1YQEA

Crystal structure of conserved protein of unknown function af0625
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
282
structure length
282
Chain Sequence
FQGHMKLVVCSESDTAGQNIKDNLLTFADFEEKDVGEFKLYLSDEFYIAETKERLIYADHIDEKLAKYIDFEEILFASRHSSKDGRKIFTVHVSGNVGTADFGGKPYSLAKPSPQTMKNYVLALRERLDRKPEFEFTMEVTHHGPSEISKPSAFYEIGSTEEEWKDREAAEVVAEAMLDAIRAEKMDWNVAVGVGGTHYAPRQTEIMLTTTFTFGHNFAKYTFEHLTAEFLVKAVKLSEAEYIIIDEKSVNSAVKKIVNEAAEVAGVEVLKSKKVKKDFRLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Conserved Hypothetical Protein AF0625
rcsb
molecule keywords Hypothetical UPF0204 protein AF0625
molecule tags Structural genomics, unknown function
source organism Archaeoglobus fulgidus
total genus 104
structure length 282
sequence length 282
ec nomenclature ec 3.1.1.96: D-aminoacyl-tRNA deacylase.
pdb deposition date 2005-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04414 tRNA_deacylase D-aminoacyl-tRNA deacylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold AF0625-like 1yqeA02
3.40.630.50 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase AF0625-like 1yqeA01
1YQEA 2GFQA
chains in the Genus database with same CATH superfamily
3I3SR 1A9TA 5CCBA 3AEQB 3NH9A 4HEJA 3O7MA 2IH4A 2FPGA 3KT3A 4DREA 4DA4A 2XOKA 1QS0B 1BOBA 2G76A 1EUCA 1NXWA 1AUXA 1USVA 2CNSA 3R7WA 5BWMA 1NUSA 2VJLA 1XPJA 3IVCA 3OLXA 4BFVA 1MMFB 2BTQB 4PFSA 3R1KA 5LOVA 3ICPA 4YCBA 2Q51A 5B6PA 4CTNA 4Q9KA 2LVBA 4X3RA 4PZYA 2FLKA 2XQJA 1ATIA 3LA8A 5EJ7A 1TGYA 3W2HA 1O94A 4MFJA 1BFUA 4O8CA 2BFCB 3II6X 4JN6B 5CITA 3P26A 1D4ZA 3LSTA 1FK8A 1SC3A 1NMQA 4WVFA 1LDNA 1GAEO 1R0YA 1G8SA 4WJBA 4YJ3B 4WNIA 2Q5FA 4G65A 2W6ZA 4Y1RA 2FB9A 1KK0A 3Q6NA 4A5SA 2RGDA 2PZKA 1KK2A 4RVFA 2IGBA 1QGAA 1V95A 5DTEA 4XGRA 3GQBB 1UDRA 4MRSA 3BTUA 5HIKA 4J6FA 2CVOA 1C5KA 1ZU5A 2XDQB 1G0NA 2IU4A 2AOUB 2DR3A 3LQFA 4XASA 4C4YA 4TMFA 4UNIA 1P7PA 3K0FA 2OYSA 3GYAA 2PKEA 3E8MA 4CIXA 1Y9EA 3OPVA 3K6KA 3UHAA 4PQGA 3OU7A 4MI1A 4B45A 2OLEA 4F97A 1KETA 1Q2DA 1TFRA 4NYJR 2JCSA 4MLDA 2GH1A 1HE4A 1JG6A 5H82A 1HKUA 4BD9A 4F6RA 1GU0A 2P91A 4JUFA 5DGHA 5EKTA 5AJZA 1FFSA 4PIMA 5AM4A 3EGIA 1J49A 2XBLA 4G0UA 2VF7A 5LNK6 3W2GA 2QVLA 5GIOE 1XZAA 4LJAA 4P93A 3BHIA 3QTLA 1YLEA 4HMPA 4UM8B 2HBQA 1YA8A 2Y4OA 1TECE 3B3GA 2VRBA 2QF7A 3QHQA 3WADA 4OXNA 5FOVA 2P9HA 4Q7MB 1JT2A 2GF9A 2PMEA 4WFJA 1EP1B 1NF8A 1Z8HA 4AF7A 1N6PA 4GRIA 2XWJI 3EUAA 4I1YA 3VU0A 3MWLA 1H4QA 2QM7A 3EQ8A 5IDWA 4HDKB 4I1UA 3VI4B 2G70A 1ZJ5A 4FYPA 4MA0A 4EW3A 1Z13A 4F85A 5HM8A 2VXCA 1PCAA 4IIFA 4L28A 2ZSFA 5TT1A 1E5LA 5JEEA 1R4ZA 3NRJA 1SOMA 1Z22A 2DHEA 5K3BA 3GEBA 3HB5X 4OKSA 4KMRA 1B6GA 3A1FA 3F1KA 2REXB 5BR4A 2W8BA 4RFSB 1MF7A 4IZHA 5FPKA 4BQFA 3WAKA 4PEVA 1AZLA 1QKIA 3QTBA 4HDMB 3O1LA 1KJZA 3EC2A 3FLAA 3ZXYA 2BYTA 3ZYCA 4Q9DA 2CXUA 3QJGA 4F86A 5JTTA 2FJPA 4FE7A 5IF3A 4MR9A 2ZB4A 4ZMSA 1K75A 2WKRA 2I3CA 1NXTA 4RMIA 1YIAA 2C2OA 5G0VA 5IT9A 1VMDA 4L72A 1AB6A 2JD0A 2GPWA 3MLAA 1RI4A 1YNOA 3RVPA 1D5CA 2ECKA 5EIBD 2QYSA 3RHZA 4ZJZA 1JMKC 3NKFA 1U6MA 2BFPA 4M0MA 4WGGA 4MDHA 4GDMA 1EFLA 5DO9A 1E1KA 3VC3A 4DDHA 3MK31 3ERCA 1BU5A 4ODIA 2RKWA 1KVTA 3L8MA 5AI4A 5CFNA 1ON0A 4UFPA 1Q74A 3CDXA 3HBMA 1I21A 1NW4A 4U6QA 2OTCA 2YY6A 1BX3A 2WQ7A 4UFWA 2I6UA 1WU8A 1W47A 4LQLA 3DXYA 4CEIB 5BVHA 1ES9A 1GPDG 3SEFA 4BKPA 1FJGB 3CCBA 2XQKA 1HDZA 2P35A 3S27A 1KJ9A 2I3AA 2HV8A 4U3JB 3BZBA 3GNQA 2ZUWA 3ADCA 2VA9A 2YJ4A 1Y5RA 1LUAA 4CMJA 2HUNA 4FT2A 2V5AA 1IOFA 3QVOA 2R65A 4KN9S 4TNUA 3GT7A 1IATA 4RA6A 2F4NA 3PDIA 1G3RA 3KFVA 2VXKA 2VDUE 1T3ZA 2XB2A 1P4AA 1V4VA 2E9SA 3P0EA 4D98A 1MB4A 2VHTA 3WLMA 4C4OA 1DRKA 1Y63A 3PA8A 3DW1X 1MJHA 2O2EA 4F4UA 2PKCA 4FQ7A 4M9SA 2OLJA 2IBSA 3GN2A 3D3WA 3UAGA 5A0VA 4JAVC 4CMAA 5T7BA 4NZ9A 4ZDWA 2VDPB 1ZCZA 4JBXA 1W0JD 2WMDA 3KZMA 3B6IA 4WKGA 3KSZO 4OM8A 5J63A 4B80A 4RD0A 3RU9A 4NH4A 5HUHA 2ZVQX 3IV6A 3DB1A 1QG4A 3P0HA 1AOXA 3HLYA 1COWA 4K9RA 1V8PA 3S6KA 1QHGA 2NO9A 2CIJA 1SZJG 5DLYA 3W5BA 1XXHE 4ZHQB 2O8FB 3MRTA 2IF0A 3MUFA 2Z2XA 4EENA 1F51E 4PNEA 1JH8A 1LRLA 1RWNA 2W98A 2YVLA 3EXEA 2PJRA 4HDNB 1EFKA 1RZ3A 1SXJA 2BY4A 3MRXA 3W4JA 5HCUA 1JECA 5F73A 5MHTA 1KF0A 3G8CA 2IVZA 1BDHA 4ZOLA 1II9A 2Y8EA 3DPSA 5KAMA 2IYYA 2BF4A 4P3NA 3GVIA 2N47A 1VDMA 1TUEA 4JOSA 2XVAA 3WA7A 5SY9A 1R12A 1PE0A 3KALA 4BBHA 4JHLA 2HK9A 2XI4A 4LAFA 2YYSA 1P5HA 2H3EA 1WLYA 1A1SA 4OKOA 5D5QA 2G0BA 3AOGA 2B4DA 2JEVA 2W2KA 4KVAA 1KHHA 1FXWA 4LOIA 5AOVA 2UVQA 1JYFA 4R05A 4RSMA 4TN5A 3GVHA 2DX7A 3PHGA 2Q4EA 4LN1A 1L4MA 4XR4A 1JKIA 2WNHA 2QIOA 3SE0A 3U4HA 2GPBA 5T8KC 3OCVA 5DSXA 1K9VF 3D4PA 1TPZA 4B6OA 1WDLA 1PGJA 4G2NA 4HS9A 4PAQA 3HMKA 3I9V6 3IQEA 1OY1A 3AX6A 4B5PA 3NJ8A 2BC9A 3SC2A 4UEQA 1FU8A 1C30B 1RPTA 1TCUA 3IIKA 5AOAA 2BIFA 2I3GA 1KO4A 2EQBA 2EP5A 3QFTA 3D7SA 3L0DA 4PHGA 5EIBC 1VYVA 1J0BA 2C9CA 3C3CA 1G6HA 1BPMA 2J5RA 2NPOA 3EZNA 2FG5A 1FXUA 1J8YF 4XARA 1W5EA 2E4ZA 1UC4B 3A58B 1MO2A 2Q3HA 3IYLW 3INRA 3H2ZA 1VSUA 4CAWA 3PX3A 5EEHA 1E1DA 5H5JA 1KI6A 3SHVA 2Z3MA 4XDGA 1J97A 4FT4A 5EGNA 4J0KA 3RR2A 4CL2A 4HDCA 1BA2A 4TTAA 3CE9A 3D8BA 1O87A 4C01A 1N5KA 3NRCA 4A30A 1DCFA 4WZBB 5KC9A 2JLVA 1Z26A 4MMYB 3QPAA 1GUBA 1E4EA 3QEKA 3RGGA 4JI0B 4X5KA 1GZ6A 2O2DA 1IM8A 1ADBA 2DWOA 5CNIA 3I4CA 1M44A 2C03A 2LBPA 1ORTA 4KUEA 3WTBA 1RM0A 1N75A 4BO4A 3AF6A 4B33A 1S6YA 4GMKA 2DWUA 2X0IA 2POKA 4UAJA 3EZ9A 4TVOA 2AC4A 1G2IA 3DLHA 3A8TA 5LKRA 4H7KA 2FW7A 4DLAA 3LU1A 1DKQA 1QYVA 1MKYA 4M1ZA 2C4NA 5JNUA 4C14A 3IQHX 4H6WA 2YYYA 3VNUA 2X9VA 4ZJUA 1XTSA 4LWZA 5FNVA 1BNCA 5LZ8A 4AJJA 2XV1A 4BP9A 1DPFA 4L6CA 4UTVA 4AXBA 3O6VA 5J5CA 3WZ2A 3B8HA 3ROMA 4CHGA 1KDPA 1W76A 4X8LA 4D56A 3CTPA 1P7YA 1NXVA 2PKYX 4B2YA 3N7ZA 2XNKA 4EEKA 4XSGA 3FRJA 2GO1A 2VQFB 3ZJVA 3JTKA 4IVNA 1JJ7A 1T3TA 2BKAA 5LLSA 1P2BA 1VJCA 2VAPA 2EYQA 4TLLB 1JR6A 4XQ9A 1K5GA 1G8PA 1MTZA 3LFTA 4HNTA 1Z7GA 3GY0A 5E38A 3K2KA 1QQBA 1M1UA 5ISVA 1T35A 3UK7A 1HV8A 2A3RA 3F6YA 3PB3A 8ATCA 5ALGA 3WC6A 3ZDZB 3KI9A 1QP7A 2B6HA 3L8DA 3H0CA 3HKCA 4WCDA 4R2LA 5TEVA 3N0TA 2CFSA 3K32A 4HRXA 1KSHA 4G56A 5EJMA 2PSJA 3M82A 2I8AA 3QMWA 5DV9A 2VBCA 4YRRA 5SYNA 1M2HA 3RPEA 3ZW8A 1GKLA 1X19A 4NVRA 4BVHA 3ADKA 3JQ7B 1N6NA 3THYA 1JHDA 1GPJA 1ZZGA 1Z73A 2ID9A 1MW8X 4PN7A 3N59A 1U7UA 3AG5A 1CQXA 5KYXB 1UPAA 4RAQA 4NU6A 1TKFA 2HMAA 2EJCA 3PYMA 4K9LA 4OJYA 3EDMA 4KDEA 2CV0A 2VRCA 4EVYA 3UJ8A 3RFVA 2B4RO 1JIXA 2GDJA 5K8NA 2Q3CA 3WLJA 4GBMA 1CUIA 4HDSA 3HABA 1JAYA 3N0WA 3V38A 3BWYA 4H6VA 1BH2A 1QQ7A 1OXBB 1PHPA 4LZJA 4CKYA 1XZHA 1URPA 4MUGA 1S1MA 2PMKA 3CZPA 2BKVA 4QUSA 1XUOA 3HP1A 1I3OA 1G9TA 5TF0A 3RVJA 5DJ5A 3DLBA 3T3DA 1L7DA 2Y92A 1OFTA 4CMCA 1GQFA 3RQSA 3GMIA 4BMXA 1PDWA 2ZITA 3MMPA 2IKQA 3W6XA 3TKAA 3IXMA 1VZ2A 2P2NA 1OHHA 4N6OA 4LBYA 1W87A 4MW0A 2QTFA 3HXKA 3ER9A 3U19A 2C4VA 1KOLA 2B83A 3QXCA 1EP3B 1FYEA 3DNMA 3QUBA 4M3SA 4NABA 3PLNA 2WFZA 4K03A 4E32A 3NOVA 1DE4C 4PG7A 2ORIA 4F9EA 3UJ6A 1L0BA 4PSVA 4IW3B 4FUUA 2XT6A 3I6YA 1J4AA 2O3SA 1WOYA 4S1OA 3D6TB 1Q5PA 1AK1A 1ZWLA 3EZFA 4DWVA 2WICA 1YMUA 3I5XA 2DC1A 2LDXA 4FFRA 4FD7A 1KC1A 1NLUA 5IB9A 1EX6A 1F2UB 3IEKA 1H2EA 3MJDA 2JJYA 1UWYA 2B3TA 1JE0A 3OZAA 3SS8A 4DEYA 3AHFA 4WK0B 3O5AA 2WFAA 3U61B 2R6FA 2WJWA 3KU4A 4PG6A 2DLNA 2QN9A 4M86A 4DMUB 3KQVA 3L1UA 3B9BA 2GT1A 3ZD6A 2Z2YA 1B6RA 4AWAA 1XF8A 3OLVA 1Y8RA 3FTCA 3HEAA 2IBTA 4MCQA 2ISSD 3ZWXA 2ODBA 1AVTA 5L7YA 3GGDA 2GZ2A 1XU7A 2VFAA 3AXTA 1P9RA 2QLMA 4KLVA 4N18A 4N0MA 4BRSA 2H7VA 2LKCA 3T3OA 4EVRA 4F8JA 4Q4HA 2O5CA 2XLCA 2V6FA 5DKFA 2V6JA 1KH2A 2WTMA 4WEOA 3NMUF 5E6UB 3USZA 2GEBA 2HT6A 3HU2A 3NHMA 1FS5A 5IYZF 1FFAA 3P9XA 1FNCA 2ZIEA 2J7PD 3HLPA 3UCXA 3OHSX 3VYRB 3U09A 3H9BA 2COKA 3GT4A 4J7XA 1G17A 3CX7A 4JZYA 1OGJA 3TO9A 1X3SA 4I50A 4BWVA 4AIRA 5LB4A 1GVHA 2HO5A 4LOKA 2YV1A 3R3ZA 1IG3A 5JG7A 3TVDA 3KO8A 2AFXA 1FDVA 4FIDA 5E1DA 3CBGA 5D84A 5SV2A 1N5OX 3DDDA 4E7OA 4MVJE 2IYSA 3IAAA 5JS6A 1Y3AA 2PRBA 2X4DA 3FDIA 1OFHA 4YDQA 3N2KB 2R48A 4RVOA 3IQZA 1PJ4A 1C9JA 3SXOA 1WHSA 3B1WA 4HZGA 1S2NA 2PR1A 1I3CA 3F6EX 3L9WA 3F8KA 4QG3A 2RI0A 4ND4A 3O3OB 5BW6B 3ZU3A 3ICWA 4LZNA 4KORA 3I9OA 3CH7A 3BMOB 5IZ4A 5DSZA 4KI0A 3QP9A 5KHOC 4PHTA 4D8TA 3LCCA 3RJTA 1NW8A 4P2GA 2JVIA 3NHKA 4J0GA 1IRXA 4WOBA 1HL3A 1W0CA 3KQHA 4Q01A 1SHTX 2ZM5A 2R8PA 3NONA 4Q3KA 3HB7A 4KJZA 2PH3A 1C3OB 3PRJA 4YXWD 2V7BA 2C7RA 1WUYA 1E66A 3T8WA 3TZLA 4EB8A 4H2DA 4GW3A 5DNVA 4Y9TA 3MA0A 2F1RA 3RVMA 4DLXA 1Q2XA 1LCIA 3IDSA 4EMTA 1XHEA 4K6HA 3P4UA 1ZK1A 4I0WB 5JH7B 1PR1A 5EUBA 2RD2A 5C4IA 4IGEA 4C06A 4ALLA 1Z88A 5AKHA 3FPGA 5CW2A 2CDBA 5J59A 3ZDFA 1ZIDA 4US0R 4F93B 1BMQA 3S1AA 1JJIA 2FCRA 4JXXA 2EKLA 1R88A 3WGMA 5CA1B 2NSYA 3DTVA 3WE7A 1I5EA 2A9RA 2XJ9A 2Z9CA 3SX4A 2WPNA 1L1QA 4ZRNA 3PEEA 3ZI0A 2OGWA 3TIIA 3FEDA 5K6TA 2BGMA 2FWRA 4DLSA 4BZWA 1ID1A 2X0JA 2E3JA 3A1DA 2WUGA 4D0GA 1P8JA 2BGGA 4GQBA 3T35A 1WW3A 1OC4A 1U1FA 3I76A 2EFYA 4TXLA 4UUPA 4XI9A 2LV8A 5F1OA 3SJCA 1B2LA 3FF4A 2YNMA 1US8A 2JS7A 5B6IA 4DCNA 4LMBA 2PZEA 1E2PA 1KBZA 2CBZA 1JSZA 2CHUA 1AKRA 2A30A 4OFWA 3IEPA 3PPVA 1ORDA 3BMNA 5CIWA 5JZMA 3EFBA 1NP7A 2QUJA 1P5ZB 5KPDA 3QF7A 3G5MA 1WMSA 3V7ZA 3L9XA 3BULA 1T3HA 3DMPA 1EUDA 3WNBA 4PPFA 1YS2X 3TGWA 1I4EB 4FX5A 1PT5A 2I8LA 4KLWA 3FVVA 3KBBA 5EI5A 1F8YA 1RD4A 3LVRE 4TKUB 1H93A 1Z6PA 4HMQA 1L3BA 1IXKA 4BV9A 4EJSC 5ICFA 1EFDN 2R00A 2H2HA 2IY9A 2Q6TA 5HIMA 1ILWA 2VHYA 3OWXA 4CMBA 3TFOA 1I01A 1DBPA 2YRFA 4N1AA 1WXGA 3LP8A 4AIIA 5D85A 1XEWX 4W5QA 4J91A 1IOVA 5IKPA 4HAXA 1YB4A 3JALA 4LX0A 4QUGA 3ECCA 4QO8A 3RRNA 2C00A 1DC7A 3DR3A 1BO6A 2YASA 3TGPA 2ZLBA 4FD6A 3E61A 5FNZA 4HCJA 4UXIA 4E09A 1S8FA 3PB9X 4IX1A 1RPNA 5AM0A 4E88A 3UUFA 5H02A 1D1SA 3FH0A 4CM5A 3GLGE 3O8RA 3ULKA 3EFOB 3TSZA 2JIOA 3TQSA 1W6RA 1RVV1 3QMMA 2Q6IA 2YRXA 1Z16A 2HR1A 3P0RA 3TLMA 1X1CA 5BY2A 2QA5A 5C8ZA 4MAAA 4EI2A 3NVKI 3OEHD 1E6LA 1DL5A 3NV7A 13PKA 1XKXA 2QN6A 4FP9A 4O0MA 2R98A 4ESHA 3SR3A 1DG3A 2F6RA 4E11A 4DT1B 1U9IA 1JR3A 5P21A 3BSYA 3IA2A 4ARVA 1UFOA 1HE3A 1YGHA 2OLKA 2J3MA 1TZCA 3C7TA 3DQQA 1QF6A 3L1KA 3ANXA 2WFLA 2WJGA 1PT9A 1LDEA 2B36A 5LXTA 1XCLA 5EGSA 4EL5A 3GY9A 3LT2A 2VI7A 1YB2A 3AKDA 3TSWA 4UBOA 5LM3A 3VVMA 2IYQA 4BKMA 4YN3A 2V3CC 2FKNA 2CL5A 1U65A 5JQGF 1E6WA 5HCNA 3BHXA 3GLIE 1XROA 2C8JA 4JI1B 1K06A 1PW7A 2XMBA 3R6WA 3V6MA 1XSEA 4E3WA 2R4QA 2X8WA 1XPUA 4W1RA 3GZNA 2PRZA 1U5BB 5DW0A 1Z4MA 1TC2A 1EVJA 4ARCA 1BAVA 2GLJA 1MP0A 3IOEA 5L4LA 2J6HA 1HC7A 3BA1A 2VPWA 1SZDA 3AOEA 4GOOD 3CUWA 2PBFA 2OZPA 4H60A 2WF9A 7REQB 2J5BA 3D7NA 3WJ2A 2ZP1A 5IVHA 3VDNB 1XVUA 1X7ZB 1DU4A 1CUVA 3M2PA 1A4UA 1PL6A 1PWYE 3IUEA 2ZETA 4C7IA 4HZUB 4AMBA 3U4DA 5BVGA 1QSTA 3IAM1 1Z2DA 4H3VA 1KVQA 1F14A 4YRJA 4AKTA 5CBMA 4JFRA 1RQRA 3T61A 1JHMA 4EJSB 1OI7A 3QVKA 1C0KA 3CEJA 5H7XA 3DHNA 3OWCA 3SYTA 4CG3A 2QGZA 5CH5A 2AE6A 3TZQA 4IHMA 3O8OA 1FVHA 2H0QA 5EMLA 5CCXA 4HWOA 3K2BA 3IQGX 4HAOA 1FYVA 4AKHA 5AVOA 3OIUA 5ALYA 1M8GA 1OOEA 1ISGA 1WCIB 3AF3A 4N8DA 3FNBA 4WDRA 3R40A 4OKIA 3T0IA 1BKSB 1JKJA 2PJ9A 1P2UA 1IN5A 2NU6B 1YULA 1XFDA 4X44A 5KOHB 3GXOA 3IAXA 4J4HA 4EHFA 1DTWA 1DP4A 2ZAOA 3TVYA 4KOSA 1O96A 4JOCA 2ZTSA 3VR1A 3VC7A 3IU1A 2G6TA 3AQIA 1JSCA 2ZR9A 5AW9A 3OCXA 2RK4A 5FCDA 2GI4A 5FEUA 4X7RA 2YWBA 5EUQB 5TXGA 1XEWY 4HB3A 5DF1A 1I3MA 4YJ3F 4J0EA 2P62A 2PUHA 1R4NA 5BWOA 4QWMA 4NBUA 1Y1PA 2Y0PA 4C7JA 1LH0A 2N9UA 1KY2A 3AW9A 3P9IA 1LI4A 4JXJA 5KYYA 5M5BA 3KAPA 4BO2A 1CG2A 3TLAA 2XDYA 2JD1A 2V1XA 2NVUA 3QNWA 5JRZA 1CM0A 3EFEA 4I4TA 1EWYA 2JFFA 2JGJA 4K6MA 1XHFA 1FJ2A 4UU8A 4H17A 1CLEA 1JDUA 2X8JA 4F5WA 3VKGA 4KR0A 3L4EA 3MGBA 1NZDA 4R6TA 4R51A 1G8JA 5C1DA 5KNBA 3ROQA 2G3TA 5A4IS 1KIAA 4E14A 4OHYA 1V9LA 2XZOA 3IP6A 1Y7RA 3THWA 3ZV6A 3U4GA 2XCUA 2M9MA 4B8ZA 4ZDJA 1H5QA 7ABPA 1P4SA 5JFTA 5F78A 3H5WA 3DCYA 1KL7A 1U8TA 1TNDA 1TCAA 3CLHA 4PAOA 3LC0A 2O28A 2AOTA 3K3PA 3E2PA 4TTTS 3F4LA 2X3FA 5L9AA 5A28A 4YT2A 1MB2A 5GJWC 2MOKA 3FFWA 3HN7A 4W5JA 4UFVA 2F1JA 4CQMB 3G5UA 1ZI6A 3RABA 2P6NA 1H6AA 3PFWO 3BXXA 4MP8A 2IP2A 3E48A 1Y4SA 1JEAA 4L51A 2CVZA 2J3QA 1E63A 4D5EA 2BO9A 1KTIA 3ZQ4A 2FZKA 2R8EA 1PVVA 4IJUA 3PQ5A 4WV3A 1TF8A 4LSGA 2CGEA 1XZDA 2OILA 4WOCA 4P4DA 2EARA 4LOLA 4XD7A 3KM0A 3ND7A 4ZOBA 2W71A 1LQ2A 3D7DA 4UMFA 2CK3A 4U5QA 2P6MA 4P33A 2WVAA 4U9YA 4X1YA 5LZ2A 3LDUA 3I61A 1AO0A 2EO8A 3PJRA 4TV8A 2Q1XA 2F1IA 1G9SA 4ZDIA 3PHJA 3HVKA 4D25A 4ZC8A 5I7HA 2FE4A 3WSTA 4KR6A 4OMCA 3O8DA 4LG1A 4WKOA 3NATA 4IXTA 3R96A 1EK1A 1R6AA 5AKGA 2EEZA 3CSDA 3H18A 4H27A 3PE3A 1E3SA 3C5HA 1WU7A 3L0BA 3CPXA 3ZV7A 3A1UA 5KYGA 2PJ7A 5CX1B 1TK9A 1FTGA 2GX6A 2SKEA 3JSXA 4KUHA 2WWXA 2WSBA 2DUUA 1ESNA 4EHBA 3OCCA 5DT9A 1E1LA 4FEAA 2BR3A 4UF4A 5D86A 1BG6A 1XF9A 3IQWA 2RMKA 4A6XA 1D0IA 1Q57A 4HNQA 5ITZA 2J8MA 3E7FA 2VP5A 2NZUG 3N2GB 4OXXA 5THKA 2PZFA 1DCMA 2CNMA 3AILA 4Z7OB 2I2WA 1E2LA 2WU8A 3HU3A 3N53A 1GO2A 3BRSA 2R8RA 2UU9B 1SIBE 1QTIA 4F7WA 3UC5A 3GOQA 5LDHA 1W49A 3QXHA 4FDUA 2Q45A 4DC1A 3O2NA 5CVEA 1KEKA 3MPOA 3AFGA 4QBHA 2NU7A 1WUTA 3JQBC 2ENWA 4EO7A 4AF8A 6LDHA 3VGJA 1AMNA 4IJKA 3C3XA 1JJBA 4MO9A 2PZMA 4XJVA 3AI2A 1JHYA 4A0QA 3BD6A 2OWDA 1T34A 1HK7A 4GS4A 5BQOA 1HM5A 2LIPA 5KVSA 4OMDA 4KKXB 1YB7A 4FYWA 5TQ2B 5EJGA 2QLLA 5J5AA 2PJDA 4UUMA 4FYVA 3IEHA 5CR9A 3D8HA 4F06A 2PV7A 1NJ8A 2X4IA 3K2EA 1WVIA 1RI1A 1WZ2A 3BWXA 3IMEA 3OQIA 4KGVA 4Y2HA 4RTLA 1STOA 3IGFA 2C8KA 4GS5A 1XXHA 4ZHQF 3DVAB 3I12A 1FSSA 1QH8B 2XB9A 4JD5A 4G0OA 3WIVA 5FI3A 3DR5A 3FVRA 2OB2A 2RGEA 3FVWA 4UTXA 3D81A 3IMCA 4DJEC 1YVKA 3FH4A 1DEHA 4GM4A 3VKVA 3TJRA 2IPLA 3KVOA 3KYDB 1YMEA 5E3IA 1ISJA 1SC9A 4YJ2B 1KWGA 3GJYA 1U0LA 3K0AB 1F3OA 1C50A 4N7MA 2HNAA 1DEXA 4BRWA 1BVHA 3C87A 3OPYA 4DJLA 4EL0A 4MQ5A 2A2ZA 1NT2A 4S1VA 4AJHA 1M2OA 4IYRA 4P4NA 5AM1A 1H2AS 2WB2A 4F2GA 4CKWB 3TECE 4OQZA 3WGKA 1UFHA 2ZM6B 3KGQA 2R1TB 1IL0A 2HRDA 4DC0A 1B00A 5JZSA 2H57A 2IW3A 1UPCA 4X1KA 3SN6A 2ES4A 2FZCA 1RE1A 3D3NA 1EFUA 3J7AC 2PVVA 3URKA 4TVSA 1A8UA 1XDBA 2OCXA 3OC6A 3AZQA 4HH1A 5F3RA 1C4XA 4FCTA 4A27A 4DLYA 1T6BY 4JQSA 1X7WB 4CM8B 3FDZB 4Y6RA 4B4OA 4BQOA 2JA1A 2NZXA 4ZV4A 2A86A 4RQBA 4MCSA 3T5GA 4J3JA 4NQRA 4F5DA 2IH2A 2HJRA 2XEJA 2IOQA 3OESA 3FRMA 4RV5A 4AKIA 4BRZA 1FCJA 3MHTA 4US2R 1PZEA 3RS7A 4FHDA 3LHSA 5B3JC 2ZYAA 1E1CB 1A5TA 4XUDA 5E7JA 4HFMA 2OBBA 4G81A 2Q4DA 1PJZA 3IOMA 3R9XA 2P1RA 5EXDA 3PRKE 2C5HA 1QNFA 3GAFA 1LKZA 1Q50A 1OBHA 3KKZA 3VDRA 4WADA 4AX4A 4JC0A 5TX7A 1YOVA 5FH9A 1GGVA 5ECWA 3CC8A 3O3CA 5I9TA 4AUNA 1XTKA 5KVCA 3NE8A 1KJQA 4QUIA 4IOJA 1JDJA 4X92A 2G5PA 4YR9A 3OTGA 4MJXA 4Q4LA 3WO0A 2PH1A 2YS7A 2O05A 1NAHA 3I1UA 1QV7A 1Z29A 2KQUA 3M33A 3VJLA 1F9EA 2ZEMA 4F2HA 3PB8X 2DTEA 1EM8B 4ZO6A 3CO5A 1T9AA 1Z5VA 4RMGA 2CF6A 5IAEA 4YRLA 5J1SB 1XQXA 1Q0ZA 5A05A 5H81A 1CEXA 2WVJA 3TFWA 1SQ5A 1PEDA 2X6QA 1RABA 4JJAA 2DR0A 1CTQA 3GJ7A 3R3VA 1TMOA 3S3TA 3AETB 4KVOE 3ZGLA 4E2AA 4AECA 4LDQA 5GJCA 1CLUA 4MHYA 3KTDA 2A6PA 2BSWA 1WW2A 1KC3A 5BMOA 2AN5A 4KOVA 2G9QA 4DE5A 3HYSA 1BA3A 1IPEA 1T29A 3SSAA 2EXXA 4MFPA 5BN1A 1ZIOA 1QOQB 3DO8A 1YVUA 4LHWA 4KSYA 4OIMA 1X74A 1A4RA 2PJ1A 5AK5A 2PN1A 1LSUA 1PWHA 3AU8A 1IZZA 2KLBA 4GH5A 3AR7A 1P0FA 5ICEA 1MHPA 3QJYA 1Z74A 2AJ6A 5B7GA 1BU8A 3CB2A 1UH5A 2XDAA 3EVAA 1I6WA 1ZD4A 4B6EA 3V4RA 2ZE8A 1DQPA 1YE8A 2N46A 5ADUS 1F8XA 1QFJA 2QPOA 3ELBA 3IIBA 3WKDA 2FLWA 2BFAA 2E87A 1C41A 4A95A 4N7BA 4OHOA 1TM2A 1Q92A 7AT1A 3AHEA 5U9CA 1Y8CA 4MIEA 4OYRA 4EEXA 2CTBA 4HFNA 4JYAB 5IBQA 4UBRA 4FBEA 1ZCBA 2BISA 2JAQA 1Z3IX 1DWQA 4JVSB 1YVEI 4L08A 5J2TA 2UUCB 1QUEA 3B9PA 5EJ9A 2RCNA 3E27A 3BEOA 5U4XA 4FJ1A 4DMLA 1WMBA 5E6SA 1VCMA 2K5TA 4ILKA 1BAPA 3ELUA 2B1QA 2B5GA 4I5EA 3HVIA 2EOAA 3GFFA 4HVAA 1TAGA 2VQSA 1ACMA 2XYHA 1GLGA 2Z95A 2F3RA 2IIVA 3Q10A 4EZEA 4B13A 2ID4A 5I0CA 3OAAD 3JD3A 4RCZA 4B81A 4FB5A 5CMLA 2NYAA 1AIPA 4KHZA 3GLJA 4DDMA 3Q2OA 1QP8A 4HP8A 2VT2A 4ZQCB 1DRJA 1UK6A 3Q7EA 4P4SB 5DLQC 2XY4A 4Q47A 1QO0D 3IEMA 4M1SA 3PC8C 2VIIA 1Y3DE 3A6ZA 3IE1A 4CW7A 4PV6A 2GEKA 3QVTA 3NH4A 1JR4A 2NYRA 1RRFA 3OZUA 3NC1C 2R5NA 1HE2A 5AHXA 1FDTA 2GWHA 4G5FA 2FPOA 2YJ6A 3ZCRA 2F1HA 5EQFA 3DXZA 2QP3A 4PY2A 2ECOA 2BVNA 5A9SA 4YP7A 1FP1D 3K9BA 4IIVA 1QWSA 5JMTA 4KW7A 5J8CA 4OVKA 1DX4A 4ZANA 3OE5A 1L6RA 1N77A 2GOYA 3PSHA 3DQZA 2ZYRA 1NUPA 2FPKA 4NJRA 4HDQB 1JEEA 3DZJA 1KPIA 2XTNA 2NO5A 4MPRA 3Q98A 4M99A 1NN3A 3E58A 4G5XA 2YNEA 3BWCA 3AFOA 3EVFA 4DLRA 2EWVA 3BF7A 2Z8XA 4TRMA 1IZ8A 1YDEA 4OCZA 4BNKA 5AI5A 4M7PA 4C3VA 2BI8A 4EMUA 5FLXA 5KYUB 5TR9A 1EJ2A 1M2NA 3GO4A 4EQ6B 4Q7LA 2XVYA 3WFJA 2CJWB 2Y1FA 3CX8A 3EOBI 2BGJA 3C3BA 4AD8A 3AEKB 2W4IA 1I7LA 4Z0NA 1UPBA 5I7FA 3LTEA 4UCNA 2OBLA 3TZHA 4Q7EA 3CRNA 1WXIA 3RT1A 3WRVA 1DOZA 3HB9A 3RNOA 3RTGA 1HT0A 3ZIDA 2J87A 4EB6B 3VDMA 1CS0A 3JQDA 4DDVA 1X70A 1VCIA 5DHFA 4ZYTA 4ARZA 4P5PA 2VA8A 4B4VA 1CY8A 4DN6A 9ABPA 4JQYA 5AI6A 4U9HS 1QAQA 1YQUA 3HA7A 3BDAA 1Z9UA 5F1YA 4EABA 2GLUA 2WAAA 3HCCA 1V11A 3O4VA 1KY4A 1ZGAA 1QWOA 2WG1A 3EG9A 4YGYA 2ZTUA 3VYSB 3L1VA 1WXFA 3TOBA 3QOFA 3RB8A 1JI0A 2Z4SA 4IGKA 3I30X 3T7EA 3L1IA 1Y1QA 3KB8A 4RL4A 1A96A 2NSJA 3SJFA 4BU0A 4GI1A 3EVCA 4G24A 2HF8A 5I45A 4MVJA 2QN2A 3LC7O 4RD6A 4QFBA 3JQ6A 1Z35A 1F4LA 1JHQA 4GPIB 3PJDA 2OCPA 2I4MA 4DLUA 1I1HA 3ND8A 4Z4IA 3SQWA 2C7PA 3L7NA 2OV4A 4UBJA 5DNAA 3M3HA 4P83A 3M1AA 4ZVTA 3KJGA 1CXZA 1ZINA 3FB1A 4XFKA 3C5EA 5HJEA 4LHZA 4UPEA 4CF6A 2AJDA 2IZ6A 5M29A 3TF5A 1VIAA 2FQXA 2HPAA 2GQ0A 1Y4DE 3KXDA 1P39A 3T3MB 4LX9A 1Z0JA 2ERYA 3KJEA 3RIGA 4ZCMA 5IULC 3LVBA 5IZCA 1I2ZA 1EHIA 1C2TA 2XT9A 2IPAB 4M1KA 1Y4AE 5CIQA 3BXOA 2QECA 2A9KA 1FC0A 2I6SA 4X64B 4YFJA 4G0ZA 3ZDEA 4B6ZA 1WV1A 4ALMA 1LA2A 3C3EA 1Q21A 4LV8B 1UXOA 3JVIA 3PITA 4QASA 5DOVA 1I1QB 2QBYB 4LY6A 3IEXA 2VTVA 1OVGA 1DAMA 2X9GA 4QGSA 3C5WP 5K4AA 2ZEJA 5EQDA 3VC2A 3OETA 3KYBA 5JH7F 3MT9A 1YR7A 1DDOA 1QGYA 1I3NA 3R9EA 3M4ZA 2AMFA 1ELMP 4RLQA 3VVBA 4X2TA 4UFXA 4IQ8A 3IDQA 4FX2A 3I64A 3RU3A 2WILA 5KNCA 4CL0A 3DFZA 5FIUA 5CA1F 1M1YB 3UAYA 4OH1A 4NGQA 4XR9A 1M8KA 3B7WA 4JJKA 2FEPA 2HSDA 1NYLA 1SOUA 1D6JA 3BGWA 2W2NA 1EBFA 3GP3A 4DBLE 1PSDA 4JI3B 3GX1A 2OH1A 4NFRA 5DWVA 3THXA 3K6SA 3AF1A 4IKPA 5HKKD 3GH1A 3DZBA 4NCJA 3HVHA 3LY7A 4M7WA 3F5BA 1ESZA 2O50A 3N8DA 2ODPA 4KTVE 3ZWCA 2I2AA 4XM2A 1QG6A 4FW9A 4IRXA 3SY8A 3QE3A 4O23A 1P29A 1ZCFA 3NS7A 2PJ2A 2BHSA 2YJTD 5HCIA 4PPZA 1T2AA 4IFIA 4NWIA 4A1OA 3ZLJA 1XMPA 4UEEA 3S2FA 4AVBA 3A7EA 2XNCA 1EAYA 2INGX 3JQAA 3NWOA 3ZCSA 4L4RA 3O31A 1U2DA 1DAOA 2RHGB 4JODA 2G7ZA 1IH8A 1EBBA 4H15A 3GP5A 4R6XA 1KAMA 2VDWB 5FULA 3NUQA 1O5IA 3ZHYA 2XNDA 4MW1A 2ILVA 1D0VA 4J0QA 1Z8DA 2Z08A 2CXRA 4Z4QA 4YRNA 2P6OA 3G6KA 4LYFA 4R71A 2PUJA 3OE7D 3GFRA 4OYHA 4FNMA 3UT0A 1JZQA 5KNLA 3TW6A 3L07A 5A62A 1C7EA 5L40A 3KLBA 3LT1A 4RABA 4WY2A 1ZJ4A 1GADO 3PEVA 5EJAA 4DRXB 4NGNA 3SEQA 3CZCA 3V1TC 3IWWA 2DU8A 2GUWA 1P9NA 1HDOA 3CPHA 1GQRA 3GLGA 3F6PA 4O2BA 4XIGS 2CNWD 1SCDA 3RUAA 4LF5B 4TKVA 5IEBA 2FKAA 3H1PA 4I55A 2BGRA 5K8JB 4E33A 1COZA 4EWLA 1O2DA 2OCDA 4JI5B 1IEWA 3LUAA 4GZMA 4XVCA 1E0DA 1TK3A 1XN1A 3VOBA 3BZUA 4LGYA 4XDYA 2VNHA 2CLSA 1OYVA 4ZOAA 3IBFA 4B34A 2PD4A 2JJ8A 3AFMA 2NP7A 4PLYA 5EPOA 4RQUA 1Q7RA 4PNPA 4YROA 3W06A 1C8BA 1WCYA 4ZALA 1VL0A 4DMHA 4FFPA 2IEYA 4K5QA 4LDPA 5JVDB 2HSZA 5ISMA 2GBLA 4NBSA 3G8WA 2ZEEA 2KHZA 1L5YA 2GB4A 1M2GA 2ZYWX 3DDHA 3H1BA 4RY2A 3GG2A 1G0OA 3GP8A 2B1IA 2ZIXB 3ZZ0A 1QX3A 5BXQC 4BKQA 4U6SA 3GLHB 3IHLA 1SCUB 3EO4A 4XOUA 1DUVG 2H1SA 1NNI1 1M2VA 3ZUPA 3WGZA 1U6IA 2DY1A 1OGYA 2CD9A 2Q3MA 1PJTA 4LCBA 1ZD1A 1ZCJA 3QKWA 2VT3A 2OQ2A 3KT0A 4DUKA 3EHEA 5CEEA 2P9QA 1E3QA 1OH8A 3FW1A 3M6FA 3OKAA 2OZHA 2E55A 4DIEA 2YXBA 1L5SA 2XRYA 1CZNA 3NTUA 5CVTA 3CNLA 4AVYA 4RGVA 3CR3C 1SD5A 1RE0A 2X0NA 5EP4A 3D59A 4OI1A 5C8DA 1D4AA 3RVSA 3OJCA 1PG5A 2W6QA 4P53A 3RUFA 4IJWA 4B3XA 3WYDA 3VNAA 1B74A 4KQWA 2P2GA 4GKJB 4DLZA 3Q9SA 4UNSA 1BC5A 2PFSA 1TVKA 3QNUA 3O74A 3RRBA 3GEDA 4JKOA 1GGHA 4R3KA 2TMKA 4J9VA 5AOBA 3OQBA 2P0EA 2V0NA 1S3ZA 1JT9A 3F9RA 1NKVA 2GHIA 4FYIA 3GIWA 4CMEA 1ECGA 3W7AA 1P91A 3EF3A 3MTIA 2K2WA 1E32A 3U7IA 5E2IA 5DTMA 3AINA 4FYJA 4YDRA 4KO8A 2ZBDA 5SY6A 1MT0A 1NJ2A 3ZBQA 5GOZA 2Q0HA 1NE2A 4GZ5A 5I51A 2VK4A 1Y9WA 1IJKA 2IP1A 1FUKA 4DJ5X 4LJ4A 1LAMA 1R6BX 3QNMA 3A32A 1Q12A 5E7IA 3FD8A 5EJ4A 5EIEA 2PL3A 3D66A 1JWLA 4RELA 3RYIB 4F3RA 3UK6A 3I8SA 4H6PA 3LDHA 2WAYA 4J0JA 3PFBA 3OJLA 1DAFA 3CJQA 4Q16A 4U2GA 1S9HA 4GX0A 2FG6C 3V7FA 3G2IA 3PX7A 1WXXA 3FUXA 2JJ1A 1M5UA 2J5QA 3RADC 1JEQA 3LYHA 1CQIA 3SQNA 2P0AA 1WCXA 3V3TA 5JT1A 3WRXA 5ITWA 5EJ5A 4DEVA 2DQSA 1Z5ZA 3OHPA 2Q29A 4ARSA 4WOKA 5MN6A 2E4YA 1T9BA 1CUSA 5JQWA 4AJNA 1CUWA 3ELWA 3KJZA 2ICAA 3BH7A 4CI9A 1PQWA 1YJCA 3NORA 4ZQEA 4M6WA 1T9GS 3A05A 4AJ1A 2Y1WA 5DX1A 4HI0E 1PFUA 1RZRA 5GQSA 4JB8A 4TV9A 4CQNA 2DCMA 3NHSA 1KO1A 1D03A 3IAHA 2Y1XA 3UTCA 4BNWA 2Z2KA 3L2OB 3MWFA 4KRYA 1E2HA 3QKSA 5CT6A 5ECDA 3ELYA 1VM6A 2K2QB 3WGYA 2IHZA 3AV3A 1C1DB 4GPTA 2H1WA 5DHSA 2CNNA 2FUCA 4I4NA 2H29A 3Q6MA 4JT2A 3ZJ5A 1W2WB 4TUYB 2YMQA 3LFUA 1Y0BA 4RKYA 4RF2A 2PU5A 1T9KA 2LNDA 1MTOA 2WAXA 1GRCA 2WDPA 3KQOA 5E1OA 3CGWA 3LK7A 4YB8A 3QY0A 1JDPA 2UZ3A 3PGLA 1XHLA 3HXTA 2B4QA 2BPOA 3UN1A 2L42A 4MLZA 4J76A 1OTYA 3JAKB 3WAGA 5CA0B 4DDTA 4L85A 4PLVA 2ISCA 1KDYA 2AHRA 1UODA 1T2UA 3MLBA 3O1HB 2VT6A 1GCIA 4XH9B 2FWAA 3SVLA 5DYTA 3ZGVA 1NY5A 2H1CA 2GXSA 1E18A 1L4KA 5FTLA 2YBDA 4PINA 1ZL2A 2FY8A 4CMIB 5TC4A 2QYOA 1K7YA 4KN8A 2JAOA 1JWAB 1GD1O 2AX3A 1I6KA 1YVDA 4DLWA 1JMYA 3SDSA 2Q0SA 3CPAA 2VWHA 1X77A 4BMHA 2BRUC 4NONA 4NE2A 2XOKD 2W2PA 1NXSA 4N03A 6ADHA 2AZXA 1O9GA 3V4OA 1EZ1A 2ZSEA 1RC8A 1VJ0A 5DMXA 5K0JA 4FFOA 1UJ5A 5IKMA 1PTJC 3A28A 3HZZA 3HZRA 3JASA 5KB3A 4OQXA 2TYSB 1XD9A 4EMEA 5KQLA 4MUHA 1DQNA 3EMVA 2QMEA 3E53A 1E9RA 4ROSA 1MC4A 2A57A 4LXTA 1O94D 4UCMA 4B7UA 3HBJA 4UVDA 3A70A 5J40A 3YASA 2Q7BA 3BGDA 1PW5A 4NP6A 2BFBB 2J3IA 5F46A 5CNJA 3C3DA 3I53A 4QG7A 2BP7A 3CGGA 1CRWG 1QP4A 2BH9A 2QENA 5GP1A 3GLSA 1E20A 2H9YA 3DSRA 1XEFA 2WWTA 1QFZA 2ZTVA 4TMXA 3RBUA 1TKBA 3OKCA 5LYDA 3FNEA 4BMPB 2I91A 2SBTA 5DEOA 1BGXT 4MPDA 5DIFA 4NC9A 3IELA 5L4NA 4JKIA 3SZ3A 4KYUA 4Q1CA 4DJJA 4BYGA 1G5HA 2HCFA 1IOZA 3KDAA 4EMSA 1MX9A 5ALJA 4L0DA 4DADA 2NADA 1ZM3A 1T6XA 1GRVA 1KDOA 2FWBA 1CNMA 2I4LA 5JWRA 1E98A 3ZXSA 4Q9NA 3LO8A 2ILTA 3MRVA 4UTZA 4J16A 1PFYA 2FVXA 2QRNA 1X0VA 1HFEL 3MT0A 3S9LA 1ODCA 1Z6ZA 5BNZA 4RF4A 3PFGA 4COKA 3FETA 4L50A 3SJ7A 3C3MA 3U13A 3L7JA 5JJCA 3OOSA 4EFKA 4DQKA 5GONA 1DQZA 4HBGA 4ZCQA 2P3SA 5BW4A 2X22A 3B52X 3HDTA 1NRWA 3EIFA 1YZYA 1GV0A 2Y1CA 2GBPA 1ARMA 4ZYWA 2BEKA 5AXAA 2GHQA 3BWEA 4F4HA 4QM6A 2VPYA 1ST2A 3BB3A 3LECA 4JYZA 5LQJA 1K4YA 1HMPA 1Y80A 4MYHA 4B73A 3LPAA 5EZYA 1FUUA 4R16A 4Q93A 5GY7A 4PXEA 3HJNA 4YJFB 2KB0A 2F9MA 3LC1O 1DOHA 4ZY2A 3CBQA 3R76A 2GJSA 2DUWA 1T3GA 3DE4X 3TH5A 2J85A 1OZGA 2A94A 4NAUA 1ULHA 1Z06A 2UUOA 3L5KA 4HG2A 3NIDB 1K5PA 4OLJA 3MAGA 4ALIA 1DARA 4LX8A 2MMGA 3S2GA 3A6PC 4M1QA 1PR9A 1W75A 4YTEA 4CYMA 4JROA 3D1JA 4LI0A 3TKLA 4YJ2F 5FR2A 4G1MB 3H65A 3A9VA 1UBRS 1PLJA 1T10A 5BOSB 1HURA 3PYXA 2WWFA 1GSAA 4D8UA 1X87A 1BCSB 1Y9DA 1LS1A 5CVUA 1PTKA 2VSNA 1Q15A 4MUIA 5TT0A 2OVFA 2EFJA 1CNFA 3FFTA 1JBKA 2DQYA 3ADOA 2PUWA 3A0UA 3H4TA 1JQJC 4FXPA 4LKRA 5IVIA 3HGQA 5ELMA 2AKAB 4IG9A 3EARA 2X3YA 5EOVA 4PZZA 1EE1A 3EPKA 3CEHA 4FI3C 4NOMA 4LIPD 1E5DA 3B7IA 2MCFA 4N48A 5K0FA 4MWOA 3D7MA 4FCCA 2VSFA 1YACA 4E2WA 1E62A 2W2MA 3QPWA 1VLJA 3OPQA 2WE7A 4GVXA 3UJNA 3RD5A 3GDOA 2YQ5A 1G4AE 3F5DA 1XNGA 2YJ5A 4HH4A 1YI0A 1BKDR 5JROA 5HR5A 3GRUA 1LLFA 2W2XA 4HT3B 3WLKX 2XWPA 4K3UA 1E3WB 2RGUA 1YCFA 2JGDB 4MS4A 1XZ8A 4L3WA 3VZCA 3TKYA 3FUUA 4IDFA 3W05A 3UKOA 4H4DA 5CFQA 2QQ5A 1P19A 2EFHB 3H4QA 1WM1A 4NMLA 1Z62A 2DF8A 1RQXA 5TIIA 2VBQA 1CDOA 2SCUA 2NNWB 4G5YA 5IHXA 2H1RA 4G0WA 5H83A 3MIIA 4AL4A 3HFGA 4U7FA 1M1NB 5BP7A 2PLNA 4JIGA 1FJHA 2JNWA 4MVCA 4ABTA 4B48A 3JPWA 4UMEA 2X9LA 3W77A 3HDGA 2PLAA 1YJXA 1YLOA 1JLMA 4P7FA 1UJ2A 1HFWA 4PTLA 4KREA 1COWD 4RHXA 1Z0SA 2GBGA 3ORSA 3WGNA 1EDDA 2BJVA 3HHPA 3AEZA 3L2NA 5C82A 1Q44A 4MQEA 3Q6IA 1DJOA 3RFXA 3OICA 3R1IA 3DE6X 2BOVA 4D8WA 2XB8A 3H8VA 4MGEA 1U8XX 1QIGA 4H08A 1ORIA 2C2BA 1MRSA 4J7AA 3IX7A 5K05A 4RTKA 2OC9A 4ZT6A 1NBMD 2OXTA 3UMFA 3OE1A 4KMOA 3NANA 2H1IA 2HEGA 1XQWA 4B3DA 5AW2A 4HPJB 1A8IA 3ZTWA 4AY4A 4CFYA 1FFEA 1NV9A 1PYGA 4WBXC 5ED0A 3IE0A 1CQJA 1AF7A 2HHLA 3DEIA 1H94A 3EXAA 3I01A 1D1TA 3BRWA 4JUIA 4MGYR 3CUTA 1AUGA 2JEZA 4C21A 3GKRA 4RIIA 2P9ZA 2F3TA 2DBVO 5LU9A 3VC1A 1F2TA 2WZNA 4M2LA 5AOCA 1EQUA 4NFHA 5IBRA 2AFSA 1I0LA 3VWEA 1QRAA 1SPBS 2PQ2A 2CXXA 1EQ2A 1L8AA 1DJQA 1UWCA 4IGFA 3IVGA 3R3YA 2P6FA 1EJBA 1LB1B 2JH9A 5HRUA 2IUFA 1LDBA 2GLXA 3BEDA 3R7DA 4A26A 1G4UR 3DP9A 4KL8S 4NU0A 3B89A 3D8RA 1HEUA 4V3BA 4JZ0A 1Q1NA 4PWZA 1RPJA 2XCOA 2D7JA 4HLCA 4ETWA 4F3TA 1LJ8A 4CHTA 3MOSA 2QMUA 1QGDA 4K7JA 4BCBA 2IIQA 1ABFA 3V4PB 4L7VA 1JFVA 3RIEA 4M8KA 3TK1A 4CM9A 2XEIA 3M1LA 1ZYUA 2YVQA 3EYWA 3IKLA 4WD3A 1XTVA 4FYKA 4O4LB 4AKEA 1H1LA 3MLEA 4YWJA 2PJ3A 2OGSA 4EA6A 2ZDGA 2FP4B 3E5RA 2AD1A 2I2FA 2OO7A 4BUZA 4UA3A 4K2HA 3IKTA 4M54A 4ZOEA 1I6LA 2JFWA 4GSKA 4CQJA 2O8CA 3TW0A 4J1TC 2DH5A 2JLWA 4FHCA 4IL5A 1G4HA 4OATA 1HDQA 4PCUA 1ULZA 3RS9A 1G8HA 4CT5A 2IPOA 4ZT4A 1PT6A 3MXTA 2EGUA 4GWKA 1Q77A 3T12A 2AG1A 1ADCA 3ZOKA 4UKDA 4BMVA 4GI7A 4NS1A 4LNUA 5D8DA 3G9XA 4DV4B 5IBPA 3PHCA 3DZIA 3HJUA 3P20A 1JDVA 1ELLP 4IUCS 2QD5A 3SI2A 2I6XA 3INNA 1KJWA 4D97A 4BXOA 1B41A 5CXUA 3RJ5A 4UU1A 4KAFA 1W4CA 3CRMA 4K05A 4MGZR 3VU9A 5FTMA 2EL7A 4LS3A 1B3BA 5LYLA 3LHKA 2PRQA 3A2KA 1M7HA 3E9NA 3KEOA 3O1IC 3LGAA 3KJIA 1D7AA 1J20A 1UFQA 3G88A 5I9BA 3FHLA 4Y0VA 4X6LA 4FZ3A 1JA0A 2ECFA 1MO6A 1GSHA 5FLYA 1DO2A 2XKBA 4PGGA 4AJ4A 3E03A 3RS8A 2C4HA 2WUDA 3WJ7A 4EFNA 4LI3X 1MB9A 4V0RA 5A3QA 4N0PA 2HV2A 1ETHA 4EYEA 3B13B 1JG4A 1XD2A 1K3TA 3WL6A 1AKMA 1T0UA 3GFGA 2GCEA 3OZBA 1A2ZA 4F1WA 2E4UA 1EIWA 5TARA 2JFYA 1GFZA 1EVKA 4EJMA 4AM8A 3S8EA 5JM6A 1QXSA 3LY9A 2ZI5A 2C98A 4AU1A 1ZD8A 1Z18A 5A3VA 4L8VA 3E2MA 3W8NA 2BHNA 2R7AA 1OJLA 2FF7A 3G85A 4Q9HA 2IF2A 3G9TA 4EYKA 3H6GA 4E51A 3I8XA 3SSNA 4CVNA 5AVSA 1V16B 2XE8A 2W6MA 2GE3A 3A2LA 1RJ9A 4WK4B 2GBFA 3IQXA 3EGXB 2QUAA 1E94E 1KI2A 1PFGA 1QFXA 3WMEA 1XAIA 5LKAA 5CDFE 2Z6QA 3PF8A 2HN9A 1QMUA 3W3AH 1D6MA 4JENA 4RYDA 5LC1A 5FV7A 3NTQA 1M67A 1JQGA 1E4VA 4CWAA 3GJSA 4RA9A 4FOTA 1GZUA 1T2VA 4P45A 4N5DA 4MYCA 3ZZIA 2QWXA 4GR9A 5EN4A 2VRCD 4RF3A 5LSAA 1IPHA 2J0EA 1NXQA 2GN6A 3IP9A 2HQYA 5I7SA 4BCCA 3FYHA 2FWPA 1Y7EA 1RFLA 3VKUA 2EZUA 5JARA 4CE6A 4ZQBA 1KI8A 1TUGA 1DAGA 1P4RA 4FJ2A 1IUOA 1VBKA 3ZC3A 3MWEA 1YAHA 2I76A 1P9WA 4NRDA 4X6XA 4XPDC 2JLBA 3H11A 3OWOA 1T5OA 3A6LA 3G1WA 5C4MA 3ITNA 5KREA 2ZYVX 2FOLA 2PUAA 2QDKA 2DZDA 1SWVA 2RAUA 1Z5GA 1X7YB 1C8VB 2MYPA 1ODLA 4P3YA 3DNFA 3P9QA 5HKOA 2EKQA 3IBYA 3GLRA 2PQ0A 2Y4NA 3PPWA 4NHOA 1DLJA 4FE4A 4YUAA 5EE9A 2OD9A 1SNYA 4GC5A 4Q39A 3C3PA 3QUSA 1OHHD 4I7EA 4JUDX 1LW6E 4X97A 3MJVA 3ZEAA 2GANA 4ZI2A 4PGHA 3K9FC 1XDUA 3MTQA 3ENNA 3JD0A 3ZHZA 2C1EA 5C37A 1SWWA 2IIPA 4JYMA 2YHAA 4QDOA 3CR8A 3RKSA 2DBYA 3ZCXA 4XA8A 4EFLA 1NN1A 5K6AA 1J90A 2X86A 3M9LA 2EU8A 2IXFA 4JMPA 2I80A 1MR3F 1N6LA 1GGMA 3R7FA 1U28A 3KOZA 2F3QA 1Z5WA 4NPAA 2M1XA 3KB1A 4II3A 2NMVA 1XEXA 3P2IA 1AY0A 1NVMB 3FPSA 4AG9A 2D4OA 1M2FA 5LBIA 5HMNA 5KWVA 1BHO1 3RROA 1T36B 4H2KA 3BIFA 3JAMA 5FWDA 2QORA 4XB2A 1XTPA 2VC2B 3GG9A 3PC2A 1BS2A 3KD2A 5CK5A 3EXEB 3IQFA 4RULA 3LHFA 1IDN1 2XQIA 1CP3A 4FZRA 4GU5A 3I5UA 1K9SA 2FFRA 3JVVA 4QA9A 4IAVA 5HQ3A 3QWIA 4PIPA 3QU2A 4XVHA 4KVZA 4QTZA 2GPSA 4PX3A 3LUJA 4R1TA 1X9HA 2I1QA 3A04A 1XVVA 2CDNA 5DIZA 4LJ9A 3BHNA 1E1RD 1DEKA 5LMUB 3PICA 3B36A 1U0TA 1NL3A 4FAIA 3N5CA 4D9CA 2NP6A 2X0DA 2BONA 1EQAA 2YMLA 3J7TA 3D02A 3EPPA 2Z3ZA 4LE2A 2CHFA 4C0JA 3HJRA 4DA8A 3UUWA 2B5VA 3RAPR 4ER7A 3QA9A 4HEA1 2FPWA 3OECA 2QMZA 1P1KA 4PM4A 2B4DB 2VI5A 2IC5A 2HUZA 3GD7A 2VLIA 4PBRA 2XGSA 5CHEA 5J1TB 1S8AA 4HTFB 3U3DA 4GL4A 4RESA 4B74A 3OC0A 1RXEA 4NDNE 1Z4LA 2Z5VA 1YL7A 2Q5JA 2JGRA 1N9KA 3A6GA 3SR4A 2ZFUA 3CV3A 4DMCA 3FGPA 3LPDA 1UDAA 2V4ZA 3D2PA 3QGMA 3SC2B 2EUIA 3S44A 3D2BA 4XPDB 1PFQA 4B75A 2P2YA 1EB9A 4BDTA 3VPXA 4UXHA 4R41A 2IUEA 3OUZA 1E9BA 4AQ7A 4E12A 4D4HA 3LBHA 4JYPA 3CT9A 2C8VA 4A37A 3HCNA 2R66A 5EWJA 3RARA 4XIIA 4FDVA 2XF2A 2GO7A 1TVMA 3SXPA 1FS4A 2Y1EA 1CUUA 3LUPA 2WHYA 1ORVA 2ZI9A 3ROKA 3A6DA 1B7GO 1P1FA 1KI6B 4QYIB 4EBBA 4GAEA 5C51B 3G1TA 4DGSA 5BWCA 5JDIC 1NPYA 1SB9A 3L01A 4B4KA 4ZT2A 1QHHA 4BMDA 1DQYA 4L3OA 4QBJA 5KTNA 1DINA 4NBRA 4Y1EA 4RH3A 4D3SA 1SA0B 2VDQB 4X60A 1JLKA 1A7KA 4FGWA 3N74A 4DYHA 1ZBQA 3Q12A 3UKJA 1R8XA 2BN4A 1H05A 4X3PA 4WPGA 2O3JA 4UBNA 1V7PC 1TEHA 4A10A 1SUPA 4N47A 3HFSA 1ZK3A 1J1ZA 2JBJA 5GADl 4MHDA 1YZQA 2V6BA 3DTVD 4KQ6A 1CP7A 4XSVA 3T3HA 5HK9A 4MROA 4RHFA 1K5DA 1MQSA 3DZFA 1M76A 4HLDA 1WL8A 1J2YA 1P60A 2C7QA 3QPDA 2VYVA 4IDAA 3VDXA 3LXUX 5KDLA 1APBA 1THZA 4C0KA 1USWA 2HD4A 2H9IA 2J1LA 4A33A 3B1FA 3PIRA 5JVDF 2P79A 1V8FA 3NEYA 4ZZIA 3UHOA 1YJQA 1ZD9A 3QELB 2GD1O 3IXLA 3VAZA 4HH0A 4HLUC 1S3IA 5CVVA 4LC1A 1LFWA 2RFHA 4AKSA 1YB6A 2F90A 4ZQIA 2EG9A 2FSFA 2QRPA 3TTVA 1MDBA 2D2IA 2YNMD 2P69A 1KAOA 4I6GA 1NUQA 3DXFA 1AHHA 3DO6A 2H65A 1C0EA 1X1RA 3FYNA 5T6BA 4YLGA 1J33A 2IEGA 3N6RA 5JCXA 1ZUWA 1P1IA 5FXMA 1CVLA 3JR3A 3CF6R 1FP4A 1MJAA 4PSKA 4GE3A 3REOA 3UQZA 3U39A 2PSFA 3HKCB 1ZN7A 2IKSA 3WB9A 2RH8A 1G291 1QYXA 3AJ9A 1VL2A 4OC0A 2OBYA 5JGFA 2LTAA 1ZSVA 4U0KA 3RG8A 3GFSA 2DHCA 3L41A 4E4TA 1PWXA 2F9FA 3ILHA 4OQMA 2KM1A 3WLPA 3BFJA 3K70D 1FMCA 4WOPA 3CR7A 3O26A 4IJVA 3DOJA 5ULLA 3IIMA 1NFRA 2C1CA 1UAGA 3STWA 1MD9A 4MZDA 2LXNA 3MUNA 1FPMA 4PONA 1XGKA 3MMXA 3JSAA 5SZJA 1Z6AA 1I3KA 1XB2A 5AMXA 2R47A 4F21A 1RWBA 2OFXA 3JVDA 5LIRA 2G36A 2QTMA 2QRKA 3L6EA 1HTWA 1OZHA 4IO1A 4CGPA 1ULTA 2PJ0A 3E6AA 1GCUA 3E9DA 4BB9A 4JLDA 2X77A 1ZUHA 2PGJA 3KQTA 2B8WA 3H5TA 4HAZA 2J9YB 3VO9A 2HB6A 3NTOA 3B85A 4YRMA 5LA6B 2AFHE 2O4UX 4DIOA 3HM2A 2GPNA 4HB4A 1LBEA 4W9YA 1K6MA 1G21E 221PA 2OBNA 4N76A 3C8HA 1DV1A 5HMMA 2FJ0A 3VPSA 4F0JA 1UJ6A 3R3SA 1JR3D 1IU8A 2FEWB 4HLNA 3L7AA 1W6UA 4YAUA 1H1TA 5K01A 2ZUUA 4FTWA 3JS5A 4MB0A 2JATA 5TMBA 1HOTA 4BVBA 3I39X 4H7DA 1E8MA 5E96A 2XXBA 1AXGA 3VSBA 3NLLA 2C5BA 1KNXA 1M3SA 2XMCA 2J0SA 2Q0YA 4IM7A 3IRUA 4MRRA 1FFWA 5LYIA 4IKOA 3GN1A 3ES9A 4OYLA 1M6HA 3VR6A 4R01A 3TTHA 4GBJA 3T06B 2ZR8A 3OCZA 3K0CC 3EXIB 4YYZA 5JSKA 2F8HA 3WGUA 5HRAA 2QD3A 2QPLA 2OESA 1IHDA 4TUYF 4J1QA 4OGLA 3HVJA 9LDBA 4ONWA 4UVGA 1A27A 3D64A 1ZGCA 4ECEA 2D06A 1UBFA 3FOEC 3TOXA 2NQTA 5HZGA 3DH0A 2XWBF 3PXAA 3VNRA 2GK6A 5A4JA 3Q7QA 2B6NA 4CL8A 1Y8RB 4W8GA 5CA0F 4HS4A 5AJWA 3F6BX 3BLNA 4WZAB 2YNCC 2D00A 1KAQA 3B1YA 2FVYA 5DGTA 4CM1A 2PJ5A 4A8HA 1WMDA 1NUTA 1Y8AA 1H8HA 1SG0A 4EX6A 2NYUA 3W6SA 1HZZC 1UM9B 3K1TA 3MZ0A 3IOYA 2YNMC 1K8XB 4Q4HB 1IY1A 4MIOA 3HL0A 1AHPA 3L6UA 2WFMA 3FMGA 1O6CA 4JWPA 2IY8A 2C4WA 5U1PA 4KS9A 1EWKA 1KZFA 5IJ9B 3G17A 3PNLA 4C05A 3SQLA 5D6OA 2JI4A 3SIPA 2BMEA 1FRQA 1VKHA 3DOIA 1CUBA 3G2PA 4B82A 4E03A 1W4BA 3SEAA 1YZNA 1PWZA 4R1OA 3AUJB 2BH2A 4X7PA 2JBKA 2PZJA 5K0CA 1ADYA 2HF2A 2RC6A 4QLAA 3L8GA 4HBZA 3T9CA 3VTAA 3FVLA 4YASA 3EMKA 3TLGA 1H3EA 3WV4A 1L5VA 3K70C 3AG6A 1EFRA 1QIJA 1LDMA 5E6RB 1WHSB 4CL3A 3ANLA 1QU2A 2N1MA 5KJ1A 1C3EA 2WE8A 4Q1EA 5L7WA 1YK0A 1N36B 2GM5A 1JVSA 3LUHA 1VJDA 2CLKB 2V7VA 5H84A 3LRPA 2Q9AA 1Y0YA 3OIYA 2C2KA 2WU1A 1NR1A 4MRMA 1WRBA 1GOTA 3QYAA 2Q7DA 4MW6A 2W8ZA 4U8GA 2DUNA 2LRHA 4NBLA 2R86A 3FGOA 4CR6A 3WDMA 4JLPA 3R7SA 3I6BA 3U3MA 1N2SA 2D7DA 1SVKA 1RAIA 3HN2A 3P97A 2JIDA 1QE0A 2PT7A 2Q1TA 4Z9XA 1JFRA 4RK6A 2XTMA 2B61A 1GA4A 3ZJ4A 5EP3A 4WBNA 1ZC3A 1AURA 2VHEA 3H17A 4AUMA 3X1JA 1YB1A 1P4JA 2I54A 5KNBD 4EFDA 4ENWA 3FWKA 4BQSA 2QJOA 3REQB 4B5KA 1E8DA 3PHHA 4JEMA 4G8BA 1PSWA 4F56A 3GFPA 5A6SA 5G53C 3MILA 2G9DA 3R0QA 3FMCA 5GGXA 4PZCA 2P2DA 3EAQA 2ZJ8A 3S1AB 2B8TA 3PVSA 2ZJ5A 4NBNA 3V8BA 3IALA 1L7VC 3ZWPA 5BV0A 3DTVB 3HYTA 2LR0A 1D9XA 4JLVA 1P6XA 2HJWA 1E3DA 3B1XA 2Q7OE 3RYOA 3GRYA 4MX8A 3CVUA 3KV1A 2O7SA 3NUGA 5ALXA 5KNDA 4XAQA 1PD0A 2Y6VA 3RTCA 3CPJB 2IHTA 2IXGA 3A1VA 4Y9UA 2VJMA 2P3OA 1KZYC 3RUPA 1N6IA 1VHEA 2ARHA 3WWYA 3HU1A 2BGNA 4YCJA 1YD7A 2MSCB 3OQ1A 1SUWA 3C39A 3WLIA 2PS3A 1T8WA 2MYTA 3ZY5A 3EEIA 2XGGA 2PR8A 4WXEA 2HA0A 3FPLA 4B32A 1B76A 2J9FA 3A4YA 4PLCA 2CK3D 2R7NA 3IBTA 3GA7A 1D2HA 1T1IA 3TL2A 2HO4A 4IP0A 1ILEA 3S9NA 1M34E 4RJKA 1WB4A 5G40A 1Y3BE 2M6LA 4CDNA 2F8LA 4MYTA 4RUHA 3BMNB 1U11A 3HRKA 3WZMA 1VCHA 1UZMA 4BYMA 2Q4ZA 4O2AA 2WHPA 4ZGYB 4Q82A 2E49A 1KZ1A 4HVCA 1EXWA 1RIIA 4E0AA 3VZBA 4H0CA 3SBEA 3AZOA 2CE2X 3KWMA 2X7HA 5BQ5A 2FRDA 4JXQA 1ZCAA 4BQRA 1PX2A 3MJHA 4PC2A 4YI3A 3OMLA 3T4EA 4TM8A 3CU5A 4IIBA 1S2IA 1NNLA 4QSHA 4XCQA 2IX9A 1NGSA 4BX9A 2NTJA 3FKJA 4EAAA 3U48A 3BJRA 3V97A 4AX8A 2QKYA 5A4KA 1ID8A 1LVUA 1R64A 2RHTA 4KPFC 4A5OA 3T95A 4E5UA 5AJUA 2A1TS 5B2FA 2VTBB 3OF3A 1NVTA 1UP6A 1J9GA 4XGQA 3CF4G 2Q4RA 1YCDA 5AI0A 3D2CA 1QIKA 3GRFA 3F5FA 1G59A 1EXDA 3WYBA 4H7EA 4XCVA 3BVPA 1RAEA 3UK2A 1VLVA 4QYTA 1KYQA 3U31A 5LMCA 3GPCA 4NGRA 4BFLA 3IS3A 2OCKA 2G82A 4ZARA 2HRCA 1ZN9A 4YRZA 4KGZA 4ZCLA 1HQDA 3COYA 5EP2A 3ZIAA 1SQGA 3C15C 5F7JA 1BFDA 4GMDA 3DSBA 3TD2A 3B6JA 3VOAA 1CUZA 3JPYA 2WKWA 1FDWA 3CX6A 4LJSA 4GE0A 4GPZA 5F5NA 3HYRA 4J75A 2WF8A 4PXBA 4TLEA 4EOGA 2AMVA 4H3KB 4RENA 2NXWA 3DEAA 1A2BA 2ZT6A 3A6HA 4DM3A 5CK4A 4GLOA 4U5YA 4MP3A 5BYJA 3I1FA 2R6JA 1UBJS 2FW6A 4WA7A 4YRIA 3H87A 3IMFA 2RK3A 1HE8B 2WFLB 4Z54A 3GLIA 3G0GA 4XEHA 1R9GA 5LR6A 4EHNA 3DZHA 2GN1A 5LXTB 1QLWA 3RWOA 4JEHA 4XYGA 1Z63A 3F8WA 4LZAA 1ZSYA 5C9ZA 3ZY3A 3GU3A 1TTTA 2HQOA 4HRAA 1UMCA 1L3IA 4JC8A 1W5AA 4EKIA 2VBIA 2B69A 5DYNA 2HZ7A 3DL2A 3E3AA 2GARA 5ER6A 3I37X 2ET6A 1T0JB 4TSRA 3IVMA 5I8WA 4UZSA 4PO8A 2GZDA 1WDMA 4J0DA 1KK3A 5EZ6B 3IR5A 4Y9SA 4C7BA 4MHPA 5IM4F 3UGKA 4CLHA 1THGA 4TTRA 2E1PA 5AUPB 2AC7A 3Q3EA 1VJTA 2GJAA 1SBHA 3WB2A 5HOEA 1L4LA 4EGQA 4S1TA 4A6EA 3FBUA 1KOJA 3V8VA 4DA0A 4O02B 3CZQA 2JZNA 3CJTA 3UMMA 2DUMA 2Y0BA 2R60A 1U8FO 4TOIA 4R8FA 1GDDA 2BFDA 4RPIA 4ZYLA 4E2ZA 3PA6A 3F3YA 1T1RA 1Y6ZA 1IM2A 5BVGB 2ZRFA 5KJ6A 3B5IA 2OXEA 2R68A 1RVDA 3B8EA 2FPXA 4TS1A 4OX9Y 3A1SA 5FPSA 3K8OE 2HAEA 4GGMX 3FYSA 2IEAA 3HUUA 2GCGA 1Q6ZA 3DV9A 2XITA 3M3DA 4QDKA 2Z6VA 1BEUB 4ZVMA 4L07A 1XN4A 3C1AA 4MQFB 1NJSA 5F49A 4H7IA 3V2IA 3Q2IA 5AJHA 1H1DA 2XUIA 5IAOA 3N2YA 3RIMA 4FI3F 3B3WA 3MUOA 4O4LF 3GBPA 1KFKB 2ZS9A 3EEOA 4GMFA 3HFRA 3H7AA 2J07A 3OQVA 4AMGA 1JKJB 4WGFA 2Y2VA 1XKTA 3OPXA 2QUZA 3B70A 4LNHA 1O96B 3B7PA 3M81A 2C9MA 3ZD9A 5EXEA 4PQEA 2A1UA 4KSFA 3MVEA 4GWGA 3U6KA 3BIOA 2Z3OA 1RTTA 2CN1A 3NDBB 4KIJA 2X0KA 3VZDA 3FPKA 2F43B 2QW0X 2I5PO 1KE2A 1SCIA 3VR2A 2Y0EA 2RJ3A 4P4FA 3HDJA 2DPXA 3Q9UA 1SUIA 5KYYB 3PS9A 1XZLA 3WLNA 3ADPA 1O08A 4P31A 1M6VA 5I9IA 2NVUB 4TVKA 2ABZA 2N1BA 5IK2D 5LP6A 2A67A 3TEJA 4BOYA 3HGTA 1DHTA 2X8JB 3AEUB 3WLSA 3BUSA 1R3UA 1F2PA 4KWTA 1XCMA 3KWLA 2HNBA 3DOEA 5THWA 1K7EB 5F2OA 4EHJA 3P94A 3S6FA 3FI9A 4CRZB 3P8ZA 5HXAA 4CF7A 1YO6A 2VZ0A 2RI1A 3GGPA 3IE2A 1LRJA 3RREA 2YQZA 4JJZA 3E9QA 4EUHA 4EY7A 4D8YA 1OH6A 3PUYA 4D42A 3EIEA 2OCBA 4CM4B 1IB6A 1EHYA 1GYPA 3IP3A 4D6XA 3WGOA 4LHXA 1WUKS 2J9GA 3R24A 3T4XA 3C5VA 5H0IA 1LRZA 4IUYA 5DTJA 3WRYA 3VV3A 1SXHA 5JOQA 1SXQA 2WIKA 3DM5A 1FSZA 3CXRA 1KEUA 2Z3WA 2VN8A 1HL7A 3BMCB 4EJ2A 2JFZA 1CZHA 2D1FA 5DNWA 3IULA 3FMFA 4A0RA 3UPUA 4X94A 2PRJA 1U31A 3AVQA 2QQEA 3V3KA 2AG8A 5FTJA 3UXYA 4GMHA 5I9NA 1UK9A 1OX5A 1VE1A 2AYXA 2JCBA 3L7BA 1EFHA 3ZWBA 3GLVA 5FAXA 4CIBA 1BMTA 4EI9A 3SOPA 2DQ4A 2AN3A 2Q8PA 3RH0A 1AQUA 4NECA 2HBZA 5DGCA 3HA2A 4QPDA 4G4SP 4WXHA 1RS0A 1NIPA 3P5BA 3CWZA 3DPIA 3F98A 5CDFA 4UNPA 5LUAA 3FFXA 5ALFA 1REQA 3P2JA 4BE7B 2Q3BA 3OQMA 1FUYB 4RIFA 3ZZ1A 3P9KA 3LLVA 4DQDA 1B1AA 4IEIA 4JEIA 2X5KO 5KQSA 3UMSA 2W9XA 4V1CA 4MBUA 3E5NA 4RPCA 1O3YA 4AMUA 4MR8A 1HDUA 3OURA 4RX1A 3GEIA 5K2OA 3ACDA 3FF1A 3DMTC 3EJ6A 2VKTA 5G0UA 1W85B 3DAOA 1VIVA 1MJGM 5DVZA 1XA4A 2YOFA 3Q41A 1SKYB 2FFJA 4MH0R 1EA5A 2JIQA 5EL0A 1F0NA 4MOWA 4EY5A 5C32A 1QB7A 2H4XA 4K1LA 1ISSA 1J25A 4XJTA 4U4AA 4OQPA 3ML1A 2YY7A 4IVRA 3PXCX 1CB7A 5JAZA 1VPLA 3PL1A 4XFDA 3U5ZB 5ITZB 4OQYA 3DLJA 2GRAA 1GM5A 3EUWA 3OFNA 3Q3HA 2E18A 8ADHA 3UMCA 5I4CA 4HXYA 4UOQA 1L5HA 2ZBVA 3TLJA 3DBLB 3DE7X 1EI9A 2AFIE 4XX0B 5IJWA 4RCVA 2DFPA 1G66A 4LSZA 4KSCA 1RM4A 1E5TA 1RLMA 2O8EA 2BCEA 2D5LA 1W9HA 5JNLA 5C8YA 3NU1A 3I0MA 1VL6A 1YIOA 1ZIPA 4P4EA 3LVFO 1XTZA 4EG6A 4L89A 5ENZA 4H7JA 4JVNA 1KIFA 5AK6A 4V2UA 3GDFA 1IJFA 3T38A 2IITA 5KDDA 2XYQA 2MMCA 1XMSA 4CJXA 3BMQA 1OT5A 4WNYA 1LBQA 3UKDA 5REQA 2OK8A 1QO7A 2VYCA 3D8PA 3FRHA 1MW9X 4OKNA 1BS1A 3U7EB 1HDGO 2ATVA 4Q3LA 4UD2A 3KU1A 1UQRA 2K4MA 2VNIA 2G28A 5E7MA 3HCPA 4L8LA 1QF9A 3NAQA 4E6EA 1UPFA 3RS0A 3DOUA 5CEFA 4KWCA 4K6CA 1XCBA 3DM9B 4G85A 2XKJE 3BGSA 1BWPA 1UBUS 1QGOA 2DGDA 2JPDA 3FOZA 4HQKA 2PC1A 3L92A 4IBOA 1NZJA 2R8ZA 5M7EA 1NSTA 1YGPA 4XWWA 5ALVA 4NDAA 4MUBA 1KEVA 2TRSB 3AVPA 5JXJA 3WMXA 1MJ9A 4YAFA 3MT7A 1RXCA 4EG0A 3DEJA 1FF9A 4EGAA 2EV9A 1P8AA 5JANA 1KRWA 4F9GA 1AG9A 3RYFB 4KLZA 4C1NA 1DBIA 3L7YA 2HWUA 4W4TA 1RRGA 3IP8A 3PNMA 2AFWA 3LMSA 1Y5IA 3KSDO 3QV2A 1XKLA 1NNSA 1KFCB 3I1JA 4LGVA 2DY0A 1VDZA 1O94C 2XIJA 1AA6A 1NYRA 3KXLA 2ZSIA 4LMRA 3KZWA 3ITKA 3EFAA 1VLQA 1R5NA 1CUXA 3BFVA 4MDFA 2OORA 1T2NA 3VR0A 2XZTA 1YZFA 1CY6A 4R1SA 4MTLA 4BAGA 3ND5A 4MXDA 3UH1A 4CTJA 3B3VA 1JG3A 3GOHA 3WRWA 3ANYB 2ETXA 3CURA 3ZE9A 3MINB 4ER3A 3CE6A 4QWWA 2FYTA 5LWQA 1HDXA 3MN8A 2WTAA 2NPFA 4RZUA 3PDJA 4OBBA 4B3BA 1N6OA 3OUTA 5JC1A 5I4MA 3LO5A 3R9XB 2XCIA 2O0KA 4HVLA 2PSHA 1M8JA 1DTEA 2XSZA 3UWKA 3SQMA 4BGDA 4B3MB 4OK5A 4MYSA 1Y4ZA 2J4FA 2ATIA 2D4AA 1NKSA 4KKVA 2P4HX 5I7WA 3PGJA 2IIBA 3BI0A 2QLTA 2CLFB 1SXJD 1PEAA 1RRPA 5E7QA 3DF7A 4M0UA 4BVFA 2IYOA 1MB0A 4PZEA 3KT8A 4R87A 3ETHA 1VMIA 1GFWA 3KAQA 3BCUA 4O4HA 4ZKDA 2BEIA 4F8EA 3QWHA 3S28A 4NXYA 4GX5A 3MMZA 4IUSA 2I79A 3MTAA 4BVEA 5H70A 2J5KA 1Z6TA 4M1MA 5AM3A 2KW5A 4N3GA 3VYVA 2O1SA 1Q7TA 2BGLA 2RJOA 1OXTA 3TCNA 3AVYA 5CDGA 4R9SA 1QGUA 1NMTA 1N1DA 1NF9A 5ITVA 3EIHA 5KNCD 4OOEA 3PQ4A 2PU7A 2AFRA 4LF6B 4Z4FA 4HXEB 1E0KA 2BV3A 2H5LA 5AKEA 5I4IA 5JI2E 3HSSA 1L5WA 3KZOA 5L3ZA 4CPAA 1N32B 4KV7A 2ZB8A 4C4PA 1UPTA 2JI6A 4Z3KA 4E5MA 5THQA 3CIOA 5HZHA 1NC3A 4RU1A 1IMJA 4MYDA 3WVNA 4KQ9A 1U1EA 1OJ7A 3WKAA 2FPGB 4RETA 2QX9A 1I94B 2QJ8A 1EUCB 3OX1A 3R7WB 1X2EA 3V00A 1QQAA 3AY7A 5CJPA 5FF9A 1GGNA 3DZDA 1A5SB 1HYGA 5LOVB 5CUQA 1OU0A 4FE3A 4UEOA 1N4AA 1DDIA 4MV4A 1L5LA 1ML4A 1EFPA 2PE3A 1WPXA 2D8AA 4PS0A 3ENKA 1ULBA 1YGYA 2QGNA 3CHYA 3PB6X 5JS2A 1PZHA 2H1FA 2H0AA 3WP0A 3RSZA 2XNDD 2MSWA 2XEXA 3T3NA 3OEWA 4Y1RB 2Z58A 3K4QA 3BH6A 5GGYA 2ATRA 4MFQA 2BE9A 2WAOA 1F1JA 3WAJA 4NEGA 2JFVA 1J06A 1SKUA 5CH3A 5B30A 1B3RA 3T7SA 2Y2UA 1X7XA 5EQJB 2PJUA 3WLEA 4YPFA 4GYYA 1LFAA 2FZEA 2AN9A 2CNOA 4YAEA 2Y0MA 1YUMA 5FTNA 4LF4B 4KU4A 4D2IA 1VKNA 4MVJP 4DUGA 3PEIA 3K0FB 4A0FA 3O2JA 4JS0A 3F9IA 4IDHA 2OMKA 3E9ZA 4EG5A 1XRJA 2JAPA 3RU2A 3IDFA 3WICA 4IIDA 2NQ2C 4C2YA 1Z8XA 4IJMA 1YE3A 3O8QA 5E1BA 2EZ9A 4IWYA 4ZVUA 5DMHA 3AHDA 2X5XA 4MY0A 2Q1UA 4F6RB 3DLTA 4UATA 2CNDA 4H7FA 1U0HC 1PVDA 2D2XA 1N5LA 1L7NA 3C74A 4HJXA 3UMRA 2R751 4NJEA 3IQIX 1VPWA 1UBKS 2WJYA 3WFZA 2J3KA 1K98A 5LA6F 3E2IA 1TTPB 5FX2A 4IOMA 4RS3A 4R8MA 1TW2A 3IB6A 4LMPA 5BYKA 7MHTA 4UCFA 2E5LB 2JAUA 2WYOA 4F8YA 4DSOA 5CGQB 1T15A 1U80A 3WKCA 1UMBA 5AW8A 1F38A 1UIRA 5IZCC 1SRRA 3TD9A 2VSOA 2PWAA 5IEJA 3ZGNA 5LQNA 2P6UA 1SXJC 4RPKA 2H7CA 3ESCA 1N0IA 5A02A 5EZ5A 3RHTA 2GEFA 3H9QA 4Z5XA 4JDPA 4Y3UA 1R50A 2P9FA 2XUHA 1FNDA 3QXXA 3LW7A 1ODTC 1RCTE 3KE9A 5LQDA 4FNAA 2J33A 3E3OA 4P3KA 1X1BA 4V0LA 4DCPA 1RMYA 2W8BB 2M1ZA 4ZEWA 4R54A 5FOXA 4POAA 1HE1C 2JFHA 2V7UA 5KJEA 4V0OA 4MUYA 4BWGA 3TIXB 4P92A 3K8QA 1YBFA 2DP4E 1N9GA 3QBEA 4R2WA 4FFNA 3ROZA 3KUXA 4MR9B 1E7MA 2EWBA 1KI3A 2CFRA 3RT7A 2VF2A 1P45A 5HVHA 5CXXA 2JL1A 1IE3A 1XRPA 1M1DA 3TDNA 1E3MA 1YH3A 3BD7A 1EUQA 2A8YA 2O2HA 1GRQA 4HWPA 1KMHA 1M66A 4L0CA 2W93A 1GTJ1 1XZMA 2BGKA 3BOSA 5TDHA 3CCCA 3C2QA 1ORWA 2UZ4A 1KZ7B 4DWJA 3F4BA 1PR3A 4MYUA 4N5MA 2QXYA 3MELA 5GZ1A 4IICA 1L4EA 3ZBTA 3HN6A 2QL7A 5PNTA 5BVHB 3FN4A 2POQX 1RHRA 1E60A 2H2AA 4ZXPA 3EEYA 2WK1A 2ZVJA 2Z04A 3C8DA 3K4HA 4RFVA 4BZZA 1UK8A 4KPUA 5H16A 3G1UA 4CIWA 1I4OA 5AKXA 2OV3A 2BAGA 1TU4A 3VPBA 5K4HA 5FJJA 4I50F 1U2DC 3ISJA 3LS2A 1SOWA 3PXEA 2QG6A 2WZCA 3NBUA 1UJBA 3V8EA 4ZI7A 3UPTA 4RA6B 2BKLA 2IEDA 4FLMA 3PDIB 4OD0A 1WHTA 3V1NA 4BLTA 1N5IA 4Q1FA 2JJ1D 3ZWQA 1UDWA 4YRPA 4YJKA 3ZDBA 4KUAA 1NXPA 1GAJA 1JB9A 4ROTA 2E2WA 4DR6B 4PX9A 3UH0A 3D3WB 1I2AA 4PHFA 1LDYA 3MGDA 2NX2A 1YONA 1DC4A 1KZ4A 5I48A 2X2PA 4OHZA 4LMAA 3RRJA 3CKYA 3NWJA 5J58A 4CYQA 1XV5A 3NHAA 1O54A 2GZ3A 3THOA 4X7MA 4WY8A 5FBVB 1Y37A 4GPD1 3FTFA 4WN3A 1LRKA 3OJOA 1RZRD 1GTRA 5DCWA 4WDQA 1MC5A 2G0NA 5DHAA 2RH5A 1W93A 3T1OA 3ZLBA 5KTRA 3AJ8A 4PAMA 2DTDA 4YQEA 2HHAA 4PQRA 1N71A 4M46A 1NYQA 4AXXA 2F59A 4X7BA 2NPIA 4ZU6X 4YAOA 1SXJB 3IP1A 5NULA 2AV6A 4TWJA 3QFSA 3RK1A 2OQIA 1E2UA 2G8LA 1GDHA 5DP2A 4G97A 3FOWA 3QOWA 2YV3A 2XR1A 2A9OA 2FPMA 1HDIA 3ZLTA 4ZOLB 1WE2A 3LWZA 1OBVA 1RYEA 2IY7A 3UICA 2GSWA 4JFAA 5ALPA 3U7HB 2VHXA 4MW7A 5HSGA 1PR4A 4PYQA 1R27A 4GR5A 2G1AA 4LK2A 4M21A 3BN3A 4M7OA 3UOWA 4ZO8A 2VP4A 4G0YA 4RZSA 1LXCA 2EKZA 2IX3A 1X1EA 1IGBA 4EB3A 621PA 3RS2A 2XUGA 2ZUVA 1VHDA 3G82C 1G5QA 5C1OA 1GKYA 1G8YA 4JL6A 5JS1A 2AZMA 1OVMA 4F2WA 4X1OA 2JFBA 4B4DA 2W2KB 4QYWA 4TYWA 5JHHB 2J31A 1U6JA 4PHCA 2CHVA 1JNXX 5ERXA 4LDNA 2HX1A 2NTNA 1EESA 1QPBA 3FX2A 4LDZA 4K9MA 2PAFA 2Z8YA 3QUQA 1F5SA 4QVKA 2OSBA 3UENA 1T0BA 4UCXA 3UFBA 4PYKA 4B5PB 3O3MB 3STVA 3D6NB 4UBIA 5AQEA 4GPEA 1MC8A 4D46A 5D5PA 1OBFO 3KT6A 4LBWA 2AX4A 3N9IA 1GQQA 2FEOA 1JWBB 3OQOA 1ZRMA 3ZW9A 4NMHA 1NZFA 4I1OA 4FGSA 4QQFA 1PS8A 2Y99A 1IIRA 3HEBA 2F4VB 2CFCA 3FAKA 2RGRA 2OAP1 4D5GA 3O73A 5K8LA 3ZE0B 3PVCA 1B8NA 4P98A 3A27A 2WJPA 4CMHA 3WGQA 4CR8A 1HYBA 5TV2A 3U3OA 1NSLA 4CETA 1ZNQO 4OHWA 5F1KA 4ZTBA 3JUWA 3LYAA 3EDOA 4YV2A 3TXAA 5JYDA 1RI2A 3O8CA 4HRVA 4R8LA 1QHIA 3IAM6 1E4EB 2OXIA 2IYFA 3F7MA 3I1YA