;  2P7C B;  4HV5 A;  1PUE E;  4GDF A;  5EG0 B;  1VQ4 I;  1MMS A;  2IS1 A;  4NQW B;  3CJN A;  4BE0 A;  3ROU A;  3K6G A;  3KZI C;  4GO1 A;  2JZY A;  2EZK A;  1XGM A;  3FBI B;  5C4J J;  4XL9 A;  5JHU A;  4XOT A;  2EBI A;  4L9N A;  4GCV A;  3IP4 B;  1ZRD A;  4DQ2 A;  1OCP A;  3RTR A;  4CCN A;  1I3Q J;  2PMU A;  5CKT A;  3H0G J;  1ZR2 A;  1B8I B;  5EEG A;  3NQO A;  4UXN A;  4B3X A;  4DIQ A;  5A2Q Z;  4NQW A;  2LFB A;  4EM0 B;  1X19 A;  1HA8 A;  2ME6 A;  2XAJ A;  2XAG A;  4KFC A;  1HF0 A;  5HDK A;  5JI6 A;  1LQ1 A;  5J3L A;  1A31 A;  4O6J A;  4PJJ A;  5EJC A;  4H0E A;  4Q4Z F;  3OOU A;  1WGX A;  4IPA A;  4PGH A;  3AG3 H;  1K4T A;  2IGK A;  2E19 A;  2F4O B;  4CUG A;  4Y13 A;  1WI3 A;  3V8K A;  4U0V A;  2LD5 A;  2J5P A;  3U2R A;  3SEQ A;  4G7H F;  3S1R J;  2E35 A;  1IDY A;  1G3S A;  4RDU A;  2GXA A;  4A3L J;  2LRD A;  1PVE A;  5J47 A;  3OYH A;  1EKE A;  1XD7 A;  3Q0U A;  4JQF A;  2ICW G;  3F3X A;  2FBK A;  3M1C A;  3CO6 C;  3ECO A;  1DGW Y;  2IT0 A;  3FXL A;  3P7N A;  1FOK A;  1XX5 A;  2WTE A;  2XPU A;  5HS7 A;  2AXT C;  3JRC A;  2EPF A;  4ZZD A;  1HKT A;  2XUB A;  5FRM A;  2FOW A;  2AXL A;  4RLF A;  4L5E A;  5HLT A;  1B1B A;  3IKV A;  1X4P A;  3KP3 A;  4A0Z A;  3I4M J;  3S15 J;  2V4J C;  1IRF A;  1LVK A;  2YR2 A;  4HX7 A;  2LH9 A;  4A3M J;  3KP5 A;  1U8R A;  3AL0 C;  1BI0 A;  1ORK A;  4EM2 A;  1W7P B;  2X0L A;  3WU1 B;  1VQ8 I;  3B02 A;  3GYH X;  1YYV A;  2ZXI A;  4AC0 A;  4HYE A;  3S2H J;  1R1V A;  3S32 A;  2CUE A;  2XGD A;  2JRT A;  2GXG A;  2JRM A;  4B8X A;  3JR9 A;  4KT5 C;  1YO5 C;  1JHH A;  2X6O A;  1B6A A;  1J09 A;  1VND A;  3K1P A;  2X1E A;  4I0B A;  4WF2 A;  3G1L A;  4BQN A;  4IHX A;  3AL0 B;  2CMP A;  1TQP A;  2VQG A;  2F5F A;  3Q3S A;  1S8N A;  2F48 A;  3J81 Z;  3OYA A;  2OF7 A;  4NC7 A;  3IRQ A;  2ZME A;  1MMD A;  4G94 A;  4JX6 A;  2UWM A;  4L9J A;  1VFC A;  2JVH A;  5FLX Z;  1S5L C;  2KIM A;  1BI1 A;  3WG7 H;  2ESN A;  3I9V 2;  1ODD A;  4WXH A;  3BR0 A;  2DK5 A;  4A3K J;  3HOV J;  2LRE A;  4EVI A;  2QSH X;  2ELK A;  3FBN B;  2PFB A;  1RNL A;  1FIP A;  1IXS B;  1S9H A;  2KQR A;  3PNV A;  1FPQ A;  2E2I J;  4XLN F;  1MBH A;  5GP9 A;  5D6F A;  2XRL A;  1RR8 C;  4A3I J;  5JHF A;  5K5Q A;  1MD0 A;  2WB1 A;  2KRF A;  2MH2 A;  2EFQ A;  4ZC3 A;  3DXJ F;  1T95 A;  3DU5 A;  1Z1D A;  4CCJ A;  3SQN A;  1G6N A;  3IWZ A;  4PGG A;  3BTJ A;  3GFI A;  2DTZ A;  5F0H A;  4WX9 A;  4A3D J;  4BXX J;  3HG9 A;  1ERD A;  1FBU A;  2JA5 J;  5HLH A;  1V54 H;  2P8T A;  1KYZ A;  3HUG B;  5FKO A;  2ISZ A;  2VKE A;  4HLY A;  2KL4 A;  1I5Z A;  5J1U A;  4KIB A;  1ZAO A;  4B3A A;  4XK4 A;  3FM5 A;  2R7O A;  2WV1 A;  2CH0 A;  4H4K C;  4QTR A;  1A36 A;  3T5X A;  3HOX J;  1TNS A;  1KQ9 A;  2LF7 A;  2MAB A;  1T0F A;  3SZG A;  4B09 A;  4B43 A;  3SHF A;  4WXD A;  2HYF A;  1X2N A;  4PFP A;  1JKO C;  3LQQ A;  4JP0 A;  1DPR A;  3T0Y A;  1ETY A;  2XPW A;  2RAE A;  3RIR A;  2M5W A;  4BJ6 C;  3GLX A;  4RB2 C;  2KP6 A;  2LTP A;  3VFZ A;  4DBQ A;  4FT8 A;  4C2U A;  3W2W A;  3DLL F;  3DQV C;  1VQ7 I;  4YIR X;  4E7J A;  2DBB A;  4XLH A;  3SZT A;  4MQV A;  3JRH A;  4LG0 A;  3MEX A;  4ZDP A;  3GFM A;  3CES A;  4IQJ A;  1LFP A;  1LDD A;  1AA7 A;  2F6C A;  4U0W A;  4C3H J;  5D4R A;  1TT0 A;  1USS A;  2IXS A;  5HDN A;  1TP4 A;  4E7H A;  2DXI A;  2VOP A;  3U9G A;  2LY2 A;  2K27 A;  4PSW A;  1A04 A;  4Q48 A;  5FKK A;  3HC7 A;  2Y31 A;  1REP C;  4MEY F;  3Q0V A;  5JLX A;  2D1H A;  1JT0 A;  3HGY A;  3ELK A;  1Q1H A;  4LG0 B;  5FLX K;  3S1Q J;  4E7Z A;  3OL3 A;  3CP2 A;  3NWS A;  3JRF A;  4G6Q A;  3WU2 C;  4BXF A;  1IG7 A;  4U7B A;  4HST A;  5K7H A;  5E3O A;  5HS8 A;  4R8H A;  1TT5 B;  2RGV A;  2UXN A;  1ETV A;  5GAG J;  1ZEL A;  3BCA A;  2XF6 A;  3V42 A;  2CFO A;  4CGZ A;  5BOX A;  2MC3 A;  5E8I A;  4PK4 A;  5FFX A;  1D5Y A;  3KPH A;  4KUM A;  1UFM A;  4IZZ A;  1YLF A;  2D45 A;  3ZMD A;  1Z9C A;  5H20 A;  2FBI A;  3B6C A;  1CF7 B;  2XF7 A;  4AU7 A;  1I6X A;  2NRA C;  3BRO A;  2IBD A;  2V7F A;  1MZB A;  3L2R A;  1W36 D;  3PO3 J;  4NHJ A;  3NAR A;  4DW6 A;  4FET A;  4ESB A;  3GTO J;  3L00 A;  5L3F A;  2DU9 A;  3PIO F;  3BR1 A;  1T08 B;  1OFC X;  4ASN A;  4D9J A;  3B6A A;  2QZ8 A;  5LBQ A;  2M1B A;  3PM1 A;  3UKG A;  2STW A;  2LG4 A;  2EFN A;  3MKL A;  1SFU A;  4U88 A;  4AVP A;  1V5F A;  2WA0 A;  3K1M A;  1SAU A;  2F5V A;  1RR7 A;  3M8F A;  5DCM B;  3TQN A;  3L2C A;  1YRN A;  3J80 Z;  1QO0 D;  2JN6 A;  4II2 A;  2ZXW H;  3LSM A;  2H8R A;  1WKM A;  2PJR A;  2LNB A;  3F0C A;  3BJA A;  4A5M A;  4EGY A;  3IUO A;  3GTJ J;  2DFF A;  4D1Q A;  3QP6 A;  5DV5 A;  3K70 C;  3BDD A;  2P0W A;  2RQQ A;  2M7B A;  1N75 A;  4B1R A;  2H09 A;  4P55 A;  3TED A;  2OBP A;  2L7Z A;  4C9Y A;  2V9K A;  2DA2 A;  3I4P A;  1F43 A;  3HSF A;  3A02 A;  4BJ5 C;  3QYF A;  3BG7 A;  3HUG A;  2HOE A;  3ZOB A;  2ZJQ F;  2KJB A;  2LP0 A;  3PL8 A;  1X1P A;  3U1D A;  4BKX A;  1XGO A;  4MNU A;  3DPT A;  1PP8 F;  1N25 A;  3HHH A;  3F22 A;  3W3C A;  1HBX G;  2RKH A;  2ESH A;  4M9X A;  1T6S A;  1S7A A;  1QZY A;  3C18 A;  1U6G A;  2HQR A;  4YII A;  1VQP I;  3I59 A;  5KNL A;  1V55 H;  3ZMU A;  2BXY A;  4M3F A;  4A3E J;  4FIS A;  2DMN A;  3ONQ A;  1QHH D;  5LD2 C;  4WWC A;  3K70 D;  2A05 A;  1IN5 A;  1Z6T A;  4K2E A;  1R4M B;  2Q1Z B;  1IN7 A;  5LGU A;  2R3S A;  1O3T A;  3TP0 A;  3BG9 A;  1RIO H;  3RDI A;  3AG1 H;  4J01 A;  5IP9 J;  3M3Y J;  4JK1 X;  2CU7 A;  1NHA A;  4KDP A;  1FP2 A;  1TWG J;  3IH3 A;  2GOX B;  2IAI A;  3D0S A;  5K5R A;  1LEA A;  1R5I D;  3QYB A;  1S72 I;  2HOT A;  2F2E A;  3BCB A;  2HPM A;  2BVM A;  2CUZ A;  2RN7 A;  1VQK I;  2RRE A;  1OKR A;  1SMT A;  3LA2 A;  2OCC H;  3LAP A;  2H8W A;  3FHN A;  1TQI A;  1FEX A;  4A69 C;  4F93 B;  3FDY A;  2E34 A;  2HXO A;  2GA1 A;  1VQ9 I;  2OQR A;  3WTS C;  2DYR H;  2NOG A;  2NVX J;  5BPI A;  1T39 A;  3OYK A;  4E6K G;  1W5C C;  3C2G A;  4MFD A;  2J5O A;  4R79 A;  4HBL A;  4B47 A;  3ISP A;  2UV1 A;  1SVO A;  2XV4 S;  3F6O A;  4RS8 A;  3TO9 A;  3H3U A;  1LNW A;  3F21 A;  3CCE I;  3ULQ B;  4CSW A;  2JSC A;  3HOS A;  3RQ4 A;  3BR5 A;  4JYK A;  4HDU A;  2EIJ H;  1J2X A;  2K86 A;  3KEY A;  1YX3 A;  5KAI C;  1Z77 A;  2CV1 A;  4E7L A;  3ZQC A;  3RYP A;  1Y39 A;  1KGS A;  2CUJ A;  3OYF A;  4A6E A;  3H3V K;  3SFI A;  2V1U A;  3BTL A;  4Z2Y A;  1Z3Y A;  4CYC B;  2FA5 A;  3O2P E;  2XKP A;  4HAM A;  1HC8 A;  3CUQ C;  4M6Y A;  1KU3 A;  3MQ0 A;  3JTG A;  2DQL A;  2FNA A;  3HGG A;  1B8I A;  2M4G A;  2ZJP F;  3Q5F A;  3GUD A;  3V7S A;  1YW7 A;  2RNG A;  2KLO A;  3CF5 F;  1SD4 A;  1IUF A;  3H5R A;  4YFX F;  1B72 B;  2IS4 A;  3JTH A;  5LGN A;  2ZFU A;  1JTX A;  4C3J J;  1QHG A;  2JSP A;  1JUS A;  4AIH A;  5JR3 A;  4XLP F;  5EGO A;  3GTK J;  2MYS A;  2QSF X; 
#chains in the Genus database with same CATH homology
 5D5V B;  2RVC A;  4I01 A;  2FF4 A;  2P6T A;  4R1H A;  2DK8 A;  3OV8 A;  3CUQ B;  1CF7 A;  1J5Y A;  3WTX C;  4L18 B;  1IXC A;  2VXZ A;  5BS6 A;  3V7C A;  5D5W B;  1KU7 A;  2VE9 A;  2V6C A;  1FNN A;  2VON A;  4KN4 X;  1W5T A;  3IHU A;  1OPC A;  1LJ9 A;  1OYI A;  5D5X B;  3VOD A;  1ZGA A;  2OU2 A;  3TO6 A;  2EB7 A;  3RPQ A;  2IA0 A;  3HSE A;  5ERI A;  2R7D A;  2Q8K A;  5CVR A;  2KIU A;  2XAH A;  1HW5 A;  1MJB A;  1EH6 A;  4OIO F;  3GW2 A;  2KJC A;  4A0Y A;  2PI0 A;  2ELH A;  2Q0O A;  3CDH A;  4CIC A;  4LLG F;  1AWC A;  3N4M A;  3GZ6 A;  1SD6 A;  1R23 A;  2OD5 A;  1O3S A;  3O3K A;  4RB1 A;  1R7J A;  2XAQ A;  3FXR A;  4GYG A;  3V7R A;  1BOA A;  1XMK A;  2YU3 A;  4RB0 A;  3BY6 A;  4A12 A;  1XDU A;  3EET A;  3JW4 A;  1WI9 A;  4KIC A;  4ZYD A;  3I0T A;  4BAY A;  2PJP A;  1DPU A;  2DO7 A;  1UHW A;  3JSO A;  4OIP F;  2BGC A;  5LHG A;  2VBW A;  1XCB A;  3C3W A;  2F5D A;  3K1N A;  4A0X A;  4U0Y A;  3G3Z A;  2O8X A;  4LLN A;  4LB5 A;  5IT9 K;  1KYW A;  5EEH A;  2GA2 A;  1ONV A;  3FWE A;  2MLG A;  3WTY C;  5HLI A;  3LA3 A;  4ESF A;  2YX4 A;  3ZMZ A;  2MD5 A;  1RUN A;  5K5O A;  3E6C C;  1QQI A;  2EK5 A;  1BM9 A;  3WG9 A;  3LFK A;  4IXA A;  3IRR A;  3TOB A;  5F6F A;  5ICE A;  2IJL A;  3QPT A;  4I7H A;  1TBX A;  3T8T A;  2RV8 A;  5ICG A;  5DDG A;  4UVA A;  1V3F A;  5F1R A;  2O0Y A;  3T1B A;  1YS6 A;  2OAZ A;  3FM3 A;  3PFI A;  1ZG3 A;  1B59 A;  2O6G E;  3E3V A;  4L9T A;  3F6V A;  4OIN F;  5L3D A;  2UZK A;  2V1D A;  5HDG A;  4MTE A;  1FY7 A;  2Z99 A;  1XGS A;  5DEQ A;  4RGU A;  3E5Q A;  4PZJ A;  5E1W A;  2QYO A;  1TLH B;  2QWW A;  1YW9 A;  1R5G A;  3SFZ A;  2GAU A;  1DUX C;  1HXD A;  4Q5S F;  3BP8 A;  3CLO A;  1VTN C;  1FLI A;  4EJW A;  1G3T A;  1U5T A;  1MGT A;  3R0J A;  3KP2 A;  3O6B B;  2OA4 A;  1QBJ A;  2LSO A;  3EYI A;  1W4M A;  2V79 A;  4RAZ A;  5L3C A;  1IN6 A;  1O57 A;  1BC8 C;  1FX7 A;  4A5N A;  4UUV A;  3BPX A;  3MZH A;  1BN5 A;  2RNJ A;  3MFK A;  1HKQ A;  2XAS A;  1LEB A;  3BJ6 A;  3F8F A;  3Q9V A;  4E70 A;  3G73 A;  2YPR A;  2MLK A;  4XBF A;  4MGR A;  1XCV A;  1ZG1 A;  1U3E M;  1IZ1 A;  1SD7 A;  4AWX B;  2ZME B;  2EV6 A;  4A2U A;  5E1Z B;  2CW0 F;  3BZ6 A;  1HST A;  2K4B A;  3EDP A;  4HF2 A;  4XSZ F;  4EJV A;  2P7V B;  1GXP A;  4ENJ A;  2Y0M A;  4MTD A;  3QU6 A;  3R0A A;  5JFR A;  2H27 A;  3ERE D;  3NEU A;  3KZZ A;  2EFO A;  2XRO A;  4OMY A;  2CYY A;  4ZYH A;  2OZ6 A;  2X4H A;  1DDN A;  4F7Z A;  4UVC A;  1XSX A;  1ZYR F;  3EQL F;  2VC1 A;  4BNC A;  1XGN A;  2YSR A;  1JGS A;  4L9V A;  2FBH A;  2PQ8 A;  5TRD A;  1E17 A;  2QUF A;  1QNT A;  3DKW A;  2ZNY A;  3QPH A;  5E8G A;  4OIQ F;  3HRT A;  1IN4 A;  4YIF A;  3J80 K;  1J0R A;  3HTS B;  2FML A;  1P6R A;  3E97 A;  4RB3 C;  2W57 A;  1L0O C;  4YFN F;  2DPD A;  3OOP A;  2QBY A;  3MWM A;  4PDK A;  1OR7 A;  5F64 A;  1Z6R A;  6PAX A;  5CVU A;  1TW2 A;  3GX4 X;  3ABU A;  1PDN C;  1ZLJ A;  1GXQ A;  2AS5 F;  4P9F A;  3RI4 A;  3ZN0 A;  3KFW X;  2GQQ A;  1I1G A;  1O3Q A;  4BHC A;  2FXA A;  4EJT A;  1FYK A;  2G9W A;  3KP7 A;  1L3L A;  1F4K A;  1B4A A;  4UV8 A;  3GFL A;  2Z9O A;  3RYR A;  3FX3 A;  4UV9 A;  2OQG A;  4CXF A;  1R1U A;  1SAX A;  2VOO A;  4IF4 A;  2FMY A;  5L3G A;  1CGP A;  3ML6 A;  5BPD A;  4KNY A;  2Y48 A;  1YIO A;  2PBI A;  4KMF A;  5E18 F;  2HQN A;  2A69 F;  4LFU A;  2FOK A;  5ED4 A;  3KE2 A;  2XHK A;  2IA1 A;  4HQE A;  2EWN A;  2L02 A;  3D5L A;  4M9S A;  2DQR A;  1C0W A;  5LLQ A;  5ILS A;  1BC7 C;  3JAM K;  3TO7 A;  3LST A;  2VBZ A;  3F8C A;  4YFK F;  4ENM A;  2D2W A;  1I1S A;  3HTU A;  4LMY A;  3TDU C;  1ON1 A;  1QGP A;  1H9T A;  2FU4 A;  1QPM A;  3PQJ A;  2ACJ A;  4FX4 A;  4LGW A;  3CUQ A;  3R61 A;  5K1Y A;  4I98 B;  3IWF A;  1EH8 A;  1YW8 A;  3GWZ A;  5FD6 A;  3QU3 A;  1MJA A;  4P9U A;  1PP7 U;  3BPV A;  1R36 A;  2CQK A;  3KEQ A;  4N0B A;  2L4M A;  1FSE A;  1HW1 A;  1SFX A;  4QLC U;  1HW2 A;  3FMQ A;  1JHF A;  2V9V A;  1IUY A;  1ZHF A;  2VBY A;  4DNC A;  1IW7 F;  3ZQ7 A;  2Z5U A;  3CO7 C;  5LRR A;  3DP7 A;  2E7W A;  4I02 A;  3RPU A;  4GXO A;  4KMU X;  1P4X A;  2QBY B;  3MZY A;  2DW4 A;  1XB4 A;  3GFJ A;  4BXU A;  1BBY A;  1F9N A;  3CTA A;  3GXO A;  4L5I A;  1XN7 A;  3P9K A;  2A6E F;  4IRG A;  2QEN A;  2ADU A;  3H3Z A;  1LDK B;  4HLX A;  4EJO A;  5CVI A;  3ZMT A;  4UVB A;  4ZYE A;  3E6D A;  1XDS A;  3EYY A;  1JXS A;  5DUK A;  4PCQ A;  2CWE A;  3WGI A;  4FHT A;  1B9M A;  1DP7 P;  1S29 A;  2MBF A;  2ZJ2 A;  4TV7 A;  3LQR A;  1Z7U A;  4I2O A;  1ZGJ A;  5A2Q K;  2G7H A;  1GVJ A;  2BBY A;  1UST A;  5HOO A;  1Z91 A;  3BOQ A;  1HKS A;  2L01 A;  2O03 A;  2W85 A;  3ZP5 A;  4LK0 F;  3VEP A;  2DT5 A;  1FC3 A;  2H6C A;  3ECH A;  3L09 A;  5D5U B;  1OMI A;  2XAF A;  3WTW C;  2IRF G;  2TDX A;  3HRU A;  3PQK A;  1RUO A;  1D3Y A;  4LJZ F;  1HSJ A;  4RGS A;  3GVA A;  3HOT A;  2YX7 A;  1MDM A;  3HSR A;  3RKY A;  4BHP A;  2HDC A;  4L5J A;  5H6Q A;  2A07 F;  3FXQ A;  3L7W A;  5IT9 Z;  1KA8 A;  1RZ4 A;  2VC0 A;  3ZMS A;  2HZT A;  2Q2E A;  3FHZ A;  3LAJ A;  4EQQ A;  3VB2 A;  2Z33 A;  1ULY A;  3BWG A;  3RJP A;  5LHI A;  1KQ0 A;  5ICF A;  4ESJ A;  2DI3 A;  1WSU A;  2W84 A;  4N9I A;  4CDG A;  1K78 B;  2DTR A;  4S04 A;  3I5U A;  2K4J A;  3M8E A;  4CHU A;  1R5H A;  1WRJ A;  2LF8 A;  2VE8 A;  3E5X A;  3QP5 A;  4M71 A;  5ICC A;  4LB6 B;  1IAW A;  4WXC A;  4OMZ A;  2DFI A;  2GZW A;  1STZ A;  2PLY A;  1S3J A;  2VT2 A;  1FYM A;  2HEO A;  2Z3Y A;  2DPU A;  5LRS A;  5D6E A;  5LEK A;  2E1N A;  3CUO A;  1UB9 A;  3WTT C;  1D5V A;  4M72 A;  2A6H F;  1J7K A;  1G3Y A;  4KIG A;  1XMA A;  5AIP A;  2P4W A;  4ENK A;  1U2W A;  2VBX A;  2G7U A;  2VOD A;  2A61 A;  3KZY A;  1V4R A;  4D0P A;  3F8N A;  1ZAR A;  5FGM A;  2L3D A;  3R4K A;  3I58 A;  3DPL C;  4Y15 A;  3J7A O;  4EV0 A;  4IRI A;  4BHB A;  3REO A;  4JBA A;  3I71 A;  4P5O A;  2STT A;  1RI7 A;  4QWQ A;  4G6D A;  1R22 A;  4HX8 A;  3I53 A;  5E1X A;  5D4S A;  1U5T B;  2HFH A;  1K79 A;  4HF0 A;  3ZMV A;  2MH9 A;  2IA2 A;  3JSP A;  4S05 A;  2OZU A;  4OIR F;  2COM A;  2QQ9 A;  4HV6 A;  2ISY A;  2P6S A;  5ILV A;  3K9T A;  1ZN2 A;  4HZF A;  2VN2 A;  1U5T C;  3KCC A;  1P92 A;  3FMS A;  1K78 A;  3GO5 A;  2B0L A;  2WV0 A;  2DLL A;  5CVV A;  1X3U A;  2NNN A;  3WOD F;  3FF5 A;  5J6X A;  2D1V A;  3V4G A;  1SMY F;  3DEU A;  3JAM Z;  3LA7 A;  4EMS A;  1FP1 D;  1FBQ A;  5AON A;  1BIA A;  3EUH A;  5E20 A;  3TDZ C;  2PG4 A;  4WCG A;  1BIB A;  4IHT A;  3AAF A;  3QOP A;  2BEO A;  2M87 A;  3HRM A;  3N97 A;  2HKO A;  5FB2 A;  4IJA A;  1R1T A;  1S6L A;  3WTV C;  2VT3 A;  2FEZ A;  2QQB A;  4U7D A;  3ZPL A;  4AIK A;  3MAJ A;  1K6O A;  4EM1 A;  2PMH A;  1Z05 A;  4P96 A;  5E17 F;  5LEJ A;  2WWY A;  2F5C A;  3E5U A;  1T38 A;  2A3S A;  2V1X A;  1FYL A;  1FSH A;  1WQ2 A;  5CYV A;  1TTY A;  5FFZ A;  3H92 A;  1FWZ A;  4MEX F;  3C1D A;  1KU9 A;  5DUI A;  4Y17 A;  4KN7 X;  4CZZ A;  3E6B A;  1FT9 A;  4ZH4 F;  3V8L A;  2M45 A;  5IT3 A;  2HTS A;  1D8J A;  1TQM A;  2EV5 A;  5H6R A;  2EA2 A;  3WGH A;  2W25 A;  1LVA A;  1JE8 A;  5FD5 A;  2UXX A;  2L4A A;  1BI3 A;  2ETH A;  5ILU A;  4RGR A;  1IRG A;  3HIF A;  2F5E A;  1MJ9 A;  1G3W A;  2XIG A;  1Y0U A;  3R6S A;  2M30 A;  3KP6 A;  4AD9 A;  1W7P D;  3BJO A;  4RGX A;  4HDV A;  4M73 A;  4ENN A;  1TW3 A;  4IHS A;  2QLZ A;  5HS9 A;  3COA C;  2QVO A;  1ZH5 A;  4O3M A;  3F72 A;  4ON0 A;  5HVQ C;  1HQC A;  3HYI A;  3WGG A;  3J81 K;  3KEO A;  2ZCW A;  2E1C A;  2P5L C;  1J9I A;  2L54 A;  5J8C A;  5L3E A;  2FE3 A;  4KYW A;  4G7O F;  2A68 F;  2IP2 A;  4L0Z B;  2JPC A;  1P4W A;  2QQA A;  3KLN A;  3DV8 A;  4CO8 A;  5JVT A;  1ZRE A;  4HF1 A;  2RC4 A;  1UHM A;  4OOI A;  2HS5 A;  1E2X A;  1P2F A;  4HX4 A;  4FX0 A;  2CSO A;  1SFE A;  3SXY A;  4MQ9 F;  4WK8 F;  2M8E A;  2WC2 A;  2GWR A;  5J8F A;  3I54 A;  1EH7 A;  3NRV A;  1B9N A;  4G7Z F;  2E7X A;  1J75 A;  2P5K A;  2H94 A;  3M7G A;  5AIQ A;  1IF1 A;  4UNO A;  1O7F A;  2QM3 A;  2CG4 A;  1J59 A;  2A5Y B;  3KLO A;  2IW5 A;  4L0Y B;  4LLL A;  4EJU A;  2EFP A;  2NAZ A;  4OU0 A;  2GIV A;  1FBS A;  2XKO A;  4M6X A;  3IKT A;  4I0A A;  3QAH A;  2FQ3 A;  3K69 A;  3ZN1 A;  1R00 A;  1T2K A;  1G4D A;  2ZFW A;  1R58 A;  2HYG D;  2ZO4 A;  1SD5 A;  3F8M A;  1OYY A;  4XRF A;  4A6D A;  2EJR A;  1YQA A;  4BH9 A;  3E6M A;  1KU2 A;  3WE3 A;  2HGC A;  1FZP B;  2GXB A;  3TOA A;  1XSD A;  3I64 A;  3KP4 A;  5D8K B;  1BI2 A;  2JTV A;  4KIF A;  1EV7 A;  4IRH A;  2LKP A;  2EA4 A;  2BE5 F;  3K0L A;  4YG2 F;  4BYY A;  3MCZ A;  3TGN A;  2ZBK A;  4GGG A;  3WU0 A;  3I59 B;  2NYX A;  3WTZ A;  5DD8 A;  1W5S A;  3DF8 A;  1MKM A;  3FZV A;  1YS7 A;  1ZG5 A;  4EGZ A;  2ZNZ A;  1I27 A;  4LK1 F;  5DYM A;  2CO5 A;  3GEZ A;  4LD5 A;  1F1Z A;  5LGT A;  4HOB A;  1H9G A;  5HLG A;  1H0M A;  5TJJ A;  4RAY A;  2KIF A;  4M74 A;  1WWX A;  4AIJ A;  5BQT A;  4NB5 A;  1P4A A;  3ABT A;  1GHC A;  3TKY A;  3P9C A;  2R7F A;  1ZRC A;  2FRH A;  2HWV A;  5BMZ A;  1YG2 A;  3L9F A;  3W6K B;  3W6J B;  3V8J A;  3SZP A;  4O5V A;  3WE2 A;  3S2W A;  5DCF A;  1UCR A;  3IC7 A;  1BJA A;  2EFW A;  4ZYG A;  3KET A;  2CFX A;  2K02 A;  5CVJ A;  1F5T A;  1OYW A;  4KA4 A;  3B73 A;  4GYI A;  4HA8 A;  2O61 A;  3LWF A;  2LDU A;  5KK1 A;  5CLS A;  2BV6 A;  1AOY A;  5DD4 A;  2IPQ X;  2JT1 A;  3R60 A;  2JPB A;  2PEX A;  4ZZL A;  5D8L B;  2H6B A;  3P9I A;  2ZXJ A;  2HTJ A;  1ZLK A;  1U78 A;  2BYV E;  1QZZ A;  4UHT A;  4BQA A;  2FNP A;  2FSW A;  3GZ5 A;  2HKX A;  4HQM A;  1ZRF A;  3GF2 A;  2XGX A;  3Q9S A;  1MDM B;  2XRN A;  1O3R A;  2P5V A;  3HRS A;  2NS0 A;  2O3F A;  2K7L A;  3M9A A;  4CYD A;  2MA3 A;  3FXU A;  3FMR A;  4G9Y A;  4ETS A;  3HHG A;  5LHH A;  3WTU C;  1IXR C;  4IVN A;  1YTY A;  1YFH A;  3RKW A;  3C7J A;  1LB2 A;  2KKO A;  3IL2 A;  2C6Y A;  1XSV A;  2DAO A;  2EV0 A;  1O7L A;  2IVM A;  2RDP A;  4MHG A;  5CJ9 A;  1LDJ A;  2XVC A;  5L3B A;  1K7A A;  4XSX F;  2PN6 A;  2CGP A;  3T8R A;  1IN8 A;  3K2Z A;  2RQP A;  1TNT A;  1ON2 A;  3DFG A;  3RKX A;  2HR3 A;  3QRF F;  5DCM A;  4M9Z A;  4Q47 A;  4HW0 A;  2W24 A;  1KQ8 A;  2NNY A;  1T98 A;  3F8B A;  2Y75 A;  3F23 A;  4N9H A;  1D8K A;  1S7O A;  5KVR A;  1W7P A;  2ZKZ A;  4G8X A;  3M1E A;  5FO5 A;  3VOE A;  4I09 A;  2P7C B;  4HV5 A;  1PUE E;  3CJN A;  3ROU A;  4GO1 A;  2JZY A;  1XGM A;  5JHU A;  4L9N A;  4GCV A;  1ZRD A;  4DQ2 A;  3RTR A;  2PMU A;  5EEG A;  3NQO A;  4UXN A;  5A2Q Z;  4NQW A;  4EM0 B;  2XAJ A;  2XAG A;  4KFC A;  5HDK A;  5JI6 A;  1LQ1 A;  4O6J A;  4H0E A;  4Q4Z F;  4IPA A;  4PGH A;  4Y13 A;  3V8K A;  4U0V A;  2J5P A;  3U2R A;  4G7H F;  1G3S A;  1XD7 A;  4JQF A;  3F3X A;  2FBK A;  3CO6 C;  3ECO A;  2IT0 A;  3P7N A;  1FOK A;  2WTE A;  5HS7 A;  4ZZD A;  1HKT A;  2XUB A;  2AXL A;  1B1B A;  3IKV A;  3KP3 A;  4A0Z A;  1IRF A;  2YR2 A;  4HX7 A;  3KP5 A;  1U8R A;  1BI0 A;  4EM2 A;  1W7P B;  2X0L A;  3WU1 B;  3B02 A;  3GYH X;  1YYV A;  4HYE A;  1R1V A;  2JRT A;  2GXG A;  4B8X A;  4KT5 C;  1YO5 C;  1JHH A;  1B6A A;  3K1P A;  4I0B A;  4WF2 A;  1TQP A;  2F5F A;  1S8N A;  3J81 Z;  3IRQ A;  2ZME A;  4G94 A;  2UWM A;  4L9J A;  5FLX Z;  2KIM A;  1BI1 A;  2ESN A;  1ODD A;  4WXH A;  2DK5 A;  4EVI A;  2PFB A;  1RNL A;  1IXS B;  1FPQ A;  4XLN F;  5D6F A;  5K5Q A;  1MD0 A;  2KRF A;  2MH2 A;  2EFQ A;  3DXJ F;  1Z1D A;  3SQN A;  1G6N A;  3IWZ A;  4PGG A;  3GFI A;  4WX9 A;  1FBU A;  5HLH A;  2P8T A;  1KYZ A;  2ISZ A;  4HLY A;  1I5Z A;  4KIB A;  1ZAO A;  3FM5 A;  3T5X A;  1TNS A;  1KQ9 A;  2LF7 A;  4B09 A;  1T0F A;  3SHF A;  4WXD A;  2HYF A;  3LQQ A;  1DPR A;  3T0Y A;  3RIR A;  2M5W A;  3GLX A;  4RB2 C;  3VFZ A;  4FT8 A;  3DQV C;  2DBB A;  3SZT A;  4MQV A;  4LG0 A;  3MEX A;  3GFM A;  1LDD A;  4U0W A;  5D4R A;  1USS A;  5HDN A;  2VOP A;  3U9G A;  2K27 A;  1A04 A;  4Q48 A;  1REP C;  4MEY F;  2D1H A;  3ELK A;  1Q1H A;  4LG0 B;  5FLX K;  4G6Q A;  4U7B A;  5HS8 A;  4R8H A;  2RGV A;  2UXN A;  4CGZ A;  5BOX A;  2MC3 A;  5E8I A;  5FFX A;  4KUM A;  1UFM A;  1YLF A;  2D45 A;  3ZMD A;  1Z9C A;  5H20 A;  2FBI A;  1CF7 B;  2NRA C;  1I6X A;  3BRO A;  1MZB A;  4NHJ A;  4ESB A;  3L00 A;  5L3F A;  2DU9 A;  4ASN A;  2QZ8 A;  5LBQ A;  2M1B A;  2STW A;  2EFN A;  1SFU A;  4U88 A;  4AVP A;  3K1M A;  5DCM B;  3M8F A;  3L2C A;  3TQN A;  3J80 Z;  1QO0 D;  1WKM A;  2LNB A;  3BJA A;  4A5M A;  4EGY A;  3QP6 A;  5DV5 A;  3BDD A;  2H09 A;  4P55 A;  2OBP A;  3I4P A;  3HSF A;  3HUG A;  2HOE A;  2KJB A;  3U1D A;  1XGO A;  4MNU A;  3DPT A;  1PP8 F;  3HHH A;  3F22 A;  1HBX G;  2RKH A;  2ESH A;  4M9X A;  1T6S A;  1S7A A;  1QZY A;  3C18 A;  1U6G A;  2HQR A;  4YII A;  3I59 A;  3ZMU A;  4WWC A;  1IN5 A;  1Z6T A;  4K2E A;  1IN7 A;  5LGU A;  2R3S A;  1O3T A;  1RIO H;  3RDI A;  4JK1 X;  4KDP A;  1NHA A;  1FP2 A;  3D0S A;  5K5R A;  1LEA A;  2F2E A;  2RN7 A;  1OKR A;  1SMT A;  3LA2 A;  3LAP A;  1TQI A;  2GA1 A;  2OQR A;  3WTS C;  5BPI A;  1T39 A;  4R79 A;  2J5O A;  4HBL A;  3ISP A;  2XV4 S;  3F6O A;  4RS8 A;  3TO9 A;  3H3U A;  1LNW A;  3F21 A;  3ULQ B;  2JSC A;  3HOS A;  4HDU A;  1J2X A;  2K86 A;  3RYP A;  1KGS A;  4A6E A;  2V1U A;  4Z2Y A;  2FA5 A;  3O2P E;  2XKP A;  4HAM A;  3CUQ C;  4M6Y A;  1KU3 A;  3MQ0 A;  3JTG A;  2DQL A;  2FNA A;  3Q5F A;  3GUD A;  3V7S A;  1YW7 A;  1SD4 A;  4YFX F;  3JTH A;  5LGN A;  4AIH A;  5JR3 A;  4XLP F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...