1YQEA

Crystal structure of conserved protein of unknown function af0625
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
282
structure length
282
Chain Sequence
FQGHMKLVVCSESDTAGQNIKDNLLTFADFEEKDVGEFKLYLSDEFYIAETKERLIYADHIDEKLAKYIDFEEILFASRHSSKDGRKIFTVHVSGNVGTADFGGKPYSLAKPSPQTMKNYVLALRERLDRKPEFEFTMEVTHHGPSEISKPSAFYEIGSTEEEWKDREAAEVVAEAMLDAIRAEKMDWNVAVGVGGTHYAPRQTEIMLTTTFTFGHNFAKYTFEHLTAEFLVKAVKLSEAEYIIIDEKSVNSAVKKIVNEAAEVAGVEVLKSKKVKKDFRLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Conserved Hypothetical Protein AF0625
rcsb
source organism Archaeoglobus fulgidus
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical UPF0204 protein AF0625
total genus 104
structure length 282
sequence length 282
ec nomenclature ec 3.1.1.96: D-aminoacyl-tRNA deacylase.
pdb deposition date 2005-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04414 tRNA_deacylase D-aminoacyl-tRNA deacylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold AF0625-like 1yqeA02
3.40.630.50 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase AF0625-like 1yqeA01
2GFQA 1YQEA
chains in the Genus database with same CATH superfamily
5BSGA 1T9KA 5JAPA 2PKXA 3K9HA 4QD3A 5K6AC 4QGHA 1J5EB 4EG7A 1Y0BA 3TLGB 3SLKA 3TZKA 2GILA 3HXLA 5EJ6A 3Q3JB 3QSGA 3BH7A 2F3PA 2IUSA 4ZJPA 3DTVB 6PFKA 2E7ZA 1ZPDA 3LYUA 5JQGA 4M36A 5A4IS 2WU0A 2O8FB 4OC0A 2IYAA 1A98A 1CUWA 1I4TD 3ZLJA 1S8FA 2FSHA 5E6RA 4MMYB 4KIWA 3KJGA 1EA5A 4WEQA 1M2NA 4DC0A 1IQPA 5CCXA 3ZDDA 1NIJA 3A70A 2P67A 3ETEA 1XZPA 3STVA 4RKQA 4C4AA 3SEAA 4ZO4A 4NARA 4ZZ2A 4L75A 3G3EA 2ZQ5A 3GELA 4MWTA 1C0IA 1EK6A 3IEIA 1NMQA 1IMJA 1BDMA 1K6EA 3FMPB 1PDWA 5ICMA 4D8VA 3VKVA 1A04A 4F2HA 4HCJA 1U0EA 4PR0A 2P6GA 1N1MA 1F60A 1XZQA 4MGKR 1AUQA 5E3IA 3WBKA 1MG0A 1T91A 4Q6WA 1FP7A 4Y2SA 3RUPA 1Y9DA 3B6ZA 3CB4A 4HQLA 4B2YA 2C0CA 3GC6A 1VPTA 3KOMA 3QU5A 4KC0A 4ZVPA 3V48A 4DLRA 1ENZA 3HWX1 3QENA 3DDDA 2OGTA 4MQFA 5HFAA 1NQTA 1Y80A 1IHYA 1LS1A 2XNSA 3FIUA 1JXMA 3GGSA 2VUHB 3JSAA 4WD3A 2OP1A 4PF1A 2IS4A 3OWHA 1JH8A 4GYYA 1R12A 4TVBA 1L8OA 1PU2A 4DIKA 5GAJA 3OEHD 3VA7A 5IAKA 3NO4A 2IZ6A 1U8AA 4OHBA 1FLAA 3BTVA 3C14C 3F9IA 2BH2A 1AQIA 4GOKA 5I45A 1QSTA 2HPAA 3R3ZA 5KOJB 2WJJA 3PEWA 1RLTA 5BXQC 1AJEA 1U6IA 5D01A 3FZQA 1Q2XA 2NV0A 3KQTA 5ECWA 4AY3A 1B41A 3L3BA 3CZCA 5AW4A 5K0ZA 4MVJA 1Y7PA 3WLLA 1IY2A 3CMMA 5K8JB 3WGKA 1WZNA 4OIFA 3AR9A 4CM5A 1GDHA 4IMRA 4AF7A 4C5BA 2FUG1 1XFOA 4OHUA 3PEEA 2PJ1A 1PP4A 4ZV4A 3DLAA 2AOTB 3QH4A 2EVWX 3RVQA 3CVUA 3KB2A 3N2EA 3FX6A 5MN4A 5TPZD 3I12A 1MAVA 1NBIA 3PDUA 2I6FA 2FPPB 5F1KA 3CN7A 4LK3A 1ZJYA 2XVXA 3MRUA 3TBHA 4YMUA 1F51E 4N18A 3DD1A 4TXMA 4YUVA 3UFBA 1Q0RA 1Y1LA 4PGHA 4TVKA 1DZIA 4A8JA 1M44A 4W6QA 3SJFA 4GOOD 3BWDD 5K05A 3S1LA 1DEHA 3VR5A 2BTQB 4J7AA 2H08A 5DX8A 4BV2A 1E7MA 3THOA 2PRJA 2FW9A 1U0FA 2FSSA 2DOKA 1K89A 2ZJYA 1WWZA 4E33A 1J8DA 3QF4B 2NYUA 4JT8A 4PQYA 3OOHA 4BO9A 1Z6PA 4I1IA 5HIAA 4U4AA 1A7KA 2XDWA 4S1OA 5A5VA 2J5KA 2Q43A 5KSWB 1M6HA 2C2MA 2X14A 4J9UE 1B43A 2Q5IA 3GY9A 3UW1A 3ZS9A 5F9FA 3SXNA 4YWHA 3ZY2A 4BE9A 8AT1A 4ZI6A 1O4WA 2JLSA 3KHKA 4EK9A 1T1JA 2KLHA 3X1JA 4K9SA 4NU5A 3EAQA 2XMQA 3EJWA 1LDGA 3KOZA 2H2IA 1TNDA 4WERA 5DISB 3ZVKA 1M7BA 5D1HA 1ND5A 4V0KA 3IEVA 3B82A 3TKLA 4C43A 4FI3C 6GPBA 5FRDA 1X39A 4UW9A 3UBTA 2VJLA 2PX3A 4KIUA 5A7HA 4BWGA 2NSYA 3OPQA 1KH2A 4I1OA 5FR2A 4GRIA 3R74A 2PJ0A 2IYNA 1YB7A 1KAGA 2UZIR 5CXQA 3BCUA 2ZW6A 3AEXA 1W73A 2EATA 5F64A 1YOVA 2WYWA 4ZU3A 2B4DB 4GS5A 1CY1A 3IKMB 1YZUA 5C0OE 1PTKA 3CSDA 5D00A 3UWSA 4EW6A 4LZNA 2P8JA 5CDSA 1HQKA 1W19A 5IF3A 2VT2A 3AF3A 3T7RA 5L95A 3U09A 2WQ7A 3ERCA 5K0CA 4MCJA 2ADFA 2D4AA 1U99A 4I1YA 3AEQB 5J9FA 4D4HA 4N8DA 3T9CA 1MDFA 2WJHA 4ZICA 4FYJA 2C98A 3RVOA 2VDVE 4D0LB 1NLMA 4L8YA 4M6HA 1MP0A 2VXCA 1QYXA 2HMTA 5AI6A 4OO3A 1A27A 1NVAA 4FN5A 2BZGA 3I92A 2QGFA 1CRQA 4GOND 3BMCB 4L95C 1RQNA 4G6ZA 4J0IA 1R0ZA 1GKUB 3CO0S 1WNTA 4A0RA 2A9OA 4FMBB 1WZCA 4MV5A 4QVKA 1XNGA 2ZKIA 2HV2A 4DNXA 5IW8A 4I46A 2Q2NA 2V65A 1JDSA 2C3PA 3EXIA 1BS9A 1W0CA 4MR8B 1PDVA 5CFRA 1ZVJA 5L4SA 3LACA 2QN9A 3CR7A 2VBCA 5GVRA 2G1AA 3IA2A 2OFXA 2NQ8A 5IS2A 2SNIE 4RH1A 4WLVA 4MEAA 2OZGA 3JQ8B 2EYQA 2VAPA 2WHRA 3GIDA 3M7IA 4EW3A 5F77A 3KU4A 4PPZA 1JFFA 2ECFA 2BJVA 2PZLA 4C2ZA 4TYPA 5GJCA 2J3JA 4JI2B 2C7VA 4IWYA 4UVDA 3HJFA 4LC9A 2P9GA 5SZIA 1IEXA 1LPAB 3T7TA 4GMFA 4EFMA 2V4UA 2ZJ4A 3BRCA 3UGQA 3L93A 4V24A 2VZYA 2QG9A 2BGUA 2G0AA 3F97A 1E6EA 2VAVA 2GNAA 3C2QA 3OT5A 3R7DA 3UK0A 2BCJQ 1US8A 4IEIA 4WGFA 4RY9A 2OXIA 1PJTA 2WFMA 1KKUA 1RTTA 3KQLA 3JARB 4URXR 4UQOA 3P7MA 4CNBA 3B1WA 3W8EA 1T8PA 2REOA 4UZSA 4EFKA 4X2TA 2HU2A 5EP3A 2FNAA 3GVXA 3MTDA 4Q66C 1G3IA 3Q7EA 2MINB 3MAGA 2OMKA 4K6GA 3O1LA 1XZGA 4Q01A 4YJGA 4EA8A 1GPDG 2HGZA 3A4LA 3NIBA 1XJOA 3E2MA 3LC0A 2C1CA 1IZZA 2IT1A 3F4BA 2E9SA 4IQFA 3T61A 3UB4A 4ZCRA 4OVKA 5KPJA 3TO7A 3KVRA 3CMCO 2XR1A 3FBWA 1VBMA 2VZZA 4HDNB 1V1MA 4G67A 2GA8A 5LRKA 1O96A 2G40A 2W8ZA 1W2WB 1NUAA 2X5KO 1T13A 2VZ0A 3DVQX 3FKJA 2O3UA 4G5QA 4HNHA 9MHTA 4QGSA 1JPNA 2BBSA 3BAZA 4HYTA 4AMUA 4E08A 3MGDA 3GF4A 1IHPA 3W5IA 2YX1A 3HZRA 4WW0A 4IDQA 3SNHA 3CS3A 3VO2A 4QEDA 4DFDA 4E1VA 2XOKD 2EO8A 1DC8A 3P2HA 2JLZA 2QE6A 3CUEF 2ATEA 4P22A 1O1YA 2JCBA 3GBPA 3HFRA 3QUAA 4L6CA 4OTZA 1A4UA 4J0DA 1I3CA 3A0RB 2GKSA 3D67A 1J97A 5D7NA 3ZDZB 4ZZ3A 3WA7A 3AXSA 1J2UA 1N7HA 3PRKE 3WNCA 3AJAA 9LDBA 2Z43A 4PANA 5EAIA 3D4UA 2DXIA 3VYWA 3VMMA 4PYOA 5H7XA 3CIFA 2WE7A 1CYEA 2W8BA 5AW9A 2R1UA 3PXAA 1O4VA 3OG9A 2EKDA 4X92A 3FY4A 1A82A 1T36A 2BVNA 2HJVA 2IYYA 4CQMD 1E60A 2RI6A 2FE7A 4CM8A 3PQ7A 2E5LB 2C94A 1A9XB 4RD4A 1FUUA 5D3ZA 3OE1A 1Z5VA 1XCMA 2CEAA 2H1HA 1CVRA 2XKBA 4ER3A 1G1AA 1Y8CA 3DVRX 3FIJA 4QRHA 5I4KA 1DT3A 4QVIA 3WNZA 5K03A 3THYA 1FY2A 2D1SA 2XCUA 3ZU3A 2GEVA 1PNRA 4MI1A 2QJRA 4C0LA 1KSFX 3SNKA 3O8NA 3TLAA 4D6YA 1SVSA 2G72A 4YFJA 3H1BA 1Y1KE 2PZ8A 3DO5A 2QUZA 4LOHA 2ZXFA 3WLJA 1KQFA 2HWKA 5FOWA 4MVJF 1RU3A 1QHFA 4E0BA 5L40A 3A6ZA 5T4EA 4DXDA 3GDOA 4QULA 2GK4A 1Y1RA 1MDBA 2QGNA 3GLQA 5EE5B 3TIGA 5BY2A 1GU7A 4FFMA 2PE5A 5AVJA 4TWRA 3PB9X 4UF4A 2IYLD 3NIFB 1MB2A 1MV8A 4TTQA 2Q5EA 5D5HA 5DNAA 4XLZA 3ZU4A 3QLVC 1J1IA 3GFBA 1M2GA 3W5HA 4Y67A 1U9ZA 5M34A 4ZQCB 3D4BA 3F1KA 3RFCA 3UT0A 4AMBA 4ZX9A 1E6UA 3OC6A 1LRKA 3M9WA 1AUXA 2Z1MA 1YVDA 2YNMA 2HJSA 1AB5A 2APJA 2P40A 1J99A 3ZCUA 3DLTA 5I7VA 2ZUFA 4U7PB 4XGNA 4EH1A 4M3SA 2OHXA 4E2YA 2ZUBA 3A26A 4GSYA 1RQRA 3RABA 3U16A 2OCPA 4F5WA 1P77A 2GD6A 1ICEA 2WG2A 2HQOA 2E4ZA 3M6LA 3VZRA 1QB7A 1MKYA 2NXCA 4FFDA 1GADO 3UMGA 1T8UA 3C26A 1X8KA 4Y2UA 1U2SA 2XUOA 3RIEA 3RYIB 5B7NA 5JRDS 1ECPA 5K0FA 5DT9A 1E7SA 4C6RA 1BGXT 2EF0A 5IM4F 2EYUA 1EZ4A 2OXRA 4XARA 1W4LA 1FDOA 1FFCA 3ZH2A 1Y37A 1QYRA 2GJKA 4RJLA 2AD5A 2HCTA 1MJAA 2QTVB 2CNTA 1JYSA 3LWUA 4PWYA 4LQGA 4EJ6A 4XWKA 1F4LA 3H3XA 3U9SA 5C7LO 3UPUA 5G02A 1IVSA 3WYFA 4FD5A 3GCXA 1AKUA 1QFZA 2BM0A 2PU7A 3MG9A 4NHOA 1E1QD 3T9DA 2FLWA 4NBUA 3AR8A 4ZVOA 2QTNA 5CBKA 1PJZA 1I9GA 1LLFA 4Q3AA 4V03A 1JDPA 4FR0A 4AFNA 4YRLA 1SUAA 1HYHA 3LT2A 4L4ZA 1PV4A 1OI2A 2YC2C 1IM8A 2X3FA 4JXKA 1JN0A 4CYMA 4ER7A 5AKJA 1DUSA 1GV0A 4O2RA 4Q4CA 4PGGA 4CGNA 1RE0A 4LKOA 4Z2YA 2RHMA 1KYQA 2ARKA 1P9NA 3ROQA 4H17A 4PQGA 5FADA 4V0QA 2YOHA 3NWJA 3TQOA 4DBLC 5C8ZA 2AMLA 3UJHA 2JJYA 3ENNA 1NF2A 3CPEA 4KQIA 5AVKA 4JVLA 5IHPA 5DWQA 3FTEA 4HNWB 3GAAA 5FJIA 3N2YA 5DF1A 2CCKA 1Y4AE 5HKOA 2R98A 2QYHA 3RT7A 5L3RA 4FOPA 1ESCA 3PC3A 3KCNA 3TF5A 1GUFA 1ZCFA 3ZLBA 1RM3A 1NW7A 2XMCA 3BSWA 2IRWA 2X0IA 3GUVA 2XVAA 2VDPB 1ULSA 2ESRA 3DT9A 3FWNA 1EG7A 3AFOA 1YLEA 1JJAA 2B7CA 2J07A 3AJRA 4P33A 2PZGA 1JFFB 3PB3A 1F14A 3M6XA 4XNHC 4EB0A 3JQ9A 3H11A 1RWWA 2P2SA 3AHGA 5E9WA 3REQB 3LBNA 2B30A 4ZPXA 3T8WA 4Q1BA 1OI3A 3PZBA 1BPNA 1FS4A 2WAMA 3L7JA 1G19A 1FEZA 1AKQA 1KI6B 1E9AA 2O2ZA 1NN3A 2W6JA 4MWSA 5AM4A 5EJMA 1EZ1A 3QFSA 3Q12A 4OYHA 2A0KA 2ZITA 1MC4A 4WZ6A 5ALEA 5A5DA 3CR8A 3F1LA 4BZZA 2DKFA 1JIKA 2QTBA 1F38A 2O0LA 3DF7A 1R64A 3JARA 4UNSA 2PIDA 3OZRA 3PP8A 4BYGA 4LIPD 3SC2B 4CYQA 4QQNA 1ZXBA 2QHXA 5E9QA 2NW6A 5B64A 1EJ2A 2AMYA 2H1IA 4LV5B 4RF4A 3O7WA 4ROSA 1CRLA 3STUA 2GAIA 4REOA 4A15A 4PRYA 2O53A 1D1QA 1Y3FE 2HY7A 4D98A 2VDUE 1CUCA 1Z6YA 1Z3CA 2VT7A 3GH1A 4JMPA 1Z0SA 4EGSA 1Q15A 4LWOA 4OFWA 4HOYA 3I53A 4WMLA 2PX6A 4N7JA 4JGIA 3UJNA 2JHCA 2Y0MA 1GQSA 3GLGE 4NEQA 1X14A 2JDCA 2R84A 3UHOA 1EX6A 2WYRA 4BS9A 4QICA 1MENA 3QXHA 3IQHX 3L1HA 3O03A 4FKBA 1FPMA 4XD7D 4IZOA 4WEOA 2YV5A 1J7KA 1XRJA 3CNNA 4IEFB 1GU1A 1I0LA 3IP3A 1GZ3A 3FH0A 3G5AA 2JIBA 3AHEA 3WLRA 1AM4D 3PFHA 1Y9JA 1N78A 3A6FA 3INTA 1P7CA 2FQYA 1K8ZB 4OKIA 2EQAA 3AONB 5JPIA 4D0SA 1E2DA 2R6FA 5AI5A 3OIWA 3VYTB 4W8HA 2MCFA 1NVFA 5BNZA 5BN4B 1OX6A 2QE7A 3HY4A 4KXUA 4J16A 3HHEA 3KQPA 3VOBA 4X64B 4BNJA 1CJTC 1PU9A 2QE7D 3RK0A 1RVV1 5KJFA 3PZJA 5JZMA 1P2FA 2X1LA 3HCEA 3OHMA 1W47A 2J6IA 2PZEA 2VQSA 3I6MA 4RXMA 4TL9A 4ZRMA 4MR7A 1IDOA 3N2ZB 4M1EA 1W581 5ELLA 1A9XA 2AFHE 5E7IA 2FWMX 3PJDA 1SHJA 1FRFS 3QELA 5CCDA 4S3MA 2IY8A 4DZTA 5EIEA 4JOQA 2R1IA 1J4AA 4WBXC 1GCUA 3CPSA 2BONA 1MEEA 4MCHA 2NADA 2JGFA 4AS3A 1MW8X 2P9TA 3DMTA 4ZT5A 4MFJA 4ETMA 1L4HA 4YRAA 1RZVA 2CXPA 1EPUA 4BO7A 1K7EB 3AUTA 5KQMA 5TLSA 2IEAA 5FNVA 3OKCA 2BFFA 4CTJA 2J08A 3R4CA 4NL4H 1EFCA 2IYOA 3D7SA 4CDGA 1V4VA 4OU4A 4EJFA 2HBQA 4HQNA 2Q0YA 1PT6A 3L8ZA 1BXGB 1CS4C 1ULHA 3S6GA 1EKXA 1E20A 2DH5A 5FULA 1GYQA 2Y2UA 2F1JA 3IWWA 1C30B 4MRMA 2QN1A 5I9MA 2CL6X 2QSYA 2B3UA 1AMUA 4D26A 2F7SA 1XMTA 4LK2A 4V0ME 4DM3A 1R50A 5EJGA 1BS2A 1NUHA 1R9GA 2KE5A 1GOTA 2Z2KA 4ER6A 4R7ZA 3K6SA 2CNKA 2I4IA 3GLUA 1HE5A 1TZCA 2ODBA 3DHVA 3O93A 2ZWPA 4EI2A 4KI0A 3VX4A 4GRDA 1DIGA 1IRXA 4RPHA 2JFWA 4MPJA 1FP1D 1NRXA 4F97A 5JH7A 4L0QA 2LDBA 1RC0A 4QNRA 1PQUA 3FPCA 1DS6A 1XELA 3OCVA 5AW5A 4KCGA 2WBLC 3E3NA 1M8FA 3TQQA 4MA5A 4XDGA 3II6X 1GGHA 2VK4A 3NHWA 1OH5A 3L7NA 4MV9A 2Q6LA 1UINA 4LXXA 4R71A 4LECA 1H0HA 2W48A 3W06A 4IRMA 3V1YA 1GN8A 2PVPA 3VC1A 5I7OA 1E5QA 3LUJA 4LWQA 4WESB 5TXGA 1WXGA 1A7JA 4TYMA 1QLJA 1J33A 2SHKA 2YIMA 2YFYA 3OM9A 4OBBA 1UKZA 1P61B 4LYGA 1MGOA 2KBFA 3UW3A 4ZMRA 1EIWA 2OCKA 1U1EA 1WF6A 2R79A 3K32A 5LXTF 1RTKA 3ADCA 3DJFA 3ZVRA 2XWQA 1Z6QA 5ALZA 1H6AA 4EYSA 2DUMA 3VVCA 4GNKA 3TTHA 3HFSA 1J1UA 4P82A 3PNSA 4JA0A 1SVWA 4W6ZA 3EPLA 1I9CA 3DOFA 3ZDFA 3BDVA 1S2LA 5C1IA 3RC3A 4M7WA 2P91A 4RHUA 5AJZA 2JIOA 1NULA 1YRLA 1NSLA 2WIFA 2WIKA 3JVDA 1FQOA 4YREA 3KLNA 3QU9A 1PTJA 1HFKA 2JKVA 3DXXA 4G1BA 4GZMA 2GN0A 4UUQA 4YH1A 3VPGA 2QGZA 4R81A 1PF7E 1H0KA 2GJSA 1JLLB 1WMDA 3H65A 4RZIA 4DPMA 3RUDA 3W4JA 1TUIA 5FL3A 1YCFA 4BNMA 8ATCA 1TIPA 3FCXA 3N5FA 4P5PA 3EZGA 4DXAA 2HXGA 3UT5B 1XQ6A 4BMSA 5IV0A 2C3YA 1UWYA 1JDBC 4KORA 3D2PA 4YV2A 1BGWA 4HEJA 1GTRA 2OCXA 4ENSA 3TL3A 4NYJR 1KO8A 5AI0A 4MUYA 1W44A 5JWOA 4KOTA 4PSXA 1J22A 1XCPA 2FPSA 3T3NA 4H16A 1WLSA 4PV7A 3VPHA 1WXQA 1SHLA 3MYYA 4TSKA 4E94A 3LPNA 1EWRA 3R4VA 2PKQP 1CQIA 1N32B 3DR3A 3ZTTA 1G8GA 4D0NA 2AEEA 3D6FA 4HPXB 5TQ2A 3ND5A 2XQFA 5JAZA 1P73A 2XAAA 1KZ9A 2DLNA 4CMGA 3RS0A 4BQEA 2XSZA 1EFAA 2ZS8A 2XEIA 5L45A 1A2KC 4QUHA 5BN1A 3RYFA 1APBA 4MV3A 1GFZA 2B3DA 3EY5A 3WNVA 4H6PA 3N86A 2ID7A 3IRUA 4IIBA 3FPHA 1P2DA 2VPXA 5ULLA 1SD2A 1U6JA 1R6DA 1JT2A 3TLMA 1NE9A 3M9XA 1V9LA 3S6KA 2Z58A 5IDYA 5A4FS 2WJ3A 5JS2A 2V0GA 4FE4A 4LMAA 1QMUA 1LBSA 4JVSB 1Q7CA 3LRTA 2CJXA 3L2NA 5FR1A 5ALTA 2G9RA 3I45A 4YCCA 4QATA 1DMRA 2Q1TA 4MARA 5KHAA 5T8KA 3RC1A 4HAIA 1HY3A 1RHMA 1OTXA 1NI4A 1SOUA 2DQSA 3E22A 1G8KA 5I9BA 4AKSA 4W5OA 2ICAA 2E1PA 4TTPA 4R8VA 3GA5A 4HFNA 3TOCA 2RFHA 1M6YA 1K08A 3DAYA 1VE9A 1WHTA 3P1JA 1YS1X 4M87A 5H0IA 4UDOA 2AJ6A 4NBNA 2W6CX 4KOEC 1T4CA 3MJRA 5BWMA 3OQNA 1R74A 2E55A 1JA1A 1YD7A 1V11B 3G9XA 1ZNZA 4C2TA 1JZQA 4KJZA 2XX3A 3L0ZA 2XTJA 5EKUA 1E4YA 3ZJ4A 1Y5MA 3PHHA 2I87A 2OLJA 4JFRA 3SOZA 2XE7A 2FRDC 4MFPA 4LJ9A 4TTAA 4CM4A 4UCMA 5CPFA 3G49A 5AKEA 5DM2A 5CFZA 4U2GA 2NUTA 1QE0A 3IUMA 4XOIA 4CF4A 5KYXA 3PWTA 2AR9A 3CXSA 1C1YA 2CXNA 2QTFA 2RI0A 3FWZA 1KOFA 1QGOA 5HSGA 4RDXA 2XNHA 3L5OA 4FZJA 3MWJA 2H54A 1VTKA 1GTSA 1QU2A 1JQDA 3T3OA 3K92A 4RF5A 5CPAA 1N5DA 2NZUG 3BILA 3EZYA 1KDPA 2DECA 3ESXA 4S05A 4JYWA 4GVXA 4XGKA 1U9JA 1ZRHA 1XTJA 4A5OA 4I3HA 2VQYA 3QU7A 4KNVA 4WJBA 3SZ3A 5IJ9A 2FT0A 1TXGA 1JAYA 2FE1A 4I1UA 2YIDA 4D3ZA 3FOWA 1FYEA 2E6UX 2XCRB 4O29A 5GWXA 1XDGA 2I54A 3BTUA 3ED1A 4WE3A 3SDZA 4CLOB 1GAEO 4DPKA 1HEIA 2OEPA 2XYGA 3PFCA 1Y63A 2PT5A 2ZCVA 3JPWA 3ZVLA 1S7KA 1AVTA 3UGJA 3ZHVA 1X94A 3RC2A 1O03A 1ZG8A 1CEQA 4ZALA 1KFBB 2BFDB 1RLUA 3TOZA 1SIWA 4BAUA 4F9FA 3UHPA 3B3VA 1G5TA 1DJOA 2PSFA 4AJHA 2CXUA 5ENDA 1DJQA 1OMOA 1EIZA 1I51A 4N48A 1X0XA 4JSYA 3VARA 1XVUA 1Y1SA 4OL0A 2I8AA 4D3DA 3U13A 3G8AA 1E2KA 1ZMRA 4HWGA 5JJLA 2CJYA 3PUVA 5GZ6A 3JU3A 4LDRA 2OK7A 4F91B 3BWCA 4X6XA 3PGKA 3UWDA 2QZSA 4DCPA 3I3GA 1I10A 4ZEWA 4UULA 4ZC1A 1KGDA 3S27A 4DV4B 1VLJA 4IP0A 3HNPA 1G3QA 3BC1A 1B8OA 1NNUA 2OCYC 3DZKA 1BHO1 2FSUA 2G9ZA 4PLZA 3T0FA 5A4JA 1ZJJA 5AHKA 1I5RA 2PYDA 4EBFA 2V8DA 3O7MA 5F49A 2XYQA 4I6JA 3DD5A 4YAWA 1MF7A 2V96A 1ISHA 3O0DA 4U3JB 5H82A 3UJDA 4D8TA 3GLFE 2C6CA 1TYDE 3CKKA 2UZ1A 1RQGA 4OQFA 1VG1A 3UOGA 2GERA 2NU9A 3IS3A 3R0ZA 1FX0B 4JKYA 2LIPA 2HA5A 3BRQA 1DXHA 1RWKA 1RBYA 1YXMA 2PWBA 1P9LA 3RVLA 1M2HA 4XWWA 2YXLA 4E5SA 1EJ6A 1P2BA 1TJPB 2ZIGA 1ZD2P 4C78A 2C2WA 1NBEA 1GFSA 3FECA 1DRVA 1KR2A 1ULAA 3NOXA 5F78A 2C31A 5T64A 5CUQA 2ZS7A 2EX4A 1R8YA 4H59A 3H5OA 2R6CA 1WU7A 3VZCA 2Q8QA 2ZRNA 2HGSA 3AOEA 3RU9A 4FFPA 5CBPB 2PJRA 4H1WA 1Z07A 4EY7A 2AN4A 1CP2A 1EX1A 2DU8A 2PRKA 2BEIA 2Y1DA 4Z65A 3LXRA 2J5QA 4JA2A 3RLIA 1DQZA 2HTEA 2OCDA 4XJVA 5ERXA 5GVSA 1VLLA 3KBOA 3FHOA 3H9UA 4KO1S 4UUNA 2AJ8A 2FK8A 3QI7A 3W04A 1KEPA 2EFDB 5FQOA 1HKUA 2VWPA 2IFTA 2YRWA 1YI8A 3H2HA 3MA0A 4TS3A 5E6UA 4I1SA 3IEKA 4DRXB 3JQ7B 1ZSVA 1AY0A 1BA2A 1C4XA 1QIJA 1NURA 2H29A 1PWYE 4DR7B 2E4AA 5BUSA 4A94A 2PZAA 1A5AB 4HR7A 2GPNA 4LGMA 1RAGA 2PK3A 2AUTA 2R6ZA 3AI7A 4OK3A 3ADBA 3F78A 2J7PA 2KBEA 2VS1A 3D2CA 2G25A 4I5EA 1E5XA 1RKVA 7ADHA 2O8EA 4US2R 4NBRA 4JKIA 2VH1A 4FUTA 1W36B 3K4QA 4C5AA 1U80A 4BNZA 4KP7A 4PCAA 1UDBA 1QHEA 2B7LA 1CZKA 1N57A 3MYRA 3U7JA 4KQGA 5BVGA 1CUGA 1SKMA 1DX4A 3UNXA 1LDNA 1WULS 1J2YA 1ISMA 2VUSA 4QUDA 3RODA 1NBAA 3JQPA 3ZWXA 1XTIA 1DP4A 2XV1A 1QUFA 1RP7A 5EMJA 1LLDA 2FZ4A 5SYAA 5K2MA 5HZGA 1GNRA 1GSAA 1EEXB 3EIHA 3RUAA 2YYAA 4RTOA 3CXQA 1SBZA 4I19A 4IVNA 1VKJA 1JKFA 2B2NA 1JG7A 1QIFA 3FNRA 1P3JA 3HKDB 3OPYI 4FCVA 3LO8A 1Q3TA 5EESA 2DPXA 1J5XA 3SXOA 3TTYA 3OBIA 3FE2A 4KO3S 2XGGA 4U5YA 5G21A 1GAQA 3ZHXA 1V0CA 2PQ6A 2HK9A 2MSWA 4IZHA 4HRYA 4TS1A 4F12A 5HTOA 4KVOE 4M6WA 5CDFE 4F2DA 1L0BA 1Z18A 1RRCA 1NFRA 4OLBA 4BX2A 1T1SA 3C8MA 1G38A 4TRMA 1NMTA 4XPLA 3WWPA 3GA7A 4WFIA 3SEZA 1N3BA 3BZUA 2PFSA 2FA9A 4V39A 4B8ZA 5IAEA 1OZAA 4AZ0A 3ZD6A 2AN1A 2XMDA 4ZYXA 2Z6QA 1VIAA 4B6SA 3EYWA 2JGNA 1RPNA 2GN8A 3BDAA 3SYNA 3ZHUA 3CRW1 2FGJA 2IZZA 2FFJA 3HM2A 4G0UA 3DT8A 1ZI9A 1R88A 5IEBA 1OROA 3AC0A 4UM5A 2VNSA 5J3JA 5BWCA 3FVLA 3LODA 1U8EA 1DEKA 2Q3DA 2YW9A 4MHOA 3O8OB 3RF6A 1JQ3A 2ZYAA 1Y6GA 2KI5A 3ND8A 3K9UA 2C9MA 1U7DA 4C7IA 2P2CA 2VWGA 4RIFA 3MW8A 1B1AA 1WB4A 1PUJA 3E9CA 3GQVA 4YCAA 4EPWA 1XC7A 4KOVA 3ZD7A 1IHUA 1H2ZA 3MVEA 3SJUA 4J9VA 1TKRA 2QX6A 3AEUA 2WAAA 4C4YA 1B87A 1USGA 3ND9A 3BIOA 3V2HA 3VV2A 1JECA 4ETNA 4Z4CA 4EYQA 3C3WA 2ZAMA 5FNVB 4OLAA 2BT4A 1V11A 1UOOA 4PG4A 1QGYA 1GNPA 2CMHA 1R18A 2JGKA 3GT3A 1M1ZA 1VA4A 3GJYA 2NG1A 3IUSA 1P7WA 1G8FA 1YBMA 1ZESA 1RZ3A 3U3XA 4P4BA 3EFBA 1Y89A 1UBUS 1NE2A 2O3JA 3OZUA 4YDQA 3NIWA 3ZK7A 2NUTB 4R7TA 1SZCA 1VLHA 4OC2A 1I7SB 1WXDA 4XYGA 1WEHA 3JQAB 3WHKA 1FBNA 4TKUA 1G60A 4M54A 3SS7X 2FMUA 3HNOA 1U8XX 2GAJA 3CTMA 4R1NA 2QRKA 4PS0A 1LD3A 1K7YA 3WWEA 1VYVA 2XNKA 2AYZA 4DZRA 4PSCA 1U0LA 3F90A 3V2GA 2FP4A 2J46A 2I33A 3DVAB 1AMNA 2R4UA 4M0MA 4R9VA 1WABA 5AKHA 4X24A 1UKAA 5HF6A 4MQEB 3ZGXA 5AVZA 4QECA 3B1ZA 2XKKA 2NMTA 3PFOA 1N6HA 2DHEA 2Q3MA 1VMIA 2QZPA 5H4GA 1UPXA 4BUCA 1I7QB 4IIJB 4BUZA 1HT2E 4KAJA 4IF5A 4J16C 5FTJA 3A7DA 3NH4A 2JBHA 1YKFA 2D4OA 3NWEA 4Y8VA 5HIJA 1ZG3A 4BO8A 2XCIA 3EQ2A 4U02A 5I8ZA 5AYVA 1WDLA 2Q4YA 2XF8A 4AQDA 1YJBA 1VE1A 1TT5B 2YMLA 9LDTA 2HLDD 1R0CA 1WDMA 3CM0A 2QLLA 4DAEA 4HS4A 3P27A 1QYWA 5KOYA 4A26A 3BUSA 4GPTA 2AEFA 3B1FA 1AN9A 3UXYA 3FYUC 4C03A 1BD4A 3R5XA 4AVCA 5A0VA 4L0MA 3TI9A 2J9FA 2BZSA 1JLHA 4E2ZA 1Z7GA 4OP4A 3PWKA 3D81A 1PFUA 1RS0A 4DLNA 2PIZA 4GGMX 5LZ8A 1TAUA 3PNYA 1CPYA 4EPRA 3KR2A 3KZOA 4MIOA 2EFJA 2JL1A 3EXG2 4NE2A 4H1VA 2WUVA 3MBIA 1JVBA 2I1VB 4L4XA 2VP6A 1A71A 2AC7A 1UODA 3INGA 1IHXA 3VBCA 3WGNA 2ZYVX 1UIRA 2WTAA 5FLKA 4CF3A 1JSRA 4PSWA 3FPAA 4TM8A 3D68A 5LJLA 1RQPA 3HU5A 3I09A 3GEGA 4DYVA 3GJ5A 1FP4B 1G7RA 4FLFA 4GUAA 3BL5A 2X41A 3ABQB 2OECA 2PBZA 3PDWA 3TRFA 4I1PA 1B16A 1LXCA 1KU6A 1TAGA 2ZYTX 4MCIA 4YRKA 3ICQB 1DQYA 1QBKC 2O14A 2DSTA 4GPIB 2JEWA 4KQ6A 2C9CA 4MCSA 1EP3B 1QJCA 2CUKA 1P45A 1DKMA 4C7OB 4B2LA 5A5GA 1MRSA 1VBNA 1R5NA 1TC1A 1DU4A 4H7FA 1P6QA 1E79D 2WJZB 4B4KA 1E1RA 2GSWA 3JYHA 4IY1A 1CC1S 3EY9A 1P9WA 3NGLA 2QIOA 1VCHA 2QQ0A 3AW9A 2GBPA 3F5SA 3KZKA 3TMYA 5JQGB 5DLEA 1QK4A 4XE5A 5I8WA 3RZAA 4IX1A 1SUPA 4QFCA 4Y9UA 4O4LA 3DR8A 2FUCA 5JNUA 1IBLB 2WFAA 1FYFA 1KJZA 5HM6A 3K9LA 4LMBA 3BERA 5E6RB 5L3ZA 1KVRA 2OMEA 3ER8A 1N9GA 2HA2A 2NWQA 3RFUA 4FMDF 3B3CA 3HZZA 3C6XA 4JC5A 2KW5A 3N2GB 4I5DA 2GAAA 5E3JA 3CZ9A 3RWMB 1BCSA 2AGVA 4HH1A 4IDHA 1PV2A 5E0KB 3OFSA 2Q9CA 5KAPA 5TJHA 5TR9A 1P6UA 3GU3A 3E8MA 4CGZA 4PZ0A 3BMQB 3I42A 4IGIA 4QGGA 2D54A 1JEYB 1VQ1A 5KYWA 4R7MA 4UCNA 1LFWA 2D0DA 2AFHB 1ZJ6A 4CLDA 1KDOA 1DXOA 5IZCC 2IPXA 3OE4A 5LD2C 3H3JA 4BLTA 2CKMA 3SI1A 1PJBA 2ZEPA 1DEAA 4C0QC 1FRQA 4XVQA 1WHSA 3IAS1 1JIJA 5JJ5A 2DXQA 5F48A 4HEA6 1L4EA 4BQFA 5HCUA 3PA8A 2ONZA 1W5TA 3GRUA 1VPLA 4XEUA 2PNFA 2W43A 4MIEA 5FLEX 5HDBB 1QR2A 3DW3X 3GGJA 1IBKB 1XA3A 3HKDA 4KBFA 1U6MA 1SG0A 1Q57A 4FIDA 1VL8A 1E3EA 4EDFA 3KETA 3TOBA 2NVOA 1KO4A 3I2YX 5DM0A 3SSNA 2M6SA 2VCYA 2J4DA 4B9AA 1FFGA 3HA7A 3EF1A 4WJZA 2YXNA 4PLGA 3VNRA 1NHGA 2EQ5A 1AO3A 2PUEA 3NHLA 3TIIA 2ZYIA 4GH5A 4R83A 4HNTA 2AFSA 1EINA 4NCJA 2OG2A 4YMLA 4PQRA 2AQ8A 4X94A 5SZHB 4C7JA 3REOA 3I9JA 2EGHA 1IQUA 3MFYA 4JVMA 1XPUA 1DRKA 3H5TA 4P2GA 5CT9A 4FSXA 4JBIA 3AFNA 4MFLA 2XRMA 1ZQ9A 1E79A 1N6IA 2O5VA 5KYUA 3D8UA 5IABA 5AUOB 5FBQB 4NK4A 4BNHA 3T1VA 2AN3A 4EKYA 4JBNA 4IJVA 2O8BA 4ZY1A 1YJXA 2CYCA 1ENPA 4H1TA 4MB2A 1DEOA 3DCYA 1NQOA 5ESDA 5K3CA 1GRQA 4F4JA 2AYYA 4P4GA 2QF7A 3OF3A 2HK6A 2Q7OE 4LY6A 4YCMA 3TRKA 5HVHA 5LVAA 1KYZA 3A1FA 4AB7A 3KV3O 5CHEA 4MK4A 1TI7A 2NZXA 2XT9A 1FW6A 2FQ1A 2PO7A 4RF2A 2GXQA 3A05A 5EY5B 1YA8A 4MVJH 2DT8A 3X2FA 4JUAA 1HM5A 1FQWA 2M9MA 1OB5A 7YASA 3FYSA 3MJFA 3OX1A 4JWPA 3OUTA 3P5SA 1R10A 2PX0A 3PGPA 1L3CA 1KEEB 2FJ0A 4YB8A 4AJNA 3ET5A 3I9SA 4RA9A 2HV8A 5JAUA 2BBTA 2HMWA 3PNQA 1JU4A 1R1DA 4ALKA 1U11A 1C8VB 1R0KA 2V98A 3JVUA 5FAKA 3HRKA 1UPTA 1CLEA 5CA0F 2GZHA 3C97A 4ZD6A 1PZMA 3ELDA 5FFMA 3DHNA 2BM9A 3EVFA 4UM7A 1UEJA 4CFYA 3D1LA 3B70A 4AMVA 2OD2A 4DDVA 4RD0A 3GI1A 5REQB 2V0CA 1Z6ZA 2X3UA 3RNOA 3VH3A 1FX0A 3MS2A 2I4LA 3PENA 4EATA 5LMCA 2J3HA 1E2GA 4PPYA 3X1WA 4TN5A 1KEUA 4BX9A 1XPOA 4FS8A 1XRPA 2A1TR 2IW1A 4LMPA 4EHHA 3O4GA 2POCA 4QDZA 2ZE7A 3IEUA 4A4DA 4ZIRB 2VTBA 3GIUA 4FD7A 3IQZA 2DQKA 3DWGA 2PUGA 4J7UA 5F12A 1WETA 2OKCA 2VJAA 3O47A 4MGHA 3ZHCA 3KPJA 1LFDB 1KYIA 4QDTA 5DS0A 4OMEA 4ATNA 4JD5A 4EI7A 3B1JA 4PYIA 5DHUA 1RCUA 4NE9A 5DXAA 2BW0A 1AUOA 2ECPA 4IVQA 1X12A 2GARA 3DE7X 1GNTA 1U04A 1UXGA 4H6UA 2GBLC 1T6NA 3UHFA 1X9IA 1Z8WA 3VDQA 2AJLI 2J3MA 4XIIA 1EFRD 4M9UA 3PDJA 5DPMA 1J25A 5ECDA 3TRDA 4BMPB 5BWBA 3BWXA 2PHZA 1MEJA 2Q6OA 3K0HA 4I9GA 4WXPA 5L9AA 1GVHA 2AOWA 2X5NA 5CGQB 3WQRA 2RG1A 2VKQA 5ALXA 4DCSA 5B3KA 3RYCA 2CXAA 1ZCJA 3VH9A 3CE9A 2AE2A 3KYIB 4I50F 2VK2A 4KDEA 3MUOA 4M2LA 5A4KA 3DC7A 4NJMA 3BWYA 3BD8A 3RC7A 2OWDA 3ZZNA 1DIBA 1GUAA 4H0CA 1W49A 1JR3D 2A9QA 2IOFK 3CRRA 2ZEGA 1ZMOA 2QD5A 4CPDA 4RCVA 3BGOS 5LYFA 3MPOA 5FWYA 3IELA 4A6DA 1ORVA 2QXUA 3RLFA 2QMEA 3WSVA 2I7XA 2J85A 2ODNA 2Z8YM 1SVUA 3H97A 2YHSA 2GXSA 3RUEA 1XAJA 4HQ0A 4FR5A 1ODTC 2ZRKA 2OHJA 2HRZA 2HA6A 2QQGA 3L4BA 2XE4A 3QLVA 4YMTA 2R86A 4O2BA 4KZPA 3OZTA 4S35A 3WFZA 2BSQA 5EIBC 3HWRA 2N46A 2QY9A 5KSYA 1Z2NX 3CNLA 2OHGA 4YT4A 4CDMA 3IEHA 2RBGA 3D5QA 3IWGA 4LHVA 3I9V6 1OTHA 3HYRA 1WCIA 4FHDA 4OKSA 2C4TA 3WRVA 5FOSA 1PUAA 3DDSA 2H2DA 3D02A 1JG1A 3TSZA 3BS4A 5AKZA 4MR9B 5JR3A 5FTNA 1DNPA 1CDEA 1GQOA 2ZI5A 3AZQA 3C1TA 3ESQA 2CNWD 4M6WB 3L7IA 1LI4A 3QX7A 5C46F 3PB7X 4MVCA 4PSUA 1NF9A 1TA9A 2FDXA 2BKLA 3H1FA 4KXMA 1Q19A 2ZU6A 2EFEB 4OHKA 2R44A 1L6RA 3D3EA 1J90A 1FPQA 2Q4OA 3FYHA 3PD7A 4L5CA 1FUEA 1AKNA 1RD4A 3JZDA 2RHHA 5HQ3A 4MUFA 3LV8A 2CXOA 5HCIA 4KQCA 4GKJB 1G20A 3KAPA 5TQVA 3TIFA 5KYXB 3EF3A 4GWKA 1XUOA 1RP1A 2DBZA 2R6AA 4B3JA 4LZZA 3KYCB 3NBUA 4B3HA 2ZPUA 2Q3HA 4AK9A 5L7TA 4CMIA 1RYFA 1F2DA 3VU8A 2WRZA 2Y1EA 2GUWA 2JASA 4ZOLB 5AKXA 3W5SA 1JWAB 3TXXA 5I7UA 4QC6A 1VJCA 3ESBA 1A97A 4IFBA 4LYAA 2LE0A 2FVGA 3NH5A 5C1PA 1AS0A 2VZ8A 4R0NA 3VVBA 3RO7A 4B14A 1V7ZA 4IDDA 3UJ9A 4AXVA 3QA3E 3BFKA 2BSAA 1JAZA 2OXEA 1ODKA 1LAMA 2PX5A 3QU2A 4LZAA 1LLCA 1YK3A 3MIZA 1QGDA 4P3XA 1CY6A 4P3NA 3FJYA 4HAVA 1K3UB 3Q9NA 3WL8A 5HGJA 1ZNYA 2AE1A 2XWPA 2G09A 4L50A 5FO1A 5HXDA 1E8NA 4BINA 2CMGA 4GPEA 3JAWA 5K0TA 4MZDA 2BGRA 3NATA 3SGLA 3SK0A 2RB5A 3LKZA 4NZ9A 1F2PA 1SEPA 3WKDA 4OIWA 4NZPA 4GX2A 2AWNA 2QM7A 1FMJA 1YZHA 4Y30A 4Y0NA 3BREA 1CETA 1O6ZA 2PWAA 1FFXB 1ZD9A 1PFVA 3P2IA 1C7IA 4FFRA 3QVJA 1TF2A 3CKMA 2C2HA 1WXFA 2I3BA 1GZ6A 4OG2A 2DR0A 2O3QA 3DAFA 3QEMB 3IWEA 4E8OA 2HEGA 4LJ4A 1YDEA 2VP0A 4BLOA 3BGDA 4G5FA 1SUSA 3VO1A 1Y8RA 1TFUA 2HRQA 5BWLA 4XW2A 4IXDA 4LXYA 4Z7NB 3ZXYA 4B87A 1KHTA 3OJFA 1QGZA 3DO6A 4YJ3A 1TLFA 5B4VA 2PRQA 1HT3A 1RHUA 3FCOA 2FPWA 1SB8A 1A8UA 1Q1BA 3KKKA 3Q3GE 4CHGA 3A06A 1F8YA 5JHHB 2QIRA 3HEAA 2C3UA 1IXYA 5T57A 2VOJA 2NU8B 3UEOA 1IY1A 4GMGA 2XOEA 2YY5A 3AP2A 2Q8NA 2X2EA 1B42A 2PL1A 5TF4A 4D80A 3NBAA 2NO1A 1DUVG 1P9RA 2Q5JA 1W1UA 2Y9MB 2EFHB 3QF7A 4UBMA 3F9RA 5B1SA 4Y6GB 2OGWA 1TT5A 4P4EA 1VP3A 3JATA 2A5YB 2IS2A 3ETDA 4ZOBA 2B8TA 3QWFA 4ISBA 4KRXA 2E4VA 3U7QA 3B9RA 3X1ZA 3THXB 4L73A 4MUJA 2NO5A 3WL4A 1MU0A 1IK4A 2PLRA 3N5CA 1X2BA 2PUVA 3OZXA 3RWBA 5LQCA 2Z5VA 3DTVA 1SKAA 2QTLA 4DL9A 5IJ0B 3JWPA 4C4SA 5G20A 2C9YA 3HB4X 1K06A 1ISSA 1V25A 3CNEA 3AETA 5FOXA 2EG9A 2WKWA 3P9PA 4V2IA 4ZQBA 1N6KA 5FPPA 1VPEA 2JVKA 1NUQA 1Q7BA 3IUYA 3SJCA 1JPJA 1HE8B 3SICE 2YY7A 4MCAA 4RZ2A 2ZJAA 2ORIA 2P5SA 3PIIA 4CGPA 3CXUA 1F4PA 5F2KA 4J4BA 2OBLA 1T9CA 2CFTA 4K3UA 4ZIRA 3B52X 4PZUA 5C8YF 4DB2A 4UWIA 4P7BA 3Q8MA 4DMHA 3HVKA 1C4OA 5BT9A 2UXCB 3R1KA 5BNTA 4U9ZA 3IBTA 1GDTA 1U3GA 4X8HA 5DIFA 3QTLA 4QO7A 1SUBA 2F8MA 2HLHA 3QW2A 4ZO8A 4BFTA 4CE6A 3T5GA 2A3NA 4Q1EA 4JP3A 1LJ8A 3ROTA 1X1CA 3UCXA 2ZETA 3I9NA 5CLJA 5JDCC 4B17A 2Y99A 5KYTA 1FS6A 4EW2A 2WKSA 2P2DA 3IPLA 4O4LB 5C4IA 1G8JA 3HJUA 1EXNA 1LF5A 1WPGA 3MWDA 3R5SA 2ID9A 4I99A 5A03A 1CEXA 1E3TA 1YCGA 2B98A 4DUKA 1C7QA 1FSFA 2MSLA 3SQMA 4HTFB 4IOKA 4EHJA 3H9BA 1OBHA 4QM7A 2OU2A 1C3EA 1GQRA 1RRMA 1TK9A 1DBIA 3H2SA 3IDSA 3O8CA 3VR3D 2VXYA 4MX8A 1M34E 2O8DB 1LJUA 1PT9A 3SD7A 4D82A 1CSEE 4ISCA 4WKNA 4CTKA 3DFMA 1HQYE 2Y0EA 3EC4A 4GXHA 1E3WA 1Y4UA 3CPHA 3P0JA 1RADA 1WW8A 1ZSNA 2YY6A 3B2EA 4AG9A 1WJGA 2BUBA 3CISA 2HQBA 1ITZA 5IB0A 1XRLA 2MR6A 1IVNA 1NQWA 4CBVA 3O83A 2BI8A 4UZFA 2W4IA 3QKTA 5FBWB 3GRVA 1J0CA 4XFJA 4DBLE 1V8DA 1REQA 2W2OA 1XT6A 3LHFA 5JY6A 4P84A 3WB2A 4DV7B 1UM8A 4YR9A 3RK1A 4CGOA 4J03A 2NV6A 5C8YB 4LCEA 2AW5A 2BTQA 4F1JA 2FZ5A 1I2BA 2YN4A 3U4GA 2HHLA 4CZ2A 1ESEA 1IFXA 5F2EA 4ONEA 1N7JA 1G9XA 4F21A 8OHMA 3THYB 2HUZA 3GLVA 4E1BA 3KE9A 2Q99A 3ZNQA 4RL6A 3PQ6A 3G13A 4LNUA 3IT1A 2G1KA 3Q5DA 3SSMA 5EWJB 1I94B 2HCFA 2DGDA 1Y7LA 4HATA 4OBXA 4QBIA 1EHIA 3GO4A 5D1NA 5G0SA 2GXUA 1NJGA 3W0LB 5EP1A 1GUDA 5I7HA 1TPYA 3C3DA 2CNSA 4F4FA 3DHWC 1I4EB 3QVTA 1NXSA 2Y67A 4PCLA 1YRYE 1ENYA 5KKAA 4LF4B 1Z8XA 3LUGA 4LYDA 3D7RA 5BP7A 1XF1A 2YCBA 1O87A 2ZTMA 4K6KA 4XLLA 2AI3A 2PSJA 2QKYA 3KCQA 3P4YA 4NC9A 5FBKA 3ZQUA 1OFTA 1IWOA 2K4MA 4F1WA 1YIOA 2J0UA 4J1QA 3LT0A 4YQFA 3C87A 1O6FA 3KQVA 4XCXA 3RSSA 5K8PA 3N8DA 3S0JA 1DL5A 1Y9ZA 2CLSA 2CXRA 3WAGA 3UM9A 3ZVNA 3TUIC 4WOKA 1VLMA 2QBYB 4XUEA 1NRIA 4K7JA 4QUKA 3EZ6A 2W0MA 3B3WA 3KQKA 4P31A 1AZSC 3IBFA 3WLEA 2V6IA 3AVQA 4G86A 3K0FA 2AI2A 4FDUA 1ACMA 3JW8A 4ZT2A 1L4NA 1R9JA 1OTYA 1KC1A 1RXUA 3A9RA 1JQAA 2RGWA 2Z9DA 1XA0A 3QELB 1K98A 1A8PA 4XTCS 5DBHX 3QEKA 1MVLA 2FPIB 1HKHA 4G1UC 4G5YA 3VR5H 2BGLA 5HM8A 5FPQA 4EAQA 4ESVA 2CIJA 1YUBA 4LISA 1OXSC 3BTOA 3QX8A 3H99A 3N2KB 5EJ9A 1JSZA 4DMMA 1PKEA 2JFBA 5KHOC 1RYEA 5CB4F 1VMDA 1G8YA 2DAPA 1NJ5A 3NKLA 3OMLA 3VO9A 1CIPA 2QI9C 1TMKA 1BRTA 2P2LA 3DB1A 3MJ4A 3NPMA 4X00A 5JJCA 3HVHA 1PSDA 5IVIA 3WTCA 4ZYLA 1J49A 1SIOA 4OB6A 3NDBB 3A4VA 3HU3A 3T1QA 4UFNA 5K0EA 1VRVA 2IEGA 4CIDA 3IV9A 3AM1A 1A5SB 3R3XA 3VR1A 1KYXA 3ZDCA 4IHJF 4R2JA 4CEJA 3PEFA 3Q8KA 3KKNA 5KYYB 3WISA 2G9NA 4DNFA 1YF3A 1UP6A 4GI2A 2XMBA 2J3DA 4F0JA 3PJFA 1O8CA 1NMYA 3PK0A 4TXNA 1R6AA 2CBGA 3LIIA 3V8QA 4LBVA 4XPDC 1UJBA 2WWFA 1A4IA 3PIRA 2I91A 1GLVA 3ISTA 4TMYA 4MGZR 3OT4A 2V7BA 4NLLA 3QHAA 1EK1A 5KTTA 1KY4A 1QHXA 2LTAA 1FP4A 1TM2A 2Z9BA 1CW2B 1J5PA 1ZAKA 3E81A 3FB4A 2ETXA 3GRPA 3L77A 3IHKA 2RJNA 2DVMA 3LU1A 4XGIA 5M04A 2PJ3A 2P35A 4NPHA 2ERYA 2W58A 4U6SA 2Q6KA 2NSDA 4GBMA 4PIMA 1ORTA 1US8B 4J75A 1MPTA 4RUKA 1ESZA 3ROGA 4CKBA 4IUSA 1DWOA 1HH4A 1LK5A 1B3RA 3CLRD 1FBTA 3ORHA 2P5YA 4F5EA 2QU8A 1S96A 3F8SA 2BHTA 2HFKA 2FMFA 1F2TB 5CDGA 3FTCA 1AK1A 3E7DA 3GUCA 4J0JA 4XPKA 4LDNA 5IXYA 2ZRIA 2XEGA 1JIUA 1VJ5A 3DPSA 3O9VA 5FEMA 3L8GA 3VUEA 1JE0A 5IJ0A 4Q4LA 2WHEA 4ZZIA 4BNYA 5CXSA 2JAQA 3F71A 1XNJA 3MUFA 3IGRA 5CT4A 3N75A 2QNIA 4JEUA 1QK3A 3CH4B 5SICE 2JIPA 4KFUA 3UN1A 3TRHA 5CTJA 2OAEA 3PR2B 3PEIA 2AFMA 1XTUA 1LS6A 3RSLA 2ODWA 4X93A 2VSYA 3EQZA 3KVYA 3NVDA 1KERA 3O31A 4L7QA 4X3OA 4CKYA 4PZ9A 3LBHA 5BV0A 1HSZA 3LXUX 5KJCA 3EBLA 4CMAA 1G63A 2YIVX 4DRZA 3Q9LA 4UJ3A 3MSXA 1IBCA 1W29A 1IY8A 1U9IC 1G7CA 3VU9B 1GXSA 2E4UA 1YC5A 2Z5LA 1PZHA 3HHPA 3IILA 1GTL1 4HLDA 4JLKA 4LDAA 4OXKA 1NT4A 4OUDA 4TT3A 5G4LA 2X4LA 2ZYSA 1BHQ1 3OIGA 4RQAA 4JX9A 1V5GA 1AGYA 4D43A 1PJCA 4D0RA 2YBEA 5NLLA 2PXHA 4KXVA 3TKYA 2GHQA 5IN4A 5KNLA 5EBVA 2PPLA 1YL5A 3H1TA 4G9EA 2F64A 3PS9A 4IDPA 2NPIA 1NOIA 2P5UA 2XDQA 4A27A 1HDZA 1UIMA 1RI1A 2X58A 3BGVA 3L7YA 4ZAVA 2A1UB 4HRXA 1R4MB 2WKRA 2P9JA 3DOCA 4RYLA 3MUEA 1Z8HA 4NJOA 1Y6QA 4AF6A 4B45A 3CTPA 1GLNA 3EFAA 1CDDA 5LRGA 1LH0A 3WWZA 2E87A 5CB0A 4QJ3A 1WCIB 4FW8A 4PLFA 5TVKA 2AJBA 4YRBA 2H2WA 1XAHA 2WPWA 4QNNA 1I30A 1AB6A 1XTZA 4DA6A 4NNPA 4S12A 4KPYA 3GJSA 1JT9A 2XEFA 4F72A 2JDIA 1GZDA 3UHJA 3PE3A 1XCJA 3CUUA 3LX5A 3VR4A 2PT9A 3TZ6A 1E99A 1CR4A 3UJ6A 4EELA 3GXOA 3LBFA 4JP8A 1HI9A 2REQA 5DGCA 3WZ2A 5HP4A 3TTVA 1MQ8B 2BHNA 1KFEB 5B55A 1SKYE 4HQ6A 3OTQA 2G82A 3STXA 2I55A 5FPKA 5AOBA 3G79A 1CQPA 1NLYA 2PA0A 2PV0A 4JZKA 4Y2QA 4F6CA 3DEAA 1FSGA 4R2MA 1GTZA 3LK6A 2F1OA 1BH6A 2I4NA 2QN6A 3DO8A 3GYBA 3MHPA 4EHFA 5LP6F 2ORVA 1E1YA 3KJZA 4ZOAA 1ZJ5A 3W5CA 3HN6A 4YRPA 4AC9A 1ZMXA 1HEYA 2NYRA 3BD7A 4GYJA 1ZMBA 1OWPA 3DZFA 4B48A 1I7DA 3M3DA 4MV0A 5J4LA 3GGOA 3GP8A 3GGPA 3M4NA 5FF9A 1DC7A 1E1CA 3B6IA 3SR4A 2IYRA 4M0UA 4TTTS 1VG0B 2QT1A 3EGVA 3LYAA 4L15A 1YI0A 3JWGA 4RZHA 4HYQA 4NIMA 5H86A 3OMWA 1H6DA 5KDLA 3ZDBA 1G64A 1EBUA 3RIYA 3DFZA 2ZSFA 2X15A 3I39X 1PG5A 2JHPA 4CL0A 5FWNA 5CLQA 4QAJA 2WU4A 2C82A 2GM9A 2C8KA 1E5VA 1LQUA 2ZSKA 4BVKA 3WY9A 3Q6NA 1QWSA 3WGZA 1J8VA 3KELA 4ACBA 3ZDQA 3M6VA 4M1YA 1ISRA 1OW3B 4LVOA 5ICSA 1EE1A 5EC8A 1UC9A 2XQJA 2VHYA 2V74B 3NVAA 3C8ZA 2CSUA 2YMPA 4G63A 1F6WA 4YJDA 3TX2A 2QX8A 4O4IB 5FT9A 1YQXA 2PM8A 2J0UB 3R6LA 4YGYA 4CDNA 3G8BA 1VKRA 6REQA 5JAMA 1E5DA 4RK1A 5JH7B 3CNBA 1D6SA 3FM9A 4TQ9A 1FXWA 2Z3OA 4JI6B 5E2BA 2O50A 2ZRLA 3AW8A 2FK7A 3DUWA 3FB1A 2PCJA 3NTQA 1Q44A 2BOVA 3IE2A 3V4ZA 3JRXA 3HKBB 2FMXA 4L3WA 3JYOA 3RJ5A 3DZDA 4AO6A 5CP8A 4KOXA 1HDIA 1PN3A 3D8RA 3FRIA 3KR9A 4MQ5A 4KOUA 3NTRA 4GPAA 4TZTA 1KK3A 3NANA 4BB6A 2ZR0A 3PIDA 1XPRA 1KZYC 2VUUA 4R3LA 5ABPA 3VU3A 3L8CA 2JBWA 4FOLA 3BGWA 1YDMA 2PKQO 4U9HS 3TM4A 2ANPA 3CEHA 4B5LA 4YP5A 721PA 3P4XA 2B5OA 3VR0A 1I4LD 3ETHA 2A3RA 2AXQA 1BWQA 4GGPA 1Q0TA 2VXKA 1L7AA 1ATIA 1DCKA 1EGHA 2X7XA 4HB0A 4YJHA 4ZYYA 3G8WA 3CLUD 3V38A 3ZZMA 3SVLA 2HWWA 3C5WP 3FUCA 1CB0A 4G0YA 4IOLA 1E6MA 3TQIA 1CRPA 2IU4A 3CX7A 1ZHOA 2OFFA 4Q36A 1WIWA 4CL3A 3T9YA 4YMSA 4Y1FA 1ZXXA 4GOJA 4KNWA 2QORA 3SZOA 2CZGA 1WBBA 1F1JA 1DC3A 1HBJA 2QLBA 4IJ5A 1TM1E 2ODEA 3L7OA 4DCUA 1XEWX 4LY9A 3H87A 5D3MA 5JIBA 5TMBA 1FNBA 5K3FB 4OA5A 5C5EA 4A82A 2D62A 4BPRA 2WFLB 5HX7A 3ONWA 3EAGA 4HSEA 5F4BA 3V4LA 3DKIA 1RZRD 3O21A 3ZHZA 2VSNA 3OFND 3U61B 4FFVA 1ZLIA 4NENA 3E27A 3QMPA 3ZU2A 4HVLA 2C5SA 2CY0A 4DEVA 1NXXA 1WUTA 3H2YA 3S2YA 1Y7IA 5CCEA 4RIGA 4FCCA 2GBCA 2FF5A 5AJTA 1XTTA 1NFFA 2AKAB 4RHYA 2WM9B 3U2QA 3UT5A 4CKZA 3K1TA 5AJYA 3IJ3A 3AWDA 3L41A 5JWRA 2VDWB 4HB3A 1QOPB 2WU8A 2FJPA 3AVTA 4E4TA 3U3OA 3AUSA 4L5IA 2V54A 3SQWA 5LBIA 5FOQA 3QV2A 4UM9B 1JDJA 2H2FA 1N6OA 1XYGA 1CQIB 4FMCF 1QQBA 2O9JA 4IQ8A 3CRMA 1DOZA 2DMRA 4MKHA 4P38A 3SU8A 3WO0A 1QRSA 1BEEA 1K2WA 4DUGD 3CPAA 4DV5B 1KIMA 4UMEA 2CLDX 3AKCA 2DYKA 1FVHA 1XYYA 1PZFA 1V2GA 2NACA 4ITRC 1A2OA 2HWXA 4UBNA 1V6AA 1ILEA 3V1KA 3GLIB 3QI2A 4RV5A 2B35A 1PIWA 1Z3IX 4I55A 4YRSA 1RMYA 1MCZA 3HYCA 3BK1A 1U0BB 4DJLA 4DDKA 4ZYUA 3LBAA 1MO4A 4FKMA 4AUKA 2V7TA 4XWGA 4IGKA 1WWKA 3FTNA 2LGJA 3ML1A 4JLBA 2IHNA 4JD6A 3FOEC 2O4UX 5KOHA 3DOHA 3D3SA 3NUQA 1HLDA 4O8CA 2DF8A 2H7XA 5AVVA 3SMVA 3WL5A 2XCSB 2JK1A 3BFVA 4MW2A 5G4KA 4CVNA 3TE6A 4Q4AA 4RVDA 2Q21A 3WG9A 2QQFA 3NT4A 3QP9A 3TCNA 2BO9A 3LL4A 2IVZA 1IE3A 2QTGA 1G291 3HI6A 5FPYA 2PR2A 1J0EA 1YNSA 2D1FA 1VKHA 3Q6IA 2CCJA 2XDQB 4UC0A 4JI3B 4PNEA 3MQFA 1R0YA 2GQ0A 4WA8A 5FI5A 1OD6A 2IIVA 1EZZA 3QXXA 2DF5A 4PZEA 1VLVA 3VR5D 4CCWA 1P5FA 1XU7A 4W7IA 1ID1A 2F8LA 3PQ5A 3L2OB 4B4UA 3L7AA 2JIDA 2VHJA 3JALA 2H5MA 4LC0A 3WL7A 3N87A 4GBED 4CM4B 2RHLA 1BW9A 4Q02A 4JGGA 2O8CB 5LPNA 1M2FA 1YDHA 4AN0A 1E89A 2EJVA 3DBRA 3ITEA 4AB1A 5KNBH 5DNYB 1KY2A 3D5TA 2ZBQA 2HM7A 3HJCA 1R6XA 3R77A 4OJMX 1M5UA 2XI4A 1GSOA 1Y82A 2REQB 4MLZA 2H2HA 2LBPA 4JK3A 1E1KA 5EIHA 3TS1A 4BX8A 1VLZA 1XHLA 2G9QA 1CP3A 2BEVA 3WQSB 3UV3A 1JDZA 2ETVA 1DKPA 3IVAA 1JKJA 2GVNA 4IQ4A 4K6MA 1OZHA 2OWEA 4EY6A 5AW3A 4U7DA 2W90A 4JV5B 5I7FA 3RADC 1XF8A 1LX7A 3ZWKA 4B9EA 2X86A 5C9ZA 5HOQA 1HR0B 1XTQA 2RGDA 3ELUA 4ZCSA 4DQDA 4R6TA 2JARA 3K0FB 1BE6A 3ZEIA 4BNWA 3AVVA 3MGCA 4YU9A 2VAWA 2ZR7A 1K92A 2A86A 3JD1A 3BIWA 1PR0A 3CH5A 3QYPA 4QODA 1A77A 3WICA 3WB9A 4TXLA 1XGKA 2WD8A 1S2IA 1T9ZA 4ZP1A 4RYDA 2ZEHA 3VC2A 3GKRA 1NJ1A 3U3JA 4JXJA 4A2ZA 4ONUA 1XOIA 4P98A 1DAIA 1JV2B 2EFGA 2H63A 2OQRA 4S2UA 2Q0SA 3GEEA 2X19A 1RI4A 3AEUB 3H6GA 4HWOA 3ELYA 1SVMA 4WFJA 4AJ1A 5CA1A 3WLQA 1DUIA 2IV2X 2I34A 5KWSA 4DKXA 6ADHA 4H2KA 3NM5A 2G08A 1P6XA 1L7BA 1SOAA 1U2GC 3UPTA 2P4EA 1F8UA 2ZSAA 3N0WA 4K28A 2RB4A 4GR5A 1O95D 3VHXB 2QJTA 3VZDA 3ZYCA 3U3DA 4NCZA 2D7DA 4J1SA 2QRNA 2VYND 3IAEA 2WYHA 3IO5A 1UFQA 4DIBA 4KUGA 1DE0A 4L0DA 3GFOA 2VJDA 1NONA 1EK0A 1TOAA 5K0GA 2QDXA 3ZE1B 3ZGZA 1UJNA 2CMDA 4ALJA 4CIXA 4DLBA 4KN8A 4I4LA 4OGKA 3UJ3X 2ZZMA 3DV9A 1V6SA 3NRJA 4XXHA 4Q21A 5K3DA 4DZZA 1EUCB 3BJMA 2C42A 2ZCJA 5AUNB 1FDUA 3IQFA 1I6WA 4H7JA 4AJ4A 3DFKA 4G9BA 1PR5A 3FEDA 1Y3BE 2VYNA 3NFRA 4E07A 2VNJA 2QJOA 1XX6A 3LCMA 4XYMA 1T0UA 2P0YA 2QAGC 2ZBUA 4JBWA 1NMZA 4DB4A 1VHDA 4GI3A 2W6ZA 3BEOA 3PTAA 4NBTA 1CUAA 4ZT3A 4BZPA 2VQ3A 3RYHA 2B8WA 1L5OA 2YV3A 3HEMA 3K05A 4FBLA 5CJJA 1H9CA 2NAFA 1QG0A 2PUHA 3E9MA 3FI9A 4QSMA 1C1XB 1PR9A 2FU5C 5C7OO 4X62B 2VRWA 4AG7A 4UARA 4GXNA 3H5WA 5JG7A 4ZI3A 3O2QB 3N53A 1EHCA 2GF2A 3AY6A 2ZI6A 3QE2A 4BUJA 5BMVA 2NP7A 2Q49A 2O7VA 2Q2QA 5JCJD 2ZDQA 2FPKA 3FYNA 5HTKA 1W5AA 4MA0A 3GDHA 3EPRA 3FI0A 4Y1EA 2P2NA 1UXJA 5IT4A 2H51A 4H2DA 1U7TA 1ZM4A 1EQ2A 1IUNA 1MUUA 4IV5A 5JAHA 1FFHA 2E5FA 4L8AA 4QFMA 1HRDA 5IVPA 1QDLB 3EODA 1FTSA 1YQUA 3CV3A 5ALMA 5ETJA 1YJAA 2DCUA 1CFJA 1J20A 2HK7A 2QZZA 3R0IA 4GYWA 4RDIA 4EGJA 3CW9A 3ILSA 4RTKA 4KZTA 1H1DA 3TVTA 3OAAD 4N3NA 2A5JA 3EOAI 1RWXA 3BFXA 2PUDA 1WEKA 1WDTA 3ANTA 4GKBA 1X15A 2YL2A 4YYZA 1M4LA 2HNBA 2O54A 4HN9A 4P3PA 3SLRA 1WUHS 1Q16A 2XW6A 2OPHA 4EYEA 2B58A 3Q3EA 3IJPA 3FN4A 1P39A 4OSPA 2H1FA 4YPOA 2XIJA 1H1LA 1I80A 2JH9A 3C98A 4HX2A 2ZI3A 3CIOA 5EIFA 3VJLA 3ZI4A 3QQ5A 4BAZA 1G8PA 1JTVA 4JN6B 3PHBE 1XXHB 4ECEA 4OOEA 1ZK2A 5GIPE 4CR8A 1U5CA 4TL6A 3AVPA 2HYIC 1NU8A 2ID4A 3KJEA 2IXGA 2A78A 2VDWA 4K40A 1RVDA 4P7FA 1D2AA 4RY2A 4TRJA 1X19A 4KPEC 1CM0A 1F2VA 1DAGA 5EN4A 3R5TA 1JPVA 2H59A 3NAQA 3TIXB 2KHZA 2YWCA 1XCGB 3G2NA 5AHWA 3U39A 4QWMA 3OQJA 4DHEA 2QTWB 4PWZA 2BGWA 3UMRA 4IICA 3U81A 2W6IA 2VJOA 4L6AA 1YK0A 4FN4A 1KI8A 1GZVA 5AQEA 3X1MA 2Y1WA 1X80B 2VATA 1RWOA 3SS8A 4EGFA 1OB2A 1PNTA 2XH8A 3PGJA 1WHTB 2GJ9A 3EUWA 4C7XA 3JQGB 4UAJA 4RS2A 1RRVA 3AUYA 3FFBA 1SRRA 1UEXC 1X1BA 3V1LA 2ODFA 1WKBA 3QVOA 4Z0NA 5JS6A 1HOXA 2ZYUX 3CCBA 2J3KA 2OAGA 3K4PA 1DFIA 5COQA 4S1TA 2O3RA 2XXBA 5IN5A 3B8EA 3AZPA 4IDGA 1EDEA 3BD6A 1NOKA 4OHXA 2FX5A 3ZVMA 4NS1A 3TUZC 3RVKA 1C0EA 2FR8C 4CYNA 2IIBA 2QECA 2JZNA 4OHMA 3CT6A 1KK1A 1J8FA 3OJ0A 1FX1A 5L7YA 1DBPA 5JXGA 3B5JA 1J0DA 1JXQA 2Z3PA 2OHVA 2WT9A 1NL3A 4I1VA 4FHEA 3RJ9A 1XRYA 3EXEB 1B6SA 3PC2A 4FIZA 1J4JA 3F8TA 1COZA 4KHZA 3KUKA 4CNQA 2GZ3A 2QN3A 1LTHR 2A5GA 1KY5A 3RT1A 2PQMA 4DDMA 1DQNA 2Y93A 3NHMA 1DKUA 1QQ5A 1G8AA 4OF4A 5HE8A 5JDIA 3I1IA 1TZBA 3OZAA 3QUCA 5ITVA 1AU9A 1RKXA 3R6TA 4YROA 2BZ1A 5AICA 4BV8A 4E11A 2MU1A 2WF7A 5DEOA 2C7GA 2GFQA 4UUBA 3PHLA 1H94A 2GK7A 2XTZA 4AQ7A 1NW5A 2VPPA 4NE7A 3NEAA 4WXRA 4J3NA 5CDTA 2P2ZA 4RFVA 1AHPA 3ISXA 2BDEA 3V4PB 4X71A 3BWBA 3U80A 3SS9X 1TCUA 1FVXA 3O1JC 1UWCA 5CG1A 1XOVA 5IM4A 1BQ4A 1G3UA 3ZOKA 3NIDB 1NVEA 1NFQA 4YWYA 3L7KA 3FMFA 1XZ8A 1EFHA 3N2KA 5HKKA 4D42A 4C89A 3WADA 5JXJA 1B6RA 1MHPA 4GT1A 3NA6A 4D79A 4QB9A 2B3VA 3O2JA 3GFQA 4IJKA 4DT1B 1L2TA 1LPMA 5H1YA 1A9QA 4JLNA 2V8VA 2WJPA 2W6ID 4CGYA 3V4RA 1XIVA 2A84A 1RI3A 3FZEA 4NFSA 3L06A 4OOFA 4DWJA 5KYUB 5LQRA 1P5RA 3KLBA 4PZDA 4KQXA 5GPBA 1VM6A 3VAAA 2WWRA 2AFIA 4YAKA 4GSKA 4JMLA 2IQIA 2FW1A 1XHFA 2Q5OA 3FZGA 2IV7A 5K4HA 1J0BA 3H2BA 2BIFA 1J09A 3IB6A 3STWA 5HVFA 3EFOA 4GKVA 2H4YA 3P0RA 3T1NA 2WTBA 3V8PA 2Z11A 3K6RA 2WUUA 4F71A 4P3OA 1JILA 1O58A 2VA9A 3BXZA 2B36A 1V3UA 3WC7A 2W6PA 4UM9D 3E05A 1XV5A 2DWPA 3L8HA 3ZBPA 1IOWA 1CYDA 1VZ2A 2DJ5A 2HIAA 4OHCA 1OXVA 4ZQHA 4ENUA 2DR2A 1Z4QA 1A9ZA 4PHCA 1OIVA 1XNRB 3ZY3A 1NXVA 1D6MA 2ZSEA 2L82A 3VHXA 1UPCA 3LA6A 3VPCA 3FGPA 4YJFA 2EUIA 1P4AA 2VRBA 4KRGA 4NP6A 1EVZA 4ZREA 3LXXA 4X44A 3GEDA 3G0IA 3CLVA 5EXDA 1Q92A 3W90A 4KVME 1CJUC 3COSA 3FWHA 3OOEA 2GXAA 4URFA 4DARA 4A6PA 2O1XA 4WH0A 3JAMA 1T5IA 1T0PA 1U4OA 1XEAA 5BR1A 1SK9A 4A9AA 2QYVA 4CMHA 1VFNA 1WW2A 1M10A 2XT6A 1HYBA 2VHUA 3OEYA 4N0EA 1YL6A 1HWYA 4R1OA 5P8WA 3ZG6A 2PT6A 1K3FA 4JU8A 3O3OB 4MEBA 1D9XA 4AZWA 2XLCA 1EG2A 3I37X 4OC5A 4KFCA 4HLUA 3H8SA 5CG2A 4MHSA 3F0AA 4HUQA 1KEVA 1WTAA 4BJHB 1ZS9A 3DB2A 1MOZA 4WSOA 1K4YA 3HVJA 1WU8A 3WQHA 3FTQA 1JG6A 1HDGO 2W2NA 2G83A 5TX7A 4E5MA 2IC5A 4EJ2A 3DGVA 2Y66A 5DGIA 1PEAA 3FHTA 3OLZA 3V42A 3ADDA 1PJSA 3P8ZA 4B7UA 3D7DA 2EP8A 1UM9A 1N2CB 2HLNA 3OTHA 4G8BA 5K0SA 3CU5A 1B26A 4EARA 1TQ6A 1PS8A 2NSHA 1BMTA 3L8DA 4UHBA 1U0SY 1L5MA 1FFWA 4XSGA 3SHWA 4DLVA 4GX5A 5AVSA 2JLXA 4G3XA 3IIMA 4PYRA 1XXHE 4BNXA 4B2IA 1FTYA 2K7ZA 2YZ2A 2BJWA 1G2PA 4CRYB 3GLIA 3BMOB 4DIMA 1IL0A 1FNOA 3FLBA 1BVYF 1PRYA 2JJ2A 3I2IA 1V26A 2V7PA 1W93A 2ZBVA 4OA8A 3UT6A 1NVTA 1ZVMA 4YAEA 1PZEA 1CRZA 1TKAA 3W7VA 1ZUWA 2ROQA 1C9DB 3PFIA 2MDTA 2ORWA 4L5YA 4RE6A 4WOBA 5AJVB 4JJAA 3ROEA 4A0GA 4D9FA 2CGEA 2CNNA 1LC0A 1TCBA 3NDRA 3LQ1A 4G4SO 4H08A 5I3ZA 5JZBA 1SM4A 1PYDA 2ACEA 4N01A 5LP1A 4PG5A 5C34B 5TT0A 3O90A 1V7CA 1Y33E 2NZJA 2PGOA 1BDHA 3AL0C 5BSHA 4A2QA 3B1XA 2A1TS 1GPWB 1DCMA 4RHFA 3ZW7A 1HEUA 1VDMA 2H8KA 4JJ7A 2BTEA 1W85B 1W8IA 2YQZA 3H5LA 4D5GA 2YNCA 4EQ6A 3MBOA 1M2WA 3K2QA 4PLPA 2NVWA 1MAWA 5DOZA 5KIAA 2FWBA 1NXTA 2Y0BA 4EY5A 3QY0A 1KY3A 2YJNA 4DLKA 3EPKA 4G0PA 3K70C 1JEOA 2H2AA 1H69A 2O3SA 2O2DA 2CHFA 4NECA 3TLYA 4B32A 4D3YA 5BQPA 1E32A 1FRZA 1WD7A 5AQ1A 3VR6H 1L0CA 4FWTA 3H6HA 1YCDA 3BHMA 4JYMA 4B75A 1E94E 3NNNA 3U7GA 4FK8A 4ZCQA 1IUOA 2XECA 3IQGX 4RVFA 4X97A 4Y2PA 1X7WB 4NFHA 3JYPA 3OX4A 1Z4RA 5K0NA 5H16A 4IAVA 5CT8A 5LKRA 1UPFA 4YFVA 4N7MA 3T1OA 5JSFA 4KYTA 4L9SA 3H13A 5IRCD 5GJWC 3B9QA 5E9AA 4QOFA 3I2HA 3R9KA 3K5IA 1G20B 3ONNA 1Q7EA 1JSXA 1UWVA 1Y8AA 4BEJA 3B3TA 3C3EA 4D46A 1OGIA 3IAFA 3ECCA 1XALA 4UAVA 4PGAA 2EDCA 4TWEA 2N9UA 3FBUA 2A0WA 5KTDA 4G25A 5C7YA 4K6HA 3VO8A 5JI3E 2B1QA 1NN1A 5KJ6A 5IKXA 5TV2A 4Z9XA 1VJ1A 4N8EA 3SHFA 4G37A 4AU1A 1N25A 4A2CA 1JFTA 3JV7A 3F74A 4AVYA 1I36A 2VF2A 1P29A 5CA1B 5AG7A 3L6DA 4HJRA 4NCKA 1MGPA 3HFJA 4MNTA 3V6MA 2JCGA 3T5AA 2G4LA 3KDAA 1Y34E 2ZJZA 3PHGA 1TT7A 1R6TA 1KDRA 1XJ0A 2K2WA 1M54A 1MA0A 1K6IA 3CZRA 5L8VA 2A6PA 4D9KA 1LNSA 2WIGA 1B8VA 1NP6A 1Y6ZA 2AFRA 2GA9A 3CRZA 1KVUA 1YZGA 2P4QA 4H3VA 3ZPXA 4BKUA 3C6YA 3RRNA 2WMNB 5JYBA 2ZGVA 5DCUA 4QUSA 1Z6XA 1UJ5A 2QRVA 2GDJA 1ZRNA 5A27A 1JKMA 5GZ1A 1P4SA 4NAUA 2VL1A 4Y9DA 1C3XA 1Z4IA 1SQ0A 1VPWA 4Q0MA 5ALRA 3R7SA 1KWGA 3KWJA 1P9OA 3W8NA 1M1YA 1QO7A 5BO5A 4YBRA 1EHYA 2GM4A 4JI0B 1AS3A 3Q7IA 4LDZA 4XI9A 1BJTA 1NXWA 1ST3A 2DQ4A 1OBOA 4WNAA 1JHDA 1ONOA 3ZI7A 3UKDA 2O28A 1XBTA 3CRNA 2B2CA 1C29B 2EZ4A 1HNZB 3GFSA 4D9JA 3E9YA 4KO8A 2EVNA 2HK8A 5FFFA 4IMJB 3RTAA 3EFOB 4JJ8A 4RENA 1QQTA 4UMVA 1QC5A 4G4IA 1TF9A 2YN0A 4UTZA 4YLYA 1N9ZA 1WPXA 1EDZA 4M0DA 4PO3X 5EL0A 5AWFC 2JLCA 3AUAA 5EEHA 3ROZA 1GPYA 4W5NA 1ZG7A 4B3XA 4YP9A 3ZW8A 4J76A 5CU7A 3O82A 1IOFA 2QRUA 1P0PA 4N3GA 5D3KA 1QSNA 3WGTA 1QVAA 2WOOA 3KDSE 1O3YA 1OYWA 4O1HA 3ZGYA 5JXHA 3D7MA 2JLQA 1LPBB 2V5VA 3D8SA 2CFRA 3Q0TA 4ZDWA 3WGLA 3ZZIA 4Q82A 4LHYA 3ZZ0A 5I7RA 3CCFA 2AXEA 3TR5A 4CKCA 3LQYA 1XD9A 2PSWA 2QSZA 1PR1A 7ABPA 5H9WA 2BFNA 2AMVA 1ZR4A 1BMFD 1N8SA 1OC2A 3DONA 4R1PA 4L51A 5AK0A 3X44A 3EYAA 4DCOA 1JKXA 3RYCB 4NEXA 2YHUA 5IX3A 3D43A 3O2NA 4MW4A 2V6FA 1S7GA 2QOEA 4YRTA 3ZCPA 2QI9F 5KHLB 3FCAA 2OZEA 1G5PA 3QEAZ 2QG6A 3U17A 3ZGNA 2X8JA 3IQWA 1PZXA 1T5LA 1KOJA 2GAOA 4IDNA 1LC3A 4R3WA 3IVCA 4HWSA 4HWPA 3PFKA 4RFSB 1N4AA 5D2CA 1ABFA 2VJMB 2R11A 4Z0TA 1FTGA 1FRVA 3DR6A 1IOZA 4GC5A 3TAUA 1H93A 1M6VA 2GE3A 1B2LA 3O8DA 2ZIVB 2WMYA 3TINA 2RAVA 3Q85A 5BR7A 3LC1O 3RGWS 4XJSA 4B79A 4E5UA 1OAOA 3Q5EA 3LJKA 5KCMA 3DDZX 4KSYA 3R5JA 5JD5A 1EYZA 3UV6A 1FZQA 2QPAA 1GNQA 5JALA 5JUWA 6CPAA 3OTGA 4QTUB 5FUMA 1ULTA 1T9GR 1OPRA 1YU6A 2R8EA 1AIPA 1RHQA 2VWQA 4KX3A 1T3ZA 1FYWA 3C6ZA 5JYDA 5ENZA 5JCJA 4QBGB 1SHUX 3W9SA 1GA4A 2GYYA 2GYVA 3BMCA 3ECSA 3HYSA 1A9TA 4DTIA 4ZZ0A 5LQSA 1G4HA 1KJ9A 3ECAA 3MZ0A 1NNEA 4YRRA 2QR3A 2JI4A 3SF0A 2WNSA 1UK7A 3WXBA 1KI1A 1II8B 5CM9C 4Q48A 1Q7LA 3FCUB 1GL7A 2JFVA 1RFGE 3FF4A 4U1RA 3KEOA 3RJMA 2B5VA 4RO0A 1X80A 2HXYA 2GN2A 2JGDA 1L7RA 3PQ2A 2GESA 1M6NA 4FNAA 4NYMQ 4D81A 4L3OA 7REQA 1X3SA 2Q4TA 3ZUPA 1KMHB 5AW6A 2RB7A 3E5RA 4KH1A 4ZOEA 4WIAA 5L7WA 1AQUA 3O74A 3GARA 3WYNA 2I2DA 1VFPA 3FTDA 2GPSA 4NBWA 4FGWA 4K9KA 3WHIA 1F57A 1M34A 2RJ3A 5DNCA 2Z2JA 4XAQA 4UU1A 1MD9A 4RV4A 2WT8A 3RVDA 1W8DA 1AQLA 4HAWA 2PIYA 3BF8A 5DBEX 1UFVA 1X42A 1W85A 2CWDA 2O0MA 4R1QA 5TS2A 5FWXA 4Q7KA 3UXHA 4EGQA 3SJXA 1Q3KA 4B6JA 3K7EA 2F00A 3N39C 4HUJA 1QH9A 3WLMA 3U0VA 1W59A 2VJKA 3AESB 1O95A 3JQ6A 5JCZA 2R7MA 1WZUA 2SBTA 3QVXA 3W3AA 3N7ZA 3LDFA 5JMWA 1SU4A 2R60A 2ZVDA 3ICEA 4IX9A 4IWXA 3LHSA 1DMSA 1K88A 1RHKA 2I6SA 3CWQA 4UEWA 4FHGA 4PZAA 3EIFA 3OFVA 1F5SA 3AJEA 1MEOA 2OY0A 4KXLA 4QTTB 4ARVA 4ZI2A 5CLFA 1G6OA 1JDTA 2DRIA 2I2BA 2D4HA 3ACBA 4FS3A 3PQ8A 1GZHB 4LNUB 4P80A 4ASUA 4PCUA 4UJ5A 3IMFA 2O0JA 4BEWA 1G1MA 4JT2A 2JFGA 4OXRA 1KAHA 1Z75A 2QY6A 2K87A 3P52A 1BXGA 1G98A 4C2YA 3FOCA 5BUQA 1SD1A 3NAZA 3GGDA 4ZXPA 4ITUA 2NYVA 2V3VA 3FFAA 5LA6A 4REMA 4PC3A 3F6PA 2OB0A 3SYMA 4YQEA 1N2OA 2YV1A 1GL6A 3GQBB 4E5KA 5F09A 5I9TA 5I3CA 1WMAA 5KTCA 3TMAA 3UJBA 5JLAA 4R1UA 5KCZA 3OLYA 5CFNA 1YSJA 4IXWA 5ESXA 3LQRA 1R5JA 2JGLA 5DYIA 2YUIA 4MRNA 2NVUB 4AY4A 3TZHA 4B6GA 4TT3D 4C7OA 5I5EA 2V97A 4XKJA 4G8JA 3DP7A 1JXAA 2ORED 3AY0A 3PEVA 4EWLA 5JO0A 1VYHA 2IYFA 4U2BA 1P5HA 1H8EA 5LMNB 1MVNA 2AXNA 5KYKA 2DB3A 2PJ7A 3IOMA 4F7DA 3RSZA 4M8KA 3GW8A 3RUFA 1NJSA 4FT2A 2I7VA 2ZBFA 3ONFA 1MQAA 3HUDA 4OMFG 1GKYA 4ZWNA 2GEDA 2OAP1 4X45A 5CFLA 3RGGA 3G8DA 4WCFA 4P92A 3AK4A 4AMZA 4M0CA 5AKYA 1NY5A 2C9BA 2YVQA 1LOKA 2CKDA 1HORA 3KHSA 3O3CA 4QSHA 3MJEA 2LCQA 5DNWA 2HTFA 2REEA 3OKFA 2ZE5A 4HGQA 1RXTA 4DCCA 5JT1A 1R6UA 1E9VA 1ACJA 1FQKA 1JSCA 1N2HA 3SYLA 1FDWA 3IQXA 3AU8A 1ZKMA 2Q5FA 3CWCA 4RZ3A 4RH3A 5DHAA 3TSWA 1QVWA 5FLXA 1C0KA 2O19A 4YMVA 1Z83A 1K6XA 2IXBA 3ENQA 1G42A 2I6GA 4HZIA 3B12A 2QUIA 5EIAA 3PCTA 1VJ0A 5FI3A 2B4BA 3SX0A 2VQ6A 5DO9A 4YPVA 4M53A 4BJ5A 2HQ1A 4RVHA 5CAEB 4ZTUB 1U7WA 4HGPA 4NICA 1TKJA 1P72A 1T2UA 4R1MA 2XZLA 1YOBA 4ADSG 3OP4A 2AOVA 4PPFA 2ON6A 5LQJA 2EGGA 2WA2A 1QSMA 3CG0A 1ZH6A 2FLVA 2ZRJA 4L28A 1ZSYA 4MO2A 5IZ4A 5L4NA 3IHLA 1FK8A 2Q4RA 4JGBA 1RWPA 1P1IA 3QJYA 1XTVA 4K6FA 3H4TA 4R31A 3FSJX 4MYUA 4EKNB 2IMOA 1T2CA 2FMHA 2ZSJA 2ANCA 2JJQA 3BPSA 3KRTA 2XF2A 4JBLA 4ZX8A 2H5JA 3K72B 3SZUA 4LX8A 3DDUA 1M2OA 3FCEA 3MXOA 1FUIA 4MRVA 3VYVA 1DAKA 4FNGA 1EVKA 3HO8A 4K81B 4LYEA 5K9ZA 2CL5A 4H9GA 2F9LA 1P4HA 1VIDA 2YNDA 5F7ZA 3MF4A 3UWKA 5FVJA 2P9HA 3CZXA 5KTKA 2HO4A 2RC4A 4CAEA 5IANA 1X8XA 2XZTA 1AQNA 4BD9A 4UEFA 2QTVA 1FFDA 4F2GA 3NZEA 3E1GA 3EGEA 1P1RA 1S01A 3Q0EA 4I5GA 3CW2A 1XVLA 1RYYA 4IJWA 2D2IA 4INPA 3EFHA 4G84A 4IINA 3D5EA 4OFZA 2J0SA 2V7VA 2WWTA 1SXPA 5KKNB 1L7MA 5JDIC 4BBHA 5JD3A 2H65A 4JJKA 1Q1AA 2BN4A 4EG0A 3B35A 2PG3A 2NZ8A 3TGPA 1UWKA 1Z5ZA 2IKSA 2Q1WA 2OILA 3F96A 1GT91 4F92B