1YQEA

Crystal structure of conserved protein of unknown function af0625
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
282
structure length
282
Chain Sequence
b'FQGHMKLVVCSESDTAGQNIKDNLLTFADFEEKDVGEFKLYLSDEFYIAETKERLIYADHIDEKLAKYIDFEEILFASRHSSKDGRKIFTVHVSGNVGTADFGGKPYSLAKPSPQTMKNYVLALRERLDRKPEFEFTMEVTHHGPSEISKPSAFYEIGSTEEEWKDREAAEVVAEAMLDAIRAEKMDWNVAVGVGGTHYAPRQTEIMLTTTFTFGHNFAKYTFEHLTAEFLVKAVKLSEAEYIIIDEKSVNSAVKKIVNEAAEVAGVEVLKSKKVKKDFRLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical UPF0204 protein AF0625
molecule tags Structural genomics, unknown function
source organism Archaeoglobus fulgidus
publication title Crystal Structure of Conserved Hypothetical Protein AF0625
rcsb
total genus 104
structure length 282
sequence length 282
ec nomenclature ec 3.1.1.96: D-aminoacyl-tRNA deacylase.
pdb deposition date 2005-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04414 tRNA_deacylase D-aminoacyl-tRNA deacylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold AF0625-like 1yqeA02
3.40.630.50 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase AF0625-like 1yqeA01
1YQEA 2GFQA
chains in the Genus database with same CATH superfamily
3FXAA 2ZYUX 4HX5A 3LW7A 1I3KA 1KI9A 3BGIA 3W6ZA 2DHCA 5I8PA 3P2HA 3HRHA 3RUAA 3L6RA 2L2QA 3OURA 3HRKA 3N3BC 3ZHXA 5ISMA 1EI9A 3U26A 3NUQA 1BXZA 2E21A 2NN3C 4FDMA 2ZUSA 4OHMA 5DHFA 3IHKA 1M0WA 4UXIA 1PJ4A 3RT7A 3VAZA 1BHQ1 1RXTA 5EMIA 1KFKB 1ZLXA 1DG9A 2JZOA 1RQRA 1PQWA 1X7ZA 4DRZA 4BKUA 2L18A 3I39X 1ZD4A 2WZCA 4L57A 1UPAA 4DY6A 4KIWA 2M98A 1TKAA 5JNRA 1DSSG 1GT91 1CUAA 4QARA 3RTAA 3ZIDA 5JRDS 5LZ4A 4F0YA 5JANA 4Y49C 1YL6A 4LV6A 3FF3A 2P6UA 4WNYA 3R7NA 3E3LA 5HZKA 3PFGA 5KYTA 3AVTA 1O1YA 4IDDA 3P5BA 5AHWA 5KNLA 3TL2A 2LZ0A 2O2IA 3U4HA 1BU8A 4RD1A 1PZEA 1QC5A 1TJ3A 2X4DA 3IKLA 2NUPB 2BFCA 3NUZA 1X3SA 1B8OA 4QFMA 1V9CA 4DR2B 3C3BA 3C74A 3A1CA 4UCFA 2Y4OA 1ZN8A 1S8FA 4NV3A 5E1MA 5SZJA 3TTHA 4AYTA 2FOIA 3G9QA 3UH0A 3I01M 2V7XA 5K6TA 3A2KA 1J56A 1DLIA 4US0R 3H7AA 1HTTA 4BLTA 3BE4A 5EJ5A 3OI7A 2GN6A 4OXIA 4UNNA 2VRNA 2O52A 4PN3A 2OLEA 2R11A 1YE3A 2GWRA 4IOKA 3ONNA 4Q12A 3STXA 3FTDA 3U3RA 1DKRA 1AKWA 1LDYA 1O94D 5EZYF 1ZOSA 4M9CA 1FBNA 4NNOA 2FE4A 5HR5A 3VSCA 3HCOA 3UMYA 1P0IA 3LZDA 3ONVA 3B6IA 3PEYA 4LXYA 2IITA 3F1LA 5A9RA 4EUKA 1ULAA 3TVYA 1SVSA 4IJKA 4IH4A 4M9QA 3PXAA 4NJEB 3RVKA 5IT4A 3THWA 2I6XA 2RHMA 4KXWA 1ZL0A 3RVOA 1FDIA 1XZNA 1UFKA 3H17A 5D00A 4MYRA 1LW7A 1Y8AA 3PDIB 4C7MA 2JHPA 4BJ6A 3DL7A 1PR6A 2XQIA 4EFLA 3G2LA 1Z6XA 1ZJJA 3AQIA 2DX7A 1E69A 4TT8A 3Q9UA 3OX3A 4DGQA 1B8VA 4ONEA 4C0KA 2GZRA 2ON6A 3JQEA 1SCUB 1YMUA 1A8UA 2EJWA 2OLJA 2GJAA 2X2EA 2CVHA 2VZ9A 2YN2A 1LEHA 3T1TA 2FPUA 4JP1A 3B3JA 4JS0A 2ZCJA 1AK1A 2E1PA 4Q7EA 2QD5A 1KYTA 2OYSA 3PI7A 2YHIA 1WL8A 2W70A 3R8XA 3F6PA 4R7MA 3WGOA 4M22A 2GCOA 5C1DA 5LKRA 4RTJA 1KI4A 1U6KA 1FU8A 3CT4A 4PIVA 5JO0A 3WWPA 4GWGA 4OP1A 4Z2YA 2H0QA 2AOTB 1NMSA 1IY7A 2C83A 1JG7A 5G2OA 4HQ0A 5D86A 5HFJA 5TEVA 2WQ6A 2GDJA 3A1WA 2ZDHA 3F6RA 3THRA 4GPTA 3FRMA 3NDIA 2Y1CA 1WEHA 3EFOB 3OFJA 1UWVA 3SDZA 2DHQA 1R4NB 2G70A 1WG8A 2XBUA 3KQVA 3MRXA 3QLUA 4PTYA 4X60A 1U2ZA 5AXDA 2BEVB 3Q7RA 2FYTA 2AG0A 5C5IA 2DLDA 4RTMA 1CY6A 1M1NB 1ULTA 2FUG6 2M6RA 2XOXA 5BYBA 3LWDA 1WS6A 2GAFA 1GLGA 1N0HA 5BNZA 3PQ3A 3E9DA 1IM8A 1UKZA 2FZLA 9GPBA 2CT8A 5K9ZA 1NQTA 1L7XA 4QD3A 1N4DA 3AKDA 2PL9A 1NNEA 3WGLA 3FMIA 4AKGA 3OOYA 3PB6X 3DAHA 4H08A 1ZINA 5G4KA 3ZCPA 1POWA 4XPDC 1G5QA 5CPBA 4C4RA 4AQ7A 2AOUA 3QXCA 1WB6A 2QP4A 3NBAA 2VRCA 3AHJA 1G55A 1ZNXA 2QYSA 3VYTB 1NXTA 3VJLA 2XZOA 4ISCA 4P10A 3E9ZA 1TM4E 3O9ZA 3H5WA 2UVPA 4RANA 5BN5A 3CVXA 3IBYA 3CRRA 3A4YA 1M2OB 3GAZA 3TLAA 5CTJA 4E33A 2BC9A 1BKYA 1NOKA 3ICWA 2GPJA 5I4MA 1RHRA 3AL3A 4NV1A 1D2RA 3KL4A 5C81A 1H8LA 1T3ZA 1UXHA 2R48A 1H69A 2BMWA 1WDMA 1CUEA 2I7TA 1XT6A 3HV0A 3CVVA 3JPWA 4OHWA 4DRXB 3LUAA 3SZLA 4L76A 3FNEA 3DOEA 3FBGA 2ZR7A 3ANTA 2JARA 3QX7A 3TQTA 3SHTA 3ORRA 3TJMA 1G2QA 1CW2B 1RYHA 5LYJB 1E1QD 1L7RA 1P8JA 1CV2A 3HJAA 4G9BA 3O9VA 4Q7JB 4EGFA 2ODWA 4GMHA 2J5RA 3TLCA 1M83A 5IZ4A 2UUAB 1LX6A 1OR8A 5BUSA 3ZKWB 4YRSA 2G9QA 1ZWKA 4IUDS 3UFXB 3NC4A 3K35A 1NXXA 2Q7XA 4DSUA 5CDSA 3BT7A 5BORA 1KUXA 2SHKA 4R3KA 1LBTA 1PT8A 3BRWA 4V03A 2JEZA 1EJ2A 1RJ9B 3OPYB 4ZO6A 1EB9A 3OFNA 4EO4A 1Y3BE 4LJKA 3HCPA 4BP8A 4LF7B 1NYRA 3DPUA 4PXCA 3A9VA 2Y93A 4HQFA 3RYTC 3AHHA 2XUJA 5CA1F 1WCYA 2YCLA 4BD9A 1GGJA 1PK8A 5DEIA 3DFMA 4EQ6B 3EIOA 1TKBA 4O1HA 1NVEA 2Q5IA 1JNXX 3PJGA 2VJLA 1ZYUA 3UXEA 1PZHA 4PONA 4YGXB 1W34A 3WDLA 2BR5A 3RDPA 2RI6A 5JM6A 3A2NA 4Q01A 5B5SA 2CW5A 4AZVA 3KSMA 4K9RA 2PL1A 2Z98A 3SF8B 1DQSA 2BH2A 4YO7A 2HZBA 3HBNA 2R7MA 3GIDA 4ZAWA 3TRJA 2O5EA 4X66B 2HJGA 1GRRA 1RRFA 3NHJA 3PF9A 1MH9A 3LDGA 2R4UA 2WRZA 3QFRA 1Q16A 4DA4A 1MX1A 4KAFA 3EDMA 4QXAA 3KPWA 3EO4A 3CSUA 1QRSA 3PEWA 4JYMA 1NYLA 1G2IA 2ID7A 3CV3A 4XTCS 5BYAA 4WZBE 3H9UA 3QENA 2VLIA 4OY3A 1CQIA 2ZWAA 4X1IB 3ZVMA 4G0ZA 4WUTA 5EBVA 1GCGA 4YCBA 2ZTUA 3ANXA 2W4MA 4IIHA 4A0RA 2O5VA 1Y9ZA 1K27A 3HFJA 2AJCA 3C70A 3F97A 1LRLA 4J29A 4QVGA 3VISA 3JASB 4FGWA 1TYAE 4HADA 5DRTA 1JU4A 1KC3A 4C3UA 4EDFA 2MINB 3UT5B 3ZJ5A 1UFRA 1XBTA 3PENA 2QMUA 2VHJA 3GUYA 1Z47A 3PC6A 4PSWA 5JDIA 2XEGA 4HNHA 3UENA 2HDWA 1G8SA 1Z0IA 2AX3A 1AK2A 1RPJA 2QSJA 2SKDA 2X4GA 3EMVA 1O58A 3QV2A 4X94A 3EZLA 4YJ2B 4W9YA 3ZCUA 4DQKA 3PHJA 4KMRA 1IWPB 2ZIVB 5T4BA 3STYA 5KTSA 2Q7BA 3LS2A 2OA0A 3SSNA 4ZJZA 5L8VA 2VOEA 1JPUA 3BJIC 4Q03A 3K9FC 1DC5A 1F5NA 1XVVA 3LUKA 2C2YA 3IVMA 4Q9HA 1XD2A 3RFFA 4G0VA 4Z7OB 4X00A 4Y6PA 1CJKC 3P7MA 4JBXA 2CVQA 3IHTA 5ES3A 1NY6A 1ONOA 4Y2XA 3VPHA 1H42A 1ZN7A 4ER7A 5KQPA 1VBNA 2E5FA 2WJ4A 4P82A 2GJ8A 5LP6A 3UPUA 4UCPA 5DI9A 4IHJF 1S2DA 2QVGA 2REXB 2RI1A 4LJ4A 4E08A 3F49S 3M3HA 4XXHA 1IYLA 4ZANA 1HT3A 2WIJA 1NI5A 1A96A 4LSGA 4BEWA 4BXOA 4CGMA 5FPKA 3AOGA 3BMCA 3KR5A 1P9OA 4FGUA 1H1LB 1QIJA 3MINA 3DEYX 4XWYA 3QFSA 4LRWA 3NTUA 5IBPA 4EL0A 5FBHA 1HE8B 1PEAA 2HHLA 2W11A 3EBOA 3T3GA 1UOEA 4HOYA 3VDMA 4A91A 4BCCA 1YHNA 4D92A 4WINA 3EDCA 1OFGA 3AERA 2DLNA 1NA5A 4KEAA 3OKAA 3HKCA 4TMKA 2PUCA 2P41A 4V1CB 3GIWA 3OE1A 2EJTA 1UMCA 1QYXA 4YJGB 2BZSA 1OWNA 4DSNA 1OFTA 3D2BA 2HCBA 4RPGA 1P5JA 1T9CA 4OXYA 4XDZA 5G1OA 1JQLB 3WYBA 3KETA 2WHQA 5LXTA 4WECA 3SD7A 4XH9B 2FEWB 4FKZA 1CY8A 2GZMA 4C4ZA 3QXXA 2HOQA 4FQ5A 4Q3CA 2I9PA 2WICA 1GKIA 1NI4B 2AJDA 2WYVA 2JFVA 3DVQX 1QZXA 4XVQA 4JITA 1AMNA 2OILA 4FE7A 4W5HA 4HYQA 4B3SB 4HX9A 3GT4A 3JQ9A 5IVIA 4ZOQI 1YW6A 1GITA 2PRZA 2PNJA 2IT1A 4P4FA 1PEKE 1WY7A 1DCFA 1VMAA 1VLZA 1FXUA 4F2DA 2ZSEA 3WK9A 4XVCA 4K3NA 3OTGA 2YRXA 1KVTA 4HDKA 3RYHA 4QJ5A 4P4NA 4BLWA 2QEQA 3Q72A 5K8CA 1DS6A 5HMNA 2PKWA 3SYLA 2QL9A 2VSYA 3IVRA 2NSYA 2VT7A 4N82A 4IMRA 4FINA 3IV7A 3O94A 2P27A 4DT1A 1ZR2A 1TL7C 2QNRA 3GZNA 2Q9BA 2COKA 3I6YA 5IK2A 1LJLA 1E7SA 2IXBA 2QRHA 4ZIRB 4EF4A 1GTJ1 4PG8A 1Z0FA 2Y9PB 1QCYA 3JZIA 5EJEA 3VR4D 2EZ4A 3FA2A 1QXSA 1LZLA 4A30A 1DE0A 1TIKA 3FZQA 3LIPA 5E38A 3LVFO 4YRTA 5JPCA 5GINE 2H3EA 3KU1A 4DKJA 2PJ8A 2F7SA 2K7FA 5DBHX 3H65A 2JAWA 1F8GA 3I2GA 2ODPA 1N5LA 1OZAA 2IA5A 3SEZA 3R0QA 5J1QA 1A7KA 4HH4A 3H9GA 2ONKA 3G9TA 1G17A 4DC9A 3TUZC 2BEIA 2ACEA 2HZ7A 2NNWB 3LQ1A 3QP9A 1MO2A 3BGWA 3RABA 4C1BA 2F9MA 2GMWA 2F3PA 4ZRNA 1WM1A 4BOYA 1OTHA 4LISA 1XU7A 1V5IA 2WQZA 2ZYTX 3CZPA 1XMPA 4RAOA 1QFSA 3UT0A 4DA0A 5AESA 1SU4A 3U7HB 2I4RA 3LG2A 4RAQA 5F2OA 2A3RA 4BXOB 2PJCA 4AVBA 1QYVA 1TIPA 2E9SA 2GQ0A 4O1MA 1A2ZA 4NGMA 3RBXA 4PXEA 2B69A 3E3MA 5A03A 3TVTA 4S2UA 1MPXA 4W8HA 2OCLA 3JAKB 4K6GA 4RCVA 3B3VA 4PNEA 5ICSA 1HL3A 4NYMQ 5KU7A 2R4TA 3TDNA 2NT4A 4CLDA 4XRGA 3NV7A 3TZ6A 3BD7A 3V8RA 4DLPA 4GZ5A 2QMYA 1T1JA 3W9BA 3B7IA 3PEVA 1JMKC 2ZBQA 1TVEA 5J4LA 2D7DA 5HH1A 3HJRA 3K70C 4FBMA 3MGCA 5AYVA 4FQ8A 3EXHA 3N8DA 4A2WA 1WETA 3PBBA 4YNBA 2XNJA 4YLGA 3TZCA 1U3WA 1U8CB 2HQOA 2Z6VA 4ETIA 4HWKA 2ZYHA 1YQ9A 3I32A 1SOUA 1X1QA 5HF8A 3MJSA 1NMZA 3GW8A 3Q88A 4ASUA 5CK5A 5GADl 4NZPA 1IFXA 1UBCA 3EYAA 4BNDA 2HWWA 4V02A 3M34A 1Y4DE 1AKUA 1TT5B 1MIHA 2Z1MA 1BCRA 3VZCA 3N8HA 1U8TA 4CEHA 4FXPA 1SBNE 2R6ZA 1F17A 4E94A 1FFXA 4ZYWA 1W48A 1QIKA 2XA9A 2CNKA 3WB2A 1UXOA 3VR3A 2XCRB 4AM8A 4JZKA 5IVHA 3BWDD 3WYNA 4CW7A 3D6TB 4DIOA 1XZDA 3ZZIA 3T7TA 3K5IA 2BHSA 4KWIA 2DKOA 2FUEA 3P9QA 4YRDA 4EA6A 2YFYA 3W5AA 3ZN2A 1IVYA 1U9CA 2FFRA 1C50A 3JD0A 5E6UB 3ICCA 2Y71A 3RC8A 1OZFA 4WY8A 2GRUA 5F1OA 5TRTA 4QXQA 4Z3KA 5LPNA 2GEKA 1QRUA 2BZ0A 1F2UA 2VAMA 4W9NA 2HA6A 4DAOA 4UF4A 2ZIWB 2N42A 2CHFA 1XQWA 3NQ41 5I7WA 4POOA 1ZRSA 1MV8A 1YC2A 2JJ1A 2PCLA 1JVBA 4YBRA 3NHRA 1ISGA 4ADSG 4FYYA 4UWIA 2P62A 1NE7A 1RKVA 3DSRA 4KO4S 1XYYA 5K3AA 3ISTA 1EWVA 2XUAA 5FLEX 2C9DA 1ID1A 1MB2A 4RJ2A 4M0LA 1KS9A 2VA9A 3D02A 1NBOA 3Q2KA 4B75A 3HSSA 2H07A 3VOSA 2BI4A 1RQ2A 5CLFA 3M0EA 1U8ZA 4LOKA 5KNCD 2Z3MA 1YQTA 2WJVA 4AF6A 3ZZ1A 3TQSA 1GPYA 1IH8A 1ZNYA 3TW6A 4F71A 4OIDA 2VHUA 1CJVC 4KE7A 4B73A 1C0KA 2YDXA 4PX3A 1N6RA 3TNJA 1O3YA 2FV8A 3LCMA 1NW4A 3NOVA 4KN8A 3H19A 1DBVO 4GDFA 5E7MA 1ZKMA 2RGRA 2LTAA 3TTXA 1OXVA 1WQ1R 1J8MF 1JH8A 4I4CA 3UAXA 4RKFA 3INRA 2HBQA 3EZNA 3FR8A 5F5LA 1NQAO 1RHKA 2B4DA 1BXGA 1GRVA 1Z28A 2A9PA 4L4YA 3ELUA 4FEAA 3LPDA 3OLYA 4NDNE 1Y3FE 1DOHA 3K1YA 3E23A 3TLZA 2PSFA 4LZWA 1ZLIA 4YONB 2WVGA 1KBQA 2HSEA 4UVDA 3PVZA 4NQZA 1ZW6A 4II9A 3DMDA 5HEKA 1OX4B 4UQPA 3WLEA 2Q04A 2IW1A 3I01A 1NF3A 3FN4A 1H6AA 1PG0A 5DNDA 2ZE8A 4JP2A 3KUKA 1AM4D 3JATB 3C4QA 1TMOA 3GPLA 2A67A 4BNJA 2ILVA 1G8HA 5E6UA 1KQNA 2FE7A 1SU8A 2AFRA 2IPMA 4OQLA 2CXPA 3ER8A 3O8QA 3DV0B 2O50A 3N8GA 4E07A 2V8HA 5IJ9B 2C2OA 2ODAA 5AUOB 5ADVA 4NXNB 3B7GA 3F0AA 2AF4C 4MK4A 1QZ3A 3K70D 1KC1A 1XZHA 3AVXA 1DKOA 3OLQA 1HQKA 1XROA 1PDOA 2VJQA 2VPXA 3EGCA 2R84A 3LQFA 3KHUA 3JQDA 1WXFA 1Z12A 3FI0A 4EGCB 2XWPA 3INNA 3CZMA 3VNBA 3BIXA 4XPKA 3THXB 3JWPA 3K09C 2IU0A 1EXMA 4JKOA 1WRBA 2I3GA 4C01A 1I1NA 4DC1A 4I08A 3GEDA 4XPIA 5GZ6A 1LKZA 3TTYA 2ZUWA 4YUXA 1CR0A 1K8RA 5I5GA 1XQYA 2CNWA 2E82A 1E6EA 4RD6A 3DM9B 2O6HA 3KDSE 2CY0A 5DWMA 3A6FA 1RI4A 3RTDA 3I1JA 5C31A 4D41A 4Z1MD 2YY7A 4Q82A 1BMFA 1E79A 2W4IA 5CG1A 3ESRA 1XPOA 5J63A 2V9ZA 3FFXA 1SC9A 3A26A 3IB6A 4IFTA 2LR0A 5CR9A 4DDWA 2QL6A 2Q6IA 4OGFA 1FYEA 3V46A 3EQ6A 3RUFA 5B7NA 1H2EA 1S3SA 1U80A 4K26A 1T4DA 4LECA 4TWBA 5IAKA 2FPMA 1D8TA 5EC4A 1KFBB 2GEJA 1KO8A 5GONA 3SX0A 5CEEA 1L9XA 1T4CB 3AWIA 2FXIA 4QTTB 3MHPA 1SUAA 4KI7A 2Y2VA 1W88B 3N5KA 1JHDA 1YFJA 3K0AB 1POXA 3AI1A 1YVDA 1GZUA 4Q3OA 4IHKA 4DG8A 1UAGA 4JI7B 4DAEA 3AEQA 2X76A 3ANMA 3W79A 3ZD8A 3EY4A 4EZIA 5A4IS 3MUFA 4WSOA 5KOIA 2XNHA 2N0SA 4N65A 4RZUA 3GYGA 5DNWA 3CINA 2V4MA 5EFOA 4P98A 3WLQA 3E22A 1WZUA 1M33A 4DR5B 3VOTA 1U0NA 1UJMA 3SVZA 2Y0MA 1KOFA 2VTEA 2J09A 4G23A 3O3MB 4OLLA 1L7AA 1UC5B 3A3NA 3NKLA 4RFVA 3VZDA 3MYRA 1HLFA 4EKIA 2H1RA 3SP1A 2WNIA 1T9KA 1VLMA 3OZRA 4OA5A 3AH8A 3RIYA 4MVJI 3SN6A 3ZU3A 4EVIA 1R9MA 2WB4A 2X7HA 3G9XA 4J0FA 4JWTA 4W9RA 3RQIA 5JNVA 4KUBA 1PJTA 2QBYB 4TLDA 2JLCA 3AEUB 5T3UA 4A8PA 1PHPA 4CQLB 3EC2A 1PL6A 5EIBD 5H81A 1DIHA 4B8YA 3NT5A 5AW9A 1COWA 4CDRA 4YCMA 3Q3VA 3TFQA 5A6SA 2W42A 4QB9A 4H7EA 3PGKA 4HVTA 1M8JA 4XM1A 1V4BA 3W4JA 4WJLA 4I8XA 2QYTA 1LF0A 2MYNA 3CC8A 4R7GA 5T67A 5F47A 4FIDA 1T9HA 5BQFA 3PTLA 3QFTA 4OL9A 4M3SA 3SOZA 1QFMA 4P54A 3KQHA 1SXPA 4BAGA 2SCUA 2ZEPA 3KCQA 3DQQA 4LVOA 4UJ3A 3UOAB 5HS4A 4DMCA 2W8BA 3W4IA 2FETA 2XE8A 1NIPA 4DJLA 5TXGA 3ILXA 3K6JA 1NKSA 4H3SA 4RLSA 5CLLA 5FI3A 5TQJA 2VT6A 1E8NA 2BRUA 2ZU0C 3EEBA 4IEIA 1P29A 3QFFA 1RXVA 3L1IA 1R4MA 2FZGA 4D4KA 4BVEA 2NYVA 3D6NB 4CHTA 1J7KA 3D7FA 5LR6A 4G0YA 4BRWA 4KAXA 2IW3A 4LJAA 4TXHA 2PS9A 1L1EA 1YH3A 4X91A 2ORYA 4V38A 2RHRA 3NWBA 1VGVA 4L73A 2VQ3A 3H9CA 3OQMA 3HKEA 1IJFA 4M76B 3ROXA 1Y6JA 4E7OA 2IYLD 3G88A 4ND8B 3W6NA 3FUWA 3GUZA 3K3PA 4P9NA 4F1KA 2QPAA 1YI1A 3HA2A 5ILOA 3MT0A 5IW8A 1II8A 1R6TA 2VTBA 4ZOAA 2XHZA 1A77A 3R8FA 5BQXA 2IC5A 4OKOA 1GPH1 1VYVA 1NJ1A 2IIQA 4XR4A 3VU0A 1C7EA 1EEHA 2NXJA 4WOBA 4IO1A 2Q5EA 2GYYA 5CH3A 1JIQA 1SOWA 3WKAA 1EFUA 4LS3A 4LOAA 5FORA 2HYDA 4AJEA 3R3JA 4J6FA 4N8EA 1CY7A 3MFYA 3WA7A 2AGVA 1HYHA 4BMHA 3PZRA 4RHTA 4NK5A 2R0QC 4D4HA 1I4EB 3N7ZA 1REQB 4OKNA 3RVDA 4A5OA 1A9TA 1P0MA 1QBKC 3GCZA 3H0KA 4J90A 3SCZA 5HXAA 3CEAA 4MTLA 5HGJA 1B6RA 1I0LA 1EVZA 4MI3A 3V8EA 1OWOA 2PSWA 2DUUA 5DI3A 1SURA 1SK9A 5BR7A 2CDNA 3O1JC 5ER9A 3NMUF 1GZ7A 5JG7A 1OZGA 3WGYA 4MDEA 4O5AA 2SKEA 3GI1A 1LTQA 1ZIDA 2JJ2D 4KXLA 5EHIA 1X94A 5BUQA 3EH2A 5BVGA 3E0KA 1OFUX 3QAHA 1H2FA 2I87A 3H8VA 2IE8A 4QPCA 3AI2A 1F60A 1KMMA 1WCIB 3AESA 3B9BA 2HO5A 3CNNA 3H2KA 4ML3A 2AZXA 2P6GA 2ISSD 1R9NA 3FDZB 4ALJA 5EKUA 4AMZA 1U1FA 1PT7A 5BXQC 3B1ZA 5JDIC 3A6LA 4Q19A 1DADA 4LPSA 3AEXA 3M81A 3HCCA 3PXUA 4FSXA 3DGFC 2PIAA 2G09A 4UD6A 4DBVO 1FQJA 5CDUA 4KORA 2XY4A 1C3EA 4IWXA 4XIIA 1WMFA 2PXHA 4U2GA 5LWQA 1IK6A 3BL5A 3V8BA 3ZV3A 4K6FA 1A0OA 1ZVKA 2VUHB 5LQKA 4PTZA 4CCSA 1UXIA 4DWJA 1IOWA 1OXTA 1Y8RA 2FA9A 5BW8A 2FY8A 5LDDC 2C54A 3DZDA 3SIPA 4IILA 4PZ0A 3C5VA 4CLRA 2BGWA 1F2UB 2C7BA 2G67A 4JQSA 2I4LA 3CPJB 4QUHA 4YMIA 1WNTA 4R3WA 2A7XA 3ZV4A 1F5SA 3O4IA 1MRZA 4BNMA 4JLWA 1YQXA 2WKRA 3CG0A 1JTFA 2HSZA 5M04A 1UKBA 2B83A 1M34B 2OXCA 3E3NA 4YJ2F 1CYDA 2O1XA 3MCWA 4BJ1A 2ODEA 4W4TA 2BHNA 4RTPA 1CB7A 3H2BA 5FYDA 3HCEA 4CYOA 1ZOIA 2NX2A 2XTMA 4F4FA 5KNBH 1YR2A 1JE0A 4H7HA 4P3KA 2EKZA 5DXAA 4BB0A 1NVGA 1LRZA 1IAVA 1I32A 5IU6A 1LQUA 1FNOA 1Z8WA 3PQ4A 1TW2A 2OH1A 3JVDA 5EP1A 1G1AA 2R8VA 5J2UA 1AYEA 2HK7A 1LW6E 3O0TA 1WLYA 3ZHCA 3G02A 3C6MA 1LOKA 4RA6B 3HR7A 3CVYA 1ZD8A 13PKA 3HU5A 1SUEA 1IB1E 2XT6A 1HDEA 2J8ZA 4KMMA 4O8ZA 2CUKA 4F4CA 3Q8LA 1SBYA 1YSCA 1RLMA 3WL7A 4L3VA 4CG3A 2E37A 5CA1A 4LY6A 1TKFA 5KYXA 4HVAA 1KY3A 5COAA 1AXGA 4BV8A 2G0TA 1SBIA 2JFUA 1QM5A 1P4GA 1XZQA 4FJ0A 3UHAA 3BB4A 2ZRHA 3JZDA 1SCDA 2QU8A 5EQTA 2Z1DA 4E7PA 3WTBA 3WRXA 5JADA 3I9LA 3BXFA 1L8OA 2FWMX 3MWFA 4QEKA 5M29A 1XZ8A 3MRUA 1A3CA 2NO4A 1UPUA 2TS1A 4P31A 2B7BA 1QYIA 1VIMA 4YH1A 1TYEB 4AZ3B 4CMAA 5TIIA 4MHTA 2J8NA 2OXEA 3VC2A 1B74A 1DKQA 3GIUA 1Y6GA 2X0DA 4CV1A 1OC4A 3AZPA 2IV7A 2C98A 2DFVA 2XB8A 2JLAA 2Z08A 3ED1A 3HJCA 1KVQA 1M2VB 2PBRA 5JY1A 4ER6A 1Z0KA 1P2TA 2JLMA 3ZDCA 2ERCA 2ES4A 3TAHA 4A33A 3RK4A 1N77A 1CTQA 4RA9A 5LYDA 4M0DA 2R44A 3EUAA 2GX6A 4W99A 5CFOA 1M8FA 4OHCA 1LDMA 1FNSA 4DR4B 3FB4A 3QEMB 3VATA 2QN6A 4DIFA 3ZWVA 3PXXA 2XR1A 4L28A 4NE9A 3W05A 2O2SA 1D09A 3D6JA 1N8TA 3WYGA 1UF9A 2FCAA 5IM5A 5C1BA 2CHGA 2C5HA 4L9WA 2ZTMA 1MTOA 5TMEA 2GJSA 3CR7A 3OCCA 1OH6A 1X77A 2ORWA 4LWQA 4NABA 1RP1A 4DWVA 3LHDA 1HE2A 3O2SB 3PGA1 1UDAA 2V5UA 4PXAA 2H65A 2I55A 3LV8A 4EATA 1DAFA 1D1QA 2Z83A 4G1FA 4GIBA 3ZE6A 4NV0A 3BRCA 1VLVA 1GPAA 1T43A 1U4OA 1Y4AE 1LDNA 3C8HA 1NQXA 3KYJB 3QE3A 3REOA 2ZS7A 1Y8RB 3EXHC 4KR3A 1ZONA 2XGSA 3F6EX 5EN4A 2PJDA 4ZALA 5J59A 1H6BA 3U81A 3T4UA 1BXKA 4CDMA 2VP0A 2ZBPA 3JCZA 3OMXA 5FWXB 3H1BA 1VHSA 2ECKA 2GVDC 3R5SA 2EHJA 2IYPA 4FMCF 3V42A 3TC8A 4D25A 4RACA 2HSWA 2PWZA 3OTIA 4RQBA 5LJIA 2WD9A 1G18A 1SBZA 2I03A 3L0IB 4A03A 2FR8A 2BGGA 4WK4B 5J2TF 3WRYC 2O7SA 3PGVA 2BP7A 2QRMA 2OP0A 2WILA 4KK4A 2W71A 3MWLA 5ALFA 4I3HA 2CMGA 4AY3A 4NF1A 4IHAA 2J6CA 1E77A 1B26A 1R0CA 1GDHA 2YIMA 5IWCA 4NKRA 5BYJA 2DLCX 2GNAA 1VKRA 2NPOA 4R8MA 3ZHZA 1DO2A 3LQYA 5BVHA 3JQ7A 4S04A 4J7CA 2IS4A 1N2SA 4DUGA 4ZC8A 3NG1A 5JQGA 3FFAA 3EWSA 1TVKA 2AFIA 1DXQA 2WNSA 3FSGD 3OFVA 5CURA 5EJGA 1MGPA 2PR7A 3DJFA 5AIBA 3OM8A 1EP2B 4B3RB 3L4BA 3N0TA 1W4LA 2OWEA 4U2EA 2V59A 3FGNA 4E0AA 4V0SA 5D6OA 3KFLA 3T3PB 3IJEB 4J1QA 4OB7A 1I1HA 4QOFA 2ZJ4A 1KMIY 2ZUBA 2PGXA 1LS1A 1VKCA 1LDGA 1NTRA 4KVGA 1MX5A 2Y0EA 1O9BA 2GTPA 5I9NA 2JLYA 3T99A 3U80A 1M6NA 1CHNA 4RK4A 4CZ2A 1O5TA 1IATA 1QNFA 2P78A 4D5EA 4F3NA 5KJ1A 1QWSA 4RVUA 4XNHB 5GTDA 3KBOA 4ZIRA 1RI2A 4N3BA 5LQUA 5EIFA 4ND3A 1XMQB 3CX8A 5IH3A 2JAXA 2WSSA 5KQRA 4PBRA 5WRFA 3O1HB 3FNHA 2A9JA 1N32B 4OEHA 4NAHA 3TZKA 5JALA 2Q8NA 1W36C 4IJUA 1KSGA 1ZXLA 1ZXXA 4II2A 4RDIA 3W2HA 4QOGA 5HKKD 3B8HA 1W73A 4TWAA 4YVFA 3BA1A 4B7AA 4E14A 3H2JA 5KNBA 3TEJA 2L69A 1NN3A 1U2GC 3T7CA 5KIAA 3O8CA 2HPAA 4EY8A 1L5RA 2PZEA 1DBSA 1CVIA 3T1VA 1GTL1 1OXSC 1UBMS 4M6IA 3JQ9C 2ZUEA 4GPEA 1W47A 2C2ZA 3PJEA 4FGZA 3HWWA 4JQOA 3NE8A 4RTQA 1RXUA 4ZYZA 1G63A 4KN9S 3HKBB 1P5ZB 1ONBA 1C2TA 4TV8F 3VM6A 5L6LB 2P69A 3L0OA 1JP7A 4CTOA 4YMTA 5EJ4A 2DBZA 3FF1A 4OVKA 1M5UA 4WV3A 5I7AA 3CXUA 1CY1A 1GQ2A 8ATCA 5LZ9A 3WP0A 1U7TA 1GGEA 2VL7A 3ZQUA 1L7VC 2NQ8A 3K1TA 4DCTA 1I51A 1TUIA 4R9SA 2DPXA 2GASA 4DCNA 4RFLA 4GOLD 2VTDA 3TTWA 1Y6QA 4UVEA 2O8FB 2Q2NA 1G8KA 4C5AA 4L78A 4G8JA 4D9CA 3FKQA 1M72A 3IB3A 2I7CA 4CCWA 4E4TA 2ZJAA 1XWIA 3DDZX 3QPVA 4FI3F 4TKVB 1EUCB 5CJPA 3NEPX 3QYFA 1N75A 3EGIA 4JLPA 2CXHA 4FOTA 5BQPA 3TTVA 3WO0A 4DMRA 3PX7A 4N0PA 3BGOS 4TMZA 1GNSA 3MXTA 3UPTA 2IH2A 3C14C 3V3TA 5K2OA 2FGKA 3L4BC 4U0KA 2CNOA 1Z4OA 2QTWB 3KVRA 3FROA 1ZVJA 2FUCA 3MB5A 4H1UA 3K8ZA 4OC1A 1YRWA 4WESA 1JQBA 4XUCA 4FX5A 3N7TA 4CRWB 3BFJA 3GJYA 1MT0A 2AFUA 4EITA 3DE7X 4KBGA 2J3HA 1U9YA 3F9IA 1NG9A 2XUIA 3AB7A 4F5EA 3O2QB 1PJBA 4MWZA 2VP3A 3E5RA 1LU9A 2DFDA 4IRUB 4EVYA 5FKJA 2XNSA 4ZQBA 2NXCA 1PWYE 3BN3A 4UBNA 2B4TO 2C9CA 2IKQA 4N9WA 3BBLA 2I1VB 2BHRA 3N2GA 1WEKA 5JV5A 1YJBA 1G3UA 4R51A 4W1PA 2E85A 2TECE 4AUNA 3GNSA 4XVRA 3PC8A 1T0PA 5ARDA 1YMEA 1NP6A 4DA9A 4CQNA 2QIRA 4AG3A 1RC1A 2Z8YA 3PL1A 1GXSB 2W2NA 121PA 2ISQA 5BN5B 1ECLA 3EXIB 3K9QO 1EJ6A 2AOTA 3E48A 5E2IA 1CETA 5IASA 3R6GA 3V7ZA 1PR1A 2IZ1A 4WBNF 3BWYA 1FUUA 1HF3A 2QZZA 4J76A 2A4KA 1VYTA 4RGQA 5ULLA 2DKFA 1O2DA 3H4MA 1PL7A 2VCEA 4H17A 1B1AA 3P2YA 2H4HA 3PT5A 4F21A 4H7PA 3QVWA 1T4MA 1TRKA 4PSCA 4POAA 4OB6A 3RWOA 1RXWA 1OVMA 1C3JA 2C9YA 4GW3A 4JMLA 1QSTA 4L75A 1XQ9A 3WISA 2P4UA 2RGBA 2MMCA 3VJMA 4B32A 3DLBA 5THKA 4Q1EA 3GQVA 4IYJA 4QIHA 3U31A 4G85A 1B0AA 4R7TA 1DXHA 1KIFA 2FPPA 2NV0A 4OI1A 2JIDA 1IL0A 1F20A 3OQIB 2FHSA 4URYR 2WTEA 5EP3A 3R7FA 3PB8X 5EJ8A 3W7VA 2QT0A 4J94A 3FVLA 4CF7A 4DOMA 2Y66A 1ZUWA 1ONNA 1Y7TA 4H31A 4I4IA 4U7FA 1Q3HA 1P80A 3BIOA 4WJZA 1BWPA 4K6MA 1T5OA 4DHWA 1JQ3A 4UFOA 5FLXA 4DZTA 3ZVRA 4HGNA 2FIAA 1YL5A 1FA9A 4ONWA 3B70A 4RV5A 3RRYA 2QTMA 3A7EA 1GUZA 1XMTA 3B2YA 4N76A 4E5VA 1MH1A 2KJQA 4B85A 4EGQA 4IJQA 1E99A 1KZ4A 1XXHA 2ZUVA 5IKPA 4G1UC 1IOIA 3TZQA 1JKIA 5JH7F 5ALNA 1KL7A 1UDCA 1ZC3A 1NWHA 4FHZA 1I94B 4IVQA 1HYEA 3N74A 4QBFA 2H1SA 2GPBA 3N2ZB 3NRCA 3QNUA 3UMGA 2BM1A 3QX8A 4CMIB 5I8ZA 4F9UA 3C7DB 3Q7QA 3VPAA 4QQ8A 4CYMA 1NBMA 3QJYA 4GLFA 5D1NA 3IOYA 1SRQA 4BC0A 3HYLA 5KSZA 2AFSA 3M5CA 1R10A 2ASEA 1NRXA 2PH1A 3ZKWA 1QIEA 1CUHA 5G3YA 2G9NA 1Q5PA 1E7QA 4C7XA 1WW2A 4DSOA 4GQBA 3TIIA 2OSBA 5H70A 5HTOA 3BCRA 3H6HA 2JEYA 2J08A 5K3SA 5LLTA 4PSUA 4CLRB 2JVJA 4BQPA 2H48A 2VJCA 3VR6D 3SQXA 4B2YA 4UZFA 2YGWA 3IWWA 5KTNA 4CLOB 3THWB 4QZVA 3ILYA 2IUTA 4RMIA 5T8KC 2ECPA 2AK2A 3AJRA 2GOYA 3NFYA 3U48A 1N57A 1P31A 4BY9E 1XMSA 1WP9A 1J0XO 3L1UA 4RH1A 3RKUA 2ZULA 4MPJA 3V7NA 4AP6A 2XCSB 3P19A 1Z45A 4R8FA 2C7PA 2XRMA 2RH4A 5FTMA 3FNIA 4CQMB 5I7SA 2NYUA 2O3RA 3WB9A 4ZGWA 3IDZA 2QBYA 4K81B 2FMUA 3OU7A 4EPWA 1HY3A 1PK7A 2CF5A 1X86B 1UJBA 1YBHA 2FPPB 2IYXA 3E0XA 1RRGA 3DPSA 3PUJA 4KXUA 4LDAA 2XQVA 3RE1A 4EGJA 2B4AA 3COJA 4E13A 3ONEA 5NLLA 4L4XA 3HKDA 2X0KA 2QMOA 2A5JA 4TMFA 5HIKA 2NOAA 3L05A 2CNSA 2PDAA 3SQOA 3F73A 1NBAA 3LK6A 2ID4A 3MJDA 1I1OA 4ZT3A 1FOEB 3HYNA 2FW6A 5A5FA 3S1SA 1J1IA 4YRIA 4YRZA 2CV1A 3OZAA 1BOBA 3GMIA 2C8JA 4WGFA 4G0MA 1GRCA 1QR6A 3QUBA 3QOWA 2Z09A 3RUCA 4IGKA 2NPIA 3BCSA 3OMLA 2JGRA 5J8FA 3M6WA 1VCIA 5JSHA 3R7DA 3B6JA 3WL8A 4F12A 4UFPA 3K53A 1IRXA 3IEMA 1I7PA 2IOQA 3TX6A 3BCUA 1I4LD 4YTEA 1Z25A 1YV9A 3L93A 3UHOA 1UKEA 4BN5A 4OQPA 2A9FA 4WWHA 3HU2A 3FYCA 4F8YA 2DUMA 3OD1A 3FWPA 4ACAA 1VHQA 3UAZA 2QG6A 5CNKA 1CVRA 3OAAA 4PCLA 4WJBA 3ILVA 3MWEB 4D9MA 2BSQA 1DJNA 1GR0A 2CCKA 2OTCA 4F3TA 3K8YA 2XODA 3CR8A 2CXQA 1JEDA 1GPNA 1DIOB 1CUUA 2KHZA 4GX2A 4JR2A 2YWRA 1XK6A 5DPMA 4ZYXA 1Y1QA 3MAAC 4A8JB 1Z56C 3MUOA 4K1XA 4LUAA 2G5GX 4NBNA 4CKEA 3ROEA 4E1BA 1GUFA 5I4BA 3SXUB 4ZOLB 1QGOA 1E3WB 1SUFA 4YAWA 1C3OA 3M9XA 1E0SA 4MMXB 5AW8A 2ZAGA 2QS9A 3IV9A 1FPQA 2Y92A 4FFPA 4OBXA 3HZHA 1LPOA 1M73E 1SWVA 3BQMB 2HRBA 3QKTA 3C0KA 2JGDA 4HNWB 4BFTA 1AX9A 4N6NA 4NU8X 4D43A 5HZHA 5T57A 4E4YA 2I3CA 3IH5A 1UCFA 2IY7A 3IS3A 4LMBA 3F8WA 2FG6C 5KYYA 1QZUA 2I2DA 4CM1A 1JJ7A 4KQWA 4K86A 3MLAA 4IQFA 3RSQA 3ZGLA 2WYRA 2VT3A 3HEAA 1GJRA 5E4TA 1BX0A 3GZJA 4L7VA 3ICPA 2D1QA 1OHHD 1EZ4A 4HZUA 5HK8A 3UAOA 4BVJA 2WWIA 5AXAA 3TW4A 2Q7OE 3SSAA 1F2DA 3LZ6A 4HJXA 4QUGA 5ENVA 3G0HA 4Y3UA 5FEMA 1EGAA 3GN2A 2F5IA 2GVZC 4B6OA 1SUCA 5CT5A 2G28A 2WPDD 4F4IA 2EL7A 3ELYA 1CUJA 3ZYZA 3ITDA 1LV7A 3IT3A 2BIFA 3GLIE 2RC4A 1S4MA 3R3VA 3WRYA 4ZN6A 4G01B 3G0IA 4R6XA 4DTIA 3LQRA 3R95A 4B4OA 4IUYA 4DPLA 5A5EA 1G21A 2DR2A 3QWBA 4DQXA 4PPZA 3MGAA 1EUDA 5EJMA 3NNNA 1G8GA 1OJ7A 3IMEA 5IFLA 4FD7A 1THMA 2FF5A 4IZOA 1Q21A 3RARA 4HR7A 3DF9A 2VH5R 3QLEA 1YQQA 2JANA 3FHTA 3EUEA 5F12A 5EL0A 3T61A 3ERCA 2NVOA 3D3WB 1WUKS 3IO5A 4ZK2A 3MQ4A 3QPUA 4JL6A 1VI2A 2PJ5A 3HY4A 4FWBA 3V8MA 1ZHFA 1KO4A 3CS3A 5IC6A 1PYTB 3G8CA 1ZHHA 3K73O 4GZ3A 2CXXA 4PZYA 4YRJA 4BNXA 1E1CA 1YR6A 3DR3A 3OUTA 3K9GA 1USVA 3K0AA 3OZXA 5KTAA 1NJGA 4P3XA 2W2LD 3L5OA 3OAAD 1SIBE 4I2VA 4DT1B 5KINB 4REQA 5IBCA 1CUFA 4JHLA 1DFIA 2W9XA 1RWKA 2YASA 3VPFA 1DIRA 3WKEA 2MWMA 4FZJA 2FPKA 2HLPA 2HLDD 3RYHB 4NK4A 1XE4A 3N6XA 2A4MA 1A88A 3H2ZA 2PBZA 1YJ5A 3KPUA 3ETHA 3R5FA 4IKOA 1RFLA 2XTAA 4NRDA 2AJTA 4Q9NA 3WSTA 1OBRA 1YX0A 5HHTA 3S28A 2J0QA 3D6MA 4LVUA 4MY3A 2RSLA 3R0XA 4M1TA 2EK9A 1T8TA 2JIMA 2Z0MA 1IMJA 3JQGB 3Q3GE 5E4YA 1YSJA 2A1IA 4LGVA 4KH0A 2V6BA 5EKXA 2AFWA 3QIAA 1BJTA 5DB4A 3VH1A 1MJAA 1KORA 2F3RA 2VK4A 2QRNA 2R62A 2B58A 2D5LA 2Q1XA 2QLLA 2GPWA 1SCNE 1UK7A 3GEHA 3KZNA 2OKGA 3NRBA 2XAAA 2ZWVA 4FD3A 4HUQA 1P19A 4N3GA 4OC2A 2JBAB 3OE7D 3QLJA 4HLCA 4IQ0A 3D6FA 4KR0A 1F7UA 3R40A 1RBYA 3EBLA 4KVXA 3C26A 1EQUA 3IU2A 1I80A 1CE8A 2C1XA 1U0TA 3TMYA 3V4LA 3VGJA 4NESA 1XKTA 2AEEA 3DC7A 3EVAA 3E7DA 2Y67A 4FLFA 2B82A 4QUIA 3NAMA 4MQMA 4N3NA 3GOHA 4V3BA 5DWDA 2C04A 2NGRA 1JEYA 2IXFA 1RLTA 4PLGA 1BS1A 3C3XA 2HA7A 4JJEA 1ZR4A 3KR9A 3DVSX 2FN7A 4NJQA 4OLBA 3F1KA 1FFHA 1SCAA 2GDZA 3I6IA 3OCXA 4GI1A 3KLNA 4Q18A 3TSWA 3VR6A 1NVTA 2WAYA 3KR2A 4GD3Q 3VVCA 3EF0A 4B76A 4BVBA 3UWOA 4Q7LA 4D9HA 3B38A 5KPDA 2PH5A 4Q4JA 4WXYB 2AZDA 3KKQA 4UBMA 1I12A 5JE8A 5I7VA 1D2AA 1G8PA 1ZAKA 2GR9A 1FP2A 2XGOA 3CLRD 1FVFA 1RHJA 1WXDA 3CZ4A 1I2BA 1QE3A 3GGPA 3PU6A 3FG9A 3N28A 3NT4A 4GI3A 3L06A 2V8DA 2XECA 3CCFA 4IUBS 2X3UA 1UDXA 5E0OA 1GQOA 1TIQA 2A84A 1V43A 2J9GA 1IEWA 4JOBA 3W91A 3PX3A 1TM2A 4DV3B 4B6SA 3T3NA 5LZ8A 3KWLA 1JHMA 3QXJA 4F2GA 3PQ8A 1VFNA 1LC3A 1GOTA 3F8KA 4AYWA 4YQZA 3OTWA 4NP6A 1M2NA 5TS2A 2XTJA 1THGA 5CD9A 4BMPB 3UWKA 1VJGA 1IZ8A 3DF7A 4BQRA 5AQ1A 1DMRA 3DW3X 1GCIA 4DLUA 1EE1A 4BFZA 5JCOC 2R7HA 2G06A 1T3TA 3AKCA 3HWSA 4H18A 4PVCA 4KYTA 3KHXA 2XDAA 4GPD1 4GGOA 4YV0A 3OD5A 4KQ1A 4DXDA 4YP5A 1U7DA 4KPUA 5DULA 4FAIA 3A1EA 3R1IA 1KEEA 3OHPA 3CURA 4LXTA 1K89A 4UOEA 1XTZA 3UXHA 5BNIA 4EEKA 4GSLA 5KOHA 4IVPA 4FWUA 1NBHA 2QUBA 1YU6A 2ZKLA 4G1MB 2C4KA 1PV2A 3A31A 4R41A 3N5FA 5ADWA 5A3VA 1AUPA 4D4IA 1G0NA 2IX9A 5J4VA 3R3SA 5IVDA 2Q4RA 3AM4A 2QJ8A 1YS6A 1ZN9A 2PS1A 2EGUA 4NHOA 1F51E 4PXDA 3II6X 1MNAA 4R9MA 2VPIA 5HKLA 1WZNA 2WMNB 2XITA 4IJWA 4NYJR 2OPBA 2VXOA 4YMWA 3S55A 4E5YA 4OC5A 1DRWA 2FG7C 2GA9A 2GAOA 1CRZA 3QLTA 2BKLA 3Q7IA 1T24A 1T6BY 3DYVA 2CJWA 4MVJM 4A0HA 3B9PA 3TR6A 3E03A 3O2JA 4GM0A 5AM0A 1R37A 4IDHA 3FYUC 4OHBA 3RK1A 4N48A 2ZIXB 3W5DA 3B1FA 2WZQA 1CZOA 1L3IA 2PX2A 4ZVPA 4TYYA 1SOMA 4F11A 1EVYA 4GKVA 4LXUA 2HXGA 2AD1A 2V7GA 3WWYA 5D84A 2PLRA 4GNKA 4G1CA 4ND2A 2WDZA 3GDWA 3S8YA 1ZM9A 1R9JA 2XUDA 4OFXA 1W85A 4U7HA 3L5KA 4JSRA 3ZWKA 1USIA 4DA8A 1LDEA 4KFUA 2XDWA 1ZD5A 4UXHA 2DY0A 5CLGA 3FPGA 2YMLA 3CY6A 1EE9A 3FUTA 5ECGC 3S1AA 3T0IA 1KTVA 1EG7A 2PPVA 1J9GA 5HM8A 2NTNA 1FUYB 1HR0B 2FPRA 4GP6A 4NOKA 5FA8A 3LPMA 4I9GA 4CR6A 3IIBA 4KVZA 1SCUA 2WUFA 1UEJA 2ZJ6A 1A9YA 1GUAA 4C0JA 4UTZA 4ZU3A 1BMFD 2NG1A 2WP8J 2PQMA 5FBWB 4GGMX 4QBJA 3S9NA 3I04M 1SXJC 2PO5A 1RVV1 4JYWA 5MN6A 4C5CA 1NPDA 4K6CA 3GJZA 3U49A 1EGHA 1VMKA 4WE3A 2HEIA 4ARUA 3I61A 4B7UA 2UZIR 5KYNA 3PRTA 4UOQA 3WL6A 3E2IA 1SOAA 1OGYA 1WD7A 2PGDA 4AKTA 1KPHA 4DNXA 4V1CI 5AI4A 1YB1A 3GN1A 2G1PA 2VUUA 3GCWA 3P0HA 4XWWA 2TMGA 3MMZA 1NRJB 1IBLB 3D7HA 4GBJA 4FNAA 1E3DA 4DLXA 1JTEA 2ZYWX 2EZTA 1ISSA 4B31A 3DNFA 3CCCA 4CDGA 4OBEA 2AOUB 4NR0A 3BHNA 1QK5A 2ZJZA 1FDUA 1N1DA 2HRZA 1QGUA 3E4CA 4HZIA 5AVQA 3DDUA 4QTXA 3BFKA 4RHEA 4MKIA 3IEUA 4RXUA 2C00A 4HLUA 2NPFA 1LLDA 1T2UA 2WFLB 2ZAOA 4C76A 2F67A 3X1YA 2PVVA 5FV7A 1FS5A 2BGKA 3U40A 2R7KA 4GAEA 3ZGNA 2C5FA 4YRRA 3L79A 4LPKA 4ILKA 5FUYA 1JDVA 2CB9A 2Y0PA 1A9RA 1K2VN 2AK3A 1Y81A 1TQ2A 1A5TA 4N3AA 3IAXA 4MPTA 2YQZA 4UHJA 5EIAA 4S0ZA 4WDQA 1Y0BA 1ENOA 2CXRA 3GYBA 2XOEA 3AP2A 1UKYA 4MR8B 4U1RA 4XA8A 3OJLA 3E70C 4MHOA 3K0EA 2OHXA 1BD4A 1YGYA 4KUHA 5B1SA 3VKWA 4OGLA 3I09A 2XXAB 5H86A 1Y89A 1R57A 4CLXA 3B52X 3T3DA 3ZOZA 4NU6A 5JASA 4YRHA 3VOAA 3CR3C 4LYYA 1QUFA 4D7AA 1AHNA 4RADA 1AS0A 4J4BA 5D5QA 3WYDA 1P44A 4UWJA 1OIWA 3OA0A 5AM5A 1SQGA 2ENUA 1Q0RA 4AVAA 1B3RA 4MGYR 4P80A 2CBXA 1HRDA 1W94A 4ND4A 4V0MA 1PV1A 4YAJA 2RGYA 4PLYA 1EM8A 4L1KA 2VHEA 4LHWA 2ACVA 2WFAA 5TS3A 3R0ZA 1Y1PA 1FSZA 1N5JA 1SHLA 3AEQB 3IRUA 4Z0NA 3RM3A 3ZS9A 3OZGA 4IMPA 1QPZA 3DFKA 1N2XA 1RRPA 4D8VA 2CN1A 5FBZA 5HCUA 4HB0A 4YGOA 4GS4A 2GBLC 1ODCA 2J9XB 2JFOA 3C15C 2TMYA 2WA2A 3DMHA 4GRIA 3P94A 2VQDA 1YS1X 3HVIA 5L3QB 3BZWA 2G71A 3TINA 1TE2A 5I7RA 2HMYB 2OAP1 3MTQA 3SI7A 1IOZA 1E4VA 4HZUB 2IELA 1I24A 3DTTA 1YQWA 1Z0SA 3AL2A 4X6UA 5BN4A 3GCXA 2E5LB 1Z8DA 1VIYA 3OA2A 2A0WA 4YRCA 1YS7A 3E2MA 1GPLA 1PR3A 2O2GA 2P1ZA 1IAQA 5J9FA 4M53A 3EH1A 4YLYA 1L1RA 1D4AA 5CFQA 4A1OA 4ARSA 3PJRA 1F1JA 1KVSA 4FILA 2SKCA 2MR5A 5DF1A 5G02A 1I7QB 4XZ3A 2ZEMA 4JGGA 5IYZB 1TK2A 4FGSA 3I64A 3HI4A 5JD3A 1UC8A 1TADA 4XJVA 2Y3IA 4EPXA 5IM4F 1E6UA 1RWQA 4BU1A 1LPBB 2J8MA 1Y34E 2OHHA 2OYCA 4DSTA 3QB8A 3R3YA 1Y9KA 2RHDA 1L5NA 2H4JA 5E6RB 5BR4A 4OK5A 2PHZA 2V3WA 2PL3A 4WCVA 4ZHQF 3OQJA 2QRPA 3BJZA 2ZPAA 1F2TB 4IINA 4EUHA 1TPYA 3AZQA 4CF6A 1S5KA 2YBDA 4DJ5X 1VOTA 2ZR0A 5JD6A 2JDDA 2OGWA 4ESOA 4BE7B 1QANA 3HUFA 4CQMA 1MJGA 4OFWA 4BX9A 4RA9B 1KE1A 1WQ3A 2G63A 2CUNA 1Q15A 3OKPA 1JR3A 4YASA 4DUYB 1U7HA 1EUZA 1BN7A 3QXSA 3DP7A 4IIYA 2HRDA 3P9NA 4RKWA 4ABYA 3QVKA 1KZ9A 1BLLE 1ZJZA 4R69A 4E5KA 4DLSA 1BWQA 2YJ4A 3KKLA 5F48A 4DM3A 2W48A 1NU8A 1SXHA 4QO7A 1NXSA 3G7UA 2QU7A 3X2FA 1EWTA 4A95A 1FSPA 3JASA 1JEOA 3GFPA 3GJ0A 5ESRA 4EHNA 4JLKA 5EMKA 4K9MA 4WTOA 1J8FA 1EXVA 3P2OA 1K5PA 1RRVA 2D59A 2MR6A 2YHAA 5FLYA 3TOXA 1WQ4A 1HFWA 4DBLC 1JBQA 3DLHA 5AMXA 1I3NA 2PR8A 1SULA 3L82B 1GA1A 4IY1A 1SXJE 5AOCA 4B45A 4ED9A 4FCCA 3FM9A 5KJCA 5L3SA 4OUDA 5HRAA 1EDEA 4XR9A 4KQXA 4DDHA 3JPYA 4UNRA 2JRLA 1AXEA 4Y2UA 3GJ4A 3FCSB 2QUAA 5LBIA 4L4RA 1K08A 1NN0A 1WCV1 1CVLA 2ZIFA 3G8DA 2PGJA 3SS7X 3HDQA 5IHXA 4TLMB 1BMTA 2KM1A 2FJUA 5TQ0B 1VI5A 1RMQA 1US8B 1INLA 3KOMA 1P74A 2YHIB 1MOSA 4QWMA 1XN1A 1HM5A 5FO0A 2GN8A 3T5GA 4MXUA 1NAHA 2WSAA 4IEEA 4KFCA 3JVUA 4MWTA 4BWYA 1FDTA 1FW8A 3G8YA 4YWYA 4OYHA 1SNYA 2ID8A 3TEMA 4O2LA 1N0VC 2XWJI 4IX1A 3GHHA 3G82C 3LT4A 5FNVB 1J9EA 3P27A 3RYOA 4R3UC 4I8IA 4TTTS 2ZW6A 5GPBA 4Q47A 3WK5A 2G36A 2J7PA 2QN9A 3FRHA 3TZBA 2YNEA 3OQNA 4CGZA 1X38A 1OGIA 1QDLB 1DAGA 4OQMA 2RDMA 4Y7CA 3EEOA 3VWDA 4I9NA 4BO5A 3V6LA 4NICA 4DLZA 1LLFA 2YIDA 2Y05A 4AMVA 1UBRS 3ND9A 4BRZA 5HRCA 3WRXC 1HE3A 4PLWA 3NI2A 1DQPA 5AVKA 3LHIA 4QJIA 5CAEB 1M2HA 4D0NA 2ZEGA 1QRDA 5HFAA 4QYIA 3E1KA 1XJ0A 3U4AA 4ONUA 2HLHA 1GG5A 3RFUA 3ZBUA 3F6SA 4EJSC 1AGXA 3Q7PA 2PUVA 4NJEA 3A3KA 3QKWA 4S1NA 3CKMA 1XN4A 1Y9WA 1XQVA 1DINA 4JLOA 1B76A 5ALQA 4IIXA 4RHCA 4UNQA 5JQGF 1A8IA 3RYCB 3VBEA 1DQNA 4G9EA 2O7RA 4GI2A 4AL4A 5FADA 1NRIA 3ESDA 4ZZIA 2Q6TA 2Y1WA 5JHHB 4M98A 3BWEA 1QQAA 3MT8A 1AO0A 4WT7A 2VHXA 2WKPA 3GP5A 1M9NA 1CR6A 1TMKA 4PZ9A 4RPCA 2FUKA 3TRFA 2W2PA 1Y0RA 4CRYB 2I2FA 3LFHA 2HJHA 4AJIA 1E20A 2CYAA 2R3SA 5D3KA 4CKCA 5FWAA 3NC0C 3SXJA 3AFGA 2P9ZA 2VDNB 2IYNA 3IIEA 3GRYA 1JEAA 2DHRA 1KH1A 2CV0A 1N5OX 4WBSA 3RGWS 3ST7A 3L2NA 4M9ZA 2DG2A 2QI9C 3LF2A 5J1SB 3GPCA 3HCRA 2I1QA 3NTRA 5F9MA 2WYOA 1X9GA 2F4NA 2OCIA 4CGNA 2FPIA 4F5ZA 1PWXA 2RAPA 3KV3O 1KJ9A 2QL5A 4YRQA 3LOQA 4ARAA 4K3VA 1NTOA 1O95A 1ZH6A 1T5SA 3KOWA 4P4UA 3ZNQA 2HMSA 2ODQA 2QM7A 4FMDF 1AQLA 4TWJA 3IFEA 1OBCA 4GM4A 3ZDZB 2BE9A 4EG5A 2LIPA 1JA9A 1ZD9A 4UM8B 2XYQA 4YHBA 5C35A 3BRSA 1PFUA 2FWRA 4MO2A 1TCCA 1KJQA 4M8LA 1K88A 4WLEA 5AJYA 3T1QA 5FUMA 2W0MA 2W6JA 3G49A 2WG1A 4GPBA 1VJDA 4BMDA 3OT5A 2HA5A 4YV2A 2I00A 4NGTA 5EKDA 3VHXB 3QE9Y 4BE4A 3G85A 4NY1A 5IKEA 2P6MA 1SOVA 2VYVD 1P2SA 2ZI6A 1B8PA 2G07A 4FFOA 1ZM4A 4PINA 5CB0A 1LFAA 5LSAA 3P52A 5F5XA 3I62A 4FHCA 1RJFA 2JA1A 3C3MA 4P7JA 3UHFA 5AKIA 1Q6ZA 3M6VA 3IAS1 3PNLA 1P75A 4A23A 4RLHA 3C1UA 3AUKA 4YEDA 2WYIA 2ZBDA 2HY7A 4ND1A 4LF8B 2CNNA 2CWWA 3ZQJA 3PSAA 1T4BA 2R1VA 2YXNA 3SHPA 4RM2A 4EI7A 2IXGA 3A6PC 1LLUA 1B42A 1UBUS 4MIOA 3KQUA 1Z73A 3FKSA 4UTVA 2B5GB 2XMBA 3VYWA 4L02A 2REEA 3FRJA 4MJXA 1TVCA 1JFFB 1Z5VA 1KRXA 4K28A 4Q3NA 1Q0UA 2I3ZA 1SPXA 1CP6A 4G26A 1MC5A 2I99A 3AU9A 4Q0MA 1AU9A 5HWSA 1PEYA 4YY3B 3OQOA 2VDRB 4ZCSA 3N8NA 5KOJB 1P7YA 3SYNA 1DT5A 2X86A 2ZU6A 4FKBA 4H6PA 1C8VB 2EDAA 4FMDB 4UC0A 2WOJA 3ZW7A 4O4LB 2AE6A 1N6HA 3JR7A 3PDIA 3K5PA 4XE5A 4EKEA 2C9OA 3SIWA 1EIZA 3D2LA 1DGQA 1Q7GA 3RC2A 3T9YA 2VQEB 3WNBA 2X23A 2ZRIA 3Q8WA 3T9DA 1B23P 3IE0A 1YW4A 4N7RA 5LYIA 2IZ6A 4LAFA 3V4SA 3DE2X 1A5SB 5A3QA 2PX6A 3EIFA 4HPXB 2MDTA 5C52B 2O7VA 2HJ9A 1TAGA 3JYHA 3IP3A 4K3UA 1UMBA 1ARLA 1HE4A 4KNWA 3C8MA 2WIFA 3A9TA 3PE6A 5EE1A 3U6BA 1PFGA 3OIUA 1P7WA 4YWHA 1L5GB 3I1FA 1RYBA 4YMLA 1WOMA 1DUIA 4UM9D 3QVJA 1NW7A 4LOJA 1UKVY 1ZLHA 1JXAA 1W4AA 3HU1A 4PAGA 2Z6UA 1L4LA 1QF9A 4TQUS 1JAIA 1V7ZA 5IJ0A 4MWEA 5IYZF 3H2HA 2JBJA 4FDTA 4BLOA 3JYLA 2C8KA 2ISCA 3WOHA 3AFNA 3B7WA 4KL8S 3A6DA 4KX3A 5J5VA 3GFVA 4OQZA 4U02A 4YJFA 3W8DA 4J1SA 3BWMA 5C80A 1RRCA 4R2JA 3SXUA 4LYDA 1V4NA 2EP8A 4E2WA 3E4DA 3G5TA 1HZZC 2NU6A 4U9ZA 1L2TA 5JMWA 2JBKA 3RI3A 3QA3E 4ZPXA 4MGKR 3M6AA 3VHLB 1GAJA 1NDQA 4U2KA 5FOSA 4QRIA 2J9FA 4XUEA 1IHPA 2OORC 5DNCA 4XDYA 2QZPA 1KEUA 1W8DA 2X0JA 1YUNA 5SY9A 2HMUA 3GJQA 4JBIA 3RS5A 4L5CA 3BF7A 2V7PA 4NCXA 5EFZA 4LDJA 2O8BB 2JASA 3PD1A 1RAGA 4FEGA 4UHHA 2QX7A 3T12A 3BS4A 1KS2A 1R00A 1EZZA 3CPAA 1B3BA 4Y2YA 5H59A 5KYKA 2EFCB 4IRXA 3L3BA 1FJHA 4X1YA 5CVVA 2XLCA 3ZJUA 5EJIA 2WM9B 3NEAA 4BBJA 5JMTA 4ZGYB 1NBWB 1A27A 3PNVA 2DULA 2H5LA 3FPBA 5GMOA 3KASA 3K2QA 3RBVA 2ANPA 4Q4AB 4DNQA 2XEJA 3SI1A 4KZTA 5C3MA 3CNHA 3G7SA 4ETWA 4JB3A 4ZKDA 5BV0A 3TOBA 1MC8A 2VRWA 2AOWA 1V3UA 2MOKA 3LA6A 4RW0A 1YS4A 4EW2A 4UDYX 3GMTA 1VL2A 4EM6A 3D2AA 1Q0QA 1HDQA 4I4TF 3GUVA 1FJGB 3DZBA 1AKVA 3CRMA 1MZVA 3FSRA 3C7AA 3MLEA 2AC2A 1OFUA 2F43B 4R1PA 4Q16A 1TKHA 2C7RA 3KLBA 4TRJA 3VNQA 2CJWB 3AHCA 1E94E 2NVUB 4ZAGA 3ICEA 5ISVA 1JRLA 3H97A 2DQSA 4BEVA 5CFMA 1L7DA 4UEZA 4GG1A 3RU7A 3U44B 1BQ4A 4ZT4A 5A9SA 2LDXA 1P1RA 2I2BA 4IDNA 4S24A 1AV7A 2XMGA 5L3RA 5TGZA 2IS6A 1JSLA 1AZLA 1G4UR 1R8XA 4PNZA 2C6GA 1CFZA 1A4IA 4UMEA 3PE3A 5KHLB 4P0TA 2VP2A 5PGMA 2A30A 4JCOA 2OB0A 4LYGA 1ULSA 1UP6A 2D62A 4BVAA 2BEKA 1OXKB 2PKXA 3QKUA 2R5NA 5TMBA 3SJZA 3ZDAA 4ZT5A 4X20A 4R0VA 4G1VA 3V2UA 4HO1X 3ZGVA 4I4NA 3TLYA 3N2LA 2HTFA 4FJ1A 3UAWA 3G6WA 2ZVDA 4RTRA 1XL1A 2HV9A 1NXWA 2J0EA 4KQCA 2ZI7A 1NUTA 4P8RA 3EZXA 5CVJA 2BFAA 4V3CA 4WY5A 2NSHA 5JS7A 2BHTA 5KDDA 4R3LA 2IUYA 3OMWA 3DFUA 1J8VA 1YTUA 4MRSA 5DBFA 4OL0A 4K6OA 1W5AA 2QSYA 1TUBB 3PQDA 2Q3MA 2ZB8A 4YBZA 1GRNA 3SSMA 5FTKA 5HTKA 3SJAA 2D6FA 3I05A 4K6HA 1V8DA 3AILA 1MAVA 5BQ5A 2IPNA 2Q4TA 4RPHA 3GLGE 5LFAA 3H8JA 3CPHA 4NDAA 4JGBA 2DR0A 1ODJA 2FUNB 2Z5LA 1LBQA 2G5TA 3ENQA 3LUDA 4Q1AA 4IJMA 3G2NA 3RANA 3TW8A 3WDMA 4G1PA 4DV7B 3HVJA 4KPYA 1YE8A 1W1UA 2YJGA 3FDZA 5EAIA 2B6HA 4MVJG 2VBQA 4GUAA 4YIKA 3DNMA 4JFRA 3VPGA 1F3LA 3LPNA 3ZWOA 4YPOA 2OZGA 5ALRA 3GZTB 4CEHB 1V8ZA 5AKXA 1TM3E 2YWGA 3L0DA 3VAYA 1SKAA 5F9FA 1H0KA 3G1TA 4BNZA 2R1IA 3ZTYA 5FRDA 4YCNA 2HO4A 3GD7A 3QNMA 1NNLA 1M4GA 3IAEA 2PZKA 3LGSA 3EEFA 3HLKA 3M1IA 3K0FB 3L8MA 3P2JA 1AQJA 1AQYA 1NW6A 2OGUA 2OFWA 1KDTA 1U65A 2AX4A 3CM0A 1YL7A 2QOEA 1C2YA 3B82A 4WX2B 1A97A 5LYJA 3ZE2B 1C7QA 4HD8A 2DPMA 2PIYA 4QRDA 5BQOA 3ZHSA 2IYWA 1CLEA 5EHQA 4OIWA 2GRJA 3RC3A 2CC2A 4CMEA 4ND6A 4PE5B 5T41A 3T9CA 2XQGA 4JLSA 3RFCA 5EHGA 3SHWA 2EFGA 5A5DA 1S1MA 1U1DA 3S6KA 3ABQB 1R0XA 3MD0A 5G21A 5KNBD 1Q83A 1NZFA 2J46A 3OBBA 4KGDA 4P3YA 4Q4HA 1ZC4A 2ZYAA 3AVVA 5CVCA 2G17A 4WXEA 2OHJA 2F3SA 3A25A 1RI3A 1CUIA 2G4VA 4OD0A 4NCJA 4NFLA 2B6NA 1X1CA 2HSGA 1CQJA 3W0LB 1CIPA 1LQ2A 4AWAA 5K1ZA 1EBUA 1N36B 1WV0A 4NCIA 2XCTB 3IAS6 3O90A 5G1NA 5JGFA 3ZXYA 5BSTA 4K30A 5JY6A 1DIAA 1XRQA 1W9HA 3TEFA 1N2CB 4NEXA 4JGIA 5B2FA 2OD2A 4N18A 4GR4A 1QUEA 1MABA 3L0SA 4MGHA 4ZFNA 1XV5A 4YK7A 4L07A 1EFRA 1FLDA 3CO5A 1MQ8B 2RJ3A 1ZA1A 3RBUA 1GP2A 2B2XA 4I66A 3HBFA 3AF5A 3U3ZA 2XXBA 1ODLA 5EE5B 3ZWNA 4CDNA 3VJKA 4CN8A 4DPKA 4JROA 3Q3HA 4AC9A 2HSJA 2B8WA 2RBEA 1Q1NA 2BEUA 4LQGA 3PYXA 1EDOA 1XQ6A 1N7HA 4AG5A 2PMEA 4PZEA 3SJEA 5AUPB 1OH5A 1CS0A 1G5TA 1XCGB 4AJOA 5LQJA 4KBYA 1P3JA 3CF4G 8ADHA 1AO3A 1GSOA 2I4NA 2CBZA 2CLKB 1T2VA 3AONB 4WEOA 4QASA 2DWQA 4BC1A 1R6UA 3CX3A 1YR0A 1F4LA 4PZLA 3CWQA 2AG5A 2ZP1A 3TFWA 4CM8B 4QULA 2ZVPX 1JG3A 1F2TA 2JFBA 1D6MA 4ODIA 3C8UA 1X8KA 2VAWA 4TV8A 1M6VB 5JZ9A 4HPWA 5E6SB 3FUCA 4W8GA 1KAMA 2FU5C 5K3FA 4D79A 1LPSA 3AESB 4UCMA 1CLUA 3VH3A 3AL0C 2ZATA 3FJ1A 2I79A 4HNSA 4HDAA 1YQDA 1YJ8A 4IXDA 2ZT6A 3WT4A 3OM0A 3WB1A 5LQNA 1HEYA 5MN4A 2GWHA 1TD1A 3O95A 1WU7A 3QBDA 2WZDA 4UVHA 2J6IA 1D0IA 4F86A 2J48A 4YV1A 1K8QA 2NO5A 5LBUA 5BW5A 3HA7A 4CMJA 2F7VA 5A4KA 1VL0A 2R65A 3KKOA 4ENWA 4DKXA 4W7IA 5ITZB 1DI0A 3TNDA 1W9MA 3GUCA 5AJUA 1TI7A 1V8PA 3DHYA 2P9CA 1CRPA 1Y6RA 1C8BA 5IC5A 2JVIA 4G4IA 1QHNA 3EQ2A 4HNRA 3RHFA 4AN4A 2OZHA 3GGGA 5AI5A 3SC2B 3R2JA 2WAOA 4RSRA 5CJ2A 3D54D 1TECE 3TQCA 4Q37A 4I5IA 1Q1AA 2UKDA 3BVPA 1I2AA 5LQRA 5B30A 1IWBB 3H2SA 4B09A 4CS0B 2CHQA 3CVOA 3NHFA 2XWBF 1N4AA 2HRCA 2UYCA 1YA4A 1SJ9A 3UNXA 3C7KA 2Y6VA 3G1WA 2Q3FA 3IVCA 1W75A 5K0CA 4IM7A 2WM3A 3WBBA 2XCIA 1EFDN 3IKVA 4G2NA 4Z0HO 4QBIA 1RPTA 2PJ9A 3VARA 3KSUA 4MS4A 4ZXPA 4BPRA 1H4SA 4U7WA 3DZHA 1MO5A 1XTJA 3ETEA 1WXIA 3GDGA 3Q5EA 3QQPA 5EE0A 2PVPA 1KP3A 1SVWA 4JR0A 3DE1X 4TZ0A 2IK8A 2ZEHA 4C0HA 2GZ3A 4GUDA 4H16A 1YREA 4PX9A 3MN1A 1EFPA 4YJGA 4MVJF 5IT5A 2R85A 3CNQS 4TTPA 3WLLA 1STOA 5JDCC 2Z2KA 4G67A 4WBXC 2B5VA 1E64A 3T7JA 3U3XA 4OXRA 2Q4VA 4BNGA 3H8FA 3QVUA 4KYUA 4BKRA 4EI9A 1EK1A 3UY5A 1KZYC 1M2EA 1QFYA 2VUSA 3FB1A 1G3MA 4FYXA 1VA5A 4AIIA 2EJCA 1NC3A 1YHYA 1FS6A 3MELA 2BEJA 1D04A 2H2WA 1NVDA 4OGWA 1PJSA 1WVGA 1PJ8A 4BLSA 2CMKA 1BTOA 4UUNA 3WQRA 3QLUC 1V39A 2H8KA 5IJ0B 4DLRA 1I8TA 2IYUA 2BM9A 3WWEA 1MLDA 1WXEA 4M1EA 5D2CA 4EMUA 1TQ4A 3R76A 2W93A 4M9RA 1JE1A 2FEMA 3ENZA 5HFNA 3VC3A 1BAVA 4I1SA 3M1LA 2FP3A 2WJWA 3ZI0A 5LMZA 1U2DC 1M1UA 3FMOB 4XYMA 4Z0PA 3V4OA 3TNFA 4CCYB 4LE0A 1U7ZA 2QIOA 4HTFA 3B1YA 5EPEA 3C41J 6PFKA 5M7EA 3KB1A 3QZUA 5E4JA 5JAPA 1E5LA 1ZDMA 1UJ6A 2PV7A 4UEWA 1T13A 3SM3A 1M1YE 3T7KA 1IEQA 3LQ4A 3BL8A 1LBEA 3RUDA 2AJLI 1OLOA 2XLBA 2DEAA 3DE5X 1TGYA 2D4AA 5SZHB 1N9GA 1RIIA 3ZEIA 2YYZA 4UIAA 2J30A 3FPCA 1E59A 4ZTZB 3ROMA 5THQA 3GEPA 3DOJA 3FOCA 2O2XA 2OZKA 2O1EA 2Q3EA 2WMDA 4IYRA 3OZDA 4P4SA 3VV3A 5H4GA 3CEMA 3UW1A 3CW2A 4GRDA 4QGFA 1HDOA 4FHDA 2ZS8A 3P71T 3RV4A 2FSHA 4RMJA 2V97A 3A6JA 1JYSA 1KIAA 2YINC 1NVBA 3BULA 3I9JA 3NHZA 1WPRA 3ZY4A 3VDXA 5A28A 3KQNA 1IDN1 2BZ1A 2SECE 3OCWA 2XWSA 3TQQA 4ENSA 1H94A 4YJ3A 4CIAA 2GF2A 3KAJA 3NU1A 4J16C 1XZFA 4NYJQ 1DU4A 3I9FA 1WB4A 3MMXA 1P2DA 4PHHA 4AJHA 1LBHA 2R8RA 2XXJA 4MS1B 5AG5A 2ID9A 2BEVA 3SC4A 2JAQA 4EUEA 3KQQA 3MGBA 6NULA 5E96A 1ADYA 4LRTB 3N86A 4CM4B 3VNUA 3IIJA 4I81A 3A05A 1OLUB 3DKRA 4RFSB 3MTDA 3OZIA 2V65A 4H1TA 4HNXB 1E2LA 3G0BA 4GP7A 4YDSA 3BLNA 2C59A 5DHPA 2ZUDA 3OETA 1VRCA 3AHDA 2OV6A 3PC3A 3KR1A 5JZBA 4ARIA 2R4QA 2WW8A 1SVOA 1BYIA 2O3UA 3C45A 1CQWA 1TT7A 4KSIA 2QZ9A 4M8IA 2OCBA 5JNUA 4LNAA 4EY5A 4E51A 4QAQA 3ZXIA 2H1FA 1OTYA 2PZJA 3QVLA 4EJ6A 4CKWA 3A6GA 3SMVA 1P0FA 4XQGA 2FUG1 3U37A 2HQRA 4MA0A 5K09A 1DHTA 721PA 2BKVA 2IUFA 4OV6B 3FMPB 5AOBA 5IEJA 1CIJA 3MTGA 3GJ8A 4FFVA 1Q7EA 3DAPA 4NBTA 5JD4A 3TX2A 4EB3A 1UADA 3HDTA 1IZ7A 2PK3A 4QBHA 4NNJA 4UD2A 2I7VA 4UE2A 2RI0A 1H8HA 2EIHA 1KHTA 4PFKA 4DJTA 1FLNA 2FW8A 1L5ZA 2CUZA 2ZZKA 3CRVA 5AKLA 5CFZA 1WP4A 2R5WA 1A5ZA 3HABA 4IZHA 3DHVA 3GO4A 2ORVA 2EWWA 4F1WA 1PVOA 4RZ2A 4CGOA 5KHAA 3T4PA 2D0DA 2AFOA 3D7RA 1O4WA 2BAGA 3D3JA 4LJ6A 4DRXA 3IQEA 3A70A 1MFZA 2BFEA 1RWNA 4MHSA 4XCQA 3A9RA 5CX1A 1QHIA 3ORSA 4AF7A 4NMMA 2GFIA 4EFNA 5DN6D 4NSQA 4BEBA 2GD0A 1P4HA 4OK3A 2HF8A 2JCXA 2XNKA 1XDUA 4ALIA 2PN1A 3Q5GA 1KZFA 2D0OB 5KI6A 4WADA 5LQSA 1QMPA 1CF9A 4JAVC 2VNSA 3PGLA 3Q85A 5DLQC 3WIDA 2HC9A 4OOFA 1YC5A 3RVRA 3AR7A 5KAPA 1W88A 4QECA 4NNPA 1ZMOA 2DUJA 3V7FA 2HCJB 2JLZA 1YF3A 1ULUA 2OCPA 2I3AA 4F06A 4CEIA 4QJBA 4EHBA 1AT1A 1R27A 4EB6B 1EAMA 3D3EA 4ZVSA 5IDXA 1Y7EA 1IXRC 1REQA 1MJ5A 3HH8A 2PJZA 1DP4A 3SFTA 1N3YA 1LVGA 3C3KA 1J5EB 1AKNA 2HPVA 3E15A 4CGLA 4D80A 2CJXA 3M9WA 1DC3A 4MDYA 1Y4SA 1ZK4A 1DXOA 3ID6C 3UBTA 4GEKA 2VP4A 1PNOA 1IJKA 5DX8A 1FP4B 3E35A 1KDYA 5KYWA 1Q7RA 1WX1A 1Z5NA 2JHAA 1P91A 1Q50A 3ELBA 1IICA 3K30A 1J8YF 2WC1A 4J1TA 4MVJH 2ONJA 2EJBA 1ZCZA 3KQPA 621PA 4LF9B 1Q2YA 3K1JA 2Z3VA 1A98A 2FPLA 1K3UB 4YFVA 2D7JA 2WHPB 1NV9A 1UQRA 2DT8A 7REQA 3IQHX 1JHYA 2NUTB 4UTRA 1H3EA 1XOVA 3SJBA 4H2KA 2H8GA 3EPPA 4E1AA 1O96A 1O94C 1Z6YA 4QPJC 3RASA 4H89A 3KVNA 3TBFA 3Q40A 3R20A 2C1ZA 1KK3A 1X7YA 3FLMA 4TXJA 4F92B 1J99A 2F1KA 3CF0A 1CEXA 2H1HA 1OLUA 2V8VA 4IKPA 1ZI6A 1JIKA 2P91A 4BP3A 1IB6A 2P4QA 4Y8VA 3VR5H 3BGSA 1Z7EA 1Z88A 1TJYA 2CY2A 4L5IA 1SA0A 3F2VA 1KQGA 4MS1A 3I92A 1Q0HA 1UBSB 2KBEA 4Q1DA 1XCPA 3VTKA 3FCYA 3H1FA 4OAPA 4AAYA 5ECYA 2VHQA 1J2YA 3H4IA 3NVDA 1QH0A 4GPIB 2UZ3A 1XTVA 2EDCA 4EKDA 1BDJA 3D4NA 2W58A 4BIIA 2P2GA 1X2EA 1L7MA 5ALZA 4CAVA 3VO9A 1N0UA 3L1JA 3QU4A 2XD4A 2YY5A 4LX0A 2P40A 4B9AA 1IZYA 4MYCA 4Z8YA 2Q2QA 4U7PB 4BNHA 3O75A 4N5NA 2A78A 4C0LA 1EM8B 4XD2A 3S0JA 4F5WA 3D4LA 1JAZA 4EA7A 5KTTA 4OAOA 4V24A 2RB5A 4KN6A 3SYKA 2G8LA 5A27A 3I1UA 3OECA 2I4TA 5ERGB 4EX7A 2HHCA 4RJJA 1SD1A 3RO7A 4PICA 1P77A 4IMJB 3ZE9A 3H8EA 2CSUA 4OSEA 3PHBE 3ZHBA 2DB3A 1QQ9A 3FBTA 2GK3A 3WYEA 4RK1A 1DO0A 2X40A 3OEWA 3LCVB 2KCWA 2I8CA 5AIAA 1XHEA 2MTBA 4ZXFA 1M2OA 3GFTA 4UAVA 1RAHA 3PR1A 5K0NA 3TLKA 3TM4A 3TJRA 4X1OA 1QP0A 1GTRA 2CLDX 3IUEA 4L8VA 4PHTA 5TARA 1V25A 1V5EA 2IYYA 1PCXA 2OFOA 2PR2A 3W3AD 5CPFA 1TTQB 4MUAA 2H3HA 3IVXA 4GVLA 3VGPA 5IZCA 3R5TA 3TW8B 2ZSFA 1PUAA 1VHTA 2HPHA 4P32A 1WKCA 2O0HA 4D4MA 1T15A 3IOMA 2VBGA 2L0XA 4KGZA 2FWNA 4MW7A 3GH3A 4NXMB 4UIBA 5CPAA 3R4VA 5KC9A 1RU3A 1JT2A 2OV4A 4KZKA 4WESB 2FXVA 4XEHA 5C82A 1OBOA 3HXTA 4LOHA 4PC2A 4R84A 4EPRA 5GJCA 4INAA 1ZOPA 4U6SA 3W2FA 4KOSA 2GPYA 3FNCA 4DXAA 1Q92A 3A3PA 3HBJA 1COZA 3O4JA 5E8RA 1KWMA 3TLXA 4M89A 2VHYA 4GWKA 1XCJA 3DNPA 2B9EA 3LDFA 2FKAA 1JAXA 4UCQA 3S6FA 3TE6A 4LN1A 1B16A 4KWHA 1QKKA 3GLIA 4FD5A 2XB6A 4TRRA 2AJ6A 3O82A 1UK6A 3JD1A 2B9VA 2F8MA 2R00A 1J2UA 4ZU1X 5FFMA 4HDKB 3WVNA 7ABPA 5A06A 1CZHA 2DETA 1XVUA 1DQZA 2P9JA 4XGQA 1EUDB 2BMVA 1KYYA 1UBHS 3DO6A 3OOJA 3SR4A 3A1NA 3KSZO 2A5DA 3RYIB 1NURA 5C9ZA 1H2ZA 2EYUA 4U2FA 2NUTA 3HFGA 5J2TB 4LFAB 2D1YA 4UQOA 3G5LA 1A5BB 1T0IA 2PQ2A 4Q1VA 4RQUA 4OQEA 1E1KA 5JWRA 1R1DA 2DPSA 2ONCA 2C2GA 2CSXA 3OOEA 4UNIA 4YJ2A 2QXUA 4B33A 1W8IA 2CTCA 4DZRA 4GX1A 1YOVB 2ZXVA 3FYHA 3MFQA 5AJHA 4U2DA 1A95A 4EZEA 4F9GA 1R0RE 3USES 3TIVA 3C3AA 2Q62A 3MGDA 3SMQA 1VIXA 1KYQA 2JLVA 2P0WA 1B00A 2HU2A 2JHCA 4XJSA 8MHTA 4M0MA 3IIKA 4EYGA 1AKTA 3TO7A 4M46A 2QMEA 1ISRA 1YQEA 1XNHA 3PEEA 1Q12A 4EB8A 4V2IA 5FBKA 3UK0A 4HDCA 2BV3A 3STUA 4QNRA 2QMLA 5JCOA 1CCWA 2WM2A 4C14A 5EVCA 4JP3A 3VTFA 3W3AA 3UZUA 1IOLA 5HUJA 4JLUA 3KWMA 3GJ7A 1G7TA 1DXYA 3LOPA 2OXTA 3OM1A 4WVLA 5K6AA 1GO2A 6LDHA 3WBKA 1Z62A 2QA5A 4V0OA 1SB8A 3P0IA 4P3PA 3ACCA 1JYFA 1L1FA 4MRMA 1ISJA 1HQCA 2ST1A 3QUCA 4MUNA 2ZWPA 1P1FA 5EIHA 2EATA 2NYRA 2IDJA 3DM5A 1E0JA 3OCUA 3QJGA 1ZN2A 5LP6B 4DA6A 4DANA 1BVYF 2AUNA 2NSJA 2ZRBA 4JBHA 3IT1A 4HS9A 3M4JA 4MVCA 4XD7A 1JLKA 3W78A 5JNLA 1DB3A 1TCBA 3TAXA 1E6LA 4CM8A 3MRSA 1S8AA 2BMFA 4UZSA 2JIQA 3HB4X 4K03A 4LA4A 3Q0TA 4M1SA 4QE3A 3RS4A 5A0TA 2OR4A 1W2HA 1ICIA 1N2HA 1HDZA 2P9QA 2QW0X 3BMQA 1L4GA 3PWZA 4L8FA 2YWFA 3JQRA 5ALIA 2A0XA 1KZ7B 2WVHA 3CT6A 5D7BA 4HNTA 3CFYA 4L15A 3DZ8A 4AG7A 4FOPA 3GF4A 1YDWA 2ZAMA 3CISA 5JC1A 2P3SA 2E4AA 2FJ0A 1W4BA 3BC1A 3KXDA 1E9EA 1OX6A 1ZI9A 3DEJA 3KOXA 4HVCA 2P6RA 3QY9A 3TT2A 1ODKA 4MVWA 3AUYA 2R68A 4D46A 3NH4A 1L7PA 2VUTA 3ASUA 3FJOA 2WZNA 4R2WA 3QVOA 5IC4A 4ENQA 3QY0A 4F60A 3NHMA 2W43A 3WGZA 3GBPA 3UH1A 4E5DA 4JK3A 1YS2X 4CR8A 5IXYA 4I3FA 5KX5F 4N5DA 1UC4B 3C3WA 4BGVA 2HCRA 3WNDA 4IIVA 2ZXUA 4CAWA 3WGVA 5TGTA 4QXRA 2JD2A 1WHSA 4FCTA 5JPDA 2XUQA 1TO6A 3S70A 3HCFA 4IWYA 4MXDA 2P9BA 4GHWA 4XX0B 1L4BA 5A2GA 5GJVC 2JDID 5JCPA 1EHYA 2F00A 1MD9A 4QUJA 4LDZA 1VSUA 3Q3IA 4DHEA 1JG1A 2YUTA 5DCWA 4B6PA 2JBWA 4E70A 4JBLA 3WZMA 1PAUA 2PS3A 3ZZTA 4PYNA 4BBHA 4M87A 1DDIA 1DUVG 3AMVA 4QL3A 1GRQA 2FOXA 2Y76A 3EA0A 1NNUA 1WXXA 2P35A 1DBIA 5HJ2A 2OUKA 3NTQA 1E2EA 3K2KA 1HKHA 4M1QA 1QGED 3V4FA 1L7EA 3O3OB 1O0CA 2WTXA 5G40A 1H05A 4L4ZA 4EW3A 1Y1RA 3T7RA 2PKYX 4HRXA 4NFHA 1ORHA 3NATA 3CZ5A 1JYEA 1DWPA 1NW5A 1BE1A 1JDBC 2AMFA 4M1MA 4GDMA 3IQZA 3TZHA 4FFNA 4EG7A 2C88A 1I5RA 1EK5A 1AD2A 2PXCA 4YREA 2XVYA 4H3HB 1JDUA 1C9NA 2GEBA 3UJCA 2CNLA 2OG1A 2NP7A 4KRYA 2OV1A 2R6HA 1RZRD 1OAOC 3PGJA 4WI1A 3WGTA 1TKRA 1ZCAA 3OT1A 2F9LA 3D8SA 2CLOB 1Y3IA 1V26A 2RHGB 3GL9A 5HPYB 1F12A 4J3FA 5H5JA 5EHNA 3PP8A 1XXHE 1Q22A 3BXHA 4LYFA 3TK1A 4B7CA