1YQAA

Engineering the structural stability and functional properties of the gi domain into the intrinsically unfolded gii domain of the yeast linker histone hho1p
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
87
structure length
87
Chain Sequence
KASSPSSLTYKEMILKSMPQLNDGKGSSRIVLKKYVKDTYPIVGSASNFDYLFNSAIKKCVENGELVQPKGPSGIIKLNKKKVKLST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone H1
publication title Engineering the Structural Stability and Functional Properties of the GI Domain into the Intrinsically Unfolded GII Domain of the Yeast Linker Histone Hho1p.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
total genus 23
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2005-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00538 Linker_histone linker histone H1 and H5 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1yqaA00
4MEXF 5DEQA 2X4HA 4N9IA 2PLYA 2IA2A 5FO5A 1UCRA 2P5KA 3U2RA 2VXZA 3F72A 1ON2A 3ZQ7A 5FFZA 3C3WA 5HS9A 3KZYA 1Z91A 1B1BA 1G3YA 1YFHA 3OV8A 3P9KA 2F5EA 2STTA 4YFKF 3JSOA 3DP7A 4KUMA 3J81K 3BZ6A 1IN6A 1EH6A 1AOYA 1USTA 3FWEA 4IRGA 1FLIA 3LA2A 3IL2A 2NS0A 4G7OF 1BI1A 4AIKA 3GEZA 5K5RA 3CUQB 2D1HA 3BY6A 5BOXA 4M6XA 4HX7A 4UUVA 2JT1A 1EH8A 2GXBA 4I02A 3R60A 2Z3YA 3GW2A 1MD0A 4R1HA 2XAJA 4I7HA 4UXNA 5CLSA 4YG2F 3QAHA 4BXUA 3CUQC 3ISPA 4A5NA 2HQRA 1CF7A 4ETSA 4L0YB 4WXHA 2V6CA 5ILSA 1Z9CA 2D45A 5DUIA 1TQIA 3ULQB 2IA1A 2CFXA 4A6EA 3WE2A 4WXCA 2DPUA 2A69F 1CF7B 1IXCA 2EFPA 1TBXA 4MGRA 2HKXA 2R7DA 2QUFA 3ECOA 2GA1A 4LLGF 1S7AA 3COAC 2OZ6A 1LDDA 4JK1X 5KK1A 3KCCA 1TNTA 2E7XA 1QBJA 4S05A 3F6VA 3RKYA 4LFUA 3R4KA 5D6EA 3ABTA 3WGGA 4BHCA 5HLHA 2NNYA 2K4JA 4EV0A 3R61A 1Z7UA 4HW0A 1FBSA 1H0MA 4CGZA 3CLOA 4DQ2A 2R3SA 4ENJA 2VC0A 3NRVA 3N4MA 5HVQC 1T0FA 5E8GA 4ESJA 4ZZLA 3CO6C 4ENNA 3FMSA 3ABUA 2ZCWA 1L3LA 1W7PB 2A3SA 3M8FA 1SFUA 2DW4A 4XRFA 2BE5F 2QQBA 3MCZA 1W4MA 3ZMUA 2QVOA 4OIOF 2OZUA 5DUKA 5LRRA 2XVCA 3IWZA 2O8XA 2VBXA 5DV5A 4A0ZA 2H6CA 1TQMA 1OR7A 3G73A 2FBIA 4UVBA 3LQRA 2IVMA 2ZJ2A 1W5SA 1U8RA 5JI6A 2COMA 2FRHA 1USSA 4LGWA 4DNCA 1DPUA 2RC4A 3SHFA 1ZREA 2PBIA 1QGPA 2V9VA 2HWVA 3K69A 4LG0B 1U3EM 1SD6A 2YR2A 2PI0A 1F9NA 2DQLA 1LQ1A 3FHZA 2DO7A 4Y17A 3DXJF 2W24A 3WE3A 2OAZA 4L9JA 2VT2A 4M73A 1P92A 4WF2A 4PZJA 1HBXG 1ZRFA 1TLHB 4WK8F 4G8XA 2C6YA 2WC2A 1WSUA 3N97A 3EYIA 3DF8A 1KQ0A 1XCVA 1ZYRF 3K1MA 5DCMB 1FSHA 1R36A 3JW4A 4G7ZF 1I1GA 2EK5A 4IXAA 5D8LB 2QZ8A 3MZHA 4U0YA 4HF0A 5FGMA 3JTGA 2HFHA 3I4PA 3T1BA 4IF4A 4XSXF 2A5YB 4LB6B 3V7SA 3LA3A 1DP7P 2G7HA 3BPVA 4M9SA 1IXRC 2DK8A 1LDKB 3O6BB 3R6SA 4IPAA 5JFRA 1T38A 3GFLA 2MC3A 3L9FA 4D0PA 1B9MA 3RKXA 4EQQA 2L01A 2E7WA 1XMAA 1R1VA 3L2CA 5LGUA 2VE8A 3HIFA 4YFXF 5K1YA 5L3FA 4CYDA 3FX3A 2Q2EA 1J75A 1TW3A 1S29A 3E6CC 2FF4A 4CDGA 1P4AA 3KLNA 2ESHA 4L9VA 3K1NA 2K7LA 4R8HA 3IC7A 4EJOA 3I54A 4ZYGA 3C7JA 1JE8A 4KYWA 3GXOA 3MQ0A 1P2FA 2FEZA 2A68F 3RI4A 2F5FA 3HRUA 4AIHA 4GGGA 2L4AA 3EYYA 1XD7A 3VB2A 4KDPA 1IN4A 3J80Z 5LHGA 3TGNA 2FXAA 2V79A 3RYPA 4UV9A 2A6EF 1J9IA 2QYOA 5LRSA 4PCQA 3HOSA 5LHHA 3GFIA 1WKMA 1MGTA 4AIJA 5FLXK 4M72A 1MZBA 2CQKA 1BOAA 1SMTA 3HTUA 2Y0MA 1ZG5A 1KQ8A 2A6HF 2M30A 4AWXB 3GUDA 1T2KA 3LQQA 4HDVA 1IRFA 3RJPA 1ON1A 3LA7A 2XRNA 2HYGD 2IPQX 3HRMA 4RB0A 1B59A 3KP2A 2WV0A 2HDCA 5AONA 1S7OA 1UHMA 1LEBA 2HTJA 3DFGA 2IT0A 1T6SA 1ZLKA 3QU6A 1UHWA 3CTAA 3HSEA 3MEXA 5LGNA 3B02A 2LDUA 3K2ZA 3FZVA 3KZZA 4I98B 4UHTA 4OMZA 2XV4S 4PDKA 3GYHX 2CW0F 3F23A 4A6DA 5H6QA 2ZO4A 5CJ9A 2Y48A 3J80K 3KEQA 1Y0UA 2XAFA 1D3YA 3GX4X 4M71A 3GF2A 4XBFA 3SQNA 4CICA 3KP4A 5L3CA 2CSOA 2W84A 2KIUA 4ZYEA 5LLQA 2EFOA 4KNYA 4RAYA 2JTVA 4ESFA 4GYIA 2L4MA 3B73A 3F3XA 1TTYA 3RPQA 2NYXA 4U0VA 4BHPA 2KKOA 3LAPA 2G9WA 1W7PD 1O3QA 5LBQA 4G7HF 3Q5FA 4IHSA 3JTHA 2FBKA 4NQWA 2HR3A 3QPTA 1Q1HA 4HLXA 2O03A 3H3UA 4KMFA 1K79A 2DTRA 1SMYF 1OYIA 1IN7A 1XGNA 2DBBA 4E70A 3S2WA 2A61A 1S8NA 3W6KB 2XAHA 2P5VA 3F8FA 2CG4A 1J5YA 1SD4A 2Z9OA 2XHKA 1AWCA 4G94A 1RZ4A 2XAQA 4WCGA 1G4DA 5H6RA 1LEAA 2MD5A 2E1CA 5HLIA 3CUQA 1PDNC 2A07F 1MKMA 1EV7A 1IUYA 3WGIA 4AVPA 1IAWA 1TQPA 1KU2A 1OYYA 4BHBA 2M1BA 2P8TA 2ESNA 4XLPF 2ZBKA 3TO7A 3CUOA 1WRJA 4KN4X 3GZ6A 3C18A 4P9UA 2OQRA 2PN6A 1ZN2A 4XLNF 2RN7A 3V8JA 3GZ5A 2UXNA 3K0LA 1SD5A 2HYFA 5JHUA 2R7FA 2EV6A 4I09A 2UXXA 1BN5A 1REPC 1L0OC 3SZTA 1FY7A 3ZMVA 1LNWA 5L3EA 1I1SA 1FP2A 1HKSA 2HOEA 1BJAA 4LB5A 1YS6A 2OU2A 1KQ9A 3HRSA 4O5VA 2AXLA 2J5PA 3RYRA 2PEXA 3BP8A 2HS5A 4LK0F 3EDPA 2CO5A 4CO8A 4BNCA 4NB5A 2EFWA 4BH9A 2VOPA 2F5DA 3QU3A 3F6OA 2WTEA 1HKTA 3BJ6A 2KIFA 2JRTA 4KN7X 5CVRA 1ULYA 2YPRA 1MJBA 4CHUA 3RDIA 1QO0D 5ILVA 2Q8KA 2M8EA 3SFZA 4L18B 1I27A 3WTVC 1KU3A 1ZLJA 2CYYA 2EV5A 1W7PA 1TNSA 1OKRA 2MA3A 3WU1B 1FZPB 6PAXA 1YO5C 1RNLA 5HDNA 3L00A 2QM3A 4F7ZA 3GO5A 3WGHA 4IVNA 3IRQA 4K2EA 1VTNC 4EM0B 1FYLA 1TW2A 3FMRA 2GWRA 1XGMA 4JBAA 2EA4A 5EEGA 4ASNA 2XKOA 4MEYF 1O3TA 1FYKA 1R7JA 4KIFA 4AD9A 1O7FA 2NNNA 2M87A 3ZMZA 2DU9A 2EWNA 4HZFA 5ICEA 3R0AA 3I59B 4LG0A 3RIRA 3F8BA 3E5QA 3KE2A 3NQOA 5ICCA 2BGCA 1F5TA 4BAYA 4LK1F 4EM2A 2P6TA 3WTTC 4OOIA 1T39A 4Q47A 1OMIA 4NHJA 2STWA 3HYIA 4M9XA 4A2UA 2QBYB 4ENMA 1BBYA 2FE3A 2VT3A 4ZYHA 1BC8C 2LF8A 3P9IA 5DCMA 3BDDA 5L3GA 1XDUA 3VODA 3KFWX 1V3FA 5K5QA 3T8RA 4BQAA 1U5TC 2KJBA 3ZN0A 3LWFA 1FC3A 3ZP5A 3TDZC 2E1NA 3ROUA 1BI3A 4IRIA 1LJ9A 5ED4A 1HSTA 3CDHA 2CWEA 3QRFF 2JSCA 1F1ZA 1W5TA 1XSVA 5FD5A 1FYMA 4IHTA 4QWQA 2GXGA 5K5OA 2PJPA 2FSWA 2LF7A 1V4RA 2Q0OA 2QENA 2GAUA 4H0EA 1E2XA 2OA4A 2UZKA 2RGVA 3KP7A 4UNOA 1R5HA 1ZAOA 4U88A 5BS6A 3MFKA 2KJCA 5IT3A 4KA4A 2DFIA 4GXOA 3AAFA 2Z5UA 2NAZA 3WU0A 1FPQA 1H9TA 2HZTA 1RUOA 5FLXZ 3F22A 1KU7A 2P5LC 4PGHA 5L3BA 5D4SA 1U6GA 2GA2A 1MDMB 1SFXA 5TRDA 4RB2C 2YSRA 3HSFA 2RDPA 1G3TA 3ZMDA 4I2OA 2CGPA 4Y13A 2K86A 1DUXC 4RB1A 3REOA 2VE9A 5DD4A 4WWCA 2JPCA 3D5LA 3GFMA 4WXDA 2RV8A 1IZ1A 2FMLA 4P9FA 2EJRA 4KIGA 3TKYA 3L09A 4MTEA 2FBHA 2MBFA 2QLZA 2RVCA 3E6BA 1KYZA 4FX0A 5BQTA 5H20A 1FBQA 3WTYC 4OMYA 1HW2A 1YG2A 3ZPLA 5ILUA 5E1XA 5CVVA 4EJTA 2QQAA 3I5UA 3M1EA 3BOQA 3E5XA 4HOBA 1G6NA 4MHGA 1K7AA 2BYVE 3L7WA 4O3MA 1E17A 2RQPA 4YFNF 3HSRA 1F4KA 3H92A 1XCBA 4OU0A 5J6XA 2DI3A 5IT9Z 2M5WA 5TJJA 2BV6A 2X0LA 1YS7A 1I5ZA 3WTUC 1D8JA 5E20A 3PQJA 5FFXA 4A0YA 3I53A 4RS8A 2ZNZA 1XSDA 2K02A 3U1DA 2IP2A 2XAGA 4RGRA 2Y75A 2JPBA 2P4WA 4HQEA 1WWXA 4HQMA 2XGXA 3EETA 4GYGA 1B4AA 1I6XA 1GXPA 4B09A 5EEHA 2EFQA 2YX7A 3F21A 2FNAA 2B0LA 1DDNA 3MZYA 1RUNA 3QP6A 4A12A 4I01A 2VBZA 3DQVC 1ONVA 5BPIA 1OPCA 1R23A 1ZHFA 1ODDA 3M7GA 3IRRA 5ERIA 2WWYA 1IN8A 3TO6A 1GXQA 3VOEA 3ZMSA 4N0BA 4PGGA 1JHHA 5IT9K 1K78B 3BJOA 4LJZF 4HV5A 5HDKA 3K1PA 3QP5A 2DK5A 1R22A 2HEOA 3I58A 4U7DA 1J2XA 1HW5A 3V8LA 4Q4ZF 2IA0A 4N9HA 3J7AO 1A04A 3M9AA 3WTWC 1IN5A 1XN7A 2HKOA 2V1XA 3MAJA 4UVCA 4LLNA 4O6JA 5HLGA 3FMQA 1O57A 4L5JA 2ELHA 5DD8A 1UFMA 4HLYA 3ZN1A 1DPRA 2ZKZA 2XKPA 2PG4A 3GWZA 2J5OA 3DV8A 2OBPA 5D8KB 2FQ3A 2H6BA 4EM1A 1D5VA 4L0ZB 4MQVA 3T8TA 2FA5A 3KP3A 1S6LA 4RGSA 3IWFA 4HX4A 1OYWA 5LEKA 1LB2A 2FNPA 1Z1DA 1ZGJA 5E18F 2P7VB 1YW8A 3V7CA 3KLOA 3I0TA 5D6FA 1YW7A 3ECHA 1XMKA 4B8XA 3QOPA 2TDXA 3BROA 4IRHA 3MWMA 1X3UA 3P7NA 2O61A 3F8NA 2O6GE 3V4GA 5A2QZ 2MLKA 2LNBA 1BI0A 2ZMEA 3C1DA 2EV0A 5BMZA 4ZH4F 3FF5A 5F6FA 5F64A 2ADUA 3E3VA 4MNUA 4G9YA 2XUBA 2ZFWA 4ZYDA 5HS8A 4JQFA 4EVIA 4CZZA 2ZMEB 1HW1A 1FX7A 1O7LA 1IXSB 4XSZF 3DPLC 3KEOA 4M9ZA 2RKHA 4R79A 3F8MA 2GZWA 3RPUA 3HRTA 2IW5A 1FT9A 4OINF 1JGSA 3U9GA 2GQQA 3WTSC 3JSPA 3NEUA 2VC1A 1CGPA 1U2WA 3IKTA 4M74A 3V7RA 1ZG1A 2XIGA 1JXSA 4HA8A 3TO9A 4EJVA 3R0JA 1FNNA 3LSTA 2BEOA 2RNJA 4OIRF 3G3ZA 1P4WA 1O3SA 2OD5A 4EMSA 1Z6RA 1B9NA 1R58A 2MLGA 1KGSA 5A2QK 3HOTA 3TQNA 5JVTA 3EQLF 5LGTA 3IHUA 4TV7A 3TDUC 1HKQA 1T98A 4EJUA 2ISYA 4FT8A 2VN2A 4LLLA 5E1ZB 1J7KA 3WG9A 1K6OA 2NRAC 2Z33A 1HQCA 3Q9SA 4CXFA 2VOOA 4KICA 2F5CA 3I59A 1NHAA 2HTSA 4M6YA 2O0YA 3TOBA 4IJAA 2H09A 5D4RA 4Q48A 3DEUA 3W6JB 3O3KA 1S3JA 2QBYA 1R1TA 3WODF 2ZXJA 1U5TA 3D0SA 3KP5A 3PQKA 4HX8A 3FXUA 4G6DA 2HGCA 4HBLA 2ETHA 5KVRA 2L02A 2DQRA 1UB9A 2IJLA 2P6SA 1WQ2A 5D5UB 1H9GA 4I0AA 4ON0A 1B6AA 2F2EA 2HQNA 3Q9VA 4FHTA 1KU9A 3QPHA 1XSXA 1U5TB 2ACJA 4HF1A 1R00A 1FWZA 3GLXA 3WTZA 4UV8A 5CYVA 2W57A 3FM5A 2YX4A 2VBYA 1ZRDA 1ZGAA 5D5VB 4OIPF 2H27A 1MJ9A 1KYWA 4L9TA 4ZZDA 1EH7A 2FOKA 1SFEA 4FX4A 3KP6A 4G6QA 3JAMZ 5FB2A 3KETA 1R1UA 4QLCU 5J8FA 1PP8F 3DPTA 4Q5SF 2PFBA 1YTYA 2K27A 2EB7A 1QZZA 2MH2A 4Z2YA 2P7CB 1IW7F 1XDSA 1ZG3A 2JZYA 2G7UA 2PMUA 1ZARA 1MDMA 2ISZA 3E6MA 3FXQA 2XROA 4Y15A 1BI2A 3RTRA 4LMYA 3SXYA 3T0YA 2K4BA 3FXRA 2KRFA 2D1VA 4MQ9F 2H94A 2L3DA 1GHCA 2EFNA 2DT5A 3VFZA 2ZNYA 5F1RA 1U78A 5FD6A 1IRGA 4I0BA 3TOAA 3BWGA 3CO7C 2YU3A 1MJAA 2VBWA 1BM9A 4HV6A 4LD5A 2V1DA 1PUEE 3ZMTA 3LAJA 2GIVA 4UVAA 4MTDA 4KT5C 3I64A 2EA2A 3HTSB 5DCFA 2L54A 1LDJA 4L5IA 1QNTA 3CJNA 1STZA 1WI9A 5E1WA 2XASA 4S04A 1XGOA 3P9CA 3JAMK 3I71A 1D8KA 2W25A 4BYYA 3ERED 2FU4A 1FBUA 3OOPA 4RGUA 4A5MA 3T5XA 3E5UA 4U0WA 3WTXC 2QQ9A 4ESBA 1XB4A 1GVJA 2O3FA 3VEPA 5J8CA 1BC7C 1SD7A 4U7BA 3RKWA 1FSEA 5CVIA 1BIBA 1QPMA 3HUGA 3E6DA 1C0WA 2BBYA 5CVJA 5HDGA 2DPDA 3O2PE 4P96A 3LFKA 3BJAA 2MH9A 5E8IA 5HOOA 1P4XA 1HSJA 3HHHA 3M8EA 4KMUX 5JR3A 1RI7A 5CVUA 3BPXA 4WX9A 2D2WA 1G3WA 1LVAA 4GCVA 5ICGA 4YIIA 1J59A 2VODA 1R5GA 5L3DA 4EGZA 3EUHA 1YW9A 2QWWA 1SAXA 5AIQA 1J0RA 2AS5F 2OQGA 2UWMA 1ZRCA 2Z99A 4HF2A 4L9NA 2W85A 1G3SA 4A0XA 1KA8A 2IRFG 5ICFA 1IF1A 1P6RA 4YIFA 2LKPA 1Z6TA 2KIMA 4OIQF 2M45A 5BPDA 1YYVA 5D5WB 3HHGA 1RIOH 1K78A 1XGSA 2DLLA 1JHFA 1QZYA 2V1UA 4P55A 2PMHA 1ZH5A 2LSOA 5E17F 1YLFA 4RB3C 3DKWA 1FP1D 3GVAA 2PQ8A 4ENKA 5LEJA 1PP7U 2VONA 1YIOA 4P5OA 3J81Z 4KIBA 3PFIA 4HAMA 3ML6A 4RAZA 4EJWA 3V8KA 3ELKA 1QQIA 5DYMA 1O3RA 5LHIA 2DAOA 5AIPA 3H3ZA 5DDGA 2FMYA 4GO1A 3GFJA 1Z05A 3K9TA 5D5XB 3SZPA 1HXDA 1FOKA 4EGYA 3FM3A 3E97A 4RGXA 4HDUA 4KFCA 4HYEA 5HS7A 3IKVA 3F8CA 1YQAA 1BIAA
chains in the Genus database with same CATH superfamily
1BW5A 4MEXF 3M1CA 5DEQA 2X4HA 2H8RA 2CUZA 4GRIA 4N9IA 3DU6A 3G1MA 2PLYA 1RRJA 2O5RA 2IA2A 2DOFA 1ETOA 5FO5A 2X6OA 2CFOA 5EG0A 1UCRA 5C3EJ 2P5KA 2X51A 4DYRA 3U2RA 1G2HA 3CJRB 1X1AA 2CW8A 2VXZA 2WADA 1JKRC 2CUJA 2CUFA 3F72A 3WU2C 1IO2A 3OYBA 1QPIA 1ON2A 2ID3A 4U87A 3GTJJ 1X1CA 1WJAA 3WG7H 2DJNA 4NC8A 4NQWB 3ZQ7A 1LVKA 3LSHA 5FFZA 3CJQB 3C3WA 5EG0B 5HS9A 3KZYA 4DBQA 2LY9A 1RR7A 1BA5A 1Z91A 3JRHA 2CRGA 2NS8A 1U8BA 1B1BA 1G3YA 1YFHA 3DWLE 3OV8A 3P9KA 2F5EA 3OS0A 2STTA 4YFKF 3JSOA 3DP7A 1A36A 4KUMA 3J81K 3BZ6A 1MMAA 1QVTA 1IN6A 1EH6A 1AOYA 3U21A 1MH3A 3A0BC 1USTA 2GXAA 3FWEA 3D5RC 4IRGA 1FLIA 1UHSA 3LA2A 2V7FA 3S1QJ 2DA5A 2M9HA 3IL2A 2Q1ZB 2NS0A 2BXZA 3BTJA 5HLTA 4G7OF 3HL2A 5IYBJ 1BI1A 3RSNA 3PIPF 1MBEA 4AIKA 3GEZA 4GDFA 1IG7A 4XONA 5K5RA 5IYCJ 3CUQB 2CS3A 2D1HA 3HZJA 2CQ7A 4MFEA 4IX7A 3BY6A 5BOXA 4M6XA 4HX7A 4UUVA 2JA2A 2JT1A 5E3MA 1EH8A 2GXBA 4I02A 2LH9A 3R60A 2M34A 4NBQA 2Z3YA 3GW2A 2XPUA 1MD0A 4R1HA 4PJMA 2XAJA 4I7HA 4UXNA 5CLSA 4BJ5C 4YG2F 2B63J 3QAHA 2E2IJ 4BXUA 2HYJA 3CUQC 3I4NJ 1ETVA 2X6XA 3H5NA 3ISPA 4A5NA 3LSPA 4RM2A 1DGRM 4C2MJ 2YU9J 3BTLA 2HQRA 1CF7A 4ETSA 4L0YB 2DTZA 1V5GA 4WXHA 2V6CA 2PX9A 2Z16A 5ILSA 5LD2C 1Z9CA 2D45A 1B72A 2VPLA 5DUIA 5J4VA 1TQIA 3ULQB 2IA1A 2CFXA 4C2TA 5F08A 4A6EA 3WE2A 1D1CA 4WXCA 3H3VK 1K83J 2DPUA 4ABZA 2A69F 1SEUA 3TW6A 2NOJB 1G8XA 1E0EA 1I3QJ 3BZCA 2VQCA 1CF7B 5E3LA 3MZ8A 1IV6A 1IXCA 1J09A 2OCEA 3JRAA 2H8WA 2EFPA 1B72B 1TBXA 3OYJA 1JT6A 4MGRA 5DM6F 2HKXA 5GPCA 2R7DA 4BQOA 1NG7A 1X1PA 2LREA 2QUFA 2LG4A 3ECOA 4DBRA 1RR8C 2GA1A 4BY7J 4LLGF 1S7AA 2LY1A 3COAC 1VQ8I 2DA2A 2AHQA 2OZ6A 1LDDA 4JK1X 5KK1A 5EZGA 3KCCA 1TNTA 2E7XA 1QBJA 4S05A 3F6VA 3KX2A 2M4KA 3ABMH 2HQAA 2XDVA 1OCCH 3W3CA 3PO3J 3RKYA 4LFUA 1GV5A 2VQLA 3DCFA 3R4KA 4F3QA 1ETQA 2OPTA 2OC6A 1PUFA 5D6EA 3ABTA 2ME6A 3WGGA 3K4JA 4BHCA 5HLHA 5E3NA 2K4JA 2NNYA 5K7FA 3QYEA 4EV0A 1AKHB 3R61A 2VB6A 3QWLA 2UV1A 4Y3OA 1Z7UA 4HW0A 1FBSA 1OJLA 2DA1A 2ID6A 1H0MA 4CGZA 3CLOA 3MKLA 1MH4A 2ELJA 1VQKI 1FTTA 1GUUA 3ONQA 4DQ2A 2R3SA 3W6VA 1YX3A 2IGNA 3A01B 1UZCA 4ENJA 2VC0A 3NRVA 1T08B 4LIUA 1TWGJ 3SDGA 4XRSG 1W36D 3CCUI 1UG2A 3N4MA 4AYBA 5HVQC 1T0FA 1I50J 3ZQCA 4BUPA 5E8GA 2W1OA 4ESJA 4FASD 3KYLA 4ZZLA 3CO6C 4ENNA 3CMAI 4DIQA 3FMSA 3ABUA 1Y39A 2ZCWA 1L3LA 1W7PB 2A3SA 3M8FA 4UB8C 2W00A 1SFUA 2DW4A 4XRFA 2IS4A 2BE5F 2QQBA 3MCZA 2LP0A 1W4MA 3ZMUA 2CQXA 3P5JA 2QVOA 3IH3A 3S32A 2ZSHB 2OZUA 4OIOF 2F48A 5DUKA 1T56A 4UUSB 5LRRA 3CQZJ 2XVCA 3IWZA 4IO9F 2O8XA 3OIQA 5B66C 4NC6A 4XKCA 2VBXA 5DV5A 2V9PA 4A0ZA 3F9KA 1GV2A 4ZTFA 5IY5H 2H6CA 1TQMA 1OR7A 3H1CA 4V2GA 3G73A 2FBIA 4BE2A 1HDDC 4UVBA 3LQRA 2IVMA 5FROA 2ZJ2A 1GVDA 1W5SA 1U8RA 3J7AY 5JI6A 2COMA 2FRHA 1YJWI 2R7UA 2DA4A 4ANJA 1USSA 4LGWA 1T0FC 4DNCA 1DPUA 2RC4A 4M3BA 1LFUP 3SHFA 2R5YA 1ZREA 1WGXA 2PBIA 1U9NA 1QGPA 2LMDA 2V9VA 2JRMA 3H35A 3HM5A 1R5ID 2HWVA 1IUFA 3K69A 4LG0B 1U3EM 2K5CA 1SD6A 2HU9A 2YR2A 2PI0A 1F9NA 2DQLA 4XM3A 2L7MP 5J3LA 3FHZA 2DO7A 1LQ1A 3K4KA 2CU7A 3DXJF 2EINH 2M7BA 4Y17A 4D5FA 2W24A 3WE3A 4RLQA 1S72I 2OAZA 4L9JA 2VT2A 4M73A 4A3FJ 4XOTA 1P92A 2O9LA 1ETKA 3EUKL 4WF2A 2QQ8A 4PZJA 4BQQA 2ZJPF 1HBXG 1IC8A 1ZRFA 2X1DA 2BY0A 3AG2H 2Y30A 1TLHB 4BACA 3KYDB 5J1RA 4WK8F 5E3OA 4G8XA 2C6YA 2WC2A 1WSUA 3HXLA 2R7XA 2CH0A 4A69C 4KITB 3N97A 3EYIA 4Y4RA 3DF8A 1KQ0A 1XCVA 3LNQA 1ZYRF 3K1MA 4MLOA 5DCMB 3W2VA 2NS7A 1NTCA 1FSHA 4I76A 4XN3A 3TL4X 1R36A 3JW4A 4Y33A 4G7ZF 5C44J 3BZKA 1I1GA 2EK5A 4IXAA 3E7LA 5D8LB 2QZ8A 2MGQA 2F5VA 2PMZN 5CQGA 2OCCH 4U0YA 3BQYA 4HF0A 3MZHA 2XAUA 2IS1A 5FGMA 3JTGA 2HFHA 3I4PA 3T1BA 4IF4A 2WY8Q 4XSXF 2A5YB 4LB6B 3V7SA 3LA3A 3HG9A 1DP7P 3BPVA 2G7HA 4M9SA 1IXRC 3S17J 2XC7A 2CMPA 2DK8A 1LDKB 3O6BB 3R6SA 3H9QA 2DDAA 5TGTA 3J7ZI 3C2GA 1QZEA 2BY1A 5J4YA 1MMNA 4IPAA 4RDUA 1Z3YA 4IOCF 5LFAA 5JFRA 1T38A 2CUEA 1LPQA 4XQFA 3GFLA 2MC3A 3L9FA 2I8DA 3NARA 2OUMA 4D0PA 4RMNA 1B9MA 3H5AA 5IP7J 3RKXA 2IS6A 1S5LC 4EQQA 2L01A 2E7WA 4E7SA 4II3A 2FUG2 1XMAA 1R1VA 4XLHA 3VYUB 2IAIA 4ZJZA 1E3HA 3L2CA 2JA7J 4HNTA 1LKXA 5LGUA 2MFZA 2VE8A 2L7FP 1QHHD 2ZB9A 3HIFA 4YFXF 5K1YA 3I55I 1GLNA 5L3FA 4JX4A 4CYDA 2L9NA 2Q2EA 3FX3A 3Q0WA 1J75A 1TW3A 1S29A 3E6CC 2VUMJ 2FF4A 1E3OC 4CDGA 1UELB 3SZGA 2M0MA 2XSDC 1P4AA 2XGEA 3OMYA 3KLNA 3VSLA 2XF7A 2ESHA 4L9VA 3K1NA 2K9MA 3HBLA 4E7LA 2K7LA 3EPZA 4R8HA 2VJIA 3IC7A 2E1MB 3FBIB 4EJOA 1D0YA 2KZGA 2K3PA 3I54A 3VDXA 1N75A 4ZYGA 1DQUA 3BT9A 2DCEA 3C7JA 2I10A 1JE8A 4KYWA 1FIPA 1VQ4I 3GXOA 2DMQA 3MQ0A 5HODA 1P2FA 2FEZA 2A5WA 1D0XA 4FE7A 3S14J 3H36A 2A68F 3RI4A 1DU0A 3CC2I 2ZXWH 3BTIA 3FXKA 2F5FA 3HRUA 1TP4A 1SFKA 3CCQI 2E1MC 3ZQFA 4AIHA 4GGGA 1TC3C 2L4AA 2XGDA 3MD2A 3EYYA 1XD7A 4A3IJ 1T8IA 3VB2A 4KDPA 3RKQA 1IN4A 3J80Z 5LHGA 3F0CA 5F27A 3TGNA 2FXAA 2V79A 4CCNA 1V55H 3KPHA 3RYPA 4B1RA 2DT6A 2MD0A 2KT0A 2FJ1A 3OIOA 1MNMC 3C2BA 2A6EF 1Y0NA 4UV9A 1J9IA 2QYOA 3HKZN 5LRSA 3TW7A 4PCQA 4BY1J 2DMUA 3HOSA 5LHHA 5KCMA 3OL4A 3GFIA 4B44A 3M8JA 1WKMA 2HXOA 2CJJA 1MGTA 4L5EA 1JTYA 1AA7A 4AIJA 5FLXK 3M3YJ 2VKVA 4M72A 1MZBA 1TT5B 2CQKA 3LSJA 2B9SA 1BOAA 3FXOA 1SMTA 4XLAA 3HTUA 1PVEA 4IQJA 1Y1VJ 2Y0MA 3JRCA 4B3AA 1ZG5A 1BR1A 1D1BA 1KQ8A 2A6HF 2M30A 4AWXB 3GUDA 1T2KA 3LQQA 4JX5A 2XPVA 4HDVA 1B8IB 1IRFA 3DLAA 2L2OA 2AO9A 3RJPA 1ON1A 3LA7A 2ZSIB 3L2RA 3IP4B 4DJAA 2XRNA 2HYGD 3CCLI 2IPQX 3HRMA 2LY2A 4RB0A 1VQOI 4CSWA 2BHZA 3BR6A 5JLWA 3I4MJ 1B59A 5H2FC 2CV0A 3KP2A 5F0CA 2WV0A 3LL7A 2HDCA 1MNEA 3ZXSA 5DM7F 5AONA 3W2AA 1S7OA 4YELA 1UHMA 1LEBA 1PJRA 2HTJA 3DFGA 2K9LA 3ZCOA 5GTHC 2IT0A 4BEHA 1T6SA 1HOMA 2EZIA 2LFBA 1ZLKA 1F43A 3QU6A 2MABA 1UHWA 2W7NA 3CTAA 3HSEA 4NUBA 3MEXA 3GBGA 1FOWA 1ZR2A 1QA6A 4ZC3A 3D5SC 5LGNA 3AKZA 4M3DA 3QODA 1S7EA 3B02A 4HNVA 2LDUA 1SVMA 3K2ZA 3FZVA 3KZZA 4A3MJ 1WHUA 1R4NB 2DJIA 3FISA 1H89C 1BR4A 4RM3A 4I98B 4UHTA 4OMZA 2XV4S 4PDKA 3GYHX 1WVRA 2CW0F 3SJMA 3F23A 4A6DA 3RZDJ 5H6QA 4QPQA 1TWHJ 3BG9A 2ZO4A 1OCOH 4AYBN 5CJ9A 2Y48A 3LSIA 3J80K 1VQ6I 3KEQA 1AHDP 1Y0UA 2EILH 1WJCA 2BVMA 2XAFA 1D3YA 3GX4X 2BY2A 2HZDA 4M71A 3GF2A 4XBFA 3LSMA 3SQNA 4CUGA 3DKYA 1FEXA 4CICA 3KP4A 3ZQLA 5L3CA 2ECBA 3JCUC 2CSOA 2W84A 2KIUA 4ZYEA 3JRIA 3O8GA 5LLQA 4F92B 2EFOA 4KNYA 3WHBA 4RAYA 1XTAA 2JTVA 4ESFA 4GYIA 2L4MA 4P1WA 3ZQHA 3B73A 2D5VA 1TZLA 3F3XA 1TTYA 3RPQA 3HOWJ 3FK7A 1FOXA 2LOOA 2CV2A 2NYXA 1O4XA 5CQEA 2KLOA 4U0VA 4BHPA 3VSKA 2KKOA 2DT7B 3LAPA 2G9WA 2BZTA 2LC2A 1W7PD 1O3QA 5LBQA 3S1MJ 3HB9A 2LLKA 4G7HF 3Q5FA 1VQNI 4IHSA 3JTHA 4DZJA 2FBKA 2KQRA 4NQWA 4BBRJ 2DN0A 2HR3A 3QPTA 3QYBA 4XR6A 1Q1HA 1ACIA 4HLXA 1BL0A 2O03A 3H3UA 3BR3A 2HDWA 3QYFA 4B48A 2F6CA 4KMFA 1YI2I 2W82A 4E7ZA 1K79A 2MG4A 2HQ5A 2DTRA 1SMYF 1K4TA 1OYIA 3OIPA 1IN7A 1XGNA 2DBBA 4BKXA 4F91B 4E70A 3S2WA 4RA2A 4XRSA 2A61A 1S8NA 1Z7LA 1WJDA 4EEFG 3W6KB 1HA8A 1RPWA 1K4SA 2XAHA 3GTKJ 1FJLA 2P5VA 3F8FA 1MBJA 2CG4A 2HXIA 3DLLF 1J5YA 1SD4A 2BW3B 2Z9OA 2XHKA 3RQ4A 2R5ZB 4KJZA 5IOZA 3TEDA 2Y69H 4PSXA 1AWCA 4ZDPA 5FKOA 2GBYA 4G94A 1RZ4A 2XAQA 2VPRA 4WCGA 4B43A 1G4DA 5H6RA 4XORA 1LEAA 2MD5A 2E1CA 5HLIA 3CUQA 1PDNC 5FRNA 2A07F 1MKMA 4XIDA 4DYCA 3OYAA 4B3XA 1EV7A 1IUYA 3WGIA 4AVPA 1IAWA 2VKHA 1KONA 1TQPA 1KU2A 4I6ZA 1OYYA 3ASNH 1X3ZB 4BHBA 2M1BA 2P8TA 1VF9A 3OYCA 3BTCA 2ESNA 4XLPF 2ZBKA 3TO7A 1YJNI 3HJEA 3CUOA 1YOVB 1Y1WJ 1WRJA 1IGNA 4KN4X 3DKXA 3GZ6A 4BL0B 3C18A 4P9UA 1I6HJ 2KISA 2OQRA 2PN6A 4KISA 1ZN2A 4XLNF 1OCRH 2RN7A 2JUGA 1TWCJ 3V8JA 3GZ5A 1WPKA 2UXNA 5EEAA 3K0LA 2DYRH 3S3NA 4PK4A 5DS9A 1SD5A 2HYFA 5JHUA 2R7FA 3OYEA 3HKZA 3TP0A 2EV6A 1R4MB 1VZ0A 3DBRB 4I09A 3G71I 1ETYA 2N8GA 1BN5A 2V1NA 2UXXA 3CMYA 3CMEI 1REPC 1L0OC 3FKJA 3SZTA 3Q3SA 1FY7A 3ZMVA 4B47A 1LNWA 5L3EA 3OYMA 1I1SA 1FP2A 1HKSA 1V5EA 2K3FA 2HOEA 4X6AJ 4BU2A 4E7JA 1BJAA 2E35A 3AG1H 4LB5A 1YS6A 2Y9ZA 2OU2A 1KQ9A 3HRSA 4ZYAA 1QU3A 5M3MJ 4O5VA 2VASA 2AXLA 2J5PA 3OSFA 1TT0A 3OYNA 5KAFC 2EZHA 4MIMA 4XOPA 3RYRA 2PEXA 2EZKA 3BP8A 2HS5A 3BLYA 4LK0F 3EDPA 2CO5A 4CO8A 3FXJA 3OY9A 1WZ2A 3DTIA 4BNCA 3S16J 4F93B 1AKHA 4NB5A 2EFWA 4BH9A 5J1YA 2VOPA 3M4OJ 2F5DA 3QU3A 3F6OA 3KIOA 4CYCB 1GT0C 2W48A 3OYGA 2XB0X 2WTEA 1HKTA 2DFEA 3BJ6A 1WH7A 3UR3C 4UY8I 2ZC2A 2KIFA 3AG4H 2JRTA 2WB1N 4KN7X 5CVRA 3A01A 2RAEA 2XB5A 1ULYA 2YPRA 4FETA 1MJBA 1YRNB 2DMNA 4CHUA 3RDIA 1QO0D 5ILVA 2Q8KA 2M8EA 3SFZA 4L18B 1I27A 3ZQIA 4BJTA 3WTVC 1EKEA 3K6GA 1KU3A 1ZLJA 4XKWA 2MSYA 2CYYA 2EV5A 9ANTA 3K70C 1DGWY 3CMMA 4G6TB 3GLLA 3BG3A 3CD6I 1YE9A 2OTLI 2JMWA 3AG3H 1W7PA 1TNSA 1OKRA 4Y52J 2MA3A 3TMOA 2Z1DA 3WU1B 1MMDA 1X58A 1FZPB 6PAXA 1YO5C 3HGYA 1RNLA 5HDNA 4YIRX 3L00A 2QM3A 2NVUB 1Z67A 4CCMA 4F7ZA 2ZJRF 3E1SA 3MMYB 3GO5A 3WGHA 1JUMA 4IVNA 4UUSA 3IRQA 4K2EA 1VTNC 4EM0B 1FYLA 4UUTA 1TW2A 3FMRA 4AUXA 2GWRA 2MYSA 1XGMA 4JBAA 2EA4A 5EEGA 5FKKA 4ASNA 4XRMA 2XKOA 4II2A 4MEYF 1WJ5A 3KEYA 3HOXJ 3S3OA 1O3TA 1FYKA 1R7JA 1Z3XA 4KIFA 4AD9A 1O7FA 2NNNA 4G12A 2WAQN 4BXFA 2M87A 3ZMZA 3WHCA 2ELKA 2DU9A 3NAUA 2EWNA 4HZFA 5ICEA 5JVGF 3R0AA 3I59B 4LG0A 3RIRA 2ZXHA 1ORKA 3F8BA 3E5QA 3KE2A 2DFHA 3NQOA 5ICCA 2BGCA 1F5TA 4F55A 1D0ZA 4BAYA 1FMWA 5KAIC 4LK1F 4EM2A 4A3JJ 2P6TA 5M5WJ 4N4OB 4GFBA 3WTTC 3BG5A 2JQ7A 4CH7A 4OOIA 5F0HA 1T39A 1HF0A 2DYSH 1YJ9I 4IHVA 1A6IA 3CDIA 4Q47A 1OMIA 4NHJA 4HRIA 3HDDA 2STWA 1HCRA 3FXMA 4XK4A 3HYIA 4M9XA 4A2UA 2QBYB 4ENMA 1BBYA 2FE3A 2VT3A 4FE4A 4ZYHA 2GOMA 1BC8C 2LF8A 2LBFB 2IBDA 3P9IA 3A4CA 3QPLA 3KZIC 2LTPA 2NOGA 5DCMA 1TWAJ 1ZELA 3BCBA 2X85A 3BDDA 3M07A 3BR0A 4DYQA 5L3GA 1XDUA 3MKYB 2CQQA 3VODA 3KFWX 1V3FA 3S93A 5K5QA 3T8RA 4BQAA 3H5RA 2KRCA 1U5TC 2Y0SA 2KJBA 3ZN0A 1S9HA 3HGGA 1WCMJ 2GIZA 3LWFA 2Y31A 1FC3A 2MC4A 3ZP5A 3TDZC 2E1NA 3ROUA 2KMUA 1BI3A 3ZR8X 4IRIA 1LJ9A 5ED4A 1AU7A 1HSTA 1LFPA 2P0WA 3CDHA 2CWEA 3LFUA 5J1UA 3GTGJ 3VYSB 3QRFF 2JSCA 1F1ZA 1W5TA 1XSVA 4V2FA 5FD5A 1FYMA 4IHTA 4QWQA 2GXGA 3OR2C 1PYVA 1V54H 2R7VA 1T33A 5B1BH 1XS9A 5K5OA 4D7NA 1W0TA 2PJPA 2FSWA 3OS1A 2X6WA 3JRDA 2LF7A 4A3EJ 1VQ9I 1V4RA 2Q0OA 2QENA 1F36A 2GAUA 5IP6A 4H0EA 1E2XA 2IS2A 2OA4A 2UZKA 3SYTA 4HG2A 1R6RA 2RGVA 3KP7A 2HVRA 3H0DA 3E0JB 4UNOA 4BDZA 1R5HA 1ZAOA 4U88A 5BS6A 5C4JJ 3MFKA 5JHFA 2KJCA 3ABLH 2VJ5A 4HSRA 2DFIA 4C3IJ 5IT3A 4KA4A 4GXOA 3AAFA 2XF5A 2X48A 3CCVI 1Y56A 2Z5UA 2NAZA 4XL9A 4XN0A 3WU0A 4DW6A 1FPQA 3A1YA 3VPRA 4D5CA 1H9TA 2HZTA 3IV5A 4FCYA 5FLXZ 1RUOA 3F22A 3S3MA 1KU7A 1W5CC 1IDZA 2DOAA 4ITVA 1JT0A 2P5LC 4PGHA 5L3BA 5EGOB 2LRDA 5D4SA 3JRGA 2X9DA 1U6GA 2GA2A 1MDMB 2RQQA 2JVGA 4UB6C 2LKXA 1SFXA 3PM1A 1JKQC 5TRDA 2AQEA 4RB2C 2YSRA 3HSFA 3RCOA 2RDPA 1YITI 1G3TA 3ZMDA 4I2OA 2HOAA 2CGPA 4Y13A 2K86A 1DUXC 3DBLB 4RB1A 3REOA 2VE9A 3KYCB 4LOCA 5DD4A 4WWCA 2JPCA 4OWRB 3D5LA 3GFMA 1NK3P 4WXDA 1BJZA 3JREA 3OSGA 2RV8A 1IZ1A 2NVTJ 2HOSA 5DTDA 2FMLA 2QSFX 2JSPA 4P9FA 3CZ6A 2EJRA 4KIGA 3TKYA 3L09A 4MTEA 1MMGA 2FBHA 2K9SA 2MBFA 2QLZA 2RVCA 3E6BA 2QGUA 1KYZA 1ZQ3P 4FX0A 1MIJA 3OYKA 2WB1A 5BQTA 5H20A 2FD5A 1LE8B 1FBQA 4IOAF 3WTYC 3S1RJ 2F4IA 4OMYA 3PSIA 1HW2A 1XPXA 1YG2A 3ZPLA 3S1NJ 5ILUA 4X0GA 5E1XA 3LSGA 5CVVA 4EJTA 2QQAA 4D7MA 2BY3A 3I5UA 3M1EA 3BOQA 3E5XA 1WFXA 4XLCA 1X1DA 4HOBA 2VKDA 4JYKA 1G6NA 4MHGA 2X6YA 1MW7A 1K7AA 1N25A 2BYVE 1JJ8C 3OR1C 3G1LA 3L7WA 3QPSA 4O3MA 4C3HJ 4V19K 1E17A 2RQPA 4CCLA 3CC7I 2KL4A 2IXSA 1D5YA 2HDDA 4YFNF 3HSRA 1F4KA 3H92A 1XCBA 1X4OA 4OU0A 5J6XA 1APLC 5TISC 4MFDA 2O8KA 2DI3A 5IT9Z 4LG3A 3K4MA 4W97A 2M5WA 5TJJA 1WJBA 1B8IA 3I3LA 1RESA 2BV6A 2DODA 2X0LA 1YS7A 4PJLA 1I5ZA 2CV1A 4A3DJ 3WTUC 1D8JA 1MBKA 1VI0A 3HUGB 3PQJA 5E20A 5FFXA 2WAQA 1JTXA 2R0QC 2IGOA 4A0YA 3LSRA 3I53A 1QVUA 4RS8A 4D9JA 2ZNZA 4NDLA 1UJ8A 1SAUA 1XSDA 2K02A 3U1DA 1RC9A 3I9V2 2IP2A 2XAGA 2HOTA 4RGRA 2Y75A 2QA4I 5IOYA 1BW6A 2O7OA 2JPBA 5K7HA 1R49A 4XICA 1UMQA 2P4WA 4HQEA 3PUBA 1WWXA 2QF7A 2JWTA 4HQMA 3L2UA 2PJRB 1HC8A 2XGXA 3EETA 4GYGA 4D1QA 1B4AA 3K10A 5IPAA 2R7QA 1RKWA 1I6XA 1GXPA 3JR9A 4IL6C 4B09A 2E5NA 1G59A 5EEHA 2EFQA 4LIVA 2YX7A 3LMMA 3F21A 2FNAA 2B0LA 3HOUJ 2X1CA 1ETWA 1DDNA 3GTMJ 1HLVA 2M4GA 3MZYA 5EDNA 1JKOC 2W4SA 3RPUD 3CF5F 2QSHX 5GAGJ 2L9SA 1RUNA 3QP6A 4A12A 1OCZH 4I01A 2VBZA 3DQVC 4A3CJ 4PJJA 1ONVA 5BPIA 1OPCA 1R23A 1ZHFA 1ITYA 1ODDA 3M7GA 3K70D 3L2VA 3IAS2 3EUHC 3IRRA 5ERIA 2WWYA 1IN8A 2CW7A 2BHYA 3HOVJ 3TO6A 5FKLA 1GXQA 3DU5A 1OQYA 3VOEA 3CCJI 3ZMSA 4X1EA 2DXIA 3K4LA 3ZGKA 3G4SI 3CP8A 4N0BA 4PGGA 2ZXIA 2V9KA 1JHHA 5IT9K 2E2JJ 1K78B 1JI8A 3BJOA 4QSHA 4LJZF 2WV1A 1YIJI 4HV5A 2YUSA 1SC7A 3BCAA 4HEA2 2TRTA 3EUAA 2FQ4A 5HDKA 2HNHA 3K1PA 3QP5A 2DK5A 1X2NA 3HOYJ 3U1KA 3O8HA 1R22A 2EPFA 3L2WA 4BE0A 3I58A 4U7DA 2HEOA 2HI3A 5M5XJ 1J2XA 1HW5A 1Z77A 3V8LA 4A3GJ 4Q4ZF 2IA0A 3CCEI 4N9HA 3ESWB 2DOEA 3J7AO 1A04A 3M9AA 3WTWC 1IN5A 2M0CA 2V26A 1XN7A 5B3SH 2HKOA 2V1XA 4A3LJ 3MAJA 4UVCA 4LLNA 4O6JA 5HLGA 3FMQA 2QKLB 1O57A 4L5JA 4NC7A 2E1OA 2M8GX 4J19A 2ELHA 4PJ0C 5DD8A 1UFMA 1I3AA 1IV8A 2BW3A 1A6QA 1X19A 1ETXA 2R5ZA 4J00A 4HLYA 3DTEA 2GM4A 3ZN1A 3A03A 1DPRA 2ZKZA 2XKPA 3CCMI 2PG4A 1JJ6C 2KFDA 3GWZA 2J5OA 3DV8A 2NVYJ 4QIWN 3H9JA 2OBPA 1D1AA 5D8KB 2FQ3A 4E7IA 2H6BA 3S15J 3TBIA 4EM1A 3BC8A 5J40A 1D5VA 4L0ZB 1HDPA 2HPMA 4MQVA 2WY7Q 4RAFA 3LSKA 3T8TA 2M7AA 2FA5A 2UUZA 3KP3A 1NG6A 1S6LA 2Y0SN 3N05A 3IUOA 4C30A 4RGSA 1WJFA 1X2MA 3IWFA 4JX6A 4HX4A 5HNHA 1OYWA 3GZNB 5LEKA 1LB2A 2VI6A 2FNPA 1Z1DA 1ZGJA 5E18F 2P7VB 4A3KJ 1YW8A 3V7CA 3KLOA 1OISA 2B7EA 2WA0A 2JA6J 3I0TA 1MSFC 5D6FA 1YW7A 3ECHA 1XMKA 4B8XA 3QOPA 2TDXA 2LR8A 3BROA 5F1JA 2LD5A 5IYDJ 1NH3A 4IRHA 3MWMA 1X3UA 4S0HB 3P7NA 2O61A 3F8NA 5EYRA 2O6GE 1M1EB 3V4GA 5A2QZ 2MLKA 2LNBA 1BI0A 2ZMEA 3C1DA 3G1OA 5EJCA 5FKNA 2EV0A 1X3WB 2BOLA 5BMZA 4ZH4F 1EA3A 4C2UA 4PFOA 1A31A 3FF5A 5F6FA 5F64A 5IP9J 4I99C 2ADUA 4PJNA 2K9NA 3X2QH 3E3VA 4MNUA 3DTKA 4G9YA 2XUBA 2ZFWA 4ZYDA 5HS8A 4JQFA 2DA6A 1YHQI 4EVIA 3W2WA 3NWTA 3OYHA 1VQ5I 4CZZA 4N4NB 5GAEJ 2E36A 1LFBA 2ZMEB 4BJ6C 1HW1A 1MSEC 1P7IA 3MN2A 1OCTC 1KZHA 1Z0XA 4XKVA 1FX7A 3CP2A 1O7LA 1IXSB 2XGCA 3IH4A 3FKIJ 4XSZF 3DPLC 1FIAA 3KEOA 4M9ZA 2EIMH 2RKHA 3UNGC 3BG6A 4R79A 3ZQGA 3F8MA 2GZWA 3RPUA 3OL3A 2JJ7A 2F4MB 3HRTA 3PFYA 2WBMA 2L0KA 2IW5A 2E34A 1YX5A 1FT9A 2ZMEC 5EZHA 4OINF 4CYCA 1JGSA 3U9GA 2GQQA 3WTSC 3JSPA 3NEUA 2VC1A 1CGPA 1U2WA 3IKTA 4M74A 3V7RA 1ZK8A 3K4NA 2XIGA 1ZG1A 1JXSA 5EF6A 1GDTA 1ZTRA 1YRNA 4HA8A 3TO9A 4EJVA 2EIJH 4BXXJ 4MO7A 4QTRA 3MKWB 3R0JA 1FNNA 3LSTA 2BEOA 2RNJA 5M3FJ 4OIRF 2ME0A 4CZCA 3HOZJ 4LITA 2KDOA 1P4WA 3G3ZA 4HNUA 1O3SA 1H8AC 2VQHA 2TCTA 2RREA 4E4HA 2IGMA 2OD5A 4EMSA 4J01A 1Z6RA 1B9NA 2E71A 4CCJA 1R58A 2LVSA 2MLGA 3OWTA 3PL8A 3S8PA 2LKSA 1KGSA 5A2QK 3HOTA 1X4PA 3TQNA 5BNGA 5JVTA 1RKTA 3EQLF 3Q0VA 5LGTA 2IEKA 4C3JJ 3UKGA 1RETA 3IHUA 4TV7A 3VWBA 5GADJ 3TDUC 1HKQA 1T98A 3PNTA 4NNJA 4XNFA 4EJUA 2ISYA 4FT8A 2R7OA 2VN2A 4LLLA 5E1ZB 1J7KA 3WG9A 1K6OA 2NRAC 2Z33A 1HQCA 3Q9SA 2KRHA 4IHWA 1VQLI 4CXFA 1FMVA 4IHXA 1MNDA 2VOOA 3CCRI 4KICA 2WAEA 1DU6A 2F5CA 5GTIC 5E79C 2EH3A 3I59A 2VLAA 3FHNA 1PUFB 4DGWB 2OV7A 3PUFA 1NHAA 2HTSA 4M6YA 3OYLA 2O0YA 3TOBA 3ABKH 3A02A 2ICWG 2EZLA 2LYCA 4IJAA 2H09A 5D4RA 4Q48A 2HVSA 3DEUA 4AC0A 3NWSA 3W6JB 3O3KA 2FX0A 1P7JA 3OYIA 1TL8A 1S3JA 2EIKH 2QBYA 1QRYA 1R1TA 2DFFA 3GTQJ 1OLTA 2K40A 1Z21A 5B1AH 3WODF 2X1EA 2GOXB 2ZXJA 3OS2A 1U5TA 3ZRGA 3IAM2 3D0SA 3KP5A 3PQKA 4HX8A 3FXUA 2A6TA 4G6DA 4M3FA 2HGCA 2LBFA 2G0EA 2ETHA 2WAFA 3FK6A 4HBLA 5KVRA 4XLEA 4QPOA 2L02A 2DQRA 3DBHB 1UB9A 2NVXJ 2KIQA 2IJLA 4EATA 2P6SA 1WQ2A 5D5UB 1H9GA 1ZGWA 1CQTA 4I0AA 2ZFUA 2XPWA 4ON0A 4E7HA 1W0UA 1VQ7I 1B6AA 2F2EA 2HQNA 3Q9VA 4FHTA 1KU9A 3QPHA 5FLMJ 2QEXI 1XSXA 1U5TB 2JN6A 5FKMA 2ACJA 1FTZA 4HF1A 1R00A 1FWZA 3GLXA 3HPGA 2MW8A 3WTZA 3AL0B 4UV8A 4JOMA 4IZZA 5FJ8J 5CYVA 4CCOA 2AQFA 2W57A 3OYDA 3A2KA 3CLQA 4AVZA 1DP3A 3FM5A 2VXDA 5CKTA 2YX4A 3GTPJ 2VBYA 1ZRDA 4A3BJ 3K7AJ 3BR5A 2OTJI 2GLOA 2R7ZJ 3BG7A 1ZGAA 4FISA 3CDLA 2Y2ZA 5D5VB 1XC5A 4E6KG 4AM3A 4OIPF 2KP6A 4JP0A 2DMPA 4XMYA 2M2EA 1QHGA 3QQAA 3AL0C 2H27A 1MJ9A 1KYWA 4L9TA 1SVOA 4PFPA 2R5YB 4ZZDA 1EH7A 2FOKA 3L1PA 1SFEA 2HVQA 5HNFA 4FX4A 3S2HJ 2I5UA 3KP6A 4G6QA 3JAMZ 2Z2SB 5FB2A 1OR7C 3KETA 3PIOF 3PJRA 2VIXA 1R1UA 2VJ4A 4QLCU 1XMXA 3C2HA 5J8FA 2L7ZA 1VQMI 3PNYA 1PP8F 5K7ZA 3DPTA 2R7SA 3DPUA 2BVLA 3VYTB 5F04A 4Q5SF 2PFBA 2FOWA 2QKMB 3OYFA 1YTYA 4PSWA 2K27A 3JRBA 4KT6A 4ZTJA 2EB7A 1QZZA 3ZQQA 1Y6IA 2MH2A 4Z2YA 2DMTA 2KDZA 2P7CB 3JRFA 1IW7F 5C4XJ 4HPQA 1XDSA 1ZG3A 2JZYA 2G7UA 5EGOA 2PMUA 4CCKA 1ZARA 1U9OA 1MDMA 2ISZA 2KZVA 3E6MA 3FXQA 2XROA 4BDYA 3VYRB 4Y15A 1BI2A 3G6EI 2L7KA 2Y9YA 4LMYA 3RTRA 3SDBA 4DZPA 5KHDA 4A93J 4PUSA 4E7KA 5GP9A 5J47A 3SXYA 3T0YA 2K4BA 3FXRA 2KRFA 4F52A 2D1VA 4MQ9F 1VNDA 2H94A 1FOYA 2R93J 2E60A 2DA3A 2L3DA 1GHCA 3J7YJ 2EFNA 1JUSA 1IRZA 1WH5A 2EBIA 1ZKGA 2NVQJ 2DT5A 3VFZA 3CF2A 2ZNYA 5F1RA 1U78A 4BS9A 5FD6A 1IRGA 4I0BA 2NXNB 3TOAA 2COBA 3BWGA 2F4OB 3CO7C 2YU3A 1MJAA 2VBWA 3L2QA 1SFOJ 1BM9A 2BXYA 2L9RA 4HV6A 4LD5A 2V1DA 4DOZA 1PUEE 4RAGA 1LE8A 1WJEA 1Y8QB 3ZMTA 3LAJA 2GIVA 2QCOA 4IEJA 4UVAA 4MTDA 3RZOJ 1IJWC 4BBSJ 4KT5C 4FQGA 3I64A 2EA2A 3D1NI 4Y7NJ 3HTSB 2H1LA 2L54A 5DCFA 1A5JA 1MBGA 1LDJA 2K9QA 4H4KC 3CESA 3RQIA 2OF7A 4L5IA 2LK2A 3CCSI 1QNTA 3GTLJ 3CJNA 1MBFA 2VQGA 1ERDA 1STZA 1MBHA 1WI9A 3FXLA 3SEZA 5E1WA 1A35A 4C9YA 2XASA 4S04A 1I39A 1XGOA 1OFCX 3P9CA 3JAMK 3BQZA 3I71A 3QOEA 2ZJQF 2JVHA 5B5EC 1D8KA 2KPMA 3PO2J 2W25A 1Q1VA 1JKPC 4BYYA 3HPHA 3PSFA 3ERED 2FU4A 1FBUA 3FBNB 3OOPA 4RGUA 4A5MA 3T5XA 3E5UA 4U0WA 3WTXC 2QQ9A 4ESBA 1XB4A 1GVJA 2XRLA 2A05A 2O3FA 2Q2EB 3AFHA 3VEPA 4XLFA 5J8CA 1BC7C 1SD7A 3K2AA 4U7BA 1LUJB 3RKWA 1FSEA 5CVIA 1K61A 2HPIA 1P9QC 4IKFA 5CPRB 1NK2P 1N78A 1BIBA 4HSTA 1QPMA 3HUGA 1R71A 3E6DA 1C0WA 2BBYA 5CVJA 2AXTC 1WI3A 2KHMA 5HDGA 2DPDA 3O2PE 5GAHJ 5M5YJ 3GCMA 2R7RA 1UAAA 1ZR4A 4P96A 3LFKA 3BJAA 2MH9A 5E8IA 5HOOA 1TWFJ 1P4XA 1HSJA 2K85A 3HHHA 3K4CA 3M8EA 4KMUX 5JR3A 1JUPA 2R7WA 1W36C 5FRMA 1POGA 1RI7A 3MVPA 5CVUA 3BPXA 1H88C 1E3PA 3DEEA 3SEQA 4WX9A 2YS9A 3B6AA 1EJ9A 2D2WA 1G3WA 1LVAA 4YEJA 4IQ4A 2PJRA 4GCVA 1IRXA 4Z6YA 5ICGA 2V4JC 3FIWA 4YIIA 4FTHA 5JLXA 1J59A 4ZDLA 2DDBA 2VODA 4CA0A 1R5GA 4RBOA 2OJED 1U0JA 5L3DA 4EGZA 3EUHA 1YW9A 5GPAA 2V6EA 1ENHA 3OOUA 2CQNA 2QWWA 2R4GA 2VKEA 1BOBA 1IDYA 1SAXA 1K6YA 1UG0A 3CJTB 3V42A 5AIQA 1J0RA 2AS5F 2OQGA 1VFCA 2UWMA 1ZRCA 2M3AA 2Z99A 4HF2A 3HEFA 4L9NA 1T95A 2W85A 1G3SA 4A0XA 1KA8A 3CCYA 1OCPA 1VQPI 2IRFG 4IHYA 3Q0UA 3HC7A 5ICFA 1XG1A 1IF1A 1P6RA 2JA5J 2LKPA 4YIFA 4ZDOA 3ZOBA 1Z6TA 2KIMA 4M6VA 4OIQF 2M45A 1X1BA 4M3GA 5BPDA 3GTOJ 1MMSA 4AU7A 2VL8A 3DEWA 1YYVA 5D5WB 4AIDA 3HHGA 4YRVA 1RIOH 1K78A 1XGSA 3ERMA 3BR2A 3G2BA 2DLLA 1SANA 1JHFA 2XSJC 1QZYA 2V1UA 2P81A 4P55A 2PMHA 1ZH5A 2LSOA 5E17F 2RNGA 4XKBA 1YLFA 4RB3C 2E2HJ 3DKWA 1FP1D 4BGDA 5FLVA 3GVAA 2PQ8A 2JK3A 3H0GJ 4ENKA 2H1KA 5LEJA 4BEHB 2VJJA 1PP7U 2VONA 1YIOA 3IH2A 4RLFA 4BQNA 4P5OA 3J81Z 3B6CA 4KIBA 3PFIA 1BR2A 4HAMA 3S2DJ 3ML6A 4RAZA 3H9GA 4EJWA 1W1WE 3V8KA 3ELKA 2E5ZA 1R9TJ 2XF6A 1QQIA 5DYMA 1O3RA 1V5FA 4BE1A 5LHIA 2DAOA 4B4CA 2ECCA 5AIPA 1XX5A 4OAYA 3A0HC 2PMZA 2DA7A 3H3ZA 3SFIA 5DDGA 3CC4I 2IGKA 2R92J 2FMYA 2E19A 1N77A 3MKZA 4GO1A 2QSGX 3GFJA 1Z05A 3K9TA 3PNVA 3K4BA 3GMEA 4W1UA 5D5XB 3SZPA 1HXDA 4M3EA 1FOKA 4EGYA 4OAZA 1SVLA 3FM3A 5KNLA 3I56I 3E97A 1Y8RB 2R7TA 4RGXA 2JUCA 4HDUA 3BR1A 2EQRA 4KFCA 4HYEA 3TP3A 3ASOH 3FDYA 3IKVA 5F0FA 5HS7A 2L5QA 3F8CA 1JGGA 1YQAA 2JA8J 1BIAA 2L9VA 1EF4A 3LOCA
chains in the Genus database with same CATH topology
4MEXF 5DEQA 2X4HA 4N9IA 2PLYA 2IA2A 5FO5A 1UCRA 2P5KA 3U2RA 2VXZA 3F72A 1ON2A 3ZQ7A 5FFZA 3C3WA 5HS9A 3KZYA 1Z91A 1B1BA 1G3YA 1YFHA 3OV8A 3P9KA 2F5EA 2STTA 4YFKF 3JSOA 3DP7A 4KUMA 3J81K 3BZ6A 1IN6A 1EH6A 1AOYA 1USTA 3FWEA 4IRGA 1FLIA 3LA2A 3IL2A 2NS0A 4G7OF 1BI1A 4AIKA 3GEZA 5K5RA 3CUQB 2D1HA 3BY6A 5BOXA 4M6XA 4HX7A 4UUVA 2JT1A 1EH8A 2GXBA 4I02A 3R60A 2Z3YA 3GW2A 1MD0A 4R1HA 2XAJA 4I7HA 4UXNA 5CLSA 4YG2F 3QAHA 4BXUA 3CUQC 3ISPA 4A5NA 2HQRA 1CF7A 4ETSA 4L0YB 4WXHA 2V6CA 5ILSA 1Z9CA 2D45A 5DUIA 1TQIA 3ULQB 2IA1A 2CFXA 4A6EA 3WE2A 4WXCA 2DPUA 2A69F 1CF7B 1IXCA 2EFPA 1TBXA 4MGRA 2HKXA 2R7DA 2QUFA 3ECOA 2GA1A 4LLGF 1S7AA 3COAC 2OZ6A 1LDDA 4JK1X 5KK1A 3KCCA 1TNTA 2E7XA 1QBJA 4S05A 3F6VA 3RKYA 4LFUA 3R4KA 5D6EA 3ABTA 3WGGA 4BHCA 5HLHA 2NNYA 2K4JA 4EV0A 3R61A 1Z7UA 4HW0A 1FBSA 1H0MA 4CGZA 3CLOA 4DQ2A 2R3SA 4ENJA 2VC0A 3NRVA 3N4MA 5HVQC 1T0FA 5E8GA 4ESJA 4ZZLA 3CO6C 4ENNA 3FMSA 3ABUA 2ZCWA 1L3LA 1W7PB 2A3SA 3M8FA 1SFUA 2DW4A 4XRFA 2BE5F 2QQBA 3MCZA 1W4MA 3ZMUA 2QVOA 4OIOF 2OZUA 5DUKA 5LRRA 2XVCA 3IWZA 2O8XA 2VBXA 5DV5A 4A0ZA 2H6CA 1TQMA 1OR7A 3G73A 2FBIA 4UVBA 3LQRA 2IVMA 2ZJ2A 1W5SA 1U8RA 5JI6A 2COMA 2FRHA 1USSA 4LGWA 4DNCA 1DPUA 2RC4A 3SHFA 1ZREA 2PBIA 1QGPA 2V9VA 2HWVA 3K69A 4LG0B 1U3EM 1SD6A 2YR2A 2PI0A 1F9NA 2DQLA 1LQ1A 3FHZA 2DO7A 4Y17A 3DXJF 2W24A 3WE3A 2OAZA 4L9JA 2VT2A 4M73A 1P92A 4WF2A 4PZJA 1HBXG 1ZRFA 1TLHB 4WK8F 4G8XA 2C6YA 2WC2A 1WSUA 3N97A 3EYIA 3DF8A 1KQ0A 1XCVA 1ZYRF 3K1MA 5DCMB 1FSHA 1R36A 3JW4A 4G7ZF 1I1GA 2EK5A 4IXAA 5D8LB 2QZ8A 3MZHA 4U0YA 4HF0A 5FGMA 3JTGA 2HFHA 3I4PA 3T1BA 4IF4A 4XSXF 2A5YB 4LB6B 3V7SA 3LA3A 1DP7P 2G7HA 3BPVA 4M9SA 1IXRC 2DK8A 1LDKB 3O6BB 3R6SA 4IPAA 5JFRA 1T38A 3GFLA 2MC3A 3L9FA 4D0PA 1B9MA 3RKXA 4EQQA 2L01A 2E7WA 1XMAA 1R1VA 3L2CA 5LGUA 2VE8A 3HIFA 4YFXF 5K1YA 5L3FA 4CYDA 3FX3A 2Q2EA 1J75A 1TW3A 1S29A 3E6CC 2FF4A 4CDGA 1P4AA 3KLNA 2ESHA 4L9VA 3K1NA 2K7LA 4R8HA 3IC7A 4EJOA 3I54A 4ZYGA 3C7JA 1JE8A 4KYWA 3GXOA 3MQ0A 1P2FA 2FEZA 2A68F 3RI4A 2F5FA 3HRUA 4AIHA 4GGGA 2L4AA 3EYYA 1XD7A 3VB2A 4KDPA 1IN4A 3J80Z 5LHGA 3TGNA 2FXAA 2V79A 3RYPA 4UV9A 2A6EF 1J9IA 2QYOA 5LRSA 4PCQA 3HOSA 5LHHA 3GFIA 1WKMA 1MGTA 4AIJA 5FLXK 4M72A 1MZBA 2CQKA 1BOAA 1SMTA 3HTUA 2Y0MA 1ZG5A 1KQ8A 2A6HF 2M30A 4AWXB 3GUDA 1T2KA 3LQQA 4HDVA 1IRFA 3RJPA 1ON1A 3LA7A 2XRNA 2HYGD 2IPQX 3HRMA 4RB0A 1B59A 3KP2A 2WV0A 2HDCA 5AONA 1S7OA 1UHMA 1LEBA 2HTJA 3DFGA 2IT0A 1T6SA 1ZLKA 3QU6A 1UHWA 3CTAA 3HSEA 3MEXA 5LGNA 3B02A 2LDUA 3K2ZA 3FZVA 3KZZA 4I98B 4UHTA 4OMZA 2XV4S 4PDKA 3GYHX 2CW0F 3F23A 4A6DA 5H6QA 2ZO4A 5CJ9A 2Y48A 3J80K 3KEQA 1Y0UA 2XAFA 1D3YA 3GX4X 4M71A 3GF2A 4XBFA 3SQNA 4CICA 3KP4A 5L3CA 2CSOA 2W84A 2KIUA 4ZYEA 5LLQA 2EFOA 4KNYA 4RAYA 2JTVA 4ESFA 4GYIA 2L4MA 3B73A 3F3XA 1TTYA 3RPQA 2NYXA 4U0VA 4BHPA 2KKOA 3LAPA 2G9WA 1W7PD 1O3QA 5LBQA 4G7HF 3Q5FA 4IHSA 3JTHA 2FBKA 4NQWA 2HR3A 3QPTA 1Q1HA 4HLXA 2O03A 3H3UA 4KMFA 1K79A 2DTRA 1SMYF 1OYIA 1IN7A 1XGNA 2DBBA 4E70A 3S2WA 2A61A 1S8NA 3W6KB 2XAHA 2P5VA 3F8FA 2CG4A 1J5YA 1SD4A 2Z9OA 2XHKA 1AWCA 4G94A 1RZ4A 2XAQA 4WCGA 1G4DA 5H6RA 1LEAA 2MD5A 2E1CA 5HLIA 3CUQA 1PDNC 2A07F 1MKMA 1EV7A 1IUYA 3WGIA 4AVPA 1IAWA 1TQPA 1KU2A 1OYYA 4BHBA 2M1BA 2P8TA 2ESNA 4XLPF 2ZBKA 3TO7A 3CUOA 1WRJA 4KN4X 3GZ6A 3C18A 4P9UA 2OQRA 2PN6A 1ZN2A 4XLNF 2RN7A 3V8JA 3GZ5A 2UXNA 3K0LA 1SD5A 2HYFA 5JHUA 2R7FA 2EV6A 4I09A 2UXXA 1BN5A 1REPC 1L0OC 3SZTA 1FY7A 3ZMVA 1LNWA 5L3EA 1I1SA 1FP2A 1HKSA 2HOEA 1BJAA 4LB5A 1YS6A 2OU2A 1KQ9A 3HRSA 4O5VA 2AXLA 2J5PA 3RYRA 2PEXA 3BP8A 2HS5A 4LK0F 3EDPA 2CO5A 4CO8A 4BNCA 4NB5A 2EFWA 4BH9A 2VOPA 2F5DA 3QU3A 3F6OA 2WTEA 1HKTA 3BJ6A 2KIFA 2JRTA 4KN7X 5CVRA 1ULYA 2YPRA 1MJBA 4CHUA 3RDIA 1QO0D 5ILVA 2Q8KA 2M8EA 3SFZA 4L18B 1I27A 3WTVC 1KU3A 1ZLJA 2CYYA 2EV5A 1W7PA 1TNSA 1OKRA 2MA3A 3WU1B 1FZPB 6PAXA 1YO5C 1RNLA 5HDNA 3L00A 2QM3A 4F7ZA 3GO5A 3WGHA 4IVNA 3IRQA 4K2EA 1VTNC 4EM0B 1FYLA 1TW2A 3FMRA 2GWRA 1XGMA 4JBAA 2EA4A 5EEGA 4ASNA 2XKOA 4MEYF 1O3TA 1FYKA 1R7JA 4KIFA 4AD9A 1O7FA 2NNNA 2M87A 3ZMZA 2DU9A 2EWNA 4HZFA 5ICEA 3R0AA 3I59B 4LG0A 3RIRA 3F8BA 3E5QA 3KE2A 3NQOA 5ICCA 2BGCA 1F5TA 4BAYA 4LK1F 4EM2A 2P6TA 3WTTC 4OOIA 1T39A 4Q47A 1OMIA 4NHJA 2STWA 3HYIA 4M9XA 4A2UA 2QBYB 4ENMA 1BBYA 2FE3A 2VT3A 4ZYHA 1BC8C 2LF8A 3P9IA 5DCMA 3BDDA 5L3GA 1XDUA 3VODA 3KFWX 1V3FA 5K5QA 3T8RA 4BQAA 1U5TC 2KJBA 3ZN0A 3LWFA 1FC3A 3ZP5A 3TDZC 2E1NA 3ROUA 1BI3A 4IRIA 1LJ9A 5ED4A 1HSTA 3CDHA 2CWEA 3QRFF 2JSCA 1F1ZA 1W5TA 1XSVA 5FD5A 1FYMA 4IHTA 4QWQA 2GXGA 5K5OA 2PJPA 2FSWA 2LF7A 1V4RA 2Q0OA 2QENA 2GAUA 4H0EA 1E2XA 2OA4A 2UZKA 2RGVA 3KP7A 4UNOA 1R5HA 1ZAOA 4U88A 5BS6A 3MFKA 2KJCA 5IT3A 4KA4A 2DFIA 4GXOA 3AAFA 2Z5UA 2NAZA 3WU0A 1FPQA 1H9TA 2HZTA 1RUOA 5FLXZ 3F22A 1KU7A 2P5LC 4PGHA 5L3BA 5D4SA 1U6GA 2GA2A 1MDMB 1SFXA 5TRDA 4RB2C 2YSRA 3HSFA 2RDPA 1G3TA 3ZMDA 4I2OA 2CGPA 4Y13A 2K86A 1DUXC 4RB1A 3REOA 2VE9A 5DD4A 4WWCA 2JPCA 3D5LA 3GFMA 4WXDA 2RV8A 1IZ1A 2FMLA 4P9FA 2EJRA 4KIGA 3TKYA 3L09A 4MTEA 2FBHA 2MBFA 2QLZA 2RVCA 3E6BA 1KYZA 4FX0A 5BQTA 5H20A 1FBQA 3WTYC 4OMYA 1HW2A 1YG2A 3ZPLA 5ILUA 5E1XA 5CVVA 4EJTA 2QQAA 3I5UA 3M1EA 3BOQA 3E5XA 4HOBA 1G6NA 4MHGA 1K7AA 2BYVE 3L7WA 4O3MA 1E17A 2RQPA 4YFNF 3HSRA 1F4KA 3H92A 1XCBA 4OU0A 5J6XA 2DI3A 5IT9Z 2M5WA 5TJJA 2BV6A 2X0LA 1YS7A 1I5ZA 3WTUC 1D8JA 5E20A 3PQJA 5FFXA 4A0YA 3I53A 4RS8A 2ZNZA 1XSDA 2K02A 3U1DA 2IP2A 2XAGA 4RGRA 2Y75A 2JPBA 2P4WA 4HQEA 1WWXA 4HQMA 2XGXA 3EETA 4GYGA 1B4AA 1I6XA 1GXPA 4B09A 5EEHA 2EFQA 2YX7A 3F21A 2FNAA 2B0LA 1DDNA 3MZYA 1RUNA 3QP6A 4A12A 4I01A 2VBZA 3DQVC 1ONVA 5BPIA 1OPCA 1R23A 1ZHFA 1ODDA 3M7GA 3IRRA 5ERIA 2WWYA 1IN8A 3TO6A 1GXQA 3VOEA 3ZMSA 4N0BA 4PGGA 1JHHA 5IT9K 1K78B 3BJOA 4LJZF 4HV5A 5HDKA 3K1PA 3QP5A 2DK5A 1R22A 2HEOA 3I58A 4U7DA 1J2XA 1HW5A 3V8LA 4Q4ZF 2IA0A 4N9HA 3J7AO 1A04A 3M9AA 3WTWC 1IN5A 1XN7A 2HKOA 2V1XA 3MAJA 4UVCA 4LLNA 4O6JA 5HLGA 3FMQA 1O57A 4L5JA 2ELHA 5DD8A 1UFMA 4HLYA 3ZN1A 1DPRA 2ZKZA 2XKPA 2PG4A 3GWZA 2J5OA 3DV8A 2OBPA 5D8KB 2FQ3A 2H6BA 4EM1A 1D5VA 4L0ZB 4MQVA 3T8TA 2FA5A 3KP3A 1S6LA 4RGSA 3IWFA 4HX4A 1OYWA 5LEKA 1LB2A 2FNPA 1Z1DA 1ZGJA 5E18F 2P7VB 1YW8A 3V7CA 3KLOA 3I0TA 5D6FA 1YW7A 3ECHA 1XMKA 4B8XA 3QOPA 2TDXA 3BROA 4IRHA 3MWMA 1X3UA 3P7NA 2O61A 3F8NA 2O6GE 3V4GA 5A2QZ 2MLKA 2LNBA 1BI0A 2ZMEA 3C1DA 2EV0A 5BMZA 4ZH4F 3FF5A 5F6FA 5F64A 2ADUA 3E3VA 4MNUA 4G9YA 2XUBA 2ZFWA 4ZYDA 5HS8A 4JQFA 4EVIA 4CZZA 2ZMEB 1HW1A 1FX7A 1O7LA 1IXSB 4XSZF 3DPLC 3KEOA 4M9ZA 2RKHA 4R79A 3F8MA 2GZWA 3RPUA 3HRTA 2IW5A 1FT9A 4OINF 1JGSA 3U9GA 2GQQA 3WTSC 3JSPA 3NEUA 2VC1A 1CGPA 1U2WA 3IKTA 4M74A 3V7RA 1ZG1A 2XIGA 1JXSA 4HA8A 3TO9A 4EJVA 3R0JA 1FNNA 3LSTA 2BEOA 2RNJA 4OIRF 3G3ZA 1P4WA 1O3SA 2OD5A 4EMSA 1Z6RA 1B9NA 1R58A 2MLGA 1KGSA 5A2QK 3HOTA 3TQNA 5JVTA 3EQLF 5LGTA 3IHUA 4TV7A 3TDUC 1HKQA 1T98A 4EJUA 2ISYA 4FT8A 2VN2A 4LLLA 5E1ZB 1J7KA 3WG9A 1K6OA 2NRAC 2Z33A 1HQCA 3Q9SA 4CXFA 2VOOA 4KICA 2F5CA 3I59A 1NHAA 2HTSA 4M6YA 2O0YA 3TOBA 4IJAA 2H09A 5D4RA 4Q48A 3DEUA 3W6JB 3O3KA 1S3JA 2QBYA 1R1TA 3WODF 2ZXJA 1U5TA 3D0SA 3KP5A 3PQKA 4HX8A 3FXUA 4G6DA 2HGCA 4HBLA 2ETHA 5KVRA 2L02A 2DQRA 1UB9A 2IJLA 2P6SA 1WQ2A 5D5UB 1H9GA 4I0AA 4ON0A 1B6AA 2F2EA 2HQNA 3Q9VA 4FHTA 1KU9A 3QPHA 1XSXA 1U5TB 2ACJA 4HF1A 1R00A 1FWZA 3GLXA 3WTZA 4UV8A 5CYVA 2W57A 3FM5A 2YX4A 2VBYA 1ZRDA 1ZGAA 5D5VB 4OIPF 2H27A 1MJ9A 1KYWA 4L9TA 4ZZDA 1EH7A 2FOKA 1SFEA 4FX4A 3KP6A 4G6QA 3JAMZ 5FB2A 3KETA 1R1UA 4QLCU 5J8FA 1PP8F 3DPTA 4Q5SF 2PFBA 1YTYA 2K27A 2EB7A 1QZZA 2MH2A 4Z2YA 2P7CB 1IW7F 1XDSA 1ZG3A 2JZYA 2G7UA 2PMUA 1ZARA 1MDMA 2ISZA 3E6MA 3FXQA 2XROA 4Y15A 1BI2A 3RTRA 4LMYA 3SXYA 3T0YA 2K4BA 3FXRA 2KRFA 2D1VA 4MQ9F 2H94A 2L3DA 1GHCA 2EFNA 2DT5A 3VFZA 2ZNYA 5F1RA 1U78A 5FD6A 1IRGA 4I0BA 3TOAA 3BWGA 3CO7C 2YU3A 1MJAA 2VBWA 1BM9A 4HV6A 4LD5A 2V1DA 1PUEE 3ZMTA 3LAJA 2GIVA 4UVAA 4MTDA 4KT5C 3I64A 2EA2A 3HTSB 5DCFA 2L54A 1LDJA 4L5IA 1QNTA 3CJNA 1STZA 1WI9A 5E1WA 2XASA 4S04A 1XGOA 3P9CA 3JAMK 3I71A 1D8KA 2W25A 4BYYA 3ERED 2FU4A 1FBUA 3OOPA 4RGUA 4A5MA 3T5XA 3E5UA 4U0WA 3WTXC 2QQ9A 4ESBA 1XB4A 1GVJA 2O3FA 3VEPA 5J8CA 1BC7C 1SD7A 4U7BA 3RKWA 1FSEA 5CVIA 1BIBA 1QPMA 3HUGA 3E6DA 1C0WA 2BBYA 5CVJA 5HDGA 2DPDA 3O2PE 4P96A 3LFKA 3BJAA 2MH9A 5E8IA 5HOOA 1P4XA 1HSJA 3HHHA 3M8EA 4KMUX 5JR3A 1RI7A 5CVUA 3BPXA 4WX9A 2D2WA 1G3WA 1LVAA 4GCVA 5ICGA 4YIIA 1J59A 2VODA 1R5GA 5L3DA 4EGZA 3EUHA 1YW9A 2QWWA 1SAXA 5AIQA 1J0RA 2AS5F 2OQGA 2UWMA 1ZRCA 2Z99A 4HF2A 4L9NA 2W85A 1G3SA 4A0XA 1KA8A 2IRFG 5ICFA 1IF1A 1P6RA 4YIFA 2LKPA 1Z6TA 2KIMA 4OIQF 2M45A 5BPDA 1YYVA 5D5WB 3HHGA 1RIOH 1K78A 1XGSA 2DLLA 1JHFA 1QZYA 2V1UA 4P55A 2PMHA 1ZH5A 2LSOA 5E17F 1YLFA 4RB3C 3DKWA 1FP1D 3GVAA 2PQ8A 4ENKA 5LEJA 1PP7U 2VONA 1YIOA 4P5OA 3J81Z 4KIBA 3PFIA 4HAMA 3ML6A 4RAZA 4EJWA 3V8KA 3ELKA 1QQIA 5DYMA 1O3RA 5LHIA 2DAOA 5AIPA 3H3ZA 5DDGA 2FMYA 4GO1A 3GFJA 1Z05A 3K9TA 5D5XB 3SZPA 1HXDA 1FOKA 4EGYA 3FM3A 3E97A 4RGXA 4HDUA 4KFCA 4HYEA 5HS7A 3IKVA 3F8CA 1YQAA 1BIAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MEX F;  5DEQ A;  2X4H A;  4N9I A;  2PLY A;  2IA2 A;  5FO5 A;  1UCR A;  2P5K A;  3U2R A;  2VXZ A;  3F72 A;  1ON2 A;  3ZQ7 A;  5FFZ A;  3C3W A;  5HS9 A;  3KZY A;  1Z91 A;  1B1B A;  1G3Y A;  1YFH A;  3OV8 A;  3P9K A;  2F5E A;  2STT A;  4YFK F;  3JSO A;  3DP7 A;  4KUM A;  3J81 K;  3BZ6 A;  1IN6 A;  1EH6 A;  1AOY A;  1UST A;  3FWE A;  4IRG A;  1FLI A;  3LA2 A;  3IL2 A;  2NS0 A;  4G7O F;  1BI1 A;  4AIK A;  3GEZ A;  5K5R A;  3CUQ B;  2D1H A;  3BY6 A;  5BOX A;  4M6X A;  4HX7 A;  4UUV A;  2JT1 A;  1EH8 A;  2GXB A;  4I02 A;  3R60 A;  2Z3Y A;  3GW2 A;  1MD0 A;  4R1H A;  2XAJ A;  4I7H A;  4UXN A;  5CLS A;  4YG2 F;  3QAH A;  4BXU A;  3CUQ C;  3ISP A;  4A5N A;  2HQR A;  1CF7 A;  4ETS A;  4L0Y B;  4WXH A;  2V6C A;  5ILS A;  1Z9C A;  2D45 A;  5DUI A;  1TQI A;  3ULQ B;  2IA1 A;  2CFX A;  4A6E A;  3WE2 A;  4WXC A;  2DPU A;  2A69 F;  1CF7 B;  1IXC A;  2EFP A;  1TBX A;  4MGR A;  2HKX A;  2R7D A;  2QUF A;  3ECO A;  2GA1 A;  4LLG F;  1S7A A;  3COA C;  2OZ6 A;  1LDD A;  4JK1 X;  5KK1 A;  3KCC A;  1TNT A;  2E7X A;  1QBJ A;  4S05 A;  3F6V A;  3RKY A;  4LFU A;  3R4K A;  5D6E A;  3ABT A;  3WGG A;  4BHC A;  5HLH A;  2NNY A;  2K4J A;  4EV0 A;  3R61 A;  1Z7U A;  4HW0 A;  1FBS A;  1H0M A;  4CGZ A;  3CLO A;  4DQ2 A;  2R3S A;  4ENJ A;  2VC0 A;  3NRV A;  3N4M A;  5HVQ C;  1T0F A;  5E8G A;  4ESJ A;  4ZZL A;  3CO6 C;  4ENN A;  3FMS A;  3ABU A;  2ZCW A;  1L3L A;  1W7P B;  2A3S A;  3M8F A;  1SFU A;  2DW4 A;  4XRF A;  2BE5 F;  2QQB A;  3MCZ A;  1W4M A;  3ZMU A;  2QVO A;  4OIO F;  2OZU A;  5DUK A;  5LRR A;  2XVC A;  3IWZ A;  2O8X A;  2VBX A;  5DV5 A;  4A0Z A;  2H6C A;  1TQM A;  1OR7 A;  3G73 A;  2FBI A;  4UVB A;  3LQR A;  2IVM A;  2ZJ2 A;  1W5S A;  1U8R A;  5JI6 A;  2COM A;  2FRH A;  1USS A;  4LGW A;  4DNC A;  1DPU A;  2RC4 A;  3SHF A;  1ZRE A;  2PBI A;  1QGP A;  2V9V A;  2HWV A;  3K69 A;  4LG0 B;  1U3E M;  1SD6 A;  2YR2 A;  2PI0 A;  1F9N A;  2DQL A;  1LQ1 A;  3FHZ A;  2DO7 A;  4Y17 A;  3DXJ F;  2W24 A;  3WE3 A;  2OAZ A;  4L9J A;  2VT2 A;  4M73 A;  1P92 A;  4WF2 A;  4PZJ A;  1HBX G;  1ZRF A;  1TLH B;  4WK8 F;  4G8X A;  2C6Y A;  2WC2 A;  1WSU A;  3N97 A;  3EYI A;  3DF8 A;  1KQ0 A;  1XCV A;  1ZYR F;  3K1M A;  5DCM B;  1FSH A;  1R36 A;  3JW4 A;  4G7Z F;  1I1G A;  2EK5 A;  4IXA A;  5D8L B;  2QZ8 A;  3MZH A;  4U0Y A;  4HF0 A;  5FGM A;  3JTG A;  2HFH A;  3I4P A;  3T1B A;  4IF4 A;  4XSX F;  2A5Y B;  4LB6 B;  3V7S A;  3LA3 A;  1DP7 P;  2G7H A;  3BPV A;  4M9S A;  1IXR C;  2DK8 A;  1LDK B;  3O6B B;  3R6S A;  4IPA A;  5JFR A;  1T38 A;  3GFL A;  2MC3 A;  3L9F A;  4D0P A;  1B9M A;  3RKX A;  4EQQ A;  2L01 A;  2E7W A;  1XMA A;  1R1V A;  3L2C A;  5LGU A;  2VE8 A;  3HIF A;  4YFX F;  5K1Y A;  5L3F A;  4CYD A;  3FX3 A;  2Q2E A;  1J75 A;  1TW3 A;  1S29 A;  3E6C C;  2FF4 A;  4CDG A;  1P4A A;  3KLN A;  2ESH A;  4L9V A;  3K1N A;  2K7L A;  4R8H A;  3IC7 A;  4EJO A;  3I54 A;  4ZYG A;  3C7J A;  1JE8 A;  4KYW A;  3GXO A;  3MQ0 A;  1P2F A;  2FEZ A;  2A68 F;  3RI4 A;  2F5F A;  3HRU A;  4AIH A;  4GGG A;  2L4A A;  3EYY A;  1XD7 A;  3VB2 A;  4KDP A;  1IN4 A;  3J80 Z;  5LHG A;  3TGN A;  2FXA A;  2V79 A;  3RYP A;  4UV9 A;  2A6E F;  1J9I A;  2QYO A;  5LRS A;  4PCQ A;  3HOS A;  5LHH A;  3GFI A;  1WKM A;  1MGT A;  4AIJ A;  5FLX K;  4M72 A;  1MZB A;  2CQK A;  1BOA A;  1SMT A;  3HTU A;  2Y0M A;  1ZG5 A;  1KQ8 A;  2A6H F;  2M30 A;  4AWX B;  3GUD A;  1T2K A;  3LQQ A;  4HDV A;  1IRF A;  3RJP A;  1ON1 A;  3LA7 A;  2XRN A;  2HYG D;  2IPQ X;  3HRM A;  4RB0 A;  1B59 A;  3KP2 A;  2WV0 A;  2HDC A;  5AON A;  1S7O A;  1UHM A;  1LEB A;  2HTJ A;  3DFG A;  2IT0 A;  1T6S A;  1ZLK A;  3QU6 A;  1UHW A;  3CTA A;  3HSE A;  3MEX A;  5LGN A;  3B02 A;  2LDU A;  3K2Z A;  3FZV A;  3KZZ A;  4I98 B;  4UHT A;  4OMZ A;  2XV4 S;  4PDK A;  3GYH X;  2CW0 F;  3F23 A;  4A6D A;  5H6Q A;  2ZO4 A;  5CJ9 A;  2Y48 A;  3J80 K;  3KEQ A;  1Y0U A;  2XAF A;  1D3Y A;  3GX4 X;  4M71 A;  3GF2 A;  4XBF A;  3SQN A;  4CIC A;  3KP4 A;  5L3C A;  2CSO A;  2W84 A;  2KIU A;  4ZYE A;  5LLQ A;  2EFO A;  4KNY A;  4RAY A;  2JTV A;  4ESF A;  4GYI A;  2L4M A;  3B73 A;  3F3X A;  1TTY A;  3RPQ A;  2NYX A;  4U0V A;  4BHP A;  2KKO A;  3LAP A;  2G9W A;  1W7P D;  1O3Q A;  5LBQ A;  4G7H F;  3Q5F A;  4IHS A;  3JTH A;  2FBK A;  4NQW A;  2HR3 A;  3QPT A;  1Q1H A;  4HLX A;  2O03 A;  3H3U A;  4KMF A;  1K79 A;  2DTR A;  1SMY F;  1OYI A;  1IN7 A;  1XGN A;  2DBB A;  4E70 A;  3S2W A;  2A61 A;  1S8N A;  3W6K B;  2XAH A;  2P5V A;  3F8F A;  2CG4 A;  1J5Y A;  1SD4 A;  2Z9O A;  2XHK A;  1AWC A;  4G94 A;  1RZ4 A;  2XAQ A;  4WCG A;  1G4D A;  5H6R A;  1LEA A;  2MD5 A;  2E1C A;  5HLI A;  3CUQ A;  1PDN C;  2A07 F;  1MKM A;  1EV7 A;  1IUY A;  3WGI A;  4AVP A;  1IAW A;  1TQP A;  1KU2 A;  1OYY A;  4BHB A;  2M1B A;  2P8T A;  2ESN A;  4XLP F;  2ZBK A;  3TO7 A;  3CUO A;  1WRJ A;  4KN4 X;  3GZ6 A;  3C18 A;  4P9U A;  2OQR A;  2PN6 A;  1ZN2 A;  4XLN F;  2RN7 A;  3V8J A;  3GZ5 A;  2UXN A;  3K0L A;  1SD5 A;  2HYF A;  5JHU A;  2R7F A;  2EV6 A;  4I09 A;  2UXX A;  1BN5 A;  1REP C;  1L0O C;  3SZT A;  1FY7 A;  3ZMV A;  1LNW A;  5L3E A;  1I1S A;  1FP2 A;  1HKS A;  2HOE A;  1BJA A;  4LB5 A;  1YS6 A;  2OU2 A;  1KQ9 A;  3HRS A;  4O5V A;  2AXL A;  2J5P A;  3RYR A;  2PEX A;  3BP8 A;  2HS5 A;  4LK0 F;  3EDP A;  2CO5 A;  4CO8 A;  4BNC A;  4NB5 A;  2EFW A;  4BH9 A;  2VOP A;  2F5D A;  3QU3 A;  3F6O A;  2WTE A;  1HKT A;  3BJ6 A;  2KIF A;  2JRT A;  4KN7 X;  5CVR A;  1ULY A;  2YPR A;  1MJB A;  4CHU A;  3RDI A;  1QO0 D;  5ILV A;  2Q8K A;  2M8E A;  3SFZ A;  4L18 B;  1I27 A;  3WTV C;  1KU3 A;  1ZLJ A;  2CYY A;  2EV5 A;  1W7P A;  1TNS A;  1OKR A;  2MA3 A;  3WU1 B;  1FZP B;  6PAX A;  1YO5 C;  1RNL A;  5HDN A;  3L00 A;  2QM3 A;  4F7Z A;  3GO5 A;  3WGH A;  4IVN A;  3IRQ A;  4K2E A;  1VTN C;  4EM0 B;  1FYL A;  1TW2 A;  3FMR A;  2GWR A;  1XGM A;  4JBA A;  2EA4 A;  5EEG A;  4ASN A;  2XKO A;  4MEY F;  1O3T A;  1FYK A;  1R7J A;  4KIF A;  4AD9 A;  1O7F A;  2NNN A;  2M87 A;  3ZMZ A;  2DU9 A;  2EWN A;  4HZF A;  5ICE A;  3R0A A;  3I59 B;  4LG0 A;  3RIR A;  3F8B A;  3E5Q A;  3KE2 A;  3NQO A;  5ICC A;  2BGC A;  1F5T A;  4BAY A;  4LK1 F;  4EM2 A;  2P6T A;  3WTT C;  4OOI A;  1T39 A;  4Q47 A;  1OMI A;  4NHJ A;  2STW A;  3HYI A;  4M9X A;  4A2U A;  2QBY B;  4ENM A;  1BBY A;  2FE3 A;  2VT3 A;  4ZYH A;  1BC8 C;  2LF8 A;  3P9I A;  5DCM A;  3BDD A;  5L3G A;  1XDU A;  3VOD A;  3KFW X;  1V3F A;  5K5Q A;  3T8R A;  4BQA A;  1U5T C;  2KJB A;  3ZN0 A;  3LWF A;  1FC3 A;  3ZP5 A;  3TDZ C;  2E1N A;  3ROU A;  1BI3 A;  4IRI A;  1LJ9 A;  5ED4 A;  1HST A;  3CDH A;  2CWE A;  3QRF F;  2JSC A;  1F1Z A;  1W5T A;  1XSV A;  5FD5 A;  1FYM A;  4IHT A;  4QWQ A;  2GXG A;  5K5O A;  2PJP A;  2FSW A;  2LF7 A;  1V4R A;  2Q0O A;  2QEN A;  2GAU A;  4H0E A;  1E2X A;  2OA4 A;  2UZK A;  2RGV A;  3KP7 A;  4UNO A;  1R5H A;  1ZAO A;  4U88 A;  5BS6 A;  3MFK A;  2KJC A;  5IT3 A;  4KA4 A;  2DFI A;  4GXO A;  3AAF A;  2Z5U A;  2NAZ A;  3WU0 A;  1FPQ A;  1H9T A;  2HZT A;  1RUO A;  5FLX Z;  3F22 A;  1KU7 A;  2P5L C;  4PGH A;  5L3B A;  5D4S A;  1U6G A;  2GA2 A;  1MDM B;  1SFX A;  5TRD A;  4RB2 C;  2YSR A;  3HSF A;  2RDP A;  1G3T A;  3ZMD A;  4I2O A;  2CGP A;  4Y13 A;  2K86 A;  1DUX C;  4RB1 A;  3REO A;  2VE9 A;  5DD4 A;  4WWC A;  2JPC A;  3D5L A;  3GFM A;  4WXD A;  2RV8 A;  1IZ1 A;  2FML A;  4P9F A;  2EJR A;  4KIG A;  3TKY A;  3L09 A;  4MTE A;  2FBH A;  2MBF A;  2QLZ A;  2RVC A;  3E6B A;  1KYZ A;  4FX0 A;  5BQT A;  5H20 A;  1FBQ A;  3WTY C;  4OMY A;  1HW2 A;  1YG2 A;  3ZPL A;  5ILU A;  5E1X A;  5CVV A;  4EJT A;  2QQA A;  3I5U A;  3M1E A;  3BOQ A;  3E5X A;  4HOB A;  1G6N A;  4MHG A;  1K7A A;  2BYV E;  3L7W A;  4O3M A;  1E17 A;  2RQP A;  4YFN F;  3HSR A;  1F4K A;  3H92 A;  1XCB A;  4OU0 A;  5J6X A;  2DI3 A;  5IT9 Z;  2M5W A;  5TJJ A;  2BV6 A;  2X0L A;  1YS7 A;  1I5Z A;  3WTU C;  1D8J A;  5E20 A;  3PQJ A;  5FFX A;  4A0Y A;  3I53 A;  4RS8 A;  2ZNZ A;  1XSD A;  2K02 A;  3U1D A;  2IP2 A;  2XAG A;  4RGR A;  2Y75 A;  2JPB A;  2P4W A;  4HQE A;  1WWX A;  4HQM A;  2XGX A;  3EET A;  4GYG A;  1B4A A;  1I6X A;  1GXP A;  4B09 A;  5EEH A;  2EFQ A;  2YX7 A;  3F21 A;  2FNA A;  2B0L A;  1DDN A;  3MZY A;  1RUN A;  3QP6 A;  4A12 A;  4I01 A;  2VBZ A;  3DQV C;  1ONV A;  5BPI A;  1OPC A;  1R23 A;  1ZHF A;  1ODD A;  3M7G A;  3IRR A;  5ERI A;  2WWY A;  1IN8 A;  3TO6 A;  1GXQ A;  3VOE A;  3ZMS A;  4N0B A;  4PGG A;  1JHH A;  5IT9 K;  1K78 B;  3BJO A;  4LJZ F;  4HV5 A;  5HDK A;  3K1P A;  3QP5 A;  2DK5 A;  1R22 A;  2HEO A;  3I58 A;  4U7D A;  1J2X A;  1HW5 A;  3V8L A;  4Q4Z F;  2IA0 A;  4N9H A;  3J7A O;  1A04 A;  3M9A A;  3WTW C;  1IN5 A;  1XN7 A;  2HKO A;  2V1X A;  3MAJ A;  4UVC A;  4LLN A;  4O6J A;  5HLG A;  3FMQ A;  1O57 A;  4L5J A;  2ELH A;  5DD8 A;  1UFM A;  4HLY A;  3ZN1 A;  1DPR A;  2ZKZ A;  2XKP A;  2PG4 A;  3GWZ A;  2J5O A;  3DV8 A;  2OBP A;  5D8K B;  2FQ3 A;  2H6B A;  4EM1 A;  1D5V A;  4L0Z B;  4MQV A;  3T8T A;  2FA5 A;  3KP3 A;  1S6L A;  4RGS A;  3IWF A;  4HX4 A;  1OYW A;  5LEK A;  1LB2 A;  2FNP A;  1Z1D A;  1ZGJ A;  5E18 F;  2P7V B;  1YW8 A;  3V7C A;  3KLO A;  3I0T A;  5D6F A;  1YW7 A;  3ECH A;  1XMK A;  4B8X A;  3QOP A;  2TDX A;  3BRO A;  4IRH A;  3MWM A;  1X3U A;  3P7N A;  2O61 A;  3F8N A;  2O6G E;  3V4G A;  5A2Q Z;  2MLK A;  2LNB A;  1BI0 A;  2ZME A;  3C1D A;  2EV0 A;  5BMZ A;  4ZH4 F;  3FF5 A;  5F6F A;  5F64 A;  2ADU A;  3E3V A;  4MNU A;  4G9Y A;  2XUB A;  2ZFW A;  4ZYD A;  5HS8 A;  4JQF A;  4EVI A;  4CZZ A;  2ZME B;  1HW1 A;  1FX7 A;  1O7L A;  1IXS B;  4XSZ F;  3DPL C;  3KEO A;  4M9Z A;  2RKH A;  4R79 A;  3F8M A;  2GZW A;  3RPU A;  3HRT A;  2IW5 A;  1FT9 A;  4OIN F;  1JGS A;  3U9G A;  2GQQ A;  3WTS C;  3JSP A;  3NEU A;  2VC1 A;  1CGP A;  1U2W A;  3IKT A;  4M74 A;  3V7R A;  1ZG1 A;  2XIG A;  1JXS A;  4HA8 A;  3TO9 A;  4EJV A;  3R0J A;  1FNN A;  3LST A;  2BEO A;  2RNJ A;  4OIR F;  3G3Z A;  1P4W A;  1O3S A;  2OD5 A;  4EMS A;  1Z6R A;  1B9N A;  1R58 A;  2MLG A;  1KGS A;  5A2Q K;  3HOT A;  3TQN A;  5JVT A;  3EQL F;  5LGT A;  3IHU A;  4TV7 A;  3TDU C;  1HKQ A;  1T98 A;  4EJU A;  2ISY A;  4FT8 A;  2VN2 A;  4LLL A;  5E1Z B;  1J7K A;  3WG9 A;  1K6O A;  2NRA C;  2Z33 A;  1HQC A;  3Q9S A;  4CXF A;  2VOO A;  4KIC A;  2F5C A;  3I59 A;  1NHA A;  2HTS A;  4M6Y A;  2O0Y A;  3TOB A;  4IJA A;  2H09 A;  5D4R A;  4Q48 A;  3DEU A;  3W6J B;  3O3K A;  1S3J A;  2QBY A;  1R1T A;  3WOD F;  2ZXJ A;  1U5T A;  3D0S A;  3KP5 A;  3PQK A;  4HX8 A;  3FXU A;  4G6D A;  2HGC A;  4HBL A;  2ETH A;  5KVR A;  2L02 A;  2DQR A;  1UB9 A;  2IJL A;  2P6S A;  1WQ2 A;  5D5U B;  1H9G A;  4I0A A;  4ON0 A;  1B6A A;  2F2E A;  2HQN A;  3Q9V A;  4FHT A;  1KU9 A;  3QPH A;  1XSX A;  1U5T B;  2ACJ A;  4HF1 A;  1R00 A;  1FWZ A;  3GLX A;  3WTZ A;  4UV8 A;  5CYV A;  2W57 A;  3FM5 A;  2YX4 A;  2VBY A;  1ZRD A;  1ZGA A;  5D5V B;  4OIP F;  2H27 A;  1MJ9 A;  1KYW A;  4L9T A;  4ZZD A;  1EH7 A;  2FOK A;  1SFE A;  4FX4 A;  3KP6 A;  4G6Q A;  3JAM Z;  5FB2 A;  3KET A;  1R1U A;  4QLC U;  5J8F A;  1PP8 F;  3DPT A;  4Q5S F;  2PFB A;  1YTY A;  2K27 A;  2EB7 A;  1QZZ A;  2MH2 A;  4Z2Y A;  2P7C B;  1IW7 F;  1XDS A;  1ZG3 A;  2JZY A;  2G7U A;  2PMU A;  1ZAR A;  1MDM A;  2ISZ A;  3E6M A;  3FXQ A;  2XRO A;  4Y15 A;  1BI2 A;  3RTR A;  4LMY A;  3SXY A;  3T0Y A;  2K4B A;  3FXR A;  2KRF A;  2D1V A;  4MQ9 F;  2H94 A;  2L3D A;  1GHC A;  2EFN A;  2DT5 A;  3VFZ A;  2ZNY A;  5F1R A;  1U78 A;  5FD6 A;  1IRG A;  4I0B A;  3TOA A;  3BWG A;  3CO7 C;  2YU3 A;  1MJA A;  2VBW A;  1BM9 A;  4HV6 A;  4LD5 A;  2V1D A;  1PUE E;  3ZMT A;  3LAJ A;  2GIV A;  4UVA A;  4MTD A;  4KT5 C;  3I64 A;  2EA2 A;  3HTS B;  5DCF A;  2L54 A;  1LDJ A;  4L5I A;  1QNT A;  3CJN A;  1STZ A;  1WI9 A;  5E1W A;  2XAS A;  4S04 A;  1XGO A;  3P9C A;  3JAM K;  3I71 A;  1D8K A;  2W25 A;  4BYY A;  3ERE D;  2FU4 A;  1FBU A;  3OOP A;  4RGU A;  4A5M A;  3T5X A;  3E5U A;  4U0W A;  3WTX C;  2QQ9 A;  4ESB A;  1XB4 A;  1GVJ A;  2O3F A;  3VEP A;  5J8C A;  1BC7 C;  1SD7 A;  4U7B A;  3RKW A;  1FSE A;  5CVI A;  1BIB A;  1QPM A;  3HUG A;  3E6D A;  1C0W A;  2BBY A;  5CVJ A;  5HDG A;  2DPD A;  3O2P E;  4P96 A;  3LFK A;  3BJA A;  2MH9 A;  5E8I A;  5HOO A;  1P4X A;  1HSJ A;  3HHH A;  3M8E A;  4KMU X;  5JR3 A;  1RI7 A;  5CVU A;  3BPX A;  4WX9 A;  2D2W A;  1G3W A;  1LVA A;  4GCV A;  5ICG A;  4YII A;  1J59 A;  2VOD A;  1R5G A;  5L3D A;  4EGZ A;  3EUH A;  1YW9 A;  2QWW A;  1SAX A;  5AIQ A;  1J0R A;  2AS5 F;  2OQG A;  2UWM A;  1ZRC A;  2Z99 A;  4HF2 A;  4L9N A;  2W85 A;  1G3S A;  4A0X A;  1KA8 A;  2IRF G;  5ICF A;  1IF1 A;  1P6R A;  4YIF A;  2LKP A;  1Z6T A;  2KIM A;  4OIQ F;  2M45 A;  5BPD A;  1YYV A;  5D5W B;  3HHG A;  1RIO H;  1K78 A;  1XGS A;  2DLL A;  1JHF A;  1QZY A;  2V1U A;  4P55 A;  2PMH A;  1ZH5 A;  2LSO A;  5E17 F;  1YLF A;  4RB3 C;  3DKW A;  1FP1 D;  3GVA A;  2PQ8 A;  4ENK A;  5LEJ A;  1PP7 U;  2VON A;  1YIO A;  4P5O A;  3J81 Z;  4KIB A;  3PFI A;  4HAM A;  3ML6 A;  4RAZ A;  4EJW A;  3V8K A;  3ELK A;  1QQI A;  5DYM A;  1O3R A;  5LHI A;  2DAO A;  5AIP A;  3H3Z A;  5DDG A;  2FMY A;  4GO1 A;  3GFJ A;  1Z05 A;  3K9T A;  5D5X B;  3SZP A;  1HXD A;  1FOK A;  4EGY A;  3FM3 A;  3E97 A;  4RGX A;  4HDU A;  4KFC A;  4HYE A;  5HS7 A;  3IKV A;  3F8C A;  1YQA A;  1BIA A; 
#chains in the Genus database with same CATH topology
 1BW5 A;  4MEX F;  3M1C A;  5DEQ A;  2X4H A;  2H8R A;  2CUZ A;  4GRI A;  4N9I A;  3DU6 A;  3G1M A;  2PLY A;  1RRJ A;  2O5R A;  2IA2 A;  2DOF A;  1ETO A;  5FO5 A;  2X6O A;  2CFO A;  5EG0 A;  1UCR A;  5C3E J;  2P5K A;  2X51 A;  4DYR A;  3U2R A;  1G2H A;  3CJR B;  1X1A A;  2CW8 A;  2VXZ A;  2WAD A;  1JKR C;  2CUJ A;  2CUF A;  3F72 A;  3WU2 C;  1IO2 A;  3OYB A;  1QPI A;  1ON2 A;  2ID3 A;  4U87 A;  3GTJ J;  1X1C A;  1WJA A;  3WG7 H;  2DJN A;  4NC8 A;  4NQW B;  3ZQ7 A;  1LVK A;  3LSH A;  5FFZ A;  3CJQ B;  3C3W A;  5EG0 B;  5HS9 A;  3KZY A;  4DBQ A;  2LY9 A;  1RR7 A;  1BA5 A;  1Z91 A;  3JRH A;  2CRG A;  2NS8 A;  1U8B A;  1B1B A;  1G3Y A;  1YFH A;  3DWL E;  3OV8 A;  3P9K A;  2F5E A;  3OS0 A;  2STT A;  4YFK F;  3JSO A;  3DP7 A;  1A36 A;  4KUM A;  3J81 K;  3BZ6 A;  1MMA A;  1QVT A;  1IN6 A;  1EH6 A;  1AOY A;  3U21 A;  1MH3 A;  3A0B C;  1UST A;  2GXA A;  3FWE A;  3D5R C;  4IRG A;  1FLI A;  1UHS A;  3LA2 A;  2V7F A;  3S1Q J;  2DA5 A;  2M9H A;  3IL2 A;  2Q1Z B;  2NS0 A;  2BXZ A;  3BTJ A;  5HLT A;  4G7O F;  3HL2 A;  5IYB J;  1BI1 A;  3RSN A;  3PIP F;  1MBE A;  4AIK A;  3GEZ A;  4GDF A;  1IG7 A;  4XON A;  5K5R A;  5IYC J;  3CUQ B;  2CS3 A;  2D1H A;  3HZJ A;  2CQ7 A;  4MFE A;  4IX7 A;  3BY6 A;  5BOX A;  4M6X A;  4HX7 A;  4UUV A;  2JA2 A;  2JT1 A;  5E3M A;  1EH8 A;  2GXB A;  4I02 A;  2LH9 A;  3R60 A;  2M34 A;  4NBQ A;  2Z3Y A;  3GW2 A;  2XPU A;  1MD0 A;  4R1H A;  4PJM A;  2XAJ A;  4I7H A;  4UXN A;  5CLS A;  4BJ5 C;  4YG2 F;  2B63 J;  3QAH A;  2E2I J;  4BXU A;  2HYJ A;  3CUQ C;  3I4N J;  1ETV A;  2X6X A;  3H5N A;  3ISP A;  4A5N A;  3LSP A;  4RM2 A;  1DGR M;  4C2M J;  2YU9 J;  3BTL A;  2HQR A;  1CF7 A;  4ETS A;  4L0Y B;  2DTZ A;  1V5G A;  4WXH A;  2V6C A;  2PX9 A;  2Z16 A;  5ILS A;  5LD2 C;  1Z9C A;  2D45 A;  1B72 A;  2VPL A;  5DUI A;  5J4V A;  1TQI A;  3ULQ B;  2IA1 A;  2CFX A;  4C2T A;  5F08 A;  4A6E A;  3WE2 A;  1D1C A;  4WXC A;  3H3V K;  1K83 J;  2DPU A;  4ABZ A;  2A69 F;  1SEU A;  3TW6 A;  2NOJ B;  1G8X A;  1E0E A;  1I3Q J;  3BZC A;  2VQC A;  1CF7 B;  5E3L A;  3MZ8 A;  1IV6 A;  1IXC A;  1J09 A;  2OCE A;  3JRA A;  2H8W A;  2EFP A;  1B72 B;  1TBX A;  3OYJ A;  1JT6 A;  4MGR A;  5DM6 F;  2HKX A;  5GPC A;  2R7D A;  4BQO A;  1NG7 A;  1X1P A;  2LRE A;  2QUF A;  2LG4 A;  3ECO A;  4DBR A;  1RR8 C;  2GA1 A;  4BY7 J;  4LLG F;  1S7A A;  2LY1 A;  3COA C;  1VQ8 I;  2DA2 A;  2AHQ A;  2OZ6 A;  1LDD A;  4JK1 X;  5KK1 A;  5EZG A;  3KCC A;  1TNT A;  2E7X A;  1QBJ A;  4S05 A;  3F6V A;  3KX2 A;  2M4K A;  3ABM H;  2HQA A;  2XDV A;  1OCC H;  3W3C A;  3PO3 J;  3RKY A;  4LFU A;  1GV5 A;  2VQL A;  3DCF A;  3R4K A;  4F3Q A;  1ETQ A;  2OPT A;  2OC6 A;  1PUF A;  5D6E A;  3ABT A;  2ME6 A;  3WGG A;  3K4J A;  4BHC A;  5HLH A;  5E3N A;  2K4J A;  2NNY A;  5K7F A;  3QYE A;  4EV0 A;  1AKH B;  3R61 A;  2VB6 A;  3QWL A;  2UV1 A;  4Y3O A;  1Z7U A;  4HW0 A;  1FBS A;  1OJL A;  2DA1 A;  2ID6 A;  1H0M A;  4CGZ A;  3CLO A;  3MKL A;  1MH4 A;  2ELJ A;  1VQK I;  1FTT A;  1GUU A;  3ONQ A;  4DQ2 A;  2R3S A;  3W6V A;  1YX3 A;  2IGN A;  3A01 B;  1UZC A;  4ENJ A;  2VC0 A;  3NRV A;  1T08 B;  4LIU A;  1TWG J;  3SDG A;  4XRS G;  1W36 D;  3CCU I;  1UG2 A;  3N4M A;  4AYB A;  5HVQ C;  1T0F A;  1I50 J;  3ZQC A;  4BUP A;  5E8G A;  2W1O A;  4ESJ A;  4FAS D;  3KYL A;  4ZZL A;  3CO6 C;  4ENN A;  3CMA I;  4DIQ A;  3FMS A;  3ABU A;  1Y39 A;  2ZCW A;  1L3L A;  1W7P B;  2A3S A;  3M8F A;  4UB8 C;  2W00 A;  1SFU A;  2DW4 A;  4XRF A;  2IS4 A;  2BE5 F;  2QQB A;  3MCZ A;  2LP0 A;  1W4M A;  3ZMU A;  2CQX A;  3P5J A;  2QVO A;  3IH3 A;  3S32 A;  2ZSH B;  2OZU A;  4OIO F;  2F48 A;  5DUK A;  1T56 A;  4UUS B;  5LRR A;  3CQZ J;  2XVC A;  3IWZ A;  4IO9 F;  2O8X A;  3OIQ A;  5B66 C;  4NC6 A;  4XKC A;  2VBX A;  5DV5 A;  2V9P A;  4A0Z A;  3F9K A;  1GV2 A;  4ZTF A;  5IY5 H;  2H6C A;  1TQM A;  1OR7 A;  3H1C A;  4V2G A;  3G73 A;  2FBI A;  4BE2 A;  1HDD C;  4UVB A;  3LQR A;  2IVM A;  5FRO A;  2ZJ2 A;  1GVD A;  1W5S A;  1U8R A;  3J7A Y;  5JI6 A;  2COM A;  2FRH A;  1YJW I;  2R7U A;  2DA4 A;  4ANJ A;  1USS A;  4LGW A;  1T0F C;  4DNC A;  1DPU A;  2RC4 A;  4M3B A;  1LFU P;  3SHF A;  2R5Y A;  1ZRE A;  1WGX A;  2PBI A;  1U9N A;  1QGP A;  2LMD A;  2V9V A;  2JRM A;  3H35 A;  3HM5 A;  1R5I D;  2HWV A;  1IUF A;  3K69 A;  4LG0 B;  1U3E M;  2K5C A;  1SD6 A;  2HU9 A;  2YR2 A;  2PI0 A;  1F9N A;  2DQL A;  4XM3 A;  2L7M P;  5J3L A;  3FHZ A;  2DO7 A;  1LQ1 A;  3K4K A;  2CU7 A;  3DXJ F;  2EIN H;  2M7B A;  4Y17 A;  4D5F A;  2W24 A;  3WE3 A;  4RLQ A;  1S72 I;  2OAZ A;  4L9J A;  2VT2 A;  4M73 A;  4A3F J;  4XOT A;  1P92 A;  2O9L A;  1ETK A;  3EUK L;  4WF2 A;  2QQ8 A;  4PZJ A;  4BQQ A;  2ZJP F;  1HBX G;  1IC8 A;  1ZRF A;  2X1D A;  2BY0 A;  3AG2 H;  2Y30 A;  1TLH B;  4BAC A;  3KYD B;  5J1R A;  4WK8 F;  5E3O A;  4G8X A;  2C6Y A;  2WC2 A;  1WSU A;  3HXL A;  2R7X A;  2CH0 A;  4A69 C;  4KIT B;  3N97 A;  3EYI A;  4Y4R A;  3DF8 A;  1KQ0 A;  1XCV A;  3LNQ A;  1ZYR F;  3K1M A;  4MLO A;  5DCM B;  3W2V A;  2NS7 A;  1NTC A;  1FSH A;  4I76 A;  4XN3 A;  3TL4 X;  1R36 A;  3JW4 A;  4Y33 A;  4G7Z F;  5C44 J;  3BZK A;  1I1G A;  2EK5 A;  4IXA A;  3E7L A;  5D8L B;  2QZ8 A;  2MGQ A;  2F5V A;  2PMZ N;  5CQG A;  2OCC H;  4U0Y A;  3BQY A;  4HF0 A;  3MZH A;  2XAU A;  2IS1 A;  5FGM A;  3JTG A;  2HFH A;  3I4P A;  3T1B A;  4IF4 A;  2WY8 Q;  4XSX F;  2A5Y B;  4LB6 B;  3V7S A;  3LA3 A;  3HG9 A;  1DP7 P;  3BPV A;  2G7H A;  4M9S A;  1IXR C;  3S17 J;  2XC7 A;  2CMP A;  2DK8 A;  1LDK B;  3O6B B;  3R6S A;  3H9Q A;  2DDA A;  5TGT A;  3J7Z I;  3C2G A;  1QZE A;  2BY1 A;  5J4Y A;  1MMN A;  4IPA A;  4RDU A;  1Z3Y A;  4IOC F;  5LFA A;  5JFR A;  1T38 A;  2CUE A;  1LPQ A;  4XQF A;  3GFL A;  2MC3 A;  3L9F A;  2I8D A;  3NAR A;  2OUM A;  4D0P A;  4RMN A;  1B9M A;  3H5A A;  5IP7 J;  3RKX A;  2IS6 A;  1S5L C;  4EQQ A;  2L01 A;  2E7W A;  4E7S A;  4II3 A;  2FUG 2;  1XMA A;  1R1V A;  4XLH A;  3VYU B;  2IAI A;  4ZJZ A;  1E3H A;  3L2C A;  2JA7 J;  4HNT A;  1LKX A;  5LGU A;  2MFZ A;  2VE8 A;  2L7F P;  1QHH D;  2ZB9 A;  3HIF A;  4YFX F;  5K1Y A;  3I55 I;  1GLN A;  5L3F A;  4JX4 A;  4CYD A;  2L9N A;  2Q2E A;  3FX3 A;  3Q0W A;  1J75 A;  1TW3 A;  1S29 A;  3E6C C;  2VUM J;  2FF4 A;  1E3O C;  4CDG A;  1UEL B;  3SZG A;  2M0M A;  2XSD C;  1P4A A;  2XGE A;  3OMY A;  3KLN A;  3VSL A;  2XF7 A;  2ESH A;  4L9V A;  3K1N A;  2K9M A;  3HBL A;  4E7L A;  2K7L A;  3EPZ A;  4R8H A;  2VJI A;  3IC7 A;  2E1M B;  3FBI B;  4EJO A;  1D0Y A;  2KZG A;  2K3P A;  3I54 A;  3VDX A;  1N75 A;  4ZYG A;  1DQU A;  3BT9 A;  2DCE A;  3C7J A;  2I10 A;  1JE8 A;  4KYW A;  1FIP A;  1VQ4 I;  3GXO A;  2DMQ A;  3MQ0 A;  5HOD A;  1P2F A;  2FEZ A;  2A5W A;  1D0X A;  4FE7 A;  3S14 J;  3H36 A;  2A68 F;  3RI4 A;  1DU0 A;  3CC2 I;  2ZXW H;  3BTI A;  3FXK A;  2F5F A;  3HRU A;  1TP4 A;  1SFK A;  3CCQ I;  2E1M C;  3ZQF A;  4AIH A;  4GGG A;  1TC3 C;  2L4A A;  2XGD A;  3MD2 A;  3EYY A;  1XD7 A;  4A3I J;  1T8I A;  3VB2 A;  4KDP A;  3RKQ A;  1IN4 A;  3J80 Z;  5LHG A;  3F0C A;  5F27 A;  3TGN A;  2FXA A;  2V79 A;  4CCN A;  1V55 H;  3KPH A;  3RYP A;  4B1R A;  2DT6 A;  2MD0 A;  2KT0 A;  2FJ1 A;  3OIO A;  1MNM C;  3C2B A;  2A6E F;  1Y0N A;  4UV9 A;  1J9I A;  2QYO A;  3HKZ N;  5LRS A;  3TW7 A;  4PCQ A;  4BY1 J;  2DMU A;  3HOS A;  5LHH A;  5KCM A;  3OL4 A;  3GFI A;  4B44 A;  3M8J A;  1WKM A;  2HXO A;  2CJJ A;  1MGT A;  4L5E A;  1JTY A;  1AA7 A;  4AIJ A;  5FLX K;  3M3Y J;  2VKV A;  4M72 A;  1MZB A;  1TT5 B;  2CQK A;  3LSJ A;  2B9S A;  1BOA A;  3FXO A;  1SMT A;  4XLA A;  3HTU A;  1PVE A;  4IQJ A;  1Y1V J;  2Y0M A;  3JRC A;  4B3A A;  1ZG5 A;  1BR1 A;  1D1B A;  1KQ8 A;  2A6H F;  2M30 A;  4AWX B;  3GUD A;  1T2K A;  3LQQ A;  4JX5 A;  2XPV A;  4HDV A;  1B8I B;  1IRF A;  3DLA A;  2L2O A;  2AO9 A;  3RJP A;  1ON1 A;  3LA7 A;  2ZSI B;  3L2R A;  3IP4 B;  4DJA A;  2XRN A;  2HYG D;  3CCL I;  2IPQ X;  3HRM A;  2LY2 A;  4RB0 A;  1VQO I;  4CSW A;  2BHZ A;  3BR6 A;  5JLW A;  3I4M J;  1B59 A;  5H2F C;  2CV0 A;  3KP2 A;  5F0C A;  2WV0 A;  3LL7 A;  2HDC A;  1MNE A;  3ZXS A;  5DM7 F;  5AON A;  3W2A A;  1S7O A;  4YEL A;  1UHM A;  1LEB A;  1PJR A;  2HTJ A;  3DFG A;  2K9L A;  3ZCO A;  5GTH C;  2IT0 A;  4BEH A;  1T6S A;  1HOM A;  2EZI A;  2LFB A;  1ZLK A;  1F43 A;  3QU6 A;  2MAB A;  1UHW A;  2W7N A;  3CTA A;  3HSE A;  4NUB A;  3MEX A;  3GBG A;  1FOW A;  1ZR2 A;  1QA6 A;  4ZC3 A;  3D5S C;  5LGN A;  3AKZ A;  4M3D A;  3QOD A;  1S7E A;  3B02 A;  4HNV A;  2LDU A;  1SVM A;  3K2Z A;  3FZV A;  3KZZ A;  4A3M J;  1WHU A;  1R4N B;  2DJI A;  3FIS A;  1H89 C;  1BR4 A;  4RM3 A;  4I98 B;  4UHT A;  4OMZ A;  2XV4 S;  4PDK A;  3GYH X;  1WVR A;  2CW0 F;  3SJM A;  3F23 A;  4A6D A;  3RZD J;  5H6Q A;  4QPQ A;  1TWH J;  3BG9 A;  2ZO4 A;  1OCO H;  4AYB N;  5CJ9 A;  2Y48 A;  3LSI A;  3J80 K;  1VQ6 I;  3KEQ A;  1AHD P;  1Y0U A;  2EIL H;  1WJC A;  2BVM A;  2XAF A;  1D3Y A;  3GX4 X;  2BY2 A;  2HZD A;  4M71 A;  3GF2 A;  4XBF A;  3LSM A;  3SQN A;  4CUG A;  3DKY A;  1FEX A;  4CIC A;  3KP4 A;  3ZQL A;  5L3C A;  2ECB A;  3JCU C;  2CSO A;  2W84 A;  2KIU A;  4ZYE A;  3JRI A;  3O8G A;  5LLQ A;  4F92 B;  2EFO A;  4KNY A;  3WHB A;  4RAY A;  1XTA A;  2JTV A;  4ESF A;  4GYI A;  2L4M A;  4P1W A;  3ZQH A;  3B73 A;  2D5V A;  1TZL A;  3F3X A;  1TTY A;  3RPQ A;  3HOW J;  3FK7 A;  1FOX A;  2LOO A;  2CV2 A;  2NYX A;  1O4X A;  5CQE A;  2KLO A;  4U0V A;  4BHP A;  3VSK A;  2KKO A;  2DT7 B;  3LAP A;  2G9W A;  2BZT A;  2LC2 A;  1W7P D;  1O3Q A;  5LBQ A;  3S1M J;  3HB9 A;  2LLK A;  4G7H F;  3Q5F A;  1VQN I;  4IHS A;  3JTH A;  4DZJ A;  2FBK A;  2KQR A;  4NQW A;  4BBR J;  2DN0 A;  2HR3 A;  3QPT A;  3QYB A;  4XR6 A;  1Q1H A;  1ACI A;  4HLX A;  1BL0 A;  2O03 A;  3H3U A;  3BR3 A;  2HDW A;  3QYF A;  4B48 A;  2F6C A;  4KMF A;  1YI2 I;  2W82 A;  4E7Z A;  1K79 A;  2MG4 A;  2HQ5 A;  2DTR A;  1SMY F;  1K4T A;  1OYI A;  3OIP A;  1IN7 A;  1XGN A;  2DBB A;  4BKX A;  4F91 B;  4E70 A;  3S2W A;  4RA2 A;  4XRS A;  2A61 A;  1S8N A;  1Z7L A;  1WJD A;  4EEF G;  3W6K B;  1HA8 A;  1RPW A;  1K4S A;  2XAH A;  3GTK J;  1FJL A;  2P5V A;  3F8F A;  1MBJ A;  2CG4 A;  2HXI A;  3DLL F;  1J5Y A;  1SD4 A;  2BW3 B;  2Z9O A;  2XHK A;  3RQ4 A;  2R5Z B;  4KJZ A;  5IOZ A;  3TED A;  2Y69 H;  4PSX A;  1AWC A;  4ZDP A;  5FKO A;  2GBY A;  4G94 A;  1RZ4 A;  2XAQ A;  2VPR A;  4WCG A;  4B43 A;  1G4D A;  5H6R A;  4XOR A;  1LEA A;  2MD5 A;  2E1C A;  5HLI A;  3CUQ A;  1PDN C;  5FRN A;  2A07 F;  1MKM A;  4XID A;  4DYC A;  3OYA A;  4B3X A;  1EV7 A;  1IUY A;  3WGI A;  4AVP A;  1IAW A;  2VKH A;  1KON A;  1TQP A;  1KU2 A;  4I6Z A;  1OYY A;  3ASN H;  1X3Z B;  4BHB A;  2M1B A;  2P8T A;  1VF9 A;  3OYC A;  3BTC A;  2ESN A;  4XLP F;  2ZBK A;  3TO7 A;  1YJN I;  3HJE A;  3CUO A;  1YOV B;  1Y1W J;  1WRJ A;  1IGN A;  4KN4 X;  3DKX A;  3GZ6 A;  4BL0 B;  3C18 A;  4P9U A;  1I6H J;  2KIS A;  2OQR A;  2PN6 A;  4KIS A;  1ZN2 A;  4XLN F;  1OCR H;  2RN7 A;  2JUG A;  1TWC J;  3V8J A;  3GZ5 A;  1WPK A;  2UXN A;  5EEA A;  3K0L A;  2DYR H;  3S3N A;  4PK4 A;  5DS9 A;  1SD5 A;  2HYF A;  5JHU A;  2R7F A;  3OYE A;  3HKZ A;  3TP0 A;  2EV6 A;  1R4M B;  1VZ0 A;  3DBR B;  4I09 A;  3G71 I;  1ETY A;  2N8G A;  1BN5 A;  2V1N A;  2UXX A;  3CMY A;  3CME I;  1REP C;  1L0O C;  3FKJ A;  3SZT A;  3Q3S A;  1FY7 A;  3ZMV A;  4B47 A;  1LNW A;  5L3E A;  3OYM A;  1I1S A;  1FP2 A;  1HKS A;  1V5E A;  2K3F A;  2HOE A;  4X6A J;  4BU2 A;  4E7J A;  1BJA A;  2E35 A;  3AG1 H;  4LB5 A;  1YS6 A;  2Y9Z A;  2OU2 A;  1KQ9 A;  3HRS A;  4ZYA A;  1QU3 A;  5M3M J;  4O5V A;  2VAS A;  2AXL A;  2J5P A;  3OSF A;  1TT0 A;  3OYN A;  5KAF C;  2EZH A;  4MIM A;  4XOP A;  3RYR A;  2PEX A;  2EZK A;  3BP8 A;  2HS5 A;  3BLY A;  4LK0 F;  3EDP A;  2CO5 A;  4CO8 A;  3FXJ A;  3OY9 A;  1WZ2 A;  3DTI A;  4BNC A;  3S16 J;  4F93 B;  1AKH A;  4NB5 A;  2EFW A;  4BH9 A;  5J1Y A;  2VOP A;  3M4O J;  2F5D A;  3QU3 A;  3F6O A;  3KIO A;  4CYC B;  1GT0 C;  2W48 A;  3OYG A;  2XB0 X;  2WTE A;  1HKT A;  2DFE A;  3BJ6 A;  1WH7 A;  3UR3 C;  4UY8 I;  2ZC2 A;  2KIF A;  3AG4 H;  2JRT A;  2WB1 N;  4KN7 X;  5CVR A;  3A01 A;  2RAE A;  2XB5 A;  1ULY A;  2YPR A;  4FET A;  1MJB A;  1YRN B;  2DMN A;  4CHU A;  3RDI A;  1QO0 D;  5ILV A;  2Q8K A;  2M8E A;  3SFZ A;  4L18 B;  1I27 A;  3ZQI A;  4BJT A;  3WTV C;  1EKE A;  3K6G A;  1KU3 A;  1ZLJ A;  4XKW A;  2MSY A;  2CYY A;  2EV5 A;  9ANT A;  3K70 C;  1DGW Y;  3CMM A;  4G6T B;  3GLL A;  3BG3 A;  3CD6 I;  1YE9 A;  2OTL I;  2JMW A;  3AG3 H;  1W7P A;  1TNS A;  1OKR A;  4Y52 J;  2MA3 A;  3TMO A;  2Z1D A;  3WU1 B;  1MMD A;  1X58 A;  1FZP B;  6PAX A;  1YO5 C;  3HGY A;  1RNL A;  5HDN A;  4YIR X;  3L00 A;  2QM3 A;  2NVU B;  1Z67 A;  4CCM A;  4F7Z A;  2ZJR F;  3E1S A;  3MMY B;  3GO5 A;  3WGH A;  1JUM A;  4IVN A;  4UUS A;  3IRQ A;  4K2E A;  1VTN C;  4EM0 B;  1FYL A;  4UUT A;  1TW2 A;  3FMR A;  4AUX A;  2GWR A;  2MYS A;  1XGM A;  4JBA A;  2EA4 A;  5EEG A;  5FKK A;  4ASN A;  4XRM A;  2XKO A;  4II2 A;  4MEY F;  1WJ5 A;  3KEY A;  3HOX J;  3S3O A;  1O3T A;  1FYK A;  1R7J A;  1Z3X A;  4KIF A;  4AD9 A;  1O7F A;  2NNN A;  4G12 A;  2WAQ N;  4BXF A;  2M87 A;  3ZMZ A;  3WHC A;  2ELK A;  2DU9 A;  3NAU A;  2EWN A;  4HZF A;  5ICE A;  5JVG F;  3R0A A;  3I59 B;  4LG0 A;  3RIR A;  2ZXH A;  1ORK A;  3F8B A;  3E5Q A;  3KE2 A;  2DFH A;  3NQO A;  5ICC A;  2BGC A;  1F5T A;  4F55 A;  1D0Z A;  4BAY A;  1FMW A;  5KAI C;  4LK1 F;  4EM2 A;  4A3J J;  2P6T A;  5M5W J;  4N4O B;  4GFB A;  3WTT C;  3BG5 A;  2JQ7 A;  4CH7 A;  4OOI A;  5F0H A;  1T39 A;  1HF0 A;  2DYS H;  1YJ9 I;  4IHV A;  1A6I A;  3CDI A;  4Q47 A;  1OMI A;  4NHJ A;  4HRI A;  3HDD A;  2STW A;  1HCR A;  3FXM A;  4XK4 A;  3HYI A;  4M9X A;  4A2U A;  2QBY B;  4ENM A;  1BBY A;  2FE3 A;  2VT3 A;  4FE4 A;  4ZYH A;  2GOM A;  1BC8 C;  2LF8 A;  2LBF B;  2IBD A;  3P9I A;  3A4C A;  3QPL A;  3KZI C;  2LTP A;  2NOG A;  5DCM A;  1TWA J;  1ZEL A;  3BCB A;  2X85 A;  3BDD A;  3M07 A;  3BR0 A;  4DYQ A;  5L3G A;  1XDU A;  3MKY B;  2CQQ A;  3VOD A;  3KFW X;  1V3F A;  3S93 A;  5K5Q A;  3T8R A;  4BQA A;  3H5R A;  2KRC A;  1U5T C;  2Y0S A;  2KJB A;  3ZN0 A;  1S9H A;  3HGG A;  1WCM J;  2GIZ A;  3LWF A;  2Y31 A;  1FC3 A;  2MC4 A;  3ZP5 A;  3TDZ C;  2E1N A;  3ROU A;  2KMU A;  1BI3 A;  3ZR8 X;  4IRI A;  1LJ9 A;  5ED4 A;  1AU7 A;  1HST A;  1LFP A;  2P0W A;  3CDH A;  2CWE A;  3LFU A;  5J1U A;  3GTG J;  3VYS B;  3QRF F;  2JSC A;  1F1Z A;  1W5T A;  1XSV A;  4V2F A;  5FD5 A;  1FYM A;  4IHT A;  4QWQ A;  2GXG A;  3OR2 C;  1PYV A;  1V54 H;  2R7V A;  1T33 A;  5B1B H;  1XS9 A;  5K5O A;  4D7N A;  1W0T A;  2PJP A;  2FSW A;  3OS1 A;  2X6W A;  3JRD A;  2LF7 A;  4A3E J;  1VQ9 I;  1V4R A;  2Q0O A;  2QEN A;  1F36 A;  2GAU A;  5IP6 A;  4H0E A;  1E2X A;  2IS2 A;  2OA4 A;  2UZK A;  3SYT A;  4HG2 A;  1R6R A;  2RGV A;  3KP7 A;  2HVR A;  3H0D A;  3E0J B;  4UNO A;  4BDZ A;  1R5H A;  1ZAO A;  4U88 A;  5BS6 A;  5C4J J;  3MFK A;  5JHF A;  2KJC A;  3ABL H;  2VJ5 A;  4HSR A;  2DFI A;  4C3I J;  5IT3 A;  4KA4 A;  4GXO A;  3AAF A;  2XF5 A;  2X48 A;  3CCV I;  1Y56 A;  2Z5U A;  2NAZ A;  4XL9 A;  4XN0 A;  3WU0 A;  4DW6 A;  1FPQ A;  3A1Y A;  3VPR A;  4D5C A;  1H9T A;  2HZT A;  3IV5 A;  4FCY A;  5FLX Z;  1RUO A;  3F22 A;  3S3M A;  1KU7 A;  1W5C C;  1IDZ A;  2DOA A;  4ITV A;  1JT0 A;  2P5L C;  4PGH A;  5L3B A;  5EGO B;  2LRD A;  5D4S A;  3JRG A;  2X9D A;  1U6G A;  2GA2 A;  1MDM B;  2RQQ A;  2JVG A;  4UB6 C;  2LKX A;  1SFX A;  3PM1 A;  1JKQ C;  5TRD A;  2AQE A;  4RB2 C;  2YSR A;  3HSF A;  3RCO A;  2RDP A;  1YIT I;  1G3T A;  3ZMD A;  4I2O A;  2HOA A;  2CGP A;  4Y13 A;  2K86 A;  1DUX C;  3DBL B;  4RB1 A;  3REO A;  2VE9 A;  3KYC B;  4LOC A;  5DD4 A;  4WWC A;  2JPC A;  4OWR B;  3D5L A;  3GFM A;  1NK3 P;  4WXD A;  1BJZ A;  3JRE A;  3OSG A;  2RV8 A;  1IZ1 A;  2NVT J;  2HOS A;  5DTD A;  2FML A;  2QSF X;  2JSP A;  4P9F A;  3CZ6 A;  2EJR A;  4KIG A;  3TKY A;  3L09 A;  4MTE A;  1MMG A;  2FBH A;  2K9S A;  2MBF A;  2QLZ A;  2RVC A;  3E6B A;  2QGU A;  1KYZ A;  1ZQ3 P;  4FX0 A;  1MIJ A;  3OYK A;  2WB1 A;  5BQT A;  5H20 A;  2FD5 A;  1LE8 B;  1FBQ A;  4IOA F;  3WTY C;  3S1R J;  2F4I A;  4OMY A;  3PSI A;  1HW2 A;  1XPX A;  1YG2 A;  3ZPL A;  3S1N J;  5ILU A;  4X0G A;  5E1X A;  3LSG A;  5CVV A;  4EJT A;  2QQA A;  4D7M A;  2BY3 A;  3I5U A;  3M1E A;  3BOQ A;  3E5X A;  1WFX A;  4XLC A;  1X1D A;  4HOB A;  2VKD A;  4JYK A;  1G6N A;  4MHG A;  2X6Y A;  1MW7 A;  1K7A A;  1N25 A;  2BYV E;  1JJ8 C;  3OR1 C;  3G1L A;  3L7W A;  3QPS A;  4O3M A;  4C3H J;  4V19 K;  1E17 A;  2RQP A;  4CCL A;  3CC7 I;  2KL4 A;  2IXS A;  1D5Y A;  2HDD A;  4YFN F;  3HSR A;  1F4K A;  3H92 A;  1XCB A;  1X4O A;  4OU0 A;  5J6X A;  1APL C;  5TIS C;  4MFD A;  2O8K A;  2DI3 A;  5IT9 Z;  4LG3 A;  3K4M A;  4W97 A;  2M5W A;  5TJJ A;  1WJB A;  1B8I A;  3I3L A;  1RES A;  2BV6 A;  2DOD A;  2X0L A;  1YS7 A;  4PJL A;  1I5Z A;  2CV1 A;  4A3D J;  3WTU C;  1D8J A;  1MBK A;  1VI0 A;  3HUG B;  3PQJ A;  5E20 A;  5FFX A;  2WAQ A;  1JTX A;  2R0Q C;  2IGO A;  4A0Y A;  3LSR A;  3I53 A;  1QVU A;  4RS8 A;  4D9J A;  2ZNZ A;  4NDL A;  1UJ8 A;  1SAU A;  1XSD A;  2K02 A;  3U1D A;  1RC9 A;  3I9V 2;  2IP2 A;  2XAG A;  2HOT A;  4RGR A;  2Y75 A;  2QA4 I;  5IOY A;  1BW6 A;  2O7O A;  2JPB A;  5K7H A;  1R49 A;  4XIC A;  1UMQ A;  2P4W A;  4HQE A;  3PUB A;  1WWX A;  2QF7 A;  2JWT A;  4HQM A;  3L2U A;  2PJR B;  1HC8 A;  2XGX A;  3EET A;  4GYG A;  4D1Q A;  1B4A A;  3K10 A;  5IPA A;  2R7Q A;  1RKW A;  1I6X A;  1GXP A;  3JR9 A;  4IL6 C;  4B09 A;  2E5N A;  1G59 A;  5EEH A;  2EFQ A;  4LIV A;  2YX7 A;  3LMM A;  3F21 A;  2FNA A;  2B0L A;  3HOU J;  2X1C A;  1ETW A;  1DDN A;  3GTM J;  1HLV A;  2M4G A;  3MZY A;  5EDN A;  1JKO C;  2W4S A;  3RPU D;  3CF5 F;  2QSH X;  5GAG J;  2L9S A;  1RUN A;  3QP6 A;  4A12 A;  1OCZ H;  4I01 A;  2VBZ A;  3DQV C;  4A3C J;  4PJJ A;  1ONV A;  5BPI A;  1OPC A;  1R23 A;  1ZHF A;  1ITY A;  1ODD A;  3M7G A;  3K70 D;  3L2V A;  3IAS 2;  3EUH C;  3IRR A;  5ERI A;  2WWY A;  1IN8 A;  2CW7 A;  2BHY A;  3HOV J;  3TO6 A;  5FKL A;  1GXQ A;  3DU5 A;  1OQY A;  3VOE A;  3CCJ I;  3ZMS A;  4X1E A;  2DXI A;  3K4L A;  3ZGK A;  3G4S I;  3CP8 A;  4N0B A;  4PGG A;  2ZXI A;  2V9K A;  1JHH A;  5IT9 K;  2E2J J;  1K78 B;  1JI8 A;  3BJO A;  4QSH A;  4LJZ F;  2WV1 A;  1YIJ I;  4HV5 A;  2YUS A;  1SC7 A;  3BCA A;  4HEA 2;  2TRT A;  3EUA A;  2FQ4 A;  5HDK A;  2HNH A;  3K1P A;  3QP5 A;  2DK5 A;  1X2N A;  3HOY J;  3U1K A;  3O8H A;  1R22 A;  2EPF A;  3L2W A;  4BE0 A;  3I58 A;  4U7D A;  2HEO A;  2HI3 A;  5M5X J;  1J2X A;  1HW5 A;  1Z77 A;  3V8L A;  4A3G J;  4Q4Z F;  2IA0 A;  3CCE I;  4N9H A;  3ESW B;  2DOE A;  3J7A O;  1A04 A;  3M9A A;  3WTW C;  1IN5 A;  2M0C A;  2V26 A;  1XN7 A;  5B3S H;  2HKO A;  2V1X A;  4A3L J;  3MAJ A;  4UVC A;  4LLN A;  4O6J A;  5HLG A;  3FMQ A;  2QKL B;  1O57 A;  4L5J A;  4NC7 A;  2E1O A;  2M8G X;  4J19 A;  2ELH A;  4PJ0 C;  5DD8 A;  1UFM A;  1I3A A;  1IV8 A;  2BW3 A;  1A6Q A;  1X19 A;  1ETX A;  2R5Z A;  4J00 A;  4HLY A;  3DTE A;  2GM4 A;  3ZN1 A;  3A03 A;  1DPR A;  2ZKZ A;  2XKP A;  3CCM I;  2PG4 A;  1JJ6 C;  2KFD A;  3GWZ A;  2J5O A;  3DV8 A;  2NVY J;  4QIW N;  3H9J A;  2OBP A;  1D1A A;  5D8K B;  2FQ3 A;  4E7I A;  2H6B A;  3S15 J;  3TBI A;  4EM1 A;  3BC8 A;  5J40 A;  1D5V A;  4L0Z B;  1HDP A;  2HPM A;  4MQV A;  2WY7 Q;  4RAF A;  3LSK A;  3T8T A;  2M7A A;  2FA5 A;  2UUZ A;  3KP3 A;  1NG6 A;  1S6L A;  2Y0S N;  3N05 A;  3IUO A;  4C30 A;  4RGS A;  1WJF A;  1X2M A;  3IWF A;  4JX6 A;  4HX4 A;  5HNH A;  1OYW A;  3GZN B;  5LEK A;  1LB2 A;  2VI6 A;  2FNP A;  1Z1D A;  1ZGJ A;  5E18 F;  2P7V B;  4A3K J;  1YW8 A;  3V7C A;  3KLO A;  1OIS A;  2B7E A;  2WA0 A;  2JA6 J;  3I0T A;  1MSF C;  5D6F A;  1YW7 A;  3ECH A;  1XMK A;  4B8X A;  3QOP A;  2TDX A;  2LR8 A;  3BRO A;  5F1J A;  2LD5 A;  5IYD J;  1NH3 A;  4IRH A;  3MWM A;  1X3U A;  4S0H B;  3P7N A;  2O61 A;  3F8N A;  5EYR A;  2O6G E;  1M1E B;  3V4G A;  5A2Q Z;  2MLK A;  2LNB A;  1BI0 A;  2ZME A;  3C1D A;  3G1O A;  5EJC A;  5FKN A;  2EV0 A;  1X3W B;  2BOL A;  5BMZ A;  4ZH4 F;  1EA3 A;  4C2U A;  4PFO A;  1A31 A;  3FF5 A;  5F6F A;  5F64 A;  5IP9 J;  4I99 C;  2ADU A;  4PJN A;  2K9N A;  3X2Q H;  3E3V A;  4MNU A;  3DTK A;  4G9Y A;  2XUB A;  2ZFW A;  4ZYD A;  5HS8 A;  4JQF A;  2DA6 A;  1YHQ I;  4EVI A;  3W2W A;  3NWT A;  3OYH A;  1VQ5 I;  4CZZ A;  4N4N B;  5GAE J;  2E36 A;  1LFB A;  2ZME B;  4BJ6 C;  1HW1 A;  1MSE C;  1P7I A;  3MN2 A;  1OCT C;  1KZH A;  1Z0X A;  4XKV A;  1FX7 A;  3CP2 A;  1O7L A;  1IXS B;  2XGC A;  3IH4 A;  3FKI J;  4XSZ F;  3DPL C;  1FIA A;  3KEO A;  4M9Z A;  2EIM H;  2RKH A;  3UNG C;  3BG6 A;  4R79 A;  3ZQG A;  3F8M A;  2GZW A;  3RPU A;  3OL3 A;  2JJ7 A;  2F4M B;  3HRT A;  3PFY A;  2WBM A;  2L0K A;  2IW5 A;  2E34 A;  1YX5 A;  1FT9 A;  2ZME C;  5EZH A;  4OIN F;  4CYC A;  1JGS A;  3U9G A;  2GQQ A;  3WTS C;  3JSP A;  3NEU A;  2VC1 A;  1CGP A;  1U2W A;  3IKT A;  4M74 A;  3V7R A;  1ZK8 A;  3K4N A;  2XIG A;  1ZG1 A;  1JXS A;  5EF6 A;  1GDT A;  1ZTR A;  1YRN A;  4HA8 A;  3TO9 A;  4EJV A;  2EIJ H;  4BXX J;  4MO7 A;  4QTR A;  3MKW B;  3R0J A;  1FNN A;  3LST A;  2BEO A;  2RNJ A;  5M3F J;  4OIR F;  2ME0 A;  4CZC A;  3HOZ J;  4LIT A;  2KDO A;  1P4W A;  3G3Z A;  4HNU A;  1O3S A;  1H8A C;  2VQH A;  2TCT A;  2RRE A;  4E4H A;  2IGM A;  2OD5 A;  4EMS A;  4J01 A;  1Z6R A;  1B9N A;  2E71 A;  4CCJ A;  1R58 A;  2LVS A;  2MLG A;  3OWT A;  3PL8 A;  3S8P A;  2LKS A;  1KGS A;  5A2Q K;  3HOT A;  1X4P A;  3TQN A;  5BNG A;  5JVT A;  1RKT A;  3EQL F;  3Q0V A;  5LGT A;  2IEK A;  4C3J J;  3UKG A;  1RET A;  3IHU A;  4TV7 A;  3VWB A;  5GAD J;  3TDU C;  1HKQ A;  1T98 A;  3PNT A;  4NNJ A;  4XNF A;  4EJU A;  2ISY A;  4FT8 A;  2R7O A;  2VN2 A;  4LLL A;  5E1Z B;  1J7K A;  3WG9 A;  1K6O A;  2NRA C;  2Z33 A;  1HQC A;  3Q9S A;  2KRH A;  4IHW A;  1VQL I;  4CXF A;  1FMV A;  4IHX A;  1MND A;  2VOO A;  3CCR I;  4KIC A;  2WAE A;  1DU6 A;  2F5C A;  5GTI C;  5E79 C;  2EH3 A;  3I59 A;  2VLA A;  3FHN A;  1PUF B;  4DGW B;  2OV7 A;  3PUF A;  1NHA A;  2HTS A;  4M6Y A;  3OYL A;  2O0Y A;  3TOB A;  3ABK H;  3A02 A;  2ICW G;  2EZL A;  2LYC A;  4IJA A;  2H09 A;  5D4R A;  4Q48 A;  2HVS A;  3DEU A;  4AC0 A;  3NWS A;  3W6J B;  3O3K A;  2FX0 A;  1P7J A;  3OYI A;  1TL8 A;  1S3J A;  2EIK H;  2QBY A;  1QRY A;  1R1T A;  2DFF A;  3GTQ J;  1OLT A;  2K40 A;  1Z21 A;  5B1A H;  3WOD F;  2X1E A;  2GOX B;  2ZXJ A;  3OS2 A;  1U5T A;  3ZRG A;  3IAM 2;  3D0S A;  3KP5 A;  3PQK A;  4HX8 A;  3FXU A;  2A6T A;  4G6D A;  4M3F A;  2HGC A;  2LBF A;  2G0E A;  2ETH A;  2WAF A;  3FK6 A;  4HBL A;  5KVR A;  4XLE A;  4QPO A;  2L02 A;  2DQR A;  3DBH B;  1UB9 A;  2NVX J;  2KIQ A;  2IJL A;  4EAT A;  2P6S A;  1WQ2 A;  5D5U B;  1H9G A;  1ZGW A;  1CQT A;  4I0A A;  2ZFU A;  2XPW A;  4ON0 A;  4E7H A;  1W0U A;  1VQ7 I;  1B6A A;  2F2E A;  2HQN A;  3Q9V A;  4FHT A;  1KU9 A;  3QPH A;  5FLM J;  2QEX I;  1XSX A;  1U5T B;  2JN6 A;  5FKM A;  2ACJ A;  1FTZ A;  4HF1 A;  1R00 A;  1FWZ A;  3GLX A;  3HPG A;  2MW8 A;  3WTZ A;  3AL0 B;  4UV8 A;  4JOM A;  4IZZ A;  5FJ8 J;  5CYV A;  4CCO A;  2AQF A;  2W57 A;  3OYD A;  3A2K A;  3CLQ A;  4AVZ A;  1DP3 A;  3FM5 A;  2VXD A;  5CKT A;  2YX4 A;  3GTP J;  2VBY A;  1ZRD A;  4A3B J;  3K7A J;  3BR5 A;  2OTJ I;  2GLO A;  2R7Z J;  3BG7 A;  1ZGA A;  4FIS A;  3CDL A;  2Y2Z A;  5D5V B;  1XC5 A;  4E6K G;  4AM3 A;  4OIP F;  2KP6 A;  4JP0 A;  2DMP A;  4XMY A;  2M2E A;  1QHG A;  3QQA A;  3AL0 C;  2H27 A;  1MJ9 A;  1KYW A;  4L9T A;  1SVO A;  4PFP A;  2R5Y B;  4ZZD A;  1EH7 A;  2FOK A;  3L1P A;  1SFE A;  2HVQ A;  5HNF A;  4FX4 A;  3S2H J;  2I5U A;  3KP6 A;  4G6Q A;  3JAM Z;  2Z2S B;  5FB2 A;  1OR7 C;  3KET A;  3PIO F;  3PJR A;  2VIX A;  1R1U A;  2VJ4 A;  4QLC U;  1XMX A;  3C2H A;  5J8F A;  2L7Z A;  1VQM I;  3PNY A;  1PP8 F;  5K7Z A;  3DPT A;  2R7S A;  3DPU A;  2BVL A;  3VYT B;  5F04 A;  4Q5S F;  2PFB A;  2FOW A;  2QKM B;  3OYF A;  1YTY A;  4PSW A;  2K27 A;  3JRB A;  4KT6 A;  4ZTJ A;  2EB7 A;  1QZZ A;  3ZQQ A;  1Y6I A;  2MH2 A;  4Z2Y A;  2DMT A;  2KDZ A;  2P7C B;  3JRF A;  1IW7 F;  5C4X J;  4HPQ A;  1XDS A;  1ZG3 A;  2JZY A;  2G7U A;  5EGO A;  2PMU A;  4CCK A;  1ZAR A;  1U9O A;  1MDM A;  2ISZ A;  2KZV A;  3E6M A;  3FXQ A;  2XRO A;  4BDY A;  3VYR B;  4Y15 A;  1BI2 A;  3G6E I;  2L7K A;  2Y9Y A;  4LMY A;  3RTR A;  3SDB A;  4DZP A;  5KHD A;  4A93 J;  4PUS A;  4E7K A;  5GP9 A;  5J47 A;  3SXY A;  3T0Y A;  2K4B A;  3FXR A;  2KRF A;  4F52 A;  2D1V A;  4MQ9 F;  1VND A;  2H94 A;  1FOY A;  2R93 J;  2E60 A;  2DA3 A;  2L3D A;  1GHC A;  3J7Y J;  2EFN A;  1JUS A;  1IRZ A;  1WH5 A;  2EBI A;  1ZKG A;  2NVQ J;  2DT5 A;  3VFZ A;  3CF2 A;  2ZNY A;  5F1R A;  1U78 A;  4BS9 A;  5FD6 A;  1IRG A;  4I0B A;  2NXN B;  3TOA A;  2COB A;  3BWG A;  2F4O B;  3CO7 C;  2YU3 A;  1MJA A;  2VBW A;  3L2Q A;  1SFO J;  1BM9 A;  2BXY A;  2L9R A;  4HV6 A;  4LD5 A;  2V1D A;  4DOZ A;  1PUE E;  4RAG A;  1LE8 A;  1WJE A;  1Y8Q B;  3ZMT A;  3LAJ A;  2GIV A;  2QCO A;  4IEJ A;  4UVA A;  4MTD A;  3RZO J;  1IJW C;  4BBS J;  4KT5 C;  4FQG A;  3I64 A;  2EA2 A;  3D1N I;  4Y7N J;  3HTS B;  2H1L A;  2L54 A;  5DCF A;  1A5J A;  1MBG A;  1LDJ A;  2K9Q A;  4H4K C;  3CES A;  3RQI A;  2OF7 A;  4L5I A;  2LK2 A;  3CCS I;  1QNT A;  3GTL J;  3CJN A;  1MBF A;  2VQG A;  1ERD A;  1STZ A;  1MBH A;  1WI9 A;  3FXL A;  3SEZ A;  5E1W A;  1A35 A;  4C9Y A;  2XAS A;  4S04 A;  1I39 A;  1XGO A;  1OFC X;  3P9C A;  3JAM K;  3BQZ A;  3I71 A;  3QOE A;  2ZJQ F;  2JVH A;  5B5E C;  1D8K A;  2KPM A;  3PO2 J;  2W25 A;  1Q1V A;  1JKP C;  4BYY A;  3HPH A;  3PSF A;  3ERE D;  2FU4 A;  1FBU A;  3FBN B;  3OOP A;  4RGU A;  4A5M A;  3T5X A;  3E5U A;  4U0W A;  3WTX C;  2QQ9 A;  4ESB A;  1XB4 A;  1GVJ A;  2XRL A;  2A05 A;  2O3F A;  2Q2E B;  3AFH A;  3VEP A;  4XLF A;  5J8C A;  1BC7 C;  1SD7 A;  3K2A A;  4U7B A;  1LUJ B;  3RKW A;  1FSE A;  5CVI A;  1K61 A;  2HPI A;  1P9Q C;  4IKF A;  5CPR B;  1NK2 P;  1N78 A;  1BIB A;  4HST A;  1QPM A;  3HUG A;  1R71 A;  3E6D A;  1C0W A;  2BBY A;  5CVJ A;  2AXT C;  1WI3 A;  2KHM A;  5HDG A;  2DPD A;  3O2P E;  5GAH J;  5M5Y J;  3GCM A;  2R7R A;  1UAA A;  1ZR4 A;  4P96 A;  3LFK A;  3BJA A;  2MH9 A;  5E8I A;  5HOO A;  1TWF J;  1P4X A;  1HSJ A;  2K85 A;  3HHH A;  3K4C A;  3M8E A;  4KMU X;  5JR3 A;  1JUP A;  2R7W A;  1W36 C;  5FRM A;  1POG A;  1RI7 A;  3MVP A;  5CVU A;  3BPX A;  1H88 C;  1E3P A;  3DEE A;  3SEQ A;  4WX9 A;  2YS9 A;  3B6A A;  1EJ9 A;  2D2W A;  1G3W A;  1LVA A;  4YEJ A;  4IQ4 A;  2PJR A;  4GCV A;  1IRX A;  4Z6Y A;  5ICG A;  2V4J C;  3FIW A;  4YII A;  4FTH A;  5JLX A;  1J59 A;  4ZDL A;  2DDB A;  2VOD A;  4CA0 A;  1R5G A;  4RBO A;  2OJE D;  1U0J A;  5L3D A;  4EGZ A;  3EUH A;  1YW9 A;  5GPA A;  2V6E A;  1ENH A;  3OOU A;  2CQN A;  2QWW A;  2R4G A;  2VKE A;  1BOB A;  1IDY A;  1SAX A;  1K6Y A;  1UG0 A;  3CJT B;  3V42 A;  5AIQ A;  1J0R A;  2AS5 F;  2OQG A;  1VFC A;  2UWM A;  1ZRC A;  2M3A A;  2Z99 A;  4HF2 A;  3HEF A;  4L9N A;  1T95 A;  2W85 A;  1G3S A;  4A0X A;  1KA8 A;  3CCY A;  1OCP A;  1VQP I;  2IRF G;  4IHY A;  3Q0U A;  3HC7 A;  5ICF A;  1XG1 A;  1IF1 A;  1P6R A;  2JA5 J;  2LKP A;  4YIF A;  4ZDO A;  3ZOB A;  1Z6T A;  2KIM A;  4M6V A;  4OIQ F;  2M45 A;  1X1B A;  4M3G A;  5BPD A;  3GTO J;  1MMS A;  4AU7 A;  2VL8 A;  3DEW A;  1YYV A;  5D5W B;  4AID A;  3HHG A;  4YRV A;  1RIO H;  1K78 A;  1XGS A;  3ERM A;  3BR2 A;  3G2B A;  2DLL A;  1SAN A;  1JHF A;  2XSJ C;  1QZY A;  2V1U A;  2P81 A;  4P55 A;  2PMH A;  1ZH5 A;  2LSO A;  5E17 F;  2RNG A;  4XKB A;  1YLF A;  4RB3 C;  2E2H J;  3DKW A;  1FP1 D;  4BGD A;  5FLV A;  3GVA A;  2PQ8 A;  2JK3 A;  3H0G J;  4ENK A;  2H1K A;  5LEJ A;  4BEH B;  2VJJ A;  1PP7 U;  2VON A;  1YIO A;  3IH2 A;  4RLF A;  4BQN A;  4P5O A;  3J81 Z;  3B6C A;  4KIB A;  3PFI A;  1BR2 A;  4HAM A;  3S2D J;  3ML6 A;  4RAZ A;  3H9G A;  4EJW A;  1W1W E;  3V8K A;  3ELK A;  2E5Z A;  1R9T J;  2XF6 A;  1QQI A;  5DYM A;  1O3R A;  1V5F A;  4BE1 A;  5LHI A;  2DAO A;  4B4C A;  2ECC A;  5AIP A;  1XX5 A;  4OAY A;  3A0H C;  2PMZ A;  2DA7 A;  3H3Z A;  3SFI A;  5DDG A;  3CC4 I;  2IGK A;  2R92 J;  2FMY A;  2E19 A;  1N77 A;  3MKZ A;  4GO1 A;  2QSG X;  3GFJ A;  1Z05 A;  3K9T A;  3PNV A;  3K4B A;  3GME A;  4W1U A;  5D5X B;  3SZP A;  1HXD A;  4M3E A;  1FOK A;  4EGY A;  4OAZ A;  1SVL A;  3FM3 A;  5KNL A;  3I56 I;  3E97 A;  1Y8R B;  2R7T A;  4RGX A;  2JUC A;  4HDU A;  3BR1 A;  2EQR A;  4KFC A;  4HYE A;  3TP3 A;  3ASO H;  3FDY A;  3IKV A;  5F0F A;  5HS7 A;  2L5Q A;  3F8C A;  1JGG A;  1YQA A;  2JA8 J;  1BIA A;  2L9V A;  1EF4 A;  3LOC A; 
#chains in the Genus database with same CATH homology
 4MEX F;  5DEQ A;  2X4H A;  4N9I A;  2PLY A;  2IA2 A;  5FO5 A;  1UCR A;  2P5K A;  3U2R A;  2VXZ A;  3F72 A;  1ON2 A;  3ZQ7 A;  5FFZ A;  3C3W A;  5HS9 A;  3KZY A;  1Z91 A;  1B1B A;  1G3Y A;  1YFH A;  3OV8 A;  3P9K A;  2F5E A;  2STT A;  4YFK F;  3JSO A;  3DP7 A;  4KUM A;  3J81 K;  3BZ6 A;  1IN6 A;  1EH6 A;  1AOY A;  1UST A;  3FWE A;  4IRG A;  1FLI A;  3LA2 A;  3IL2 A;  2NS0 A;  4G7O F;  1BI1 A;  4AIK A;  3GEZ A;  5K5R A;  3CUQ B;  2D1H A;  3BY6 A;  5BOX A;  4M6X A;  4HX7 A;  4UUV A;  2JT1 A;  1EH8 A;  2GXB A;  4I02 A;  3R60 A;  2Z3Y A;  3GW2 A;  1MD0 A;  4R1H A;  2XAJ A;  4I7H A;  4UXN A;  5CLS A;  4YG2 F;  3QAH A;  4BXU A;  3CUQ C;  3ISP A;  4A5N A;  2HQR A;  1CF7 A;  4ETS A;  4L0Y B;  4WXH A;  2V6C A;  5ILS A;  1Z9C A;  2D45 A;  5DUI A;  1TQI A;  3ULQ B;  2IA1 A;  2CFX A;  4A6E A;  3WE2 A;  4WXC A;  2DPU A;  2A69 F;  1CF7 B;  1IXC A;  2EFP A;  1TBX A;  4MGR A;  2HKX A;  2R7D A;  2QUF A;  3ECO A;  2GA1 A;  4LLG F;  1S7A A;  3COA C;  2OZ6 A;  1LDD A;  4JK1 X;  5KK1 A;  3KCC A;  1TNT A;  2E7X A;  1QBJ A;  4S05 A;  3F6V A;  3RKY A;  4LFU A;  3R4K A;  5D6E A;  3ABT A;  3WGG A;  4BHC A;  5HLH A;  2NNY A;  2K4J A;  4EV0 A;  3R61 A;  1Z7U A;  4HW0 A;  1FBS A;  1H0M A;  4CGZ A;  3CLO A;  4DQ2 A;  2R3S A;  4ENJ A;  2VC0 A;  3NRV A;  3N4M A;  5HVQ C;  1T0F A;  5E8G A;  4ESJ A;  4ZZL A;  3CO6 C;  4ENN A;  3FMS A;  3ABU A;  2ZCW A;  1L3L A;  1W7P B;  2A3S A;  3M8F A;  1SFU A;  2DW4 A;  4XRF A;  2BE5 F;  2QQB A;  3MCZ A;  1W4M A;  3ZMU A;  2QVO A;  4OIO F;  2OZU A;  5DUK A;  5LRR A;  2XVC A;  3IWZ A;  2O8X A;  2VBX A;  5DV5 A;  4A0Z A;  2H6C A;  1TQM A;  1OR7 A;  3G73 A;  2FBI A;  4UVB A;  3LQR A;  2IVM A;  2ZJ2 A;  1W5S A;  1U8R A;  5JI6 A;  2COM A;  2FRH A;  1USS A;  4LGW A;  4DNC A;  1DPU A;  2RC4 A;  3SHF A;  1ZRE A;  2PBI A;  1QGP A;  2V9V A;  2HWV A;  3K69 A;  4LG0 B;  1U3E M;  1SD6 A;  2YR2 A;  2PI0 A;  1F9N A;  2DQL A;  1LQ1 A;  3FHZ A;  2DO7 A;  4Y17 A;  3DXJ F;  2W24 A;  3WE3 A;  2OAZ A;  4L9J A;  2VT2 A;  4M73 A;  1P92 A;  4WF2 A;  4PZJ A;  1HBX G;  1ZRF A;  1TLH B;  4WK8 F;  4G8X A;  2C6Y A;  2WC2 A;  1WSU A;  3N97 A;  3EYI A;  3DF8 A;  1KQ0 A;  1XCV A;  1ZYR F;  3K1M A;  5DCM B;  1FSH A;  1R36 A;  3JW4 A;  4G7Z F;  1I1G A;  2EK5 A;  4IXA A;  5D8L B;  2QZ8 A;  3MZH A;  4U0Y A;  4HF0 A;  5FGM A;  3JTG A;  2HFH A;  3I4P A;  3T1B A;  4IF4 A;  4XSX F;  2A5Y B;  4LB6 B;  3V7S A;  3LA3 A;  1DP7 P;  2G7H A;  3BPV A;  4M9S A;  1IXR C;  2DK8 A;  1LDK B;  3O6B B;  3R6S A;  4IPA A;  5JFR A;  1T38 A;  3GFL A;  2MC3 A;  3L9F A;  4D0P A;  1B9M A;  3RKX A;  4EQQ A;  2L01 A;  2E7W A;  1XMA A;  1R1V A;  3L2C A;  5LGU A;  2VE8 A;  3HIF A;  4YFX F;  5K1Y A;  5L3F A;  4CYD A;  3FX3 A;  2Q2E A;  1J75 A;  1TW3 A;  1S29 A;  3E6C C;  2FF4 A;  4CDG A;  1P4A A;  3KLN A;  2ESH A;  4L9V A;  3K1N A;  2K7L A;  4R8H A;  3IC7 A;  4EJO A;  3I54 A;  4ZYG A;  3C7J A;  1JE8 A;  4KYW A;  3GXO A;  3MQ0 A;  1P2F A;  2FEZ A;  2A68 F;  3RI4 A;  2F5F A;  3HRU A;  4AIH A;  4GGG A;  2L4A A;  3EYY A;  1XD7 A;  3VB2 A;  4KDP A;  1IN4 A;  3J80 Z;  5LHG A;  3TGN A;  2FXA A;  2V79 A;  3RYP A;  4UV9 A;  2A6E F;  1J9I A;  2QYO A;  5LRS A;  4PCQ A;  3HOS A;  5LHH A;  3GFI A;  1WKM A;  1MGT A;  4AIJ A;  5FLX K;  4M72 A;  1MZB A;  2CQK A;  1BOA A;  1SMT A;  3HTU A;  2Y0M A;  1ZG5 A;  1KQ8 A;  2A6H F;  2M30 A;  4AWX B;  3GUD A;  1T2K A;  3LQQ A;  4HDV A;  1IRF A;  3RJP A;  1ON1 A;  3LA7 A;  2XRN A;  2HYG D;  2IPQ X;  3HRM A;  4RB0 A;  1B59 A;  3KP2 A;  2WV0 A;  2HDC A;  5AON A;  1S7O A;  1UHM A;  1LEB A;  2HTJ A;  3DFG A;  2IT0 A;  1T6S A;  1ZLK A;  3QU6 A;  1UHW A;  3CTA A;  3HSE A;  3MEX A;  5LGN A;  3B02 A;  2LDU A;  3K2Z A;  3FZV A;  3KZZ A;  4I98 B;  4UHT A;  4OMZ A;  2XV4 S;  4PDK A;  3GYH X;  2CW0 F;  3F23 A;  4A6D A;  5H6Q A;  2ZO4 A;  5CJ9 A;  2Y48 A;  3J80 K;  3KEQ A;  1Y0U A;  2XAF A;  1D3Y A;  3GX4 X;  4M71 A;  3GF2 A;  4XBF A;  3SQN A;  4CIC A;  3KP4 A;  5L3C A;  2CSO A;  2W84 A;  2KIU A;  4ZYE A;  5LLQ A;  2EFO A;  4KNY A;  4RAY A;  2JTV A;  4ESF A;  4GYI A;  2L4M A;  3B73 A;  3F3X A;  1TTY A;  3RPQ A;  2NYX A;  4U0V A;  4BHP A;  2KKO A;  3LAP A;  2G9W A;  1W7P D;  1O3Q A;  5LBQ A;  4G7H F;  3Q5F A;  4IHS A;  3JTH A;  2FBK A;  4NQW A;  2HR3 A;  3QPT A;  1Q1H A;  4HLX A;  2O03 A;  3H3U A;  4KMF A;  1K79 A;  2DTR A;  1SMY F;  1OYI A;  1IN7 A;  1XGN A;  2DBB A;  4E70 A;  3S2W A;  2A61 A;  1S8N A;  3W6K B;  2XAH A;  2P5V A;  3F8F A;  2CG4 A;  1J5Y A;  1SD4 A;  2Z9O A;  2XHK A;  1AWC A;  4G94 A;  1RZ4 A;  2XAQ A;  4WCG A;  1G4D A;  5H6R A;  1LEA A;  2MD5 A;  2E1C A;  5HLI A;  3CUQ A;  1PDN C;  2A07 F;  1MKM A;  1EV7 A;  1IUY A;  3WGI A;  4AVP A;  1IAW A;  1TQP A;  1KU2 A;  1OYY A;  4BHB A;  2M1B A;  2P8T A;  2ESN A;  4XLP F;  2ZBK A;  3TO7 A;  3CUO A;  1WRJ A;  4KN4 X;  3GZ6 A;  3C18 A;  4P9U A;  2OQR A;  2PN6 A;  1ZN2 A;  4XLN F;  2RN7 A;  3V8J A;  3GZ5 A;  2UXN A;  3K0L A;  1SD5 A;  2HYF A;  5JHU A;  2R7F A;  2EV6 A;  4I09 A;  2UXX A;  1BN5 A;  1REP C;  1L0O C;  3SZT A;  1FY7 A;  3ZMV A;  1LNW A;  5L3E A;  1I1S A;  1FP2 A;  1HKS A;  2HOE A;  1BJA A;  4LB5 A;  1YS6 A;  2OU2 A;  1KQ9 A;  3HRS A;  4O5V A;  2AXL A;  2J5P A;  3RYR A;  2PEX A;  3BP8 A;  2HS5 A;  4LK0 F;  3EDP A;  2CO5 A;  4CO8 A;  4BNC A;  4NB5 A;  2EFW A;  4BH9 A;  2VOP A;  2F5D A;  3QU3 A;  3F6O A;  2WTE A;  1HKT A;  3BJ6 A;  2KIF A;  2JRT A;  4KN7 X;  5CVR A;  1ULY A;  2YPR A;  1MJB A;  4CHU A;  3RDI A;  1QO0 D;  5ILV A;  2Q8K A;  2M8E A;  3SFZ A;  4L18 B;  1I27 A;  3WTV C;  1KU3 A;  1ZLJ A;  2CYY A;  2EV5 A;  1W7P A;  1TNS A;  1OKR A;  2MA3 A;  3WU1 B;  1FZP B;  6PAX A;  1YO5 C;  1RNL A;  5HDN A;  3L00 A;  2QM3 A;  4F7Z A;  3GO5 A;  3WGH A;  4IVN A;  3IRQ A;  4K2E A;  1VTN C;  4EM0 B;  1FYL A;  1TW2 A;  3FMR A;  2GWR A;  1XGM A;  4JBA A;  2EA4 A;  5EEG A;  4ASN A;  2XKO A;  4MEY F;  1O3T A;  1FYK A;  1R7J A;  4KIF A;  4AD9 A;  1O7F A;  2NNN A;  2M87 A;  3ZMZ A;  2DU9 A;  2EWN A;  4HZF A;  5ICE A;  3R0A A;  3I59 B;  4LG0 A;  3RIR A;  3F8B A;  3E5Q A;  3KE2 A;  3NQO A;  5ICC A;  2BGC A;  1F5T A;  4BAY A;  4LK1 F;  4EM2 A;  2P6T A;  3WTT C;  4OOI A;  1T39 A;  4Q47 A;  1OMI A;  4NHJ A;  2STW A;  3HYI A;  4M9X A;  4A2U A;  2QBY B;  4ENM A;  1BBY A;  2FE3 A;  2VT3 A;  4ZYH A;  1BC8 C;  2LF8 A;  3P9I A;  5DCM A;  3BDD A;  5L3G A;  1XDU A;  3VOD A;  3KFW X;  1V3F A;  5K5Q A;  3T8R A;  4BQA A;  1U5T C;  2KJB A;  3ZN0 A;  3LWF A;  1FC3 A;  3ZP5 A;  3TDZ C;  2E1N A;  3ROU A;  1BI3 A;  4IRI A;  1LJ9 A;  5ED4 A;  1HST A;  3CDH A;  2CWE A;  3QRF F;  2JSC A;  1F1Z A;  1W5T A;  1XSV A;  5FD5 A;  1FYM A;  4IHT A;  4QWQ A;  2GXG A;  5K5O A;  2PJP A;  2FSW A;  2LF7 A;  1V4R A;  2Q0O A;  2QEN A;  2GAU A;  4H0E A;  1E2X A;  2OA4 A;  2UZK A;  2RGV A;  3KP7 A;  4UNO A;  1R5H A;  1ZAO A;  4U88 A;  5BS6 A;  3MFK A;  2KJC A;  5IT3 A;  4KA4 A;  2DFI A;  4GXO A;  3AAF A;  2Z5U A;  2NAZ A;  3WU0 A;  1FPQ A;  1H9T A;  2HZT A;  1RUO A;  5FLX Z;  3F22 A;  1KU7 A;  2P5L C;  4PGH A;  5L3B A;  5D4S A;  1U6G A;  2GA2 A;  1MDM B;  1SFX A;  5TRD A;  4RB2 C;  2YSR A;  3HSF A;  2RDP A;  1G3T A;  3ZMD A;  4I2O A;  2CGP A;  4Y13 A;  2K86 A;  1DUX C;  4RB1 A;  3REO A;  2VE9 A;  5DD4 A;  4WWC A;  2JPC A;  3D5L A;  3GFM A;  4WXD A;  2RV8 A;  1IZ1 A;  2FML A;  4P9F A;  2EJR A;  4KIG A;  3TKY A;  3L09 A;  4MTE A;  2FBH A;  2MBF A;  2QLZ A;  2RVC A;  3E6B A;  1KYZ A;  4FX0 A;  5BQT A;  5H20 A;  1FBQ A;  3WTY C;  4OMY A;  1HW2 A;  1YG2 A;  3ZPL A;  5ILU A;  5E1X A;  5CVV A;  4EJT A;  2QQA A;  3I5U A;  3M1E A;  3BOQ A;  3E5X A;  4HOB A;  1G6N A;  4MHG A;  1K7A A;  2BYV E;  3L7W A;  4O3M A;  1E17 A;  2RQP A;  4YFN F;  3HSR A;  1F4K A;  3H92 A;  1XCB A;  4OU0 A;  5J6X A;  2DI3 A;  5IT9 Z;  2M5W A;  5TJJ A;  2BV6 A;  2X0L A;  1YS7 A;  1I5Z A;  3WTU C;  1D8J A;  5E20 A;  3PQJ A;  5FFX A;  4A0Y A;  3I53 A;  4RS8 A;  2ZNZ A;  1XSD A;  2K02 A;  3U1D A;  2IP2 A;  2XAG A;  4RGR A;  2Y75 A;  2JPB A;  2P4W A;  4HQE A;  1WWX A;  4HQM A;  2XGX A;  3EET A;  4GYG A;  1B4A A;  1I6X A;  1GXP A;  4B09 A;  5EEH A;  2EFQ A;  2YX7 A;  3F21 A;  2FNA A;  2B0L A;  1DDN A;  3MZY A;  1RUN A;  3QP6 A;  4A12 A;  4I01 A;  2VBZ A;  3DQV C;  1ONV A;  5BPI A;  1OPC A;  1R23 A;  1ZHF A;  1ODD A;  3M7G A;  3IRR A;  5ERI A;  2WWY A;  1IN8 A;  3TO6 A;  1GXQ A;  3VOE A;  3ZMS A;  4N0B A;  4PGG A;  1JHH A;  5IT9 K;  1K78 B;  3BJO A;  4LJZ F;  4HV5 A;  5HDK A;  3K1P A;  3QP5 A;  2DK5 A;  1R22 A;  2HEO A;  3I58 A;  4U7D A;  1J2X A;  1HW5 A;  3V8L A;  4Q4Z F;  2IA0 A;  4N9H A;  3J7A O;  1A04 A;  3M9A A;  3WTW C;  1IN5 A;  1XN7 A;  2HKO A;  2V1X A;  3MAJ A;  4UVC A;  4LLN A;  4O6J A;  5HLG A;  3FMQ A;  1O57 A;  4L5J A;  2ELH A;  5DD8 A;  1UFM A;  4HLY A;  3ZN1 A;  1DPR A;  2ZKZ A;  2XKP A;  2PG4 A;  3GWZ A;  2J5O A;  3DV8 A;  2OBP A;  5D8K B;  2FQ3 A;  2H6B A;  4EM1 A;  1D5V A;  4L0Z B;  4MQV A;  3T8T A;  2FA5 A;  3KP3 A;  1S6L A;  4RGS A;  3IWF A;  4HX4 A;  1OYW A;  5LEK A;  1LB2 A;  2FNP A;  1Z1D A;  1ZGJ A;  5E18 F;  2P7V B;  1YW8 A;  3V7C A;  3KLO A;  3I0T A;  5D6F A;  1YW7 A;  3ECH A;  1XMK A;  4B8X A;  3QOP A;  2TDX A;  3BRO A;  4IRH A;  3MWM A;  1X3U A;  3P7N A;  2O61 A;  3F8N A;  2O6G E;  3V4G A;  5A2Q Z;  2MLK A;  2LNB A;  1BI0 A;  2ZME A;  3C1D A;  2EV0 A;  5BMZ A;  4ZH4 F;  3FF5 A;  5F6F A;  5F64 A;  2ADU A;  3E3V A;  4MNU A;  4G9Y A;  2XUB A;  2ZFW A;  4ZYD A;  5HS8 A;  4JQF A;  4EVI A;  4CZZ A;  2ZME B;  1HW1 A;  1FX7 A;  1O7L A;  1IXS B;  4XSZ F;  3DPL C;  3KEO A;  4M9Z A;  2RKH A;  4R79 A;  3F8M A;  2GZW A;  3RPU A;  3HRT A;  2IW5 A;  1FT9 A;  4OIN F;  1JGS A;  3U9G A;  2GQQ A;  3WTS C;  3JSP A;  3NEU A;  2VC1 A;  1CGP A;  1U2W A;  3IKT A;  4M74 A;  3V7R A;  1ZG1 A;  2XIG A;  1JXS A;  4HA8 A;  3TO9 A;  4EJV A;  3R0J A;  1FNN A;  3LST A;  2BEO A;  2RNJ A;  4OIR F;  3G3Z A;  1P4W A;  1O3S A;  2OD5 A;  4EMS A;  1Z6R A;  1B9N A;  1R58 A;  2MLG A;  1KGS A;  5A2Q K;  3HOT A;  3TQN A;  5JVT A;  3EQL F;  5LGT A;  3IHU A;  4TV7 A;  3TDU C;  1HKQ A;  1T98 A;  4EJU A;  2ISY A;  4FT8 A;  2VN2 A;  4LLL A;  5E1Z B;  1J7K A;  3WG9 A;  1K6O A;  2NRA C;  2Z33 A;  1HQC A;  3Q9S A;  4CXF A;  2VOO A;  4KIC A;  2F5C A;  3I59 A;  1NHA A;  2HTS A;  4M6Y A;  2O0Y A;  3TOB A;  4IJA A;  2H09 A;  5D4R A;  4Q48 A;  3DEU A;  3W6J B;  3O3K A;  1S3J A;  2QBY A;  1R1T A;  3WOD F;  2ZXJ A;  1U5T A;  3D0S A;  3KP5 A;  3PQK A;  4HX8 A;  3FXU A;  4G6D A;  2HGC A;  4HBL A;  2ETH A;  5KVR A;  2L02 A;  2DQR A;  1UB9 A;  2IJL A;  2P6S A;  1WQ2 A;  5D5U B;  1H9G A;  4I0A A;  4ON0 A;  1B6A A;  2F2E A;  2HQN A;  3Q9V A;  4FHT A;  1KU9 A;  3QPH A;  1XSX A;  1U5T B;  2ACJ A;  4HF1 A;  1R00 A;  1FWZ A;  3GLX A;  3WTZ A;  4UV8 A;  5CYV A;  2W57 A;  3FM5 A;  2YX4 A;  2VBY A;  1ZRD A;  1ZGA A;  5D5V B;  4OIP F;  2H27 A;  1MJ9 A;  1KYW A;  4L9T A;  4ZZD A;  1EH7 A;  2FOK A;  1SFE A;  4FX4 A;  3KP6 A;  4G6Q A;  3JAM Z;  5FB2 A;  3KET A;  1R1U A;  4QLC U;  5J8F A;  1PP8 F;  3DPT A;  4Q5S F;  2PFB A;  1YTY A;  2K27 A;  2EB7 A;  1QZZ A;  2MH2 A;  4Z2Y A;  2P7C B;  1IW7 F;  1XDS A;  1ZG3 A;  2JZY A;  2G7U A;  2PMU A;  1ZAR A;  1MDM A;  2ISZ A;  3E6M A;  3FXQ A;  2XRO A;  4Y15 A;  1BI2 A;  3RTR A;  4LMY A;  3SXY A;  3T0Y A;  2K4B A;  3FXR A;  2KRF A;  2D1V A;  4MQ9 F;  2H94 A;  2L3D A;  1GHC A;  2EFN A;  2DT5 A;  3VFZ A;  2ZNY A;  5F1R A;  1U78 A;  5FD6 A;  1IRG A;  4I0B A;  3TOA A;  3BWG A;  3CO7 C;  2YU3 A;  1MJA A;  2VBW A;  1BM9 A;  4HV6 A;  4LD5 A;  2V1D A;  1PUE E;  3ZMT A;  3LAJ A;  2GIV A;  4UVA A;  4MTD A;  4KT5 C;  3I64 A;  2EA2 A;  3HTS B;  5DCF A;  2L54 A;  1LDJ A;  4L5I A;  1QNT A;  3CJN A;  1STZ A;  1WI9 A;  5E1W A;  2XAS A;  4S04 A;  1XGO A;  3P9C A;  3JAM K;  3I71 A;  1D8K A;  2W25 A;  4BYY A;  3ERE D;  2FU4 A;  1FBU A;  3OOP A;  4RGU A;  4A5M A;  3T5X A;  3E5U A;  4U0W A;  3WTX C;  2QQ9 A;  4ESB A;  1XB4 A;  1GVJ A;  2O3F A;  3VEP A;  5J8C A;  1BC7 C;  1SD7 A;  4U7B A;  3RKW A;  1FSE A;  5CVI A;  1BIB A;  1QPM A;  3HUG A;  3E6D A;  1C0W A;  2BBY A;  5CVJ A;  5HDG A;  2DPD A;  3O2P E;  4P96 A;  3LFK A;  3BJA A;  2MH9 A;  5E8I A;  5HOO A;  1P4X A;  1HSJ A;  3HHH A;  3M8E A;  4KMU X;  5JR3 A;  1RI7 A;  5CVU A;  3BPX A;  4WX9 A;  2D2W A;  1G3W A;  1LVA A;  4GCV A;  5ICG A;  4YII A;  1J59 A;  2VOD A;  1R5G A;  5L3D A;  4EGZ A;  3EUH A;  1YW9 A;  2QWW A;  1SAX A;  5AIQ A;  1J0R A;  2AS5 F;  2OQG A;  2UWM A;  1ZRC A;  2Z99 A;  4HF2 A;  4L9N A;  2W85 A;  1G3S A;  4A0X A;  1KA8 A;  2IRF G;  5ICF A;  1IF1 A;  1P6R A;  4YIF A;  2LKP A;  1Z6T A;  2KIM A;  4OIQ F;  2M45 A;  5BPD A;  1YYV A;  5D5W B;  3HHG A;  1RIO H;  1K78 A;  1XGS A;  2DLL A;  1JHF A;  1QZY A;  2V1U A;  4P55 A;  2PMH A;  1ZH5 A;  2LSO A;  5E17 F;  1YLF A;  4RB3 C;  3DKW A;  1FP1 D;  3GVA A;  2PQ8 A;  4ENK A;  5LEJ A;  1PP7 U;  2VON A;  1YIO A;  4P5O A;  3J81 Z;  4KIB A;  3PFI A;  4HAM A;  3ML6 A;  4RAZ A;  4EJW A;  3V8K A;  3ELK A;  1QQI A;  5DYM A;  1O3R A;  5LHI A;  2DAO A;  5AIP A;  3H3Z A;  5DDG A;  2FMY A;  4GO1 A;  3GFJ A;  1Z05 A;  3K9T A;  5D5X B;  3SZP A;  1HXD A;  1FOK A;  4EGY A;  3FM3 A;  3E97 A;  4RGX A;  4HDU A;  4KFC A;  4HYE A;  5HS7 A;  3IKV A;  3F8C A;  1YQA A;  1BIA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...