1YQEA

Crystal structure of conserved protein of unknown function af0625
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
282
structure length
282
Chain Sequence
FQGHMKLVVCSESDTAGQNIKDNLLTFADFEEKDVGEFKLYLSDEFYIAETKERLIYADHIDEKLAKYIDFEEILFASRHSSKDGRKIFTVHVSGNVGTADFGGKPYSLAKPSPQTMKNYVLALRERLDRKPEFEFTMEVTHHGPSEISKPSAFYEIGSTEEEWKDREAAEVVAEAMLDAIRAEKMDWNVAVGVGGTHYAPRQTEIMLTTTFTFGHNFAKYTFEHLTAEFLVKAVKLSEAEYIIIDEKSVNSAVKKIVNEAAEVAGVEVLKSKKVKKDFRLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical UPF0204 protein AF0625
publication title Crystal Structure of Conserved Hypothetical Protein AF0625
rcsb
source organism Archaeoglobus fulgidus
molecule tags Structural genomics, unknown function
total genus 104
structure length 282
sequence length 282
ec nomenclature ec 3.1.1.96: D-aminoacyl-tRNA deacylase.
pdb deposition date 2005-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04414 tRNA_deacylase D-aminoacyl-tRNA deacylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold AF0625-like 1yqeA02
3.40.630.50 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase AF0625-like 1yqeA01
2GFQA 1YQEA
chains in the Genus database with same CATH superfamily
2QZPA 3FDZB 3BJRA 2R5WA 1DXOA 3CX8A 2I2WA 2I2AA 4C06A 3BDIA 2GYWA 4G5GA 3R75A 1HKUA 4TN5A 4ASUA 1T25A 4IDEA 2PHZA 1EBBA 4D96A 3KQWA 2LR0A 3KPYA 4IMIB 4C0HA 2R87A 4MA5A 1Z8HA 3LDAA 2E2WA 1CR1A 4IH1A 5J4HA 5D6OA 3D2AA 1CUXA 3R9GA 3IV6A 1ZM9A 1IPHA 1T5SA 1IRXA 1RI4A 2Z3OA 4RTKA 3JR7A 5KDDA 3CRVA 2ACWA 1W94A 1QIKA 3G89A 4EDFA 2Z3KA 2BFDB 4S35A 2QL9A 4FYJA 1E2LA 4PR0A 4CKCA 3LUHA 3ZZNA 1IUOA 4EA8A 3SC2B 5DXAA 2EYUA 3CZQA 1K88A 1IBRA 5ALZA 1FS4A 4KI7A 2ZUFA 3ZLVA 2ZYHA 4BFUA 2V58A 1XMIA 2BVNA 3QWBA 4BNJA 1GFSA 4KSFA 2G08A 3WV4A 1SOAA 4D74A 4GVPA 1ZOLA 1U2DC 4G4IA 1QUFA 3ZS8A 1GQQA 2ZUSA 4W9NA 3D4OA 1XGKA 2W2LD 1HMPA 1I30A 1L7NA 1QZTA 2JLVA 5FD8A 4HCJA 1XEXB 3KLOA 4FOSA 3N3AC 3ZDCA 2H11A 5A7GA 2FHSA 1R9NA 2UUOA 4MW7A 1VHTA 1YA6A 2WJWA 4BWVA 3L9WA 4RA9A 3I1IA 1PFQA 4G4SO 3IKJA 4C7OA 3FR8A 5JY1A 1G2QA 4U7GA 1P75A 4QICA 4LZNA 2WWTA 3SZRA 3A26A 2NXWA 2ZOSA 3IL2A 2J5XA 1QSNA 2FRXA 3QUSA 3JAMA 4NAVA 1A95A 3CSDA 3HDJA 3JYPA 3N8HA 4QXRA 3V7YA 3IWGA 2OHIA 3FFAA 3TXYA 5TNXA 1S7KA 4NXYA 3TS1A 3FCUB 5LLDA 2ZJAA 4UEEA 5CH8A 5EKTA 4XASA 3ZQ6A 1O94A 3RRFA 1TEXA 5DGTA 4QM6A 2CLEB 4WNAA 2JD0A 5DTRA 2ZPAA 3S6HA 1EH5A 5IAKA 4JLVA 3TM4A 3N07A 3VOSA 2XDWA 2KLBA 1T2UA 3OECA 4TSFD 3R3SA 4B5PA 4A7PA 3AHHA 4HB3A 3OSZA 4AROA 1YDMA 1QSRA 1VGRA 2C96A 2BRUC 5GJVC 2PQ8A 4BVEA 4UIAA 3L7IA 3OO0A 3VO8A 2VAPA 3JQBA 4KVOE 3BH7A 1KZ4A 1NQOA 4MJ7A 4HNRA 1V26A 1GGMA 4OFBA 2DSTA 2NOAA 4IRXA 1M72A 2VA8A 3VH3A 1M8GA 4I9NA 4J3GA 2D2VA 5AW6A 5IJAA 5HG0A 3JQFA 1NBWB 2K2WA 3MAJA 2PR7A 4IY1A 5GZ3A 3ZHRA 1S6YA 3D7SA 1HT3A 1NVDA 1G7RA 4LBYA 2B4YA 4G65A 1D9XA 1UXIA 3MW8A 1ULZA 1QANA 3JQAA 1BVYF 4PZYA 4DJ5X 1WMFA 4CCWA 1AF7A 1NBEA 4LNUA 1ZOOA 1I01A 5C8DA 3LO5A 3JD0A 4YP0A 2ZJ4A 3WIUA 3DBRA 1GQ2A 2PJZA 2QXYA 2C42A 4MSUA 4BJ3A 3GRUA 2O5EA 3DMTC 3U3DA 4DRXB 1FFAA 2F7VA 2YS7A 4I81A 3QBTA 1O8CA 3ZJVA 4HDSA 1OILA 5LP6F 1DBQA 3P9PA 4NS4A 1CUWA 2Q1XA 4B5OA 3L8FA 4GUDA 1FYDA 1LH0A 4WKOA 3ES9A 1M67A 4PF1A 5DRYA 5B1YA 2WB4A 2HJSA 1OHHA 4DPLA 3ZWQA 3C98A 4JBYA 1ZYUA 5FUYA 1T4MA 2JGEA 3CLVA 4CKWB 2I1LA 3SR0A 3L43A 2ZJBA 1C80A 5EAIA 3WK4A 3PB6X 4JBNA 3H4QA 4XI9A 1AUQA 4YRQA 4UE3S 4W5NA 1ND6A 2W8BA 4RKFA 1ZZEA 4FDLA 2ATRA 3T61A 4C04A 3SQDA 1FPMA 4DR4B 2D0OB 4GVXA 3R3WA 1XCLA 1QZXA 4MWOA 3F3SA 4PRLA 1D9ZA 5L3SB 2WICA 4CV2A 4LQGA 3SLRA 2PYZA 1DEKA 1WXWA 1KYWA 4WDRA 4JKYA 1SBHA 4B5LA 2P1DA 1R8JA 3L18A 2QAGC 2CZCA 1Y8CA 2NLOA 1V3TA 1HDEA 2FW7A 1FXWA 1KYTA 3GC6A 4RTPA 3LRXA 1TKAA 2QB5A 2ZIWB 3WGGA 3FVWA 3NIGB 2C2ZA 1ARMA 1DFGA 2WFMA 4PO9A 1Y5LA 2O7NA 4MFZA 3OURA 3JZMA 1DVRA 4B3RB 3AESB 3M70A 4DB4A 4V0KA 5GGYA 2HRZA 3GXBA 2V1XA 2XUHA 4PLVA 2MSWA 3GT0A 4C0BA 4FFBA 2JJ2D 3DP9A 3G0BA 2GBCA 3EFHA 2V5AA 1Q1GA 1L4MA 4JOSA 3B1XA 4RL6A 1Y9DA 4EG6A 2JEVA 1L7PA 1O6ZA 2KHZA 4J0GA 3ZHBA 2ZYWX 4Q15A 4RPGA 3JZIA 2J1LA 2YVAA 2FSFA 2GK7A 1FDSA 1IJKA 4JLOA 4UC0A 3K53A 4WMLA 1PWXA 4F9GA 5DYTA 1YA4A 5F7OA 3KX2A 1KYVA 1QPZA 2YXBA 4ZOLF 1PT6A 1GCGA 3KQHA 5CB6A 5SY6A 4C7HA 2JAOA 3F7NA 1O4VA 4TV8A 2P7HA 1NU6A 3R3YA 2OHXA 3TTXA 3VXKA 4NBWA 2H1SA 4DY4A 1QRRA 4QO8A 1NOIA 1IB0A 3CJTA 4EPVA 3VU1A 4BMDA 3NNSA 1XWFA 5KWVA 1C3OB 4ZYYA 2J3IA 1YR0A 3B3SA 5HH1A 5JAOA 1IXYA 1ESEA 1I8TA 2HMVA 4WJZA 4AP9A 1TPZA 2WNIA 4M86A 2R1VB 2ZXFA 4MVJH 2VK4A 3REFA 2O3UA 4ML3A 5JMTA 2RIRA 1YW6A 2BEUB 2UVPB 4GZMA 1GGHA 3ZW8A 3HN2A 5E4JA 2WU3A 1S2OA 3EG5A 4IGAA 2CNDA 2PGJA 2P75A 2VRCA 4BZXA 5K8MA 2ZRFA 2JG3A 2DR0A 3JQEA 1CSEE 3B7WA 1QU2A 1K75A 4YUWA 3IIIA 1TVKA 1CS0A 4P08A 4Q4HA 5MN4A 5AIBA 2VQEB 5CBPB 3IVXA 4RFSA 3NDIA 1QLJA 3KQVA 2OXEA 4Z2AA 1GRQA 1L4EA 4TL7A 2HJHA 3F5MA 4RELA 1XEAA 2ONYA 2XITA 5I4BA 3STXA 1ZITA 2GF2A 3DE7X 3HFGA 4BO7A 4HWRA 3FA2A 2DFKB 2J3KA 1WXIA 5FL7A 3V5NA 1W36C 4ND3A 2JEOA 3UHOA 1ZVVA 3ER9A 4JN6B 3VX4A 1DS6A 5FOSA 1RWWA 3W6ZA 4BUJA 4TWAA 4U0KA 4AWAA 4XIIA 2GM4A 2OB1A 4PONA 4YEDA 5E6RA 3UH1A 1EUCA 5EQTA 4O6VA 1S1MA 5J8FA 1GAEO 2OXTA 3U4HA 3EVAA 5TPWA 4LDRA 4HDNB 4G9EA 4YAIA 5T4BA 5BQPA 1XYYA 1G5TA 1ZJWA 3PXGA 5E3IA 3B38A 4TV9A 3WYNA 3QMPA 2FSVC 1CUEA 5BN3A 5JSQA 1NA5A 3IIJA 2VBQA 1Z5UA 3HB9A 4OV6B 2CZQA 3WAKA 1YGPA 4KVFA 5HF9A 1P74A 5D51S 3RIYA 2ZATA 3H18A 3AEQA 4BV9A 4MR8B 3VUFA 2VHTA 1TX4B 2YWCA 5LZ4A 5CEJA 3EOZA 2P30A 4KSYA 2JCYA 4ZBGA 3N7TA 3G8YA 1DEXA 1UP6A 2AEEA 5HQJA 2CVQA 1FB5A 5IAAA 1OXMA 2ANBA 5K3EA 5JROA 1KEUA 1XE4A 1P2DA 5D5HA 4QU0A 3ONEA 4KGXA 4L0DA 4EX6A 4V1CB 4CCAA 4HLUA 1NX9A 3PK0A 5D7NA 2AJDA 4QZVA 1IATA 3TZCA 1EFHA 3LKBA 1ENOA 3NEJA 1H9BA 2XDQB 1A27A 1G3RA 5CITA 4CIWA 2VJKA 4P3OA 4Q39A 1H1LB 2XOKD 1VECA 3ZE0B 1B3BA 1Y8QA 4PG5A 3S9NA 5E6UB 5FB3A 3BK2A 2ZR8A 5A5EA 1XD8A 3CJRA 3I6MA 2CW5A 3CSSA 1BGXT 2FE7A 1UJCA 3EIWA 1QPGA 5IBRA 4CQMB 1L7XA 1BS2A 3GY0A 2WIJA 3RIHA 3D6HA 2GHRA 3PWSA 4O29A 3L0ZA 2WKQA 3Q40A 1FIUA 1NRWA 2EFEB 2JGFA 1XBUA 4GKKB 5JH7B 2CY0A 1WLSA 3I37X 2D8MA 1DJLA 4RV9A 1U0OC 2BM8A 1VMAA 1X9IA 2W6PA 1N3BA 3S1LA 2IEBA 4KLNA 5FHRA 4YMLA 4DQLA 1W5BA 4XGNA 3K16A 3B85A 2ECOA 3B1YA 2A9RA 2REQA 3AWDA 3CPHA 1JQ3A 3T5BA 5DNDA 3E9MA 2OL4A 3VU9B 3INGA 1FNDA 2VCYA 3VI4B 4XR4A 1N6PA 3D64A 5HF5A 4GQAA 1KE2A 3VPCA 5KYKA 4FSHA 1F2TA 1D0SA 4NY1A 4OHVA 4WZAA 4G0QA 3IOBA 2XVMA 2C3MA 4RANA 3LYHA 5CPBA 3WYBA 2IY8A 1FMLA 1CVRA 2G4CA 1BW9B 5DCLA 3OZAA 3CR8A 4ZDWA 2C99A 1KE1A 3H8VA 1DAPA 3ZVLA 1CHNA 4ZDKA 3PDUA 2LCQA 4WESB 1M6EX 1IHXA 4ARZB 2Z1NA 5JXIA 4KRXA 3OJXA 3TAUA 4X66B 4MV0A 3F1KA 1GLGA 4RMGA 1T6NA 3CLRD 3S27A 4JX9A 1X1DA 4MV9A 1U2DA 4HX2A 4BEBA 2OO5C 4X94A 4MS1B 3T5TA 5CLIA 4FTWA 1MOSA 2UXDB 1BE0A 1XMJA 4PAMA 1AQIA 2XOXA 4EENA 2G82A 1KZ9A 2A5LA 1JPUA 5BR1A 1GGKA 3K0CC 1GQSA 3MINA 3QI2A 2SICE 1F0KA 4O4HA 4JZYA 2H52A 2RGNC 3H4MA 4JP2A 4I0WB 1KQGA 4C76A 1JHXA 4A8JB 4L6IA 3ZHSA 1FFHA 2BEWA 4AZTA 2ASVA 4DVGA 1CJSA 5IYZF 2VKQA 1FTGA 1KY2A 4LGCA 3C5EA 3DHNA 1VGQA 2FWJA 1X94A 2NZJA 4OBWA 4O4IB 4OK5A 4NE9A 3I4CA 1T9AA 5M04A 1PV2A 4DIUA 2P0WA 3VGJA 4B09A 1CVLA 1OU0A 3KQKA 2PR2A 1RO5A 3I39X 1RYEA 1FDVA 3CM0A 5JADA 1A2KC 3E70C 4REQA 1TGYA 4H9GA 3FLAA 5KUTA 4R9NA 4XOUA 1CZOA 4DA0A 3TVTA 1LXCA 3RKSA 5GWXA 1W5TA 1K8ZB 1N1GA 2WNHA 1LB1B 2XJ9A 2VWQA 5FWXA 3BJZA 2QYOA 4D9JA 3ELYA 4GLLA 4B0PA 1VC2A 3KQNA 1PQPA 2OA0A 1Y48E 1COWD 2Z98A 1Q7CA 2FX3A 5F12A 2BRUA 2OCLA 2PD6A 4QQNA 1Q44A 1D04A 4KVGA 4HFRA 1JB1A 2C20A 2O2JA 3DOUA 2FPLA 1VKHA 4AWBA 4UM9B 5F1PA 3HGQA 2JAQA 3RABA 4J2TA 3UJBA 3K73O 4XYLA 1CUBA 1GQRA 1L5GB 4DILA 3I5AA 2FNAA 3DE4X 4UUMA 4PBSA 4L5IA 3Q3IA 3GPBA 1SR8A 4G01B 1ZUIA 4RD1A 4NGMA 2DQ4A 1Z37A 3DNSA 3QX9A 4KFRA 4EKGA 2XYGA 13PKA 2SNIE 5AI6A 1AGXA 1V95A 4QHYA 3GROA 3K2KA 3UMSA 4BMOB 4PNHA 2GWRA 3E1KA 4AO8A 1X8JA 2VTDA 4YMTA 2UYHA 3K9LA 3LUDA 4XYGA 3BIJA 5JRJA 1K4JA 4Z0TA 1O7JA 1TRKA 4FYKA 1T15A 1HYEA 1DQNA 1KSJA 2UUCB 2Z30A 1H0HA 4X1IB 2X7XA 1NAIA 3DMNA 2B7BA 3S70A 2GHTA 3KR0A 4PPGA 3TAXA 1OLOA 1QP7A 3ZU6A 4DCJA 4NAHA 1GLNA 3A4YA 1MJ5A 1U8CB 2FW0A 1CY7A 4C21A 3DMTA 1Q7RA 2ZSHA 2Z5LA 3EEFA 1T6BY 4YRPA 3IT1A 2O52A 1RJWA 2EWMA 1RHUA 4HQ6A 2JFUA 3NW9A 3KTFA 2C2WA 4EI7A 2VUHB 4QX6A 4BNHA 3PENA 2WJIA 3EX7C 4RY2A 2LCFA 4CF5A 3D8TA 1U0NA 3W4KA 3AINA 5F1YA 1OXTA 1CU1A 3M6UA 1F2UA 1CIVA 3RK0A 1R4MB 2DLNA 1T26A 4E5SA 1PUJA 3CX7A 1GDTA 3P26A 4C2XA 3PQ5A 1QKIA 3E1GA 1M1NB 3LYUA 4FYHA 5LQRA 1Z28A 3COPA 2F6RA 4EVSA 1WNFA 3ZDEA 3FKSA 4TXNA 2B3TA 1SUCA 4KACA 3SC4A 1TF5A 1WZ2A 4I55A 4UQOA 4FFSA 2OZEA 2NX2A 1NMXA 2KE5A 4BYMA 1GRRA 5DGXA 1D3AA 2RBKA 3OLZA 1FFEA 1UADA 4R2LA 2ICAA 4Q3OA 4IDBA 3NGXA 2LE0A 4HWOA 5AKEA 4I5DA 3AFIA 3S1AA 1QTRA 1OFUA 1EUDA 1QX3A 1DPGA 2QAGA 5JAHA 1GZ6A 4INAA 1UWKA 5TXGA 2WU1A 1WEKA 2O0JA 3RVJA 4AUKA 5BW5A 1TGVA 2JCVA 4J6EA 3P1JA 3OOSA 1W44A 3I9SA 4CF6A 1K66A 4BKQA 1YQTA 3EODA 3EXG2 3WWOA 3A3NA 3L92A 3ETLA 2ZEEA 1RWKA 3EUAA 1ISHA 2ZIEA 3I05A 1LWOA 2H0QA 1A7JA 4NBTA 1ZSVA 1X7YB 3ANTA 4Q4AB 3WNVA 2XA1A 2G07A 1IBMB 5AW1A 3MGCA 2WW8A 3T0GA 2BSAA 1OYWA 3CZPA 4YAWA 4MI9A 4D43A 1YFLA 2A35A 3V3TA 1IG3A 1U7HA 3BYZA 1GSAA 1KU6A 2JGJA 3DDZX 4W6ZA 3FH0A 1ZWLA 1NZJA 2YYSA 5EMNA 1CG2A 2GCNA 1RIIA 3GFOA 4R81A 1TT7A 3UJ7A 1DBRA 4UFNA 2P3SA 2R84A 4BBPA 4OC2A 4NRDA 3H19A 4N5DA 1KY3A 1UL1X 5KQLA 2BE7A 3MBOA 1EPUA 1TCAA 2H5IA 2RHGB 3U3RA 4I5FA 4NCIA 1CPSA 4MXUA 1BFUA 3A3KA 1LX7A 4X62B 3W91A 3TUJC 5FPYA 5E8RA 5KSPA 2JFYA 4J29A 2EZ8A 1B74A 1NTOA 4OQZA 3WO1A 2FG6C 4CQLB 1W0KA 3BULA 3LPLA 3SK0A 2BEVB 2C2GA 3AY6A 4PTLA 4AL4A 3ZV4A 5DGHA 4BKOA 2YL2A 3GLFB 4TYWA 1QNFA 1P7CA 4X20A 1FE8A 2P2DA 3Q7RA 1DCMA 2CLFB 3R0ZA 3FWZA 5H8WA 3JZAA 3OFNA 4QGSA 4MWZA 2GJAA 4OHWA 5LYJF 3UPTA 3P2KA 4XPZA 4E4YA 3GIUA 2CLMB 2QPAA 3DBHB 2ZVPX 3WLTA 2BM9A 1OZ0A 3GUVA 4TQ9A 1NJ6A 1NVTA 1QSMA 1IDOA 1Q3HA 4ZCQA 1QV6A 5B57C 4J7CA 1OE0A 3UWOA 2Q4TA 1Q11A 4ITRC 4I50A 4NCBA 4H3HB 2QRMA 4PN3A 1TMGE 1XVIA 2UZAA 1OW3B 2ORED 4GI5A 4UWJA 4N3BA 1BXGA 2NNLD 1QO0A 1KEPA 2UYQA 2XMQA 3E22A 4TXJA 4CMBA 4ZO6A 2WDPA 4BCBA 4P7GA 3OJCA 1LOKA 1QHIA 6REQB 2VF2A 4N39A 3GBSA 3ZD7A 2C6GA 1T9GR 2B0JA 2C4HA 4G5OA 1NT2A 5LLTA 3KB6A 2I1VB 1A3CA 4RGVA 4H0NA 1RMQA 2PSSA 5FUVA 3AERA 3P94A 2BGNA 1JKMA 1FNSA 4NGNA 1LBTA 4HTFB 1W49A 3I6BA 3SXUB 1OVMA 1U1DA 2FSVA 1H6AA 2D0PB 5CB4A 1VBMA 3RO0A 3CNOA 2C8LA 4TRMA 2DTXA 2DT5A 4YRNA 3N2NA 4QUJA 2MIIA 2PH5A 3R7FA 2QMOA 4O63O 2NSMA 2ZB8A 2RKBA 1ZC4A 3QVLA 3FJYA 1LAPA 1B3RA 3D6NB 5ARCA 1SG0A 1I3NA 2H51A 4IIJF 5G0TA 5FBWB 2PQ0A 1UJ6A 3GI1A 1CF9A 4HFMA 4MDHA 5C7IO 1QAMA 3WGUA 4LYEA 4UMFA 4OJYA 4CS0B 2RJ3A 3TO6A 3P19A 5AVJA 3HGTA 2YFYA 1HYQA 4IW3B 1BWSA 4JGIA 5ESWA 3UK7A 2FI1A 4ZY1A 4ZAVA 4AVCA 3KTAB 4RNCA 1FPQA 5JQGB 3R96A 1L4GA 1HDCA 1TO2E 3UANA 2Z9BA 2C94A 1UFQA 3IR5A 3KV1A 5IDYA 1NVEA 4L57A 3GIDA 3GAZA 4G07A 1CLUA 3ESDA 1E3LA 2FSPA 4U2GA 4CUZA 1VCIA 3M6XA 1NUAA 4DZTA 2CJWA 5COQA 3W6NA 1Z17A 3A36A 1WTCA 1JNXX 3GUXA 2ZB3A 3KALA 3NG1A 2VOJA 2VP2A 4FZ5A 1N8KA 3NCTA 3K70B 1PLKA 3TW8A 3DW3X 3ASYA 4CN8A 4MKIA 2RGCA 5IEJA 1X86B 2IEYA 4ZC8A 4WWHA 2KMLA 4NULA 1CE8B 3TLZA 5B2EA 3A9LA 4DNQA 2F7SA 4RZSA 3JR3A 2JEWA 2CCGA 5EEGA 2NQTA 3MGGA 5KTKA 4WJBA 4Y6GB 3F5BA 4W1RA 2Q41A 1C0LA 2VNIA 5AOVA 2J41A 3R4CA 2AA3A 3IEIA 1A9RA 3KJIA 1ZICA 1W59A 1TPYA 1GDHA 7YASA 3SNHA 5AVOA 5KYWB 1HLDA 3TLJA 2AJTA 2QE6A 1U28C 3L2OB 3SBOA 2X4DA 1XCPA 4HNQA 5LZ9A 2K7ZA 5HKKD 2XR1A 1H69A 3MMPA 1VE5A 2ACKA 2B34A 2GPAA 3CO5A 1KQOA 3NT5A 2JA1A 1QMGA 1V0JA 1LW6E 2PJDA 3W7BA 2KBEA 1YCDA 4WFKA 2R6CA 1DTWA 4PFQA 1VPDA 2QZJA 4RYDA 4UHJA 3OZEA 1JILA 4FKMA 2AFIB 4R0VA 3THRA 2QIRA 3PNLA 1Q77A 5AW2A 2IJZA 3QKUA 4H6WA 4P4UA 1M2FA 4Q3NA 2ANPA 2CHVA 1B6GA 5DCWA 4RGQA 5D1NA 4LX8A 5FBKA 4A16A 1QCZA 1MVLA 2I9KA 3W7VA 1U7UA 2I87A 2NVBA 2M9MA 4ZVLA 2AXEA 3WZMA 2WVGA 1MQSA 3I0MA 3FMCA 3DEIA 4BO2A 2ZUTA 1Q6YA 1OIVA 4NJOA 5DTEA 4UHFA 2GF9A 2H4JA 4MRVA 3WMFA 3VC7A 1NSAA 4CIYA 1HLPA 2VDNB 2F4NA 2OO5A 1UM9A 5JANA 1GNVA 5KKNB 5KIAA 1IUNA 1M1XB 3RBAA 3KDPA 4ZT2A 2MOKA 4YXWD 2P6PA 1U80A 5IW8A 4DDMA 3EIUA 1U0SY 3K0CA 1T1IA 3HM9A 1C7ZA 2YVKA 3JWHA 2RGNA 3NRBA 3WSVA 4EEKA 3PEYA 3BWVA 4A23A 1GCOA 2IUEA 3IQWA 2IH5A 4J75A 1AYEA 5ILQA 1CR4A 1Z2LA 2XA2A 1Z4MA 5ESXA 2YYYA 3I83A 1NQXA 1D8AA 5JSHA 4ZY2A 2VQDA 1XAHA 3BS4A 3TI9A 1B76A 1UPUA 5L53A 4BVFA 1CUCA 4YT4A 1OTXA 3PG5A 4WNYA 3Q6MA 4Y67A 2R4TA 5KREA 4GM4A 3REQA 4WZAE 4C3VA 3OEEA 1Q0LA 5B37A 4K05A 2OFOA 3KT0A 3DTVA 4W5OA 3HYSA 2W6IA 3NKFA 5IXJA 1TUBA 3OCZA 4HZUB 1BRTA 1J8FA 1A9XA 4M60A 2O2ZA 1M6WA 3MTJA 2CFTA 3ROEA 2EBFX 3AONB 3IDFA 2JCBA 3SHTA 2F1OA 1GTL1 3KKKA 3FPKA 2VL7A 5KTPA 1KDOA 5A9RA 4KR6A 3FF3A 3CW2A 2FCAA 3IQFA 5E1MA 3T7EA 4AJIA 2CYCA 3PC8C 1VHQA 4J03A 2GJ4A 4HRAA 1KNQA 2DBVO 2XUDA 2HKIA 3HBMA 2CL5A 1PJRA 4RA6B 3RTGA 4MKFA 4D8YA 5HIJA 2NZ2A 5C4MA 3HVKA 2OORC 5F2KA 4AMBA 3KKPA 2JVKA 2QI9C 4EQ6A 4HKFA 4WH0A 1UK9A 4URHA 3LLCA 4YRRA 1YOVA 5HJ2A 1Q1QA 1XXHB 5JSZB 4IKPA 2JI9A 1Q0UA 3VHXA 3WBJA 2ZI9A 4XTRA 2JLRA 4DJEC 2XWJI 5TF4A 1Y3CE 2WK1A 3FUCA 4B4UA 1IICA 2GHQA 2BFEA 4BLRA 2IEDA 3Q1LA 2ZVDA 4G4GA 2O57A 2XB4A 3HUDA 4AZ3B 1Z45A 3LC2O 4R7TA 4JI2B 1KYYA 2Y1CA 3A7DA 3SD7A 2DM6A 3F5FA 1E99A 3PFCA 2YKGA 4HNGA 1EM8B 4D0SA 4RKQA 5C37A 3RASA 2IYSA 5CMLA 5IPFA 4Q47A 3UQZA 4EB6B 4EHKA 3BXXA 2VP5A 2RI0A 2NAFA 3FGZA 4QJ4A 4M0PA 4BBZA 1IN8A 1JAHA 2L17A 3WLSA 4Q38A 5ALSA 4O25A 1XRQA 3SYRA 4IIBA 2GF0A 4A33A 2V6JA 3WJ1A 3OJOA 3Q8WA 1X7ZB 3WLLA 4TKLA 4FIZA 4TYYA 3WOVA 1Z0AA 5CIQA 2ZW5A 4KO8A 1DWOA 2Q6TA 4OJQA 1MRZA 1CNMA 2XGMA 4I2VA 4ENQA 5BOSA 3TZQA 3PDJA 2ZI3A 4RAQA 5AUQA 4DA6A 2PZEA 2RHLA 3SF0A 2D2EA 2F67A 1YDGA 2JBAB 2Z58A 4UEFA 5HCUA 1P9NA 4H7KA 4OO3A 4NQRA 4S2UA 4P38A 4FEAA 2WUEA 3DLJA 4H4CA 4RU1A 1DBPA 1KQFA 1NOJA 2FEWB 2N1BA 3UMVA 1TKFA 1QQ5A 1O6BA 4H27A 5HTOA 2FPGB 2DPYA 2Q2VA 2XE8A 2IU3A 1KRWA 3EDCA 4DQXA 3FOCA 2ZE6A 1ESDA 3QU9A 1GKKA 3NE7A 5LYYA 5E7JA 2H57A 1DQPA 4GECA 2P2SA 3TLGA 5CDSA 4B32A 1MGPA 3CE9A 1MZVA 2FIWA 4OK6A 3ND5A 5ISVA 3A0RB 3PDHA 5K03A 1W0JD 2H00A 5DTQA 2VDWA 2HR1A 2R44A 4HYEA 4NH0A 1XMPA 3TZLA 3D2BA 1PG5A 3S2ZA 1DI0A 3C1OA 3ZUGA 4GQIA 2JASA 2CUKA 4BASA 1N36B 2HJWA 2V59A 4G5FA 1N6IA 3MMZA 4HFJA 4MUNA 4JBWA 1Z75A 2HSWA 4KZTA 3R5KA 2UXBB 1FUYB 4DQDA 3LDUA 4RPJA 2VT6A 3FXTA 2IVZA 4FMCF 4XX0B 3KUKA 2VYNA 4II7A 1VSQA 3WHKA 4C05A 2PM8A 4H35A 3SICE 3GNQA 2EJUA 4W9YA 4KEAA 4QTUB 2PKQP 1UQRA 4MO9A 1GUFA 3SKVA 2V4MA 1FY2A 1AGYA 4YJ2F 3KSMA 5LDGA 5JCZA 4YCMA 2Z1DA 3S1SA 3K0FA 3R7WA 4LKRA 5DN6D 2IYOA 3ETJA 3JAKB 5TEVA 2HPZA 1M9NA 1NRXA 2ZAOA 3MOIA 5I5GA 1TZCA 2QLNA 3NFZA 4BCCA 2XTJA 2A33A 1CG6A 1H2EA 4B83A 4DXHA 2LDBA 5G0UA 3EZFA 3I4FA 1PJQA 5EQDA 2AN1A 2OHGA 2JGIA 3DOEA 2OQRA 1L5MA 5EJIA 1JU4A 2H54A 2AFUA 1XVUA 1WG8A 3R3XA 4CETA 2WM8A 3VVBA 3D2MA 3QX7A 1ZNYA 3ZIUA 3P96A 1VRCA 5DH9A 1XOVA 4GZ5A 4PHHA 3DOHA 3JYLA 5LNK6 1E3WB 1UEJA 2XTMA 3PQ4A 5BVHB 5LWQA 1Z35A 2NTYC 3SQOA 1EHIA 1K97A 3WLRA 3ZVRA 3HPRA 3BZBA 2WYIA 1XZJA 3B9QA 4LRSB 3EZNA 2Z9CA 4Q82A 4PAQA 1PR9A 2C83A 5EUCA 2R1TB 3RVQA 5I47A 3MB5A 1VI5A 4V0OA 4YCLA 2RG7A 1LSJA 3BDAA 1GG8A 4XYMA 1TM1E 4S3MA 4FFNA 3I58A 3BDVA 3DPIA 4OTZA 4XEUA 4N8EA 5I4KA 1O0BA 4OKIA 3PGVA 2H4YA 1ARZA 4I4TB 2HMWA 5M29A 3UXHA 3O8RA 2JH8A 2ZDHA 3HKEB 3OQVA 2H5JA 3C3YA 3ZCPA 3RAPR 1F1JA 2JIQA 3Q9LA 4OGFA 3LFTA 4YAOA 1ZVMA 3I62A 5JS6A 4R76A 1X80A 2J3MA 1EB9A 2GK4A 5G22A 3UWPA 2IA5A 1QVZA 4LHXA 5LSAA 2HK9A 2H7CA 5AMXA 1UEXC 1L1QA 2CT8A 2C04A 2GZRA 1MGOA 1Z68A 5C53B 2G88A 2A6PA 3FI0A 1UBHS 1WXEA 4HPWA 3H6GA 1UEIA 4BN5A 3QQ5A 5ENVA 2QN3A 3PI6A 4U7TB 5MDHA 4MA0A 4S1OA 1UBJS 4DR7B 3DV0A 4P83A 2OYSA 3GLQA 3W2GA 2QLJA 4DA4A 2IXFA 4BP9A 2HYIC 4G67A 1Z5PA 3AF5A 5ERXA 5KOHB 3MNFA 1CEYA 4X0EA 2B8WA 4TMYA 4WXRA 4BU1A 5BW8A 3WL7A 2NAPA 3UB2A 5EERA 1SIOA 4X2TA 3FZGA 1Y1SA 1WZCA 2GXUA 2XHEA 1DOAA 2VZLA 1LRJA 4YIKA 2OILA 1LNQA 1NQVA 7MHTA 4MW4A 5EVJA 4EKIA 4ZALA 3PQ7A 1XCGB 4JBXA 1KXJA 3PXUA 1YUBA 3FF4A 3P2EA 3MMSA 1QGED 2AWNA 2XJ4A 4V3CA 2DWQA 2C5EA 4KGDA 4NBUA 4C03A 1NUQA 2A67A 4BRZA 4BQFA 4PNEA 3LSTA 2EW1A 1YC2A 3ZGZA 1TK3A 2WJZB 4EHNA 2NSLA 3PB8X 3TDKA 5J2TA 2GTPA 4RH0A 2EUIA 2ZJYA 3W2FA 2E85A 3GJ3A 5IFKA 5SICE 3C8DA 4J16C 2VC2B 1VXOA 2GZMA 2CMGA 3WGJA 3NP7A 2IYAA 1JVNA 4OB7A 2HU8A 3CNEA 3GRCA 4NU5A 4D92A 1MUUA 1E3MA 4XUDA 1U28A 2O4UX 3HR8A 1YUNA 4YGXB 3LUCA 1UWYA 2PSJA 4IM7A 1OXKB 3E23A 5L8VA 4H08A 2RGYA 3SVTA 5SYAA 4F93B 3DEJA 5LM3A 3BT7A 4UUAA 1SBQA 1HOTA 3CUVA 2E4VA 1JFTA 4FBLA 3H5IA 1XTIA 1F5SA 2Q9BA 4PYIA 3ENQA 5BXQC 3QEMA 2PQMA 3NHKA 3MT8A 3BPSA 2ZB2A 2D7CA 5K0NA 4E2AA 3FUVA 3AR4A 3KSDO 1OPXA 1RP7A 3O4GA 1C2YA 1HE2A 5FO0A 4FD5A 5TEWA 5FQOA 2P67A 3AEXA 1K5PA 3OLYA 2AN3A 3RRXA 4KQFA 1YI1A 1ZJZA 4LQCA 2NUPA 3KQUA 3NO4A 3E3MA 3GN1A 1G3UA 5K0SA 1XJ5A 4YUXA 1PBNA 2J8MA 1ST3A 1PG2A 1UP7A 1T0BA 1VHDA 4KV9A 5E3JA 4B9EA 1GPNA 4V38A 2H1RA 3L07A 2HFKA 1R50A 2FWPA 3OC6A 1WU8A 3I32A 5BN4B 3V3KA 3TIXB 2B82A 4OBXA 1FSPA 3GHYA 1WETA 4YYEA 1CRLA 1I6MA 1XPJA 3TLYA 5C32A 1OXUA 5LIPA 4DG9A 3E4CA 4OL9A 1Q0SA 1P2FA 4TLEA 2VDKB 2VSOA 1UZUA 2YZ2A 1Y6JA 3TT2A 3PQ6A 2MSEB 4LSZA 3G5TA 1BCRA 3KQOA 5H3CA 2W43A 2WPDA 4L1KA 4FJ2A 3MT9A 3HZHA 3AHGA 4YP7A 3G8BA 1JQKA 4B2YA 1MQ8B 2IPOA 2OBBA 3LCVB 3DZCA 1YS6A 3EGWA 1I12A 4QEZA 5ER6A 2FOXA 1QHXA 1Q91A 3A04A 3ZWPA 1YS9A 4BC1A 3KJGA 1ZRMA 3NWPA 2Z0MA 5JDCC 4ZQFA 4YDRA 3OM0A 3D1JA 1P1CA 2ZYSA 3H4VA 2GUWA 3MCVA 2HWXA 4OJKA 5JZ9A 3IP1A 3H1GA 1ORDA 5H83A 1SVOA 3PEWA 3WKEA 4PGHA 3INTA 4MUYA 3GGCA 3X1DA 2O2IA 3VR5D 1US8B 4CEIA 1HA3A 2O8CB 4DSOA 2AG1A 1Z15A 2HA0A 2O8FB 3UTCA 3K5HA 5K20A 3NGLA 3PC8A 5TRTA 4F3CA 4ND7A 3IOCA 1B73A 2UZ1B 3WK7A 1JEQB 2QPTA 2V8VA 1NM5C 4B3IA 2O6HA 1JSLA 3ITKA 3FCYA 1DUVG 2HWKA 3RVDA 3AHIA 4YIHA 3E5HA 1ZK3A 3NAQA 1RVV1 2ZAGA 2OORA 3AU9A 2XNDD 1KR5A 1KO8A 1CM0A 3KZOA 2HIMA 4UXIA 1NI4A 2Q3JA 4HLQB 4RS3A 3NJRA 2CDAA 3N0RA 3G7NA 2J3EA 3QOXA 4ZIRA 1OI4A 1E2PA 4L3OA 2IRWA 1UBLS 1WY7A 1DDOA 4BGVA 1X8KA 4YAEA 4FEGA 1HDIA 1ENZA 1DQZA 3Q72A 4NSQA 2VTBB 1QRUA 5C18A 3CEHA 4FCTA 5JAPA 2IBTA 1RI3A 3TD9A 2A0UA 4R7GA 3H75A 2GLUA 4Q02A 1FMJA 2PVWA 4QXOA 1VKZA 2WUGA 4WW0A 4M9RA 3SN6A 5KOJB 2VNAA 1BYUA 1N9ZA 4D8XA 5KVVA 2DWCA 4BKUA 4EZEA 1PBTA 4P33A 5LRJA 4F6AA 3HUFA 3HZOA 4G1VA 4G26A 2JLAA 2YN0A 2BEJA 5KBYA 3OT1A 4F91B 2BEKA 4P44A 1LPMA 5C31A 3EXIA 1V3UA 4YV2A 4JK3A 5CVUA 4P45A 2GN6A 5ESDA 3T5CA 4HI0E 5ADWA 3D1VA 5E7IA 3KL2A 5JJKA 4W5WA 4XFJA 1Y6GA 4D0GA 2WFZA 5LRKA 2OHJA 2GN0A 2PX4A 2QVGA 2Q5HA 2QTMA 2EARA 3UFXA 4WZBA 3OZTA 1TW2A 2RSLA 5DCYA 4QYSA 4RVDA 1MOQA 4QU8A 3FJOA 3L3BA 4PV6A 1JJ7A 3FXAA 3EGXA 4NU0A 4J90A 2W6QA 4R8SA 1L7VC 1FFBA 4BQRA 2F48A 4DIDA 1JQLB 4R8VA 2REFA 2CLSA 4X65B 4ZFNA 1URPA 2V7VA 1O0SA 5ECYA 2W83A 1L4KA 4D98A 3HM2A 4EY8A 3JQCA 3W9YA 2YWJA 1I21A 1ESZA 3OU7A 5EKXA 5DSTA 3NTXA 2FA9A 1K2VN 3HA3A 1M6VA 2YWEA 1I2MA 3LXMA 5ITWA 4N7BA 5AVTA 3NDPA 5JFTA 1SC4A 3MCAA 3R5XA 1SKYB 3KYCA 4L3VA 3T9EA 2FW6A 2FZLA 4UCNA 4FR5A 4DT1B 3T0IA 3OX1A 5AOBA 3BWBA 1Z6PA 1EP9A 1BE8A 3N76A 1WL8A 1VRWA 4ZZ2A 2XSZA 4UASA 1Y6FA 3PXBA 4LDNA 2Z2ZA 2NVWA 4LOAA 2ETVA 1QDLB 5GONA 2P9JA 5ALIA 4P4BA 4DR2B 4B7CA 1WXXA 3UJ6A 3SX0A 2W0SA 1TEZA 1NUSA 3I9NA 1GL3A 3FJUA 2PCJA 5IB9A 5DYNA 5BUZA 2I79A 2EFDB 2A3RA 4BMNA 4AXXA 5GADl 1BE6A 2V54A 1E4VA 2BI4A 4BFVA 4WXMA 2JFNA 3AR6A 1XG5A 1B15A 1PLLA 4D1YA 3K2EA 3NI2A 3HVRA 2E4UA 1UBGA 3CTPA 2PKWA 3RCBA 2AYYA 3W77A 2OCDA 2V5VA 4K9LA 4J7UA 3T94A 4BO3A 4Q4DA 5B4VA 5JXHA 2PJ5A 3M9WA 1ZN2A 1H4VB 2QLBA 3IFEA 2JI8A 5IK2A 1LTQA 3TQOA 5I9IA 2OBYA 5AFSA 3GG2A 1XMOB 3O2QB 2G3TA 4H7JA 1O9GA 3IVAA 1QF9A 2H3EA 1A5SB 2IZ6A 3QOYA 4JQOA 4ID9A 1LANA 3WYCA 3ZC3A 5H82A 2AE6A 1Z0SA 2AHOA 1PQYA 1GT91 4JI8B 3D6AA 5KTNA 4M6HA 3UPUA 2Z43A 2R6GA 3MSXA 1IY8A 1RZVA 4L22A 1A8QA 4ICIA 4D9HA 3P4XA 1Z4NA 2HJGA 4EECA 3OJ0A 2OG2A 4ONEA 3VAAA 5B53A 1V47A 4B12A 3ZJ4A 4CKXA 5ABPA 5AUPB 4DFDA 4MVJI 1IRIA 1QHNA 4LCJA 2VSQA 2Q5EA 4O0LA 2ZROA 1ORIA 2X4IA 1YZ3A 1CJUC 2O3SA 5IKMA 3AM1A 1JHVA 1QP8A 2J31A 2Q3CA 1IY2A 3WYDA 5KYUB 2CJYA 4HVLA 2X58A 4PLPA 2NWQA 3MGAA 2W2OA 2B3VA 4ALKA 5T4EA 4ZO8A 3GGGA 2FPIA 1JXAA 4MIKA 1IM8A 2A7XA 1RYYA 1PR1A 2NXCA 4UTOA 1TJYA 3THSA 1OLXA 3PC2A 1NSFA 4DE5A 4OIFA 3HL4A 4JQYA 1SK8A 3W04A 4G0VA 3ZHYA 1SELA 4BNUA 5I5EA 2GEJA 4BP1A 1WXHA 2BL1A 1MAAA 2CHGA 3DR3A 2GN1A 1DXYA 5H02A 4V2IA 3F6SA 3ZDQA 3DT6A 4WXHA 3WDSA 3ROTA 3G9TA 3NNNA 4M7WA 1I2CA 4DUYB 1G8JA 3KRTA 3L8EA 2ZTSA 1GU1A 2UUPA 3GJ6A 3FTQA 3CXPA 3PI7A 4IPTA 1KI9A 3PFFA 2PT5A 3NJ8A 2XBLA 3U16A 5LBUA 5LIRA 2VHYA 3GB9A 5EZYB 3WG9A 4OXIA 4M87A 4KVXA 1XMTA 2PU5A 3H9QA 1DQSA 1QF7A 3USZA 2DSNA 2ZULA 3FPCA 3M7IA 4UKDA 3FH4A 4KVAA 3EIEA 2DR2A 4QEKA 4MPDA 4Z7JA 4OM7A 4V0QA 3RHFA 3SE0A 1B6TA 1QGZA 3K5WA 4NNJA 1QLHA 1IM2A 2YWDA 1MXHA 3WGLA 1BAVA 4NMWA 4OQDA 2XDYA 1U4OA 2QY9A 1K8QA 3D6FA 4D3ZA 1WPQA 2WIFA 5LYFA 5JNLA 4KHPB 4JU9A 4AFNA 5CBMA 3Q7TA 4BNXA 2HDOA 3O26A 1HC7A 1IN6A 4EB8A 3WKBA 4NG4A 4ZOEA 4F8JA 1EDEA 3F73A 4XCXA 1FTNA 2LCIA 2YYAA 3DE0X 4NEGA 3C3XA 4GM1A 4MDEA 3W2TA 1CQIB 3QPDA 1F0YA 1V41E 4J16A 3LTNC 5JPCA 3CRQA 5JNSA 4N0EA 4D9KA 1W88A 2QJFA 1P0CA 2W2LA 1E20A 4FMDB 1QOZA 5CTJA 3I28A 1FXWF 2IS2A 4TN1A 4K6HA 5A0VA 1KPGA 4PYRA 4MKHA 1ZU5A 4E70A 2XMCA 3EBLA 5DNWA 1G4AE 4GE3A 3IAUA 3IKVA 2FL4A 3RS4A 5DN9A 3ISJA 1E1NA 3TBKA 1ZIPA 3NRJA 3L7LA 1E0KA 2BFWA 2W6JD 4B34A 1XYVA 2DPTA 2VK2A 1G3MA 3TL2A 4R2JA 4TXLA 3COYA 4YO8A 2IXGA 2QQEA 3MXTA 5FPTA 4JJ4A 4EPTA 2J0QA 2YC2C 1YSJA 1RPTA 5DULA 4IJWA 1H4QA 1Z5NA 3FNRA 3ZH2A 2WD8A 4MCQA 2OH1A 4L8AA 2BGTA 3BL8A 1BH2A 3QAHA 1E3IA 5IC5A 3ENVA 4TV8F 3O21A 4DV6B 4RVOA 1M83A 2A2ZA 2FRDC 1JG1A 1EP1B 4PSVA 3DBOB 4IF6A 1R0LA 4BNLA 1SXJB 2C59A 4INOA 4C88A 2XT0A 5J47A 3UJPA 3H7AA 3GFFA 1L7RA 4CV1A 2RJOA 1RQ2A 4D4LA 1JYSA 2A4MA 2FPKA 1I6LA 1DTDA 3Q7SA 3S2UA 4X6LA 3L0OA 5THWA 4ZCTA 4AY4A 3WQHA 4TSFA 5BSKA 1UKAA 1SXPA 4Y1RA 2BAGA 1WCWA 5JCXA 3BERA 4W5TA 3LH5A 1PTKA 4ZANA 4I66A 4N01A 5AGEA 4NMXB 2YXEA 2BIFA 4GZ3A 3HVIA 4Q12A 3SVZA 1DQYA 2P9FA 5DHQA 1ILWA 4W7HA 3P9SA 4X45A 3KE9A 4MGEA 4PG4A 1T29A 3WHPA 2IH4A 4EY3A 1FC0A 5DTJA 2WJPA 3A14A 4R40A 3T7SA 4UEOA 4GR9A 5JIBA 3ENZA 4BQOA 2DQYA 4RVNA 3OPNA 1T0HB 1V11B 2AB0A 3T35A 2IQ5A 2E18A 1P0QA 2D7DA 2GCPA 2I5PO 1B6BA 1GPDG 4UAJA 1L5SA 1P1KA 2O1EA 2IS1A 1R9GA 2IOHA 3BIWA 1P1RA 4EPXA 5L95A 5A9SA 2VQ6A 2FSGA 4FDUA 4V0ME 5JDCA 2PANA 3GBVA 4P7KA 1JTFA 2WTBA 3C1AA 3X2FA 2CSUA 3PU6A 1ZH2A 1B41A 3SS9X 5CA0A 5LXTA 3CMMA 2ID9A 1L5NA 4PIMA 3NHAA 3RVNA 4PSXA 2NNWB 3KXLA 4MQFB 5ESRA 4TV9F 3EDMA 5AHKA 2IV3A 2BBTA 3W8NA 3WL5A 3WGHA 3ITNA 1IYLA 1RXEA 1BOFA 4OY3A 2B5WA 1KYZA 1HNZB 3K71B 1Q0RA 3R76A 4E46A 1J07A 2P4EA 3KHTA 4JY7A 1NM5A 3M5WA 1JLHA 4KZKA 3FNIA 1ZS9A 4GWLA 1S3IA 3K1JA 4UMVA 2NP6A 3BL5A 3QENA 1WR8A 5IC6A 3H1EA 4WY5A 5C80A 2QAIA 3KOXA 1WB4A 1TFUA 4KQ6A 3J81k 4CLOB 4KH0A 4BLPA 2PLWA 4ND4A 1UKCA 4U7JA 1KJ8A 3FFBA 5LC1A 1JDBC 1V1MB 4JODA 4DMUB 2NU8A 4TZ6A 3USES 5EA2A 3SJBA 1XF9A 4WN9B 1B14A 3ZH9B 1FJXA 4XCQA 1KP3A 2CWDA 2WILA 4I8XA 2Q4ZA 1E1QD 3N8NA 1G4HA 5J43A 2LV8A 3VPDA 4X54A 1VPWA 3ESYA 3QFSA 2ODWA 3L40A 3SEQA 4UA3A 5ELYA 2D0DA 5EXSA 4LNAA 5ALWA 5JRZA 1PG0A 3TPZA 2GA9A 1OOEA 2PUJA 4F56A 4MEAA 1RLJA 2ZT6A 3WFJA 4AS3A 4YJFA 2D5IA 2XCOA 1HGXA 1J8YF 5I7RA 2F1HA 4FC6A 1NX6A 4U2CA 3I09A 4R84A 3C85A 1HE4A 1ON0A 3L8YA 3AR5A 621PA 3RU3A 2VATA 5JPDA 1GQOA 1KP9A 2BH9A 2D3TA 2OB0A 2A1TS 2OV6A 1CP2A 1RQPA 1DBVO 1GRCA 4UCXA 3LW8A 1V35A 3ZXIA 2XUKA 4JYMA 4JUBA 4G8DA 3CU5A 1BA2A 3VZDA 2V7XA 1A69A 3CE6A 3EY4A 5HRAA 4NTZA 2BTEA 1U2GC 4IIYA 3UHJA 5F7XA 4YRAA 3B6MA 1NATA 4AG6A 1KK3A 3T7TA 3LX8A 2IEIA 1VPLA 1PL8A 1H6DA 2DB3A 5EIHA 3COVA 5K3CA 3H8JA 1HDXA 3QY9A 3HBNA 2ZEFA 1Y8RB 4IVNA 2B25A 4Q9IA 5G1NA 1HT0A 2BFBB 2FK7A 2HA2A 1OXVA 3I0NA 1QQAA 4KTTE 3N2EA 2QYTA 4UU8A 2I8CA 3OIUA 2FWAA 3E3AA 3UYLA 3PSHA 2GVZC 1SQFA 3KKOA 3U5ZB 2WJJA 3DGEC 1J25A 4N3NA 3GCZA 2D1RA 4J3FA 5HIAA 1PWHA 1R66A 4OI4A 3DEAA 3D81A 4U1RA 3WXMA 3CH7A 1G5IA 4NABA 2YMLA 5GVSA 5AT1A 4D9EA 1H9CA 3EEYA 2VJOA 2CDBA 1W8IA 3PE4A 4ALIA 3KSAC 3JVDA 4Q1DA 4BFSA 2QVBA 5F21A 4MWDA 3OSUA 5DT9A 1NW9B 3OX3A 1EK6A 5C8YB 5CNKA 5JM6A 3B89A 2X9VA 2SECE 4IIVA 3R3JA 2V98A 3KWMA 1F8XA 1SBZA 4LF8B 3E8MA 2FPWA 4O4HF 2PKEA 1G59A 5MF6A 2VJYA 5LA6B 1DUSA 3PB4X 1MV8A 2XKKA 4WZBE 3ZLBA 4OREX 1I7LA 4TTTS 2IGBA 3HB1A 1VZ2A 2O9JA 4KITB 2W00A 2ZCVA 3MF4A 4B4DA 1ZKDA 1RYDA 3KJFA 2ODEA 1QH1B 5KHOC 4JR2A 3A1VA 1ODFA 4MYCA 5JW6A 4GOJA 2OYCA 3N53A 5AVQA 1UK8A 4FZRA 1TLLA 1J24A 4RTQA 4RM2A 4DOMA 3AIKA 1TUIA 1MEOA 1F3LA 5F2NA 3CF0A 1LNSA 2AL7A 3DO8A 4YMSA 4UM7A 2A88A 1QH0A 5U9CA 1DC4A 1ODCA 4XD2A 3PT9A 4MS4B 5I8PA 5JHGB 2R1UA 1FP4B 4QUBA 2BTOA 1UBFA 2XBUA 4BB6A 5D3ZA 5DM70 1M5RA 1G3QA 3T99A 1ZW1A 4ONWA 1KZHA 1UAYA 1RW4A 2NTEA 4G36A 5JZBA 3KVYA 1ETUA 5BN5A 4Z3KA 4L4UA 1P0IA 2N1MA 3FZEA 4PC7A 3KPJA 1XRRA 1RCUA 4JJ8A 2XUZA 5L3RA 1VB5A 4QUSA 1PEAA 2H59A 2J8RA 4PX9A 4EFKA 1OLSA 1U0TA 5KTMA 2BTQA 2RFHA 2O0LA 3AF6A 4QOEA 5BV2P 5ITZB 4GOOD 2PMCA 4D4MA 4NDZA 1SZJG 2D74A 4EABA 4FM9A 3THYB 5IV0A 3KAPA 4YDQA 1ZMXA 5G4KB 4IYRA 3S6FA 3B6KA 4YQFA 3SZMA 5B7GA 3G13A 4YCNA 4MS3A 4DCTA 4FXPA 4MPRA 4PFSA 5DO9A 2C57A 2CLLB 2BYTA 1WPRA 3VMFA 4DQUA 4RWEA 4P5EA 1ZWKA 3COZA 3JAWA 2J3HA 1M4IA 3ZYZA 3SJUA 1QC5A 2H8KA 3RU9A 1RS0A 4EH1A 3WHIA 3FDIA 3AL2A 1IAVA 3RLIA 4Z53A 1E8MA 1BO4A 1AUPA 4ESVA 3CLTD 2YJNA 5EXTA 2BJHA 4QJIA 4HZGA 4JB8A 3V1LA 4S24A 1Z9UA 5KNBD 1SGWA 3GLVA 4BNDA 3CEMA 1N33B 1QSTA 3FWKA 2GCEA 3N2GB 4EMTA 1J4AA 1A82A 2QUZA 4DDTA 5DHTA 5KWSA 5ALKA 4MA4A 4EBFA 2QMYA 4OD0A 3KGQA 2WYHA 4ZVOA 1RP1A 5ALUA 1U0HC 5KTOA 4TTSA 2W2KA 3AHCA 1UZLA 1PNOA 2OAQ1 4JVMA 4DAEA 2NZYA 3RSQA 5JXWA 1RU3A 5DBOA 4I55F 2CNTA 3MAAC 3FHJA 1M0EA 2PRJA 4ALMA 3DA8A 2AOUA 1Z2CA 4DB2A 3T38A 1MV5A 3DQQA 2IU6A 4HNYB 3PUJA 3DZDA 1YTLA 1YQUA 2CTBA 1SVMA 4PICA 4H89A 2Q4EA 1Y8AA 3R9FA 5ED4A 5CCXA 4Q9KA 1PAUA 3PRHA 3NWJA 1SCJA 1D6SA 2ZSAA 2OCAA 3BA1A 2V3WA 3GA0A 4Z4GA 3JW8A 3MVEA 4PHCA 5F5XA 4E33A 1XB2A 1U6KA 1EVJA 1G20A 1RLTA 3AR3A 4JWPA 2BV3A 3INYA 4Q4JA 3KHKA 4CTJA 2IBSA 4LHYA 3URKA 1L4NA 2EQAA 1I0ZA 4Y1EA 3DFFA 3AVXA 2HUPA 3U1BA 3IQEA 3L8GA 1CZUA 3WNCA 1BDMA 1CR0A 1XNRB 4RLQA 2PPLA 4MRSA 3KR4A 4PQFA 3D7FA 3BGIA 2RAUA 3KEFA 2OXIA 4L0CA 4BVGA 1UJBA 4MVCA 4M88A 4JVLA 4M89A 5C9ZA 1MD9A 1LA2A 3IAM6 1V43A 3UUEA 3RVLA 1BCSB 3A6DA 3KR9A 2MYTA 2G63A 3D4PA 2R7KA 2XNKA 3ILXA 3NIFB 3FOAA 2ZVJA 5A06A 5AM0A 2VLIA 4R51A 2D5AA 3MTQA 3AQIA 3U6KA 1KERA 1JN0A 4Y49B 3O3CA 1NJ2A 4RACA 1NP3A 3DWFA 3G2JA 2OSVA 4MJLA 1F6WA 3BD6A 5IFLA 3RUHA 3K0AA 1FMFA 3QPUA 2FRDA 3QPBA 4KN5A 2FS5A 3NHYA 5DGDA 4D3DA 3L7KA 8LDHA 2UYYA 4KQ1A 1ZY2A 3WYFA 2ZU6A 4MI4A 2PBLA 3OQNA 3ISTA 2P9HA 2ZQ5A 4FAIA 3MS7A 2JBJA 4IG9A 5BSVA 3VDRA 3FRJA 2GO1A 4F9FA 4A9AA 2B35A 1U8AA 1COWA 3RTBA 2AV6A 2CXAA 4HUJA 4G3XA 2DHQA 2E55A 4QD3A 1Z2AA 2Y68A 1H4TA 1RNLA 4C7MA 1DHRA 1CHDA 1IZ7A 1XKLA 3B51X 3NTUA 1EVQA 3GA5A 1I9GA 3B53X 4W8GA 3BLNA 2GRAA 1W4BA 3PVCA 1QH8B 2BGGA 3M6AA 1R8SA 4J1SA 2JBWA 3VKHA 4FBEA 3ORQA 3ZE8A 1OLUA 2AFSA 3T1NA 4C7XA 4PU0A 5FO1A 1V8BA 1TQ6A 2OO7A 4UDYX 1A77A 1C30B 3O75A 2X0JA 1R0WA 1FSGA 4LPSA 2IYYA 4F06A 1C0PA 4AZVA 5B1HA 5AW8A 2H2FA 1XIXA 4ZI7A 3H2YA 1E3JA 2HB6A 2Y1DA 5GM2A 1U5BA 4I50F 4O2BA 5CT9A 4ZVKA 1GNTA 2I66A 3B3TA 4RF3A 1L5ZA 2D4AA 2JIMA 1EEHA 1M34B 2BR5A 5BSGA 3P2HA 2GYYA 4ZT4A 2BGWA 3RFCA 3DBLB 1DIOB 1G0OA 3WK5A 4QG7A 2PT7A 1N7HA 3AFOA 3ND9A 5HMLA 3NATA 2AVNA 3LAWA 5KYYA 4BNZA 4N03A 3KVVA 5CB4F 1MTOA 2BCGY 3UCFA 2B21A 4C2ZA 3TTUA 2X0IA 3SIPA 4WFIA 5E9AA 2JD2A 2W2VA 1T3SA 1N2XA 1ML4A 2RC5A 1OKKA 2ZBEA 1DAFA 1GGVA 2HIGA 1P4AA 2C8VA 4TLLB 1OX4A 2VYCA 2QY6A 1E5QA 2NU6A 4LYDA 3N0XA 3K2QA 3BB3A 2YXDA 5KTDA 1LPPA 4EX7A 2GN8A 2PMBA 4ITVA 3QKWA 4Q6WA 2DHDA 1DBWA 1V7PC 4L5YA 3ROGA 1YMUA 2BFOA 4P4NA 2RGAA 1O5TA 2WMNB 2XMPA 2XUPA 3ZWWA 2CSXA 1ATIA 2HMAA 3KKEA 2MSCB 1NXOA 4MQEA 2GQ0A 3B48A 4NYJR 1LDYA 4TKUA 4X3CA 1BGVA 4FYVA 2ZXEA 2NVUB 3E9CA 3SI0A 3E9ZA 5LMCA 4CUJA 2WAMA 3VO9A 4B3JA 2DPHA 2DLDA 1TC2A 3FTEA 4H17A 2DXIA 4E3ZA 2XZTA 4Z65A 5EI5A 4RZUA 2ZI6A 3EBPA 4MMXB 1UFKA 3WT4A 1E7WA 3LNTA 5AHRA 2JZCA 2MINA 1IJBA 3BILA 2LWIA 4QKQA 2CYBA 2ONJA 2XXAA 5DWQA 2VYQA 2QRVB 4NLLA 4WK6A 5B1SA 1NYQA 3FTFA 1FZTA 4A26A 5DASA 4Y2SA 4ACBA 1V1RB 2FWNA 4HQNA 2J4CA 1DARA 3QIAA 4F71A 3AR8A 4CMHA 1N5JA 4YONB 3LLUA 5IVDA 2OXFA 1YS4A 4DDKA 3PGXA 4YV0A 2PJ0A 3WLNA 4C7KA 5KYNA 3FAKA 4QFBA 5F5LA 4QOJA 4R1NA 2Q46A 1S2NA 4O4LB 5CFLA 2IXBA 4NYMR 4GXRA 5IUJC 1U2GA 4CKBB 1W85B 2PVSA 2YJ6A 2RI6A 3EGIA 1LUAA 4Y9RA 1I4DD 1XJ0A 1W2HA 2J6IA 5AJYA 3FI9A 3PKIA 3EJ6A 2CHQA 2R66A 3KQPA 4X8LA 1T8UA 4IJ6A 4Q01A 2JIRA 4EFNA 5ALGA 1GKYA 1X2EA 5JAUA 3LUPA 3IH5A 4PLFA 2CBXA 4DBZA 9MHTA 1W87A 4Y0VA 4EM6A 2P2NA 4DJTA 3G9ZA 2WF6A 4A5OA 3LUBA 3EFBA 5IXYA 3ZXSA 3R6LA 3DMGA 3ZOKA 1LY1A 3B5IA 1HETA 3BTVA 3PHLA 3USCS 3N2LA 3AIMA 1XJOA 1NUUA 5J59A 1Q12A 2H4FA 4DA9A 3QVGB 4BBJA 1JHAA 3BKXA 2Q7SA 3M9XA 4YRHA 1RKBA 3OF5A 4JC5A 4KUBA 2H0AA 2QTAA 2BZGA 4FX2A 3BRSA 2PT6A 2GCOA 4HGYA 1X70A 2FPXA 5DSXA 4OQMA 3VWDA 4LGMA 2O0HA 4TKMA 4CU2A 1JQEA 2P69A 2KB0A 1OCEA 1O89A 1I3OA 3T8YA 4JL8A 1YQQA 2XGSA 3B2QA 3N05A 3ME5A 2IOYA 4RENA 5B2ZA 3ZPXA 1P18A 1WZNA 3E7WA 4MQ5A 1E4YA 4FS3A 4N5HX 2QRKA 2PFGA 5CEFA 3O92A 4MCRA 1TL7C 3TLAA 3FG9A 5CDFA 1Z4LA 3RW9A 3VSCA 1OAAA 3LMKA 2XNJA 3ZD6A 3HYLA 3NBAA 2YCBA 1UXKA 1LBEA 2IHBA 4ER6A 4XIYA 1CKEA 5FI1B 1MC8A 3G6KA 4F6RB 4IWXA 2IDKA 1J9ZA 4BJ6A 1TZMA 2X4LA 2FLKA 4EHFA 1GOTA 1O87A 5A5GA 5KYXA 1GJRA 2B1RA 5C5CA 1BLLE 5BRJA 1G18A 3PPYA 4FYIA 5ALOA 4AYTA 5CPFA 2PPVA 2XECA 1Q92A 3TFQA 1R9MA 3R2JA 2GN4A 3OUZA 3BSWA 1WOYA 2CXXA 3I6IA 4B17A 4DANA 5IAEA 3RYFB 5JFOA 1PYDA 2RARA 3JX9A 4RDHA 2F4VB 2EJWA 3TE6A 3QX8A 3SJAA 4RIHA 2YNEA 3P0RA 5CURA 1KS9A 1SBCA 1AMUA 5BUQA 3G17A 4QT0A 5JWRA 2UVQA 1UMCA 4DZZA 3H7IA 2XEIA 1XZHA 2FB9A 1B0ZA 2E48A 2PGOA 4WBNB 4ZN6A 3CH6A 2IEZA 4UTZA 3UICA 1SVUA 3JS5A 4V0MA 2B83A 2XB9A 5TQ2B 4OQ4A 2R2GA 2VJDA 3TIFA 3O1LA 1SCUA 3PWTA 4CI0B 4RTRA 4GRDA 3TJMA 3LX6A 2Q2QA 1GGNA 5TF0A 1M2OB 1L4HA 1BRMA 2RK3A 3IPAA 4ND1A 1UK6A 3GVXA 1O96A 1CEEA 2AN9A 1MLDA 1GXSB 3LXUX 1U3TA 4KH1A 2X2FA 1AXRA 3U48A 3KZ1E 2PX5A 1N5OX 4G86A 2WWHA 3ILSA 2G70A 3IMEA 1BD3A 3LC0A 1I32A 2ZSEA 1KFEB 3QLEA 4K46A 2OLEA 2XLBA 2B4DA 3Q3JB 1UAAA 3KOYA 1TYAE 4Q36A 1AN9A 4TTVA 2J4FA 5IF9A 5ALTA 3U4QB 4M0KA 2P9QA 3UA3A 2AC2A 1UC4B 1X42A 4DPKA 1WF3A 4AECA 3QUQA 5I7AA 1K6MA 4B31A 4TKVB 1KZFA 4L28A 5KYGA 2GUGA 1X1EA 5DNYB 4UTRA 2AEMA 4RH1A 1CNFA 5A5VA 3ETCA 1LPBB 1RKVA 5TV2A 4EW6A 1K63A 1DC8A 5IMBA 3MELA 1RT9A 4PE5B 6ABPA 1G41A 3ZV6A 5SZHB 4PXEA 2Y2UA 2JEYA 4AF8A 1KUYA 4B75A 5GIPE 2WTAA 1XJCA 4B8ZA 1R6UA 3ZJ0A 3H9UA 2HZBA 4URWR 1IONA 5G02A 2WA2A 4F84A 3LDGA 3VISA 4YR9A 3AL0C 4BQSA 4CR6A 3EF3A 4MUAA 3SQWA 3W2HA 1SHKA 4JJ6A 1FQKA 5FTJA 4D5GA 5HEKA 1HEIA 4NHEA 1WW3A 1UFVA 1ZRSA 4OMCA 1QG2A 1E61A 4HUQA 2NU7B 4ENWA 1TKHA 2QX4A 4EO4A 3DKIA 3IC5A 1E9FA 4IV0A 1EIWA 5KAPA 5IDVA 4IR7A 3BCRA 2W2MA 3T41A 4Q3AA 4YXWA 4NBLA 3T9CA 4RPHA 2IPMA 1J97A 1N0WA 1W47A 1YCFA 3OAAA 4HEA1 3IE2A 3E1SA 5GV7A 3AF2A 3S6GA 3L7AA 1NRJB 5EC8A 5AK5A 1H2BA 4IHJB 3UVEA 1E8NA 3U7HB 5ALQA 1W48A 2O5RA 2P2LA 3NP9A 2G6TA 3PUKA 3PDWA 1E1LA 1K6IA 2Y1WA 2RHWA 1TK9A 3N0WA 3RYCA 2J7PD 5THQA 721PA 1NDQA 3O9ZA 3PVSA 3ZZ0A 4QA9A 4RYLA 3RYOA 3LCRA 3DOIA 3NCHA 3X2EA 2IZ1A 1AMOA 1WS6A 2N0SA 2X8JA 4OIMA 1WVIA 1YK3A 2W2XA 2WFAA 2EERA 4R2MA 2C58A 3CPJB 1T9ZA 2EOAA 1EK2A 1VLJA 4OCZA 1OROA 2X9NA 3IHLA 3OUUA 4DV2B 1V4BA 3MJSA 2Q21A 5JD5A 3CH5A 3RODA 4POOA 3I34X 3PKZA 3SGLA 5CDUA 1XZCA 4FHDA 2YHBA 1BQEA 1USWA 1U63A 2GU2A 1EGHA 5HMMA 3CG0A 2ZSUA 3PGA1 4O2AB 2WT4A 2AH5A 2ZBUA 3OVMA 3K20A 4MGIR 2O2HA 1LTHR 3LBHA 3OA0A 2I6TA 3T9FA 3MOGA 4J3NA 3Q5EA 4F0XA 1CUGA 1XPOA 2AOVA 1K4KA 1JRLA 4CFYA 4LJRA 1QK3A 1E2UA 4I9UA 3O3OB 4HLCA 4GIBA 1H2AS 1FFXB 1RBYA 1DEAA 2R48A 1EVIA 2DWOA 2ST1A 2PU7A 1GSIA 1NFRA 2IW1A 2E21A 1G20E 4C0LA 2JKYA 5LOVA 3QVKA 5JYBA 3AETB 5IMSA 3TTTA 1E6MA 2FP4B 4CCYB 2P6MA 2WM3A 4EGAA 4DSZA 1CZNA 4XM2A 3MFQA 1KO4A 1QFJA 1PJSA 4LV6A 2NMTA 1Z6ZA 3ZQ4A 1HG1A 3KZKA 4AX4A 2NU9B 3OQ6A 1L8OA 2HUNA 2QTBA 4UD2A 2PUCA 2Q4YA 1OZGA 2UU9B 3R7SA 2D5CA 3GUHA 3V7ZA 5HGJA 1F8UA 2OBXA 3G5UA 2P8JA 3ZK9A 1HZZC 2XNHA 1ZIXA 1KK2A 1BQ4A 4JLNA 3IBGA 4OQXA 2G17A 4EPYA 4ZAWA 1CQXA 1K0FA 1MX3A 3L49A 2WFLB 4KQJA 4S1NA 3OCJA 2CFCA 4PTZA 1VLZA 4L85A 3IERA 4Y7DA 4Z8XA 4F6CA 3BMNA 1FLNA 5JD3A 4MPPA 1BHJA 3W1EA 4ESHA 3V4LA 3CGGA 1ZVQA 4J0HA 4NOMA 3SZGA 4XSVA 2EF1A 1YK0A 2P79A 3QHQA 3CRMA 1LTKA 2FZCA 9LDBA 5SY4A 3R5HA 1EQUA 1UKVY 1PS9A 2ODNA 2PKRA 2FFAA 3AJAA 4WFJA 2WHYA 4CMCA 4KIJA 2H4ZA 4GBJA 4ZQHA 4ABYA 1NHGA 4MHDA 1WHSA 1SXQA 3RS3A 1P61B 3MRSA 2JHPA 1EWQA 3REOA 3SOZA 4HNSA 1CUJA 4D79A 1KOGA 2IGTA 2QRNA 2IYNA 8ADHA 3AIOA 2G1PA 3WK8A 5TPZD 1JLKA 4JUCA 4R1TA 1RC8A 2OOTA 2F90A 4V1CI 2DR3A 4KSIA 4AY2A 1PLJA 1HQDA 1XRMA 4KMMA 3RWMB 2F3RA 1QQ7A 3B2NA 1UDCA 1ZD8A 1W34A 4C7BA 4IIDA 5FI0B 4FONA 3AF3A 4AS2A 1X39A 5F77A 2DUUA 3ZGVA 4QQRA 4BQIA 3PUZA 3QXXA 2G7ZA 1VI6A 3P32A 5KOYA 1C0IA 4DR5B 4ITUA 4MW1A 4F97A 1EJ2A 2F9FA 3KYIB 5LKRA 6YASA 5JD6A 1YKFA 4TSRA 1K86A 5IWAB 4FD6A 4C22A 1I5OA 3OQ1A 2HLPA 4MB0A 3OKCA 4JYPA 3IPRA 3F6PA 2DFTA 4JV5B 4NCAA 4FGJA 2JL1A 1P80A 1I24A 3CF4A 3AGQA 2J3DA 3BMCB 4P3YA 3HXTA 2Z09A 1F48A 4ND6A 1Y82A 1QOPB 4BMVA 1R4NB 5J2TF 2NTNA 2QSZA 4F6LA 4ORFA 3ABRB 3CXSA 3ZCTA 2ANCA 1P29A 1U8FO 3OWHA 1EVZA 1IH8A 3RJ9A 2FMIA 4EUNA 2I2XB 3DLAA 3F9CA 1PFWA 3MD9A 4OYHA 1WXGA 4UCPA 2QRLA 1MKYA 1YU6A 2R86A 4YQZA 3U44A 4PEVA 1AKTA 3R9IA 3B82A 2FEMA 2MHCA 4GNRA 2B1JA 1P4HA 2JD1A 4YFJA 1U7ZA 5CW1A 1EXMA 4I5GA 1WBBA 1UIMA 1FTQA 2IKSA 5AUNB 5IVIA 3JPWA 1CUYA 2VBCA 3AILA 3V2HA 4N0DA 4ZGGA 2B8EA 2X0KA 5LU9A 3L77A 3Q8LA 2EGUA 4R83A 2QG4A 1ZD2P 3QVMA 5FPPA 3M5CA 3V8PA 3WIOA 1NLMA 3FLBA 4IFBA 5PNTA 4KXQA 1WX1A 3AV3A 4HBZA 1EGQA 1VYUA 1C29B 4CTOA 5H59A 1OYYA 2FWMX 5J63A 3KR5A 4DSNA 1F17A 3PNMA 4WQMA 3ICEA 2BCOA 1J2UA 4RQBA 2EGGA 3GMDA 3OT4A 2Q6IA 2DPMA 4D2IA 4W7SA 1C9KA 1L8AA 2LP4Y 2ZIVB 4DIKA 1MH1A 1NOKA 4DBLE 1Y98A 2L82A 1AKEA 1D1QA 5D5QA 2QTGA 3N6RA 1JJFA 5K1ZA 2VWGA 1P2BA 1SKAA 1KC1A 4WERA 3BWEA 3HRKA 3AVQA 3MB8A 1NW6A 3K9BA 1WO8A 1H93A 2IYTA 4UUPA 4PQEA 1GTVA 2R8ZA 4Y2YA 3SAJA 4ZOQI 4OLJA 5GOTA 3S5JA 2OZKA 4EJFA 5JXGA 5TR9A 1K7YA 2NGRA 1YR7A 5GP1A 1OH6A 4GI7A 4W5JA 4ZAFA 3R7AA 3CLRC 4GPZA 4KRYA 1BMFD 1SHJA 1Y7IA 4X1YB 3TLBA 3W3AH 3JCZA 4C78A 2FUCA 1Z6AA 1SWVA 5GM1A 1JEEA 2J3JA 3NHFA 2PXAA 3FNHA 3TRHA 2BFAA 4JYZA 4B8WA 2WP0A 2YV3A 4IMRA 3S81A 3AYXB 4D4HA 1WTAA 5EKSA 1E9EA 3HGMA 2XHZA 4X7BA 4EHHA 1RWOA 5ICSA 1RHJA 4OQNA 4NOKA 2EV9A 2HK8A 2PRIA 3N3BC 5BMVA 1I1NA 4DMFA 3BFKA 1PCAA 4XNHB 3O9VA 2B5GB 3HCNA 4EA9A 4CMIB 4BINA 5B36A 1XELA 4PZCA 4KFSA 1OH5A 4NC9A 5I01A 5C3MA 4NENA 5L7TA 4AM8A 5A2QA 3KDSE 2B99A 5AVXA 4LRQA 4MWSA 4G85A 2VNKA 3LT0A 3ZHVA 5IHPA 4ZAXA 3U4GA 3Q8KA 2REBA 2A14A 2O53A 4RVFA 2DCUA 2XYQA 1GL9B 2CFSA 2QI9F 1Q95A 2EZUA 3EVGA 5CDFE 4DLKA 1Z36A 5LJIA 1D2GA 1YAHA 1Z6XA 3IUNA 4ER5A 2FSUA 3DFMA 3FBTA 2N9UA 1WW2A 3G8CA 5KINB 4CW7A 2ECPA 2WG2A 2FPSA 5BO5A 1K4MA 1UBEA 4K8OA 4JEUA 3L6RA 5EWMB 3GEPA 5KX5A 1YBVA 3ECAA 1G8HA 2F55A 4EI9A 1J2TA 4UJ5A 3B12A 4AU1A 3IPCA 4TM7A 3FHCB 3LPDA 2ZOGA 2B7LA 2HQRA 4HH3C 3KEMA 2R1IA 4BN4A 2X14A 2XMDA 3HLYA 3GRZA 3SFZA 3Q0EA 5IJXA 4QBHA 1Q7TA 3NUZA 1I7QB 1XDUA 5FWYA 2J30A 2FPPB 1VI2A 1PVDA 5ELXA 5JHHB 4AG3A 4JJKA 4TVBA 3OIFA 1KI6A 2C5HA 4IDGA 3W6OA 2PD3A 1RADA 3EASA 1FY7A 4A0HA 2E6KA 2Z04A 3BVPA 4EKNB 1C1DB 3DWIA 4G1MB 1ZL0A 3OMXA 3B60A 3UMMA 3NIBA 4BP3A 3OFVA 4WV3A 2FMHA 5HM8A 3NVKI 1AA6A 2O6LA 3DKRA 3A1SA 1XKQA 2Q1WA 4BVBA 2AG8A 3EPKA 2ZP1A 1IL0A 3G9QA 3M3PA 2XNSA 2MU1A 5JCPA 2Q4RA 4HGZA 4B4WA 1BPNA 1K0UA 2WZCA 3RSLA 1JHPA 4DLSA 4Y2TA 3FM9A 4CG2A 2QZ9A 5IXSA 4NPAA 2ZGVA 4AVAA 3AHDA 4RK1A 3C6ZA 2YV2A 5ICMA 1AX9A 2XQJA 3CUSA 1LNZA 3FDFA 4MGKR 2DQZA 1Z7EA 2I3DA 2YBDA 3CVWA 4BPBA 3ESXA 2QX6A 1JXQA 4BIIA 2I76A 1QHGA 3D31A 1L1FA 3GD7A 1BDBA 1QTIA 1AY0A 2IXTA 4QC6A 4JNKA 3ZKWA 3N8KA 5IARA 2IHTA 3PXAA 2XMZA 4EY6A 1QAQA 4BL5A 2HHHB 2J9FA 3H87A 4OIWA 5KOIA 1DPFA 1GILA 2PO7A 2YJZA 4IQGA 4U3JB 2YTZA 5DEOA 1DC6A 4KNVA 2GB4A 1UBNA 1U6IA 3M6MD 3DFIA 1R10A 2V6MA 3ZJYA 3LBFA 4F8YA 3W1WA 5A4DA 3C3EA 5GONF 3AL3A 3K1TA 3C24A 3A4VA 3UV6A 1D07A 3SC6A 1ECCA 1KY5A 3ZI4A 4Q7LA 3TSZA 4U0JA 3HYCA 1E77A 3L46A 2QLLA 3SQXA 1CYDA 1CD5A 3D43A 3NALA 3I9V1 2PE3A 3UMRA 4YJHB 2AEJA 3G82C 1LRKA 2I2BA 1HEEA 5D3QA 1RM0A 1KTIA 4DJFC 1TM3E 4BZPA 5CG1A 5L51A 2PBZA 4KUEA 2BKUA 4MUFA 1UT8A 2JJ2A 3VBEA 4DIFA 1P7WA 2PZJA 3QVXA 3OM8A 4BAUA 4G0OA 3W8FA 1ESCA 1EP2B 3MWEB 1RBMA 4AJJA 5EP2A 5LRGA 2HRBA 5A4KA 3FRHA 5ECDA 4KOAA 3CG4A 3F49S 4DBLC 4ZJPA 1LQ2A 3UZUA 4W1PA 1W30A 2WDZA 4E5PA 4AY3A 4G1CA 3H9BA 4ECAA 1THMA 1DIGA 3AHEA 2GZAA 2JFZA 1U2PA 4BRSA 2XNDA 3T9BA 3KZCA 5KVSA 4ZOLB 1GR0A 1DRKA 2D5BA 1C3XA 1IB6A 2JGLA 5L7YA 2ZRPA 3IALA 1HZZA 4DIEA 4H1TA 3AZOA 5JUWA 3PE6A 2K4MA 5C1BA 4JSRA 4HRXA 4U5QA 2R8VA 1Q0QA 2PWZA 2B2XA 3OPYB 4EJSB 4K6OA 2FQWA 4F8EA 1EJBA 4C6SA 2ZRQA 4HXYA 3LT4A 1A1VA 4G4SP 4JC8A 2CIJA 1SHUX 4M85A 2PMFA 3PVZA 1CQWA 5BSRA 4E13A 1YZQA 5D87A 3FD8A 1NULA 4R98A 3T1TA 1N4AA 1WD7A 1C3EA 5F9HA 3EIHA 2VDUE 4IJVA 2HREA 2ZAIA 1NWHA 3BTUA 3L0CA 4HNAA 3MRUA 2I22A 4Q3EA 3VJLA 4LDZA 4LXHA 2XB6A 5C82A 1WSAA 4RF5A 1I4EB 3OZCA 3H5OA 6GPBA 1MPXA 2JPDA 4G89A 4XYEA 3H83A 3EAFA 3T1OA 2J09A 2PR1A 3I72A 3FYUB 5AW9A 2G6BA 5I8ZA 2EGHA 2FJUA 2I1WA 2K5UA 1ABBA 4DS3A 2IX3A 4RM3A 5E4FA 1EEXB 3INNA 5T4HA 3GVCA 1GPAA 1Z2EA 1A04A 3K5PA 2IMOA 2AMLA 1T36B 1T9DA 3NHLA 1NT4A 4Y6QA 1YONA 1O6CA 1HG0A 2E37A 3FNCA 4LYFA 4OB8A 5JJIA 3SQMA 1KQPA 5I51A 3TKYA 4MV1A 1V8PA 1FP1D 1IWBB 3LP8A 4GC9A 1BXRB 4KSCA 2GETA 2C9DA 3TQTA 1UPXA 4GRAA 4IOMA 1XI2A 2GIVA 3QPVA 4IGEA 3KKQA 4OAPA 2QMZA 4WSOA 8CPAA 3K8OE 1OASA 2DU8A 4XSHA 1ZUNB 3FYCA 1USKA 4Q66C 3WMXA 1JHUA 3KWLA 3IESA 3ZCRA 1NKVA 1N3IA 2WYUA 1QNLA 3H2BA 1YIAA 2W37A 4L02A 1H5NA 2XW6A 3R8CA 3R9XB 5HIKA 2PEZA 4NFSA 2C2MA 4LVNA 2ECKA 4ZJYA 2P62A 1SZPA 1WEHA 2IITA 4L8LA 3C6QA 5CEEA 1EXDA 2OY0A 1YB6A 2RE8A 1NLUA 3KI9A 4PM4A 2ZWOA 1YZYA 5DLPA 2AFZA 1LBHA 3KUUA 3L05A 1XTPA 3AFGA 2PS0A 1DFHA 3SLKA 4WGFA 5TT1A 3UT5B 4B79A 4PS0A 5E1BA 4HNWB 1ZP6A 3MRXA 1E7MA 2YFQA 1QR2A 1YJ8A 3HO8A 4OA8A 1L7QA 1OBHA 2XOKA 3NC1C 1KQNA 3R9KA 2ECFA 4TTPA 5HXDA 1ABEA 4FFPA 4JSYA 1T8YA 3BCUA 1I0IA 2MYNA 4N3CA 1W4RA 4US0R 2H8GA 2V7GA 3UCEA 1VIMA 4MI3A 1RWNA 4QOFA 1IQPA 2VK8A 4K1XA 1N34B 1ORRA 1U2SA 1HEUA 3T5PA 1LLFA 2XLCA 3C3DA 1G5FA 2HD4A 2B20A 1HTTA 2DMRA 3PHBE 5SYMA 1Y4UA 1YRYE 1GTMA 2FH5B 3EEQA 4N0MA 4GW3A 1FNNA 4R8RA 4MUMA 1BEEA 2RBEA 4KO3S 1U9JA 1Q2UA 3AU8A 4CFSA 3WB9A 1G5HA 1CQJA 2QRJA 1FXSA 3IBYA 5A1TA 1L8LA 5DXJA 1T3HA 5HS4A 4DCOA 1C8VB 1OFVA 3GDOA 1DL5A 3L7DA 1QRAA 4X6UA 4E09A 3P9CA 3S5UA 4A0GA 1C4OA 3OCUA 1JYFA 2NO9A 1MJHA 1WUIS 4OHYA 3QRWA 2B4BA 4KR3A 1XCMA 4IS3A 4J7AA 4B71A 2OCGA 2RCYA 4N48A 3EPHA 4AF7A 4A15A 2VF4X 3A1DA 1C9MA 2A5FA 5CDYA 1T1JA 4D9GA 4Z4EA 2QT0A 1X8LA 1Z22A 4C5CA 1A7UA 3GLRA 2Q4DA 2J7KA 4XB2A 2AG0A 2QL6A 3CF4G 1SK9A 3KZMA 4PSCA 3U3MA 1T4CB 2JAUA 3GLIB 4PZPA 3PR3A 4Q9NA 2ZM5A 3RYHB 4UREA 2C2BA 4H1UA 1UUFA 3ONVA 3NAMA 1OWMA 1BVUA 2BHNA 4QVIA 1REQA 1L4UA 2ZJ0A 5EG5A 4V03A 2AN5A 3HLKA 3L02A 2BM0A 2QNBA 3NAZA 5ALEA 1UPFA 3AUKA 1JI3A 5JYEA 1DOZA 1UDRA 3LLSA 3WNZA 2W93A 3PD7A 5JBNA 3M34A 3O8QB 7ADHA 5CA0F 5LXTF 3CLTC 2PWAA 5I9TA 1A2BA 3HNOA 3C0KA 3EE6A 3IUEA 2WQ7A 1U7XA 3WWEA 5CCBA 4MUIA 4NARA 2E1RA 3G88A 2CLHB 4YPOA 1YZFA 4QGAA 1CUIA 4KBGA 3ZLJA 4URUR 3UKDA 5CHEA 5AKIA 5IYZB 4DUKA 1VLLA 5ITVA 5I3CA 2F9MA 3MQFA 2JKVA 4HATA 3UG7A 4R69A 1N7IA 2VHXA 1ZJYA 1XMVA 4MV7A 4XLLA 3ORFA 3STWA 5CCEA 2X42A 1VKJA 3G5AA 4K3UA 5F3DA 5DIZA 2QW8A 4M9ZA 3THOA 4MQUA 1XUOA 3OC0A 3D7KA 3L6CA 3G0OA 1BGWA 4CM4B 3EVFA 4RGBA 1B1AA 4JEIA 4EKEA 3SZOA 2I6SA 1XOIA 3S29A 5I45A 1A72A 3GEDA 3QZUA 2GEVA 5EJ6A 4URVR 1P6QA 2W71A 9GPBA 1E7QA 3QE9Y 3K09C 1J8DA 4O2RA 4I1OA 2HJ9A 2RH9B 3I5MA 2XADA 1B0UA 1M2GA 4L78A 5IVHA 5I8WA 3U3ZA 4QGFA 4DUPA 3X1KA 5CG2A 2R4QA 2GZ1A 2CNNA 3BWMA 4AB7A 3CUUA 3A6ZA 5BOVA 3CXQA 1JHDA 4GGOA 2CD7A 2AQIA 2VCHA 1NI3A 3QKRB 3TH5A 4REOA 4LZLA 3T7JA 4N7RA 1NSLA 2AQKA 4D56A 5JNRA 3REGA 4E1VA 4BFLA 4RK4A 3D6VA 5HTKA 5CNMA 5LB4A 2QTVB 4FI3C 1K08A 3KLBA 4A31A 2XV1A 4KXYA 3O93A 1QZUA 2WD7B 3UJDA 4LY3A 2O1XA 4KBYA 1NE7A 1EG7A 2NZVG 3T15A 2ZW7A 3HL0A 3RVKA 5FX2A 3DDNA 3X0DA 5E96A 4OHZA 4ZOCA 1NN5A 3L1KA 1DP4A 2OC4A 3C1UA 2Y6VA 4Y2XA 2IHVA 2ZK7A 4P32A 3Q4GA 4BXOA 4ZJZA 4PBRA 2QW0X 3PQCA 2CUZA 2ZRIA 1MHTA 1N9KA 1UJMA 2IEGA 2WAYA 1ZO8A 1BROA 4C89A 4HWKA 4P0TA 3LA6A 1FDWA 3OA2A 4WY2A 4ZU1X 5CCDA 4LRTB 5BYKA 4FSXA 5BQOA 3ZZUA 5I9LA 1ADFA 3PD1A 1N6LA 1FLVA 2ZU0C 3E84A 4JI6B 3RUAA 2H92A 1YIDA 1VB3A 3ONDA 3O4IA 3EC7A 3PCTA 4TQUS 1JU9A 3ZWCA 3BXMA 4EG4A 4TT3D 3N86A 2QT1A 3LBNA 3LGSA 3F71A 1Z0ZA 2ZYDA 1KBQA 5L3VA 3DGFC 4IIHA 4OJNA 3T3NA 3UENA 2PGNA 5AG5A 2YR0A 5D1HA 2EC5A 2HCBA 3HEAA 1SCAA 5DS0A 3GMSA 3PIDA 3B3GA 4WACA 3HWX1 4LJ4A 4UULA 4FR0A 3THWB 3O0TA 4EG8A 4HXFB 3K6SB 1NVVQ 3AQ4A 3EISA 3PTZA 2R6ZA 3EZYA 1ZG3A 2HV9A 4PXAA 4JLPA 2BI7A 2EKPA 3O84A 4LPKA 2AI1A 3DLTA 2AWOA 1SVKA 1J0XO 1IZ0A 2OAGA 1SUSA 5DP1A 5L6MB 3AX6A 3HG7A 3WTCA 3VR4H 4C2TA 4EUKA 3CKYA 4MWBA 4RV5A 3MTIA 3O3MB 5JRDS 1OFTA 1GQFA 4KDCA 4CLRB 1ZLYA 5EPUA 3KU4A 1Z4EA 5CVTA 5BQXA 1OJLA 3KYDA 3V4ZA 3L6OO 3U3OA 5HHTA 1ES9A 4H2DA 2NYQA 3VJMA 4CIDA 2ZYIA 4J9UE 3QLJA 4P4TA 3CPSA 3R23A 2O7SA 2YZGA 4MLPA 3TNLA 1J42A 1Q5PA 3Q7IA 4R1PA 3AP1A 4TL9A 3ELBA 4JLBA 1E1KA 4ZWNA 3O4VA 4ZXPA 3TTVA 4YRFA 3ZV7A 5KMGB 3GYBA 4I3HA 4AULA 2V7WA 1QS0B 2V7EA 1NNLA 3AJ8A 2V7QD 5U4XA 1BNCA 3EQ6A 3UM9A 1YHZA 2GDZA 1X77A 2XD9A 1OQAA 5GQSA 5G40A