1YQHA

Structure of domain of unknown function duf77 from bacillus cereus
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
104
structure length
104
Chain Sequence
SNAMSQQVTMSFSVVPQAKTKDVYSVVDKAIEVVQQSGVRYEVGAMETTLEGELDVLLDVVKRAQQACVDAGAEEVITSIKIHYRPSTGVTIDEKVWKYRDEYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of domain of unknown function DUF77 from Bacillus cereus
rcsb
source organism Bacillus cereus atcc 14579
molecule tags Structural genomics, unknown function
molecule keywords IG hypothetical 16092
total genus 26
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01910 Thiamine_BP Thiamine-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.930 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1yqhA00
2EKYA 1YQHA 1S99A 2IBOA 1LXNA 1VK8A 2EPIA 1LXJA 1S7HA 1SBRA
chains in the Genus database with same CATH superfamily
3M8ZA 1GNKA 4AFFA 2YWFA 4JI7F 3DXSX 2VFRA 2GC8A 3MFHA 1K8AT 3QFHA 3UW1A 1BD6A 2XMAA 1R3NA 1XMBA 3CJKA 4FKYA 4G1QA 3BS9A 1HNZJ 2EK1A 2W2OP 3G6ES 2RD5C 4DPXA 3S8SA 1GTHA 2UV8A 4CQ1A 4ED1A 4JI8J 1REVA 4ZVEA 1EP4B 3HSZA 4LVNP 2I6WA 1PIEA 9ATCB 2DNPA 4C8ZA 1OY9A 2E1MC 4JI2F 1AA1B 2HNZA 1RHRB 2HNZB 1YJ9S 2X1GA 4ECXA 1X5TA 4F8RA 2VH7A 3UVJA 3N6NA 4LSLA 3Q8QB 5D6GA 1N34F 3O6QA 2G0IA 2XEXA 1IUJA 5EUHA 4QIVA 4NRTA 1RBAA 5KFTA 4Y2MA 2JZ5A 2ZVSA 1FF2A 5M2PA 2L41A 4I6YA 2VFUA 3OTBA 4M1KA 1XMOF 3RUBL 2G0JA 1UTAA 2CQCA 3DRPA 5HMYA 1TKTA 2IRYA 1M5OC 2BACA 2PD1A 4I4BA 1H38A 3TX8A 2RDIA 1VRTB 1X7VA 2MQOA 2VZ9A 4AUKA 2DITA 2DPJA 1KC8T 2UVWA 3MPUB 3OL8A 1K47A 2L9WA 4ZPVR 4HLBA 1XMQJ 4JI5F 1KOOA 4PUOB 2J0SD 4DF8A 3MF5A 4X4UA 3UCZP 4OLPA 2UVVA 1X4CA 1WD6A 3VCDA 4R0EA 5BR8J 4DR5J 4P7TA 4FBUA 1F60B 4UOHA 5J2PB 1N5YA 1UJ4A 2E9ZA 1DTTA 3DRRA 2LU2A 1K1QA 4LT6A 4NLPA 2EC2A 1E6VB 2YX1A 1NJYA 3TAQA 1AXQA 4JI2J 4GKJF 2Y1RI 2B9YA 1S72S 1TAUA 3UCGA 4CRJA 3F41A 3V6HA 1HBNA 2LMIA 3PKMA 1HBOB 4NMXA 1UVJA 2H1YA 2B3TB 2PEBA 3Q8UA 1RHMB 4LRFA 3OUYA 4CNYA 4KGZB 3TZXA 5DQHA 3ADAC 3QGGA 4RW8B 1DJ0A 2ASLA 3OFEA 5JVGQ 4O0NA 3MI7X 1U02A 2ALYB 2JL9A 2DRDA 3CIMA 3R5BA 3B4DA 1NO8A 4EYIB 1AW0A 4A4JA 1MMNA 2JNJA 5KFOA 3TARA 1EETA 1WG1A 5KFVA 1VCTA 3IWXA 5F8GA 3J81j 4OZNA 2VICA 1DURA 1F2HA 3L95X 3VGSA 3DOKB 3TUZC 4GVLA 4O4GA 1JK9B 2YVSA 1U2FA 4LQ3A 2QN6B 3IRXA 3LW5C 3QJPA 4ZVTB 3TNVA 2EK6A 3S1TA 3FC9A 1L3TA 1U8SA 3UN5A 4IO1A 4ZKAA 1CC8A 2HGLA 4M5GA 2BE2B 3WDOA 1H74A 2RKIB 1NJZA 2WBMA 1YRXA 4CCHA 3W62A 1DQ9A 3VAJA 2V50A 3MEDB 2X1FA 4AD6A 1J5EJ 4G1IA 3FZ2A 3D66A 1MROA 2HFZA 2LA4A 1NBEB 1T11A 2Z4PA 3ELHA 3IP0A 4ZP8A 4DCPB 1GK8A 5F8MA 2M8DB 1GAOA 2HQGA 2BJ3A 1XN9A 2DISA 2JHEA 5BYRA 4C8MA 3DDKA 4NLXA 3R7NB 1RZMA 3RBEA 3QSIA 2VA2A 3MEDA 3T1AA 3DU6A 1R43A 2AYMA 4ETZA 4K4YA 1XNRJ 3DRRB 4KTQA 1HBUB 3HHNB 2BVZA 3CJ4A 4ZJOA 1T05B 4Q0BA 5B09A 4X65J 1VBXA 3GLJA 1I94F 2BRLA 3B78A 1X4BA 3EE3A 1CC7A 1TTHB 3Q8YA 2SXLA 4UF4A 2O1PA 3GIJA 3TQ1A 1M1KT 4KHMA 1KFSA 2HHHF 1RYSA 1Q95G 1RB0A 2MKJA 4A48A 3JSMA 2W9CB 1WSRA 4WIIA 5EN1A 1J27A 4B3TJ 1XEZA 2XHWA 4IR9A 4YB7A 1KVJA 2YWEA 1LOUA 3T19A 1VISA 4H4MB 4QBUA 2VB6A 1SB6A 2CKWA 3G82A 1T9UA 4B9LA 5CYQA 3BV8A 3MMCA 3M8QA 4PXBA 2ZH7A 1XR5A 1RACB 3MEGB 4CWBA 3CO9A 1CJTB 2QG9B 5CQGA 1S1VA 3H2UB 3M05A 4ENOA 4HKQA 3KLHB 4PYDA 4TLQA 1YJVA 1XK8A 3DGVA 1BQMA 4NZ6A 3UN3A 3H4DA 3GIRA 2AU0A 1CEZA 2B5JA 3G82B 3I6PA 1Q7YT 3EGNA 2JDJA 4KHPF 4CLTA 4QIEA 3UDCA 2AF6A 1R27B 2MZSA 3QFWA 2MMYA 3HK2A 3BBFA 2DY9A 3JYTB 3T1HF 4PUOA 2R7VA 3R5GA 1V6HA 2MJUA 2BX6A 2M70A 2M7SA 2UV8G 3C3LA 2GGPB 5GADI 3VGVA 5K8PA 3KNGA 1U47A 1HR0F 1S79A 4ANDA 2JC1A 4B3SF 4DL0C 3FNNA 1CJKA 2QLXA 3FCHA 2Y3YA 1H0HB 3HI9A 4KV8A 3GPAA 1RTZA 2RHSB 3Q83A 4M5IA 1S48A 4DX8H 2CXEA 1HNWJ 2HYIB 3CMAS 3ZZRA 5C25B 2XSFA 3NAHA 4HT7A 3QT8A 2BQUA 3SCLE 5KG2A 4RO0A 4JI6J 4Y34A 2DNNA 1ZBTA 4FF4A 1JJ2R 3LTOA 5HMWA 3CCMS 4MFBA 2HK2A 5C24B 4J9LA 2QJ3A 1I3OB 4KR0B 4LMZA 4FYWB 2AJFE 4DDFA 1SL2A 2DXEA 2MKHA 3ZZZA 5B0CA 2UU9F 1S6QA 4I0WA 1CLFA 4NZ0A 1FKOB 3CD6S 4AXIA 4DR3F 2HNDB 2UVRA 3G87A 2ZH8A 1UW4A 4TY8A 4DL3A 1VBKA 3GCXP 1IBMJ 2B4OA 4NE9C 3QT5A 2AEFA 3M9NB 1O8BA 1FK9B 1ZA2B 3FCVA 3NLCA 4UZCA 2RF2A 5AXLA 3OLBA 2IY5B 4YOEA 3BREA 1S6PA 2P5VA 4FN5A 5ETVA 2GIQA 3FGVA 3HDSA 4Z7CA 1F6TA 3DLGB 1T03B 2HNDA 4ZIVA 2Y9HA 2KTQA 1HQEB 2LVWA 3ET6B 1J2VA 2QC3A 4ID8A 3PNIA 3FMBA 1L5UA 1IBKJ 3OVSA 4NMLA 3RR7A 4DSEA 3CF5Q 3ZO7A 2ZC4A 4U67Q 1PYSB 4G1QB 4EO6A 2IMOA 4LRCA 3HT3A 1FKPB 1S9FA 3CSKA 1C4CA 5KFQA 3J7YU 2OTJS 2HLUA 2MDAA 5CYMA 5L8RC 4ED2A 5L1JA 3RRGA 2FLNA 3TAMB 2W4DA 4X62F 1LWFA 2G1DA 1UZHA 1T0TV 2R4FA 2MKKA 3PTWA 1QSSA 5J1EB 1LFPA 3G86A 4I6AA 5T7LB 4TXSA 2LFVA 3MEKA 5A6PA 1N48A 1CJVB 1MW7A 2UU9J 5CCMA 4EEYA 4WCEQ 2J7UA 1NUEA 2D69A 2X1BA 3DM2A 5A0YA 2AKWB 4QW9A 5E0OA 1OY8A 1R0AB 4E8UA 2HHVA 2HNYB 3JSBA 2QLBB 4MTPA 1FE4A 3DI6A 5EWFA 4D3HA 2R2SA 4FBTA 2CZ4A 1IM4A 5ADZA 3FEYB 1WF2A 1IR0A 1U49A 3HO1A 4CZCA 3R8YA 2MGZA 1NB7A 4UQGA 1YDLA 1NH8A 4DQSA 5F3TA 3K5LA 3ISNC 4GO7X 4KY3A 2WVBA 2F8MA 4HYKA 4GC6A 3K0JA 1UCNA 4DFMA 4ZVPB 2RIJA 1C1BA 1ZTTA 4UTGA 1JLCB 4HH0A 2H3EB 2E5LJ 4LJMA 1N0VC 4C98A 4KGXB 2CJAA 1HMVB 2HAIA 2IAJB 4EU0A 5B0BA 1D9AA 1YG0A 2X3GA 4RBUA 4ZPCA 2JX2A 3IGNA 4MMOA 2BRKA 3HSJA 1HNIA 4YHHJ 3BO2A 1U0HB 3MOJB 2HZCA 2K1RB 2H5EA 2J9CA 2RNEA 2C3PA 4RUBA 3MAHA 3C46A 4NXMF 1VK8A 2XLKA 1CULA 2DCLA 1QVGR 1Y3JA 3KWMA 4ZPDA 3R97A 1FKOA 4URSA 2FHMA 5KFGA 4UOGA 1AROP 2G13A 3MM8B 1FEEA 3Q8PB 2BM1A 5KG3A 1YRUA 2R7OA 3B4MA 3MPWA 1LKZA 3MUVP 2JOQA 2R7WA 4V1Ak 1F9FA 2FC8A 4HVZA 3HMJG 4DUZF 2NR0A 2PO4A 2NQPA 4ZLLA 2QSWA 3AOBA 5CD4H 2C28A 1TV6A 3FRZA 4RWWA 1EIYB 4B9TA 3IWNC 1JXLA 3MFIA 1REVB 2YX7A 2VG5B 4HL9A 3ET6A 3N9UC 1VBZA 4JYAJ 1UKUA 3PRBA 1CVJA 1C4AA 4RW4A 5H9FJ 1N32F 4DSLA 5I3PA 1Q79A 1P27B 3AOCA 4P6QA 3SFGA 2A6OA 1RT4B 4DU7A 2RH3A 2IC3A 2YWWA 4X4QA 1FA0A 3JTPA 4NA1A 4USUA 2R7UA 4HR2A 2V2ZA 5A8RA 2IDEA 4TU7A 5C42A 2H5IB 1S1TA 5IQQA 1LXNA 1YI2S 1WC6A 1JLAB 1OMSA 3M7VA 4DPYA 3A12A 2G2OA 2J8SA 3NWRA 4LSLB 2WW8A 3UVJB 1X9MA 2XZDB 4A47A 2J6UA 5HATA 4J5OA 3AA9A 3CCUS 2EG2A 2VDHA 2R7QA 3TP2A 4DLGA 2M0GB 3UDEA 3MAAB 4DXLA 2FJBB 5D4LA 5LSLA 1S5ZA 4Q2MA 4NEYA 2R42A 2AYEA 3OTDA 2Z2ZA 3TUJC 3L09A 4CM2A 1TKXA 3T1YJ 1M0SA 3D28A 2YH0A 2H9ZA 3OXGA 2IPOB 4OHZA 2LXIA 1WJ9A 3FUYA 3HHLC 5K14A 2DD8S 7FD1A 1YHQS 4MKYA 3ILLA 1B0VA 1CJUA 1E6YA 3UN2A 4DZDA 5J2MB 1VQ7S 2ZBPA 1WHWA 2OEMA 1U0HA 4YMEA 5DQGA 3MURP 1H7WA 2ILZA 1TAQA 2OSRA 3H5UA 3GYXB 4RLEA 3SQOP 3VVUA 1N32J 3MGJA 3JTNA 3HKWA 4ZCKA 1YK9A 2DR8A 2LYVA 2A10A 2L3MA 4FDFA 5IS2A 5KFKA 4DL6A 4DR6F 1N34J 4NASA 4QYRA 2CIMA 4C8KA 2O5DA 4W90B 2HURA 1B7YB 3QT7A 4E2FB 2FVPA 1R31A 3AOAA 3PFEA 1ZPVA 2HFSA 3BR9A 4O0IA 3OXFA 3SSQA 3OW2R 4ZP9A 3VAKA 2XMWA 2VOPA 3HP6A 5GAEI 3M32B 4ZJLA 4JI0F 3KK2A 4FKXA 1VHFA 4B3SJ 1CPZA 3L7PA 3OUYB 1IWGA 1ZETA 3G2XA 5KFPA 2JEGA 4CI0B 4OMFG 4LSZB 4IH6A 4MKVA 5SUHA 4NOHA 2ABYA 2DHXA 2GVDA 2C42A 3D3CJ 3F56A 4QPTA 3DFEA 2BZ2A 4F0HA 2KFNA 4WP3A 4ZPWR 2HQDA 3M32A 1YJTA 4JP8A 2KKHA 3MR3A 3I5CA 3N28A 3KK2B 1XR6A 5KFMA 3OVBA 5A8WB 2CNNB 2QSFA 2K8GA 4NLWA 2L48A 2FVRA 4LF6F 5EWEA 5D77A 5DDPC 3X3UA 2VFTA 3SSRA 2V68A 1PC5A 5KAKA 1HWJA 2RHQB 2RU9A 1FNMA 2NREA 2ZKTA 2VFVA 3E2EA 4LF7F 2HSEB 2XCPA 2IM3A 1ZYQA 2Q66A 5D8HB 5D0GA 3WC0A 1C0TB 4DG1B 2FHOB 2IBOA 3NBPA 3GP9A 3S6EA 3SCJE 5DG8A 2XYPB 2AGOA 1RYRA 1U6BA 3MCSA 1OSCA 4G65A 4P52A 4WYWA 3PW7A 3DRPB 5F41A 1L3UA 2XI3A 4TN2A 4W92B 2IDLA 1CSJA 4YFUA 4O3PA 2C2RA 5K14B 4Y6IA 4YEAA 1UEVA 1UETA 4L6V3 2KVIA 3FBBA 1PJ6A 2CPXA 2XO7A 3OFHA 1F2GA 2HHXA 3KUEA 1S12A 1QSYA 2BJDA 4WK1A 2VPZB 3NG8A 1N0UA 3W2VB 2FJDB 3FBEA 4K5SA 4O4RA 4AL5A 5DDRC 1HNZF 4DR2J 1XBWA 4MK8A 5A2QU 5IQ6A 2KJWA 4ECTA 1UFLA 2ACYA 4Y2KA 2V8VA 3HSGA 4JI8F 1JKHA 3DDNA 4WKRA 3IM8A 2QMWA 4LF6J 3KXDA 3DHWC 3N01A 3GU0A 2R3VA 2EWHA 4IG3A 4I69A 4ICLB 4ZVHA 3BQ0A 2UUAJ 2HGMA 4JI1F 3BR8A 4OJ3A 1S9GA 2BKOA 2EFQA 2R8KA 4B3OB 3BBBA 1I51B 4QJVA 2COLA 3UD5A 2XULA 2R2TA 2DGVA 1LK5A 4X4PA 1TUGB 1FNXH 1KVIA 4IG3B 5J2QA 5DDQC 2BABA 3GFHA 2VPYB 3LP1A 3MDFA 2JFDA 1Y0HA 3Q8RB 1CS4B 1GXUA 1BQXA 4NI2B 3HXMA 3C16A 3QQCD 2B4UA 4CTAB 3KJFB 4EBEA 1WOSA 2BE7D 2HWHA 1T9YA 2H65B 5LJ3Y 4IOCQ 2V67A 3D2WA 2EFOA 1IQTA 2YWHA 3KK3B 4NX9A 1FJGF 1X4DA 4YS2A 4QWCA 1OWXA 1WEYA 2J9DA 4LF1A 2UUCJ 3DM2B 2DR5A 3MMCB 1KD1T 2HIYA 3RAQA 2B9EA 3M6XA 2OH2A 1N33J 4OYAA 4Z37A 2BE9B 4RUCA 4A8SA 2E29A 1D9DA 1U48A 4HI1A 3UR3C 3V6DB 2YKMA 3VAGA 2AJQA 2W24A 1S59A 5GMEA 3RGIA 3UWTA 2KHCA 4ZVRB 3ZZOA 4Q44A 4J9OA 4UOCA 4GC7A 4TLRA 4WZQA 3QYYA 4OI3A 2GVZA 2GA7A 3CCJS 5HANA 4DV2J 5J2NA 5HO4A 3GYGA 3NS7B 5DDOC 2V8DA 3SQGA 2AD9A 2XI2A 2W7OA 1RT1A 4OZ2A 2KT2A 2AW0A 4PG5A 1N5TA 1M5HA 1C0TA 1B4SA 1H72C 2MSTA 5AJ3F 1Y9OA 1DFDA 4USKA 3KFWX 2H4YB 5F9LA 4EYHB 1QUVA 3TQEA 1RTHB 1FVQA 4WYLA 2MXYA 4PQUB 1FXDA 2M88A 2C3OA 1H3DA 2FY8A 2HFVA 1U25A 2NXUA 4H54A 4ANEA 2RF2B 3OD2A 3MMAA 1UWAA 2CRLA 2G1HA 2W8LA 1FJGJ 2QMXA 1MN7A 2QFIA 1PAUB 3GJSB 1JXEA 4FXVA 4IH5A 2UUCF 3P49B 4ZN3A 2KHDA 4K4VA 2VOOA 3DOMB 4X4NA 4OV6A 3VWSA 3GV5B 1UEUA 4MYUA 5CA5A 2W7AA 4UUXA 1FHTA 2F63A 1M5PC 2WB4A 4MIBA 1ZZFA 1MU2A 3A3OB 3NKYA 3GR0A 3NP5A 4K2XA 4CLFA 4PABA 3CCVS 2MQMA 1TMMA 4NA2A 1D8YA 3OJUA 3I4HX 4CYUA 4K0KF 2DHSA 5LOQA 1QTNB 2LXUA 3DRSA 3EVWA 4TU9A 3UPFA 3A8IA 2IRXA 4C8NA 2ZH4A 2VG7B 2CJXB 4ZPAA 3PV8A 4BWJA 1KTVA 1SVDA 4Y2AA 1X9WA 2KFZA 4OLOA 3B82A 1HHQA 2OD6A 4CNZA 1D09B 4CLYA 1IBMF 3TA2A 2W2QP 3OFGA 4L76A 3IN5A 1HFEL 5HL7Q 2XB2D 5CZVA 3D54A 2Y1JA 2VUGA 4OHWA 3QGPA 2Q43A 2V34A 3CJ3A 4XO0A 3HHLB 3C16B 1MWZA 3KDOA 3QRRA 2QA2A 2BEFA 1RTJB 4DCOB 3EX7B 3KHGA 4KKOB 2UVUA 4J9UE 3FJ2A 4LF5F 3LH2S 3GSDA 2DTJA 2VBYA 3NNHA 3W7BA 3GIIA 5KFNA 3NMRA 2O67A 3TR5A 1R0AA 1TP7A 3V2UC 5A8KB 1P9QC 4MFBB 3BGOP 4NLVA 5K8OA 2W7PA 2Q79A 3NMAA 2YQ1A 3VVTA 3TJ9A 1Q53A 3DI6B 5L1KA 3WHIA 5C25A 4IRDA 2B7BB 1NPPA 3OV7A 2W9BA 2NUHA 2QLJB 2K2PA 1FVSA 1G4CA 1S57A 4C6AA 4M5KA 3UNGC 4DL2A 1CJKB 3T9NA 2UP1A 1G1XA 4CH7A 1Q82T 5J2NB 2PFFB 4KB7A 1Y5LB 3CCES 1VRUB 3CJTA 1LK7A 3TVKA 4NLUA 3DOLA 4PXCA 1GFWB 1SXLA 2OMLA 4YQWA 4DN0A 3N5BA 1UFKA 4IDKA 1XR7A 2X3DA 3I0RB 4OL8A 1S7IA 3GFYA 2MEWA 2HIQA 1RISA 3BBCA 3BZQA 3H90A 2H48B 4ZCLA 8RUCA 4DFJA 4ED6A 2UXDF 2HQIA 4QIFA 2CPDA 3CDWA 3HT0A 1NCLA 2HRYA 5D3GB 1FDNA 3V4IA 5F8JA 3MM8A 1FTCA 3M2VB 1AYEA 3DOMA 3M2VA 5KG5A 1SH0A 3E3XA 5DETA 3Q8VA 2XWYA 1FRIA 2QMUB 2CFXA 2ZC3A 3THTA 4N76A 2DIVA 4J90A 4DCJB 2DGWA 2IC3B 2OPRB 1NSPA 3QT6A 2NZ4A 1BMQB 4NYZA 3D67A 3DGPA 2MB0B 1BWVA 4FYXB 1B3TA 3I32A 2WCXA 5BYSA 2WTFA 1SC1B 1U24A 1NDPA 2BA9A 2CA9A 2YNFA 2ZOMA 4MYTA 1NAQA 4ZP6A 2MSSA 3R5CA 3CDEA 4IRKA 4DOZA 4NXNJ 2E9RX 3NNCA 2KH9A 3VAIA 1WC3A 4RW6A 1DAXA 1DQAA 1RAOA 3CD7A 1FDAA 1QY7A 1RAEB 1TL1A 3EYZA 4OX7A 4QU6A 3QLHB 1IXKA 2Z2MA 3MECB 3E8OA 4OYPA 5H9EK 1BUXA 2DB1A 2IIHA 4ZITA 3I56S 3BGUA 2HHSA 3TZYA 5F8NA 3G6XA 2XMUA 3WX4A 2KG1A 2MPUA 1HHSA 1JLFB 3CTRA 4P10A 4Q2LA 4BBYA 2PDAA 3AB2B 3NGRA 2MGZB 5HP1B 1M90T 2XGQA 1TL1B 5A8KA 2BJEA 2EXUA 3E51A 1S0MA 2D3ZA 2CADA 1SC3B 4M5NA 3PHEA 4ETXA 3OL7A 2QE5A 2GQQA 3MPVA 2FVSA 4AT1B 2JEJA 4CLKA 4B9NA 1LW2A 2V4JA 2YY3A 4ES1A 4PWWA 5E5NA 3POTB 1K73T 1JX4A 1IVZA 5J2PA 1N5YB 4JI3F 5KTQA 4LVOP 4ZVSB 1HMVA 2KT3A 1FJ7A 4HT5A 1FWPA 2HZAA 3AJ2A 2E5IA 2RRBA 3CIZA 3M30B 2ZJPQ 1SJ3P 1C1BB 3OHBA 4IFVA 1FD2A 2VU5A 1ZTWA 2V9WA 1B7FA 2QTWA 1FXLA 1CQMA 2GIFA 1RT3B 2HVIA 1C1CA 4ZVGA 1UW9A 3SMZA 5F0WA 5HVGA 4OYZA 4R8UB 1UA0A 2MZTA 2HWIA 1S0OA 3IO1A 2RILA 1REGX 3H40A 1YJ7A 2OPRA 4UY85 4F2RA 3ILOA 8ATCB 1HI8A 4W98A 1KTQA 3ZZ0A 1OY6A 1JQGA 4RBVA 1KKHA 1Z4UA 2CG4A 1FEHA 2LDIA 4S0MA 3J81U 4ELVA 3V6DA 4ZJQA 1Q8LA 4DR6J 2CNLB 4RR5A 1NK6A 1EP4A 1NZ8A 4RKUC 5KT3A 4JI3J 4V19J 2ZOGA 2V69A 2H4WB 4USTA 4U96A 5ETNA 3TAMA 2H5JB 2ASYA 1T9XA 2GNKA 4TQRA 3CNQP 3BQ2A 3HKZD 4U8VA 1FRLA 4H4KA 3W60A 3K5OA 2CUYA 2HS0A 2J9EA 2ZOFA 1CJVA 2R8IA 4JI0J 2K3IA 2KDOA 2ZJRQ 1X5SA 4LSNA 4HACB 4R5PB 1UWBA 1IJEB 4KSEB 2ADBA 4UT4A 2W8KA 1SUQB 3GG0A 1IWAA 1JLQA 2GMJA 4FVCA 4WZMA 4B3TF 1LWCA 4C11B 1WELA 4DX6A 2PI4A 1FESA 1GX5A 2WONA 3DLEA 2EVZA 5AXKA 5EDWA 3U7JA 1X5OA 2WBRA 1TZ0A 1S1XA 2QL5B 2DIUA 2IRUA 2YQ3A 2CDRB 2NPIA 4CH1A 2IHR1 1MMDA 4OZ5A 3J80Y 4ZVQB 3SBMA 4CM0A 5L1IA 3R1LA 2ZE2B 2EG1A 3GONA 4ATNA 4WXWA 3QJJA 4MKBA 4P71A 1N4LA 2E7WA 3TEGA 2XY6A 3OTOF 2I5JA 2XM3A 4FS1A 1X4AA 4KHPJ 2V9KA 1NPRA 2V4RA 5H1SV 2AGPA 4F25A 3BYPA 1HWIA 4USMA 4BC9A 2DNQA 2ACMA 3DLKA 3O3LA 2RS8A 4DS4A 2BYCA 2HQ3A 2YKQA 3EGVA 5DLFA 1N52B 2DGSA 2RS2A 4CO1A 3Q8SB 3KG0A 3L7OA 3NAIA 4HDHA 1DTTB 2YNHA 4CTAA 1KRPA 3X1LB 2HW3A 2LQ5A 2Y8WA 1GX6A 3AQPA 2E7XA 3C6UA 3IAM9 3VZIA 4EBCA 1V3ZA 2YQ0A 3TW0A 3R7BB 4F2SA 4PG6A 1HD1A 1RU1A 4C3KA 4BS2A 1SQEA 3P96A 3QO9A 1RJJA 5ETOA 3R9LA 4B9MA 2OLWA 5GMKa 3O5TB 1APSA 3TYTA 1YJWS 2ZH2A 3N6MA 3QRQA 2R7TA 4CP5A 3FDSA 2A1BA 4ED8A 3DLJA 4JI1J 4YDXA 2J8AA 3J7Z5 2ZH1A 2B5JB 2WW4A 2AHOB 1N36F 3R2DJ 3OTOJ 5KFSA 3KHRA 4A8YA 5KFLA 4JV5J 4P75A 2B9XA 3BKTA 3FQKA 2N7CA 4Q7AA 2ZDOA 2RJZA 1T3NA 1G6BA 4M5HA 1RHUB 5GMDA 2ZFHA 1I1GA 3ZTSA 4OHYA 1G2EA 5JMNA 3SQGB 2ZM6F 1BXNA 1XTZA 3BPSP 4NCGB 2HBQB 4TKTA 4A8KA 2E66A 1S76D 5IV3A 1KLMB 3OHAA 4J91A 2PT0A 1WC4A 3NBPB 2IVYA 4GRSA 2DHHA 2ZJQQ 5C42B 1QD1A 1RADB 3HZEA 2UXDJ 4X4SA 3ILIA 5DJBA 4M8LA 2HHWA 3D0IE 5IT9U 5KFXA 1RT1B 2HQCA 2AIRB 3HHEA 3JSRA 2IJFA 1A6LA 3NCRA 4P72A 1KVKA 2EFVA 4OI1A 3N5FA 2DH8A 4ZHRB 4LFCF 4WXOA 1HBUA 4IDKB 1MN9A 1FE0A 3HHKA 5T14A 2OKQA 1YJRA 3R5JB 2HFOA 1WHVA 2MQQA 5CH7B 3N6LA 4DX7A 1N36J 2CPFA 4N5SA 3AD7C 2H51B 4RW9A 1IKXA 5KFYA 1X0PA 1KQGB 2IVFB 1S49A 3NGKA 3W65A 5B0AA 2PMWA 3QJLA 2YNHB 4LIRA 1NDLA 3K17A 3I55S 2LU1A 4KE5A 1J5EF 1T9VA 4DUYF 5HLFB 4DPOA 2QA1A 5L9NA 4OI2A 2WVDA 1RAHB 4WTOB 5HJYA 2UUBF 2LKZA 1ITPA 1VOMA 3LP1B 2RT3A 4ZDNA 3KK1A 1NDCA 1TKZB 1RWWB 3B54A 3LP0B 3E01B 2P6TA 4KAIA 3DMJA 4LRBA 3Q0AA 3GFXA 3V81B 5G0RB 3RG6A 3M8QB 4JV0A 3HVTA 3K8VA 3O44A 3VQSA 2Y1IA 2DGUA 4O3OA 1VIXA 3R3TA 1XIQA 4DPWA 1V3SA 4Y2CA 2KXNB 2JH3A 4RNFA 4ALZA 2W4PA 4DR7F 3IC1A 2WVFA 3BYRA 4X65F 4DV3J 4Z2XA 1T02A 3CT9A 3D1QA 4OV1A 3UFCX 3QO9B 2PEHA 4TVAB 2A2CA 2E1PA 1RTJA 2B8QA 3G8QA 1YBUA 1WKJA 1TQLA 2FJEB 3D6MB 3HD1A 1WI8A 2HFUA 1BQMB 4DPTA 4ZP7A 4J9KA 4ECQA 1M5SA 2OPQB 3A8KA 3MPYA 3KNAA 2LP4A 2J7KA 4NA3A 2GGPA 3KG1A 2FZGB 2XMMA 3LA0A 2Z2YB 1ZAWA 3PDNA 4YHHF 2E7VA 4CIOA 3MEGA 2VA3A 1JMTA 1KLMA 2GS8A 3LO3A 1JLGA 3MAQA 1HNWF 1CBKA 4RWXA 4RW7B 2JJ4D 5LM7E 1VJQA 2OHDA 1CQNA 2WVEA 3LF0A 2QA4S 2I2YA 1TFYA 4USJC 4B9UA 2WB1D 2PSZA 2FLLA 2HVHA 1YBAA 3IR7B 5LT5A 1GTEA 4EFAC 5CXTA 1AFIA 2KZMA 4K4SA 2YNIB 2V8HA 1JJHA 3N0VA 3L3CA 2W25A 5CZXA 1IBLF 3QSYB 4ANCA 4QOTA 4PXDA 5M2UA 1U1RA 1F3VA 4QWAA 4ER8A 4CH0S 2CG8A 4NCGA 1VQPS 4DR1F 2AYBA 1BWEA 3VAHA 4PG7A 3P6YC 1YLXA 4LF9J 2ZZMA 3G4SS 2OJ3A 1EZZB 2XZWA 4R25A 3I0RA 4DSJA 4J9VA 2DEIA 3BN7A 3MMJA 1WORA 5HJXA 1XJWB 2BE2A 2R7SA 1WDTA 4IFVB 1XC9A 1WG5A 2CZ9A 1HA1A 3DOLB 3JS9A 4EWTA 3PO4A 3QIDA 4RPFA 2CYYA 1AUDA 1SV5A 2ZBRA 3HZGA 4OI6A 3RAXA 5LMUF 4FNHA 3MWBA 3D1HA 5U47A 3SCIE 3FQLA 4CO0A 3SZ2A 2GQ2A 2Z2LA 5LSOA 2FYXA 5IT0A 4QYZK 1X0FA 1CULB 1R0CB 1O0PA 2VD3A 3QZ8A 1RK8A 3DRXA 1T03A 5GADU 4DL7A 5D3GA 3M9OB 3T6BA 2LLZA 3EZUA 3T5KA 1RI7A 4F50A 3W1YC 2XBPA 3W5XA 4F3QA 5A76A 3RYLA 1DQ8A 3KLIB 2QYCA 4WFAQ 5DZ6A 1QJHA 3MM6A 4JI4F 3CD0A 2C2ZB 1BC6A 1LNQA 3FEZA 1WC1A 1ZAXA 2APOA 2ZH9A 2B56A 4P9SA 3BF4A 4DV0J 2Q1LA 4PXEA 3D1OA 1U09A 2OELA 5KFUA 3QWUA 4M5LA 1QAIA 3M8YA 4YR2A 1EJ7L 2IVMA 2E1CA 1RWNB 1ZA1B 3QGIA 2RB7A 2ZHAA 5FJ4A 2GMHA 2POKA 4B08A 4A46A 2VG7A 3UCUP 5HK4A 3IRXB 3FBFA 4PKDB 3SDEB 9RUBA 3ENAA 2XCAA 3D0HE 4IFYA 4ECSA 4YB1P 2HS3A 1KBRA 2WSFC 3M8PB 2OMOA 4F3MA 4Q45A 5DZ7A 1FT8A 1PILA 3ITHA 1WNEA 1IBCB 2LCWA 2IM2A 3D6HB 3MCNA 1WF0A 3PW0A 1J5OB 3MR2A 1WC0A 3ZFVA 2XQCA 2IMWP 2NXEA 1S1XB 2XTJP 3BH6B 2QYGA 2DR9A 2N4DA 2OTLS 1U1LA 4F26A 1N54B 1S1TB 1NK9A 1RU2A 2IYGA 2BQRA 1NXIA 2IBKA 4LF2A 2CJYB 2Q6CA 5D0RA 1LWXA 1FWLA 3AJDA 4RJVA 3UE2A 4OX9J 2OUGA 1WEXA 1GT8A 2VPXB 4MJKA 1L3SA 2B51A 2DPIA 3QMQA 4N77A 2PE8A 4C0BA 1YVFA 2NCKL 3PR5B 1ZH5A 4FZVA 3BSNA 2V6AA 3G96A 3NXZA 4Y28C 4DV1F 1ZZNA 3DCAA 1YJNS 4C3LA 1WF1A 2HG4A 1IKVB 1ZM4A 2FUG9 1ULRA 4ED7A 2GZOA 4QR0A 3SIPB 2CQGA 4A8XA 2XLIA 4DV7F 1DARA 3SI8A 1LV5A 5A6WA 3AB4B 2XSJB 4CO4A 5IV4A 3EVOA 1EKRA 2F9DA 1C1CB 2V8PA 3KG4A 3SCKE 1QLNA 2W9CA 5KT2A 1UL3A 2J0XA 2Q3PA 3GR1A 5KT4A 3BGRA 4RNOA 3OPKA 2DR7A 3HLUA 4AQYJ 4KGMA 4KO0A 2DRAA 1PBAA 1FFGB 1SJQA 5JUMA 1DHMA 1WWHA 5D4NA 2VC1A 3PYGA 2JLGA 1RE1B 5D0EA 4I6WA 4WIQA 4TY8B 3VALA 4DSFA 2UXBF 2K1RA 2CQ3A 3EUNA 4JI5J 1HNVA 3MHYA 4B9SA 2I1RA 2W2PP 2XMKA 2XGPA 3KK3A 3G6VA 1KONA 3BSOA 1KQKA 4OZLA 1R7IA 3QIPB 2R7RA 1SC6A 4QU7A 2QV6A 5EGYA 3GV8B 2DO4A 2HFNA 3CB4A 3CW2C 3SFUA 5DLGA 5E3RA 4DV1J 1U1OA 4WWSA 3ZC4A 2AT1B 1LW0B 1M1GA 2DO0A 4RNHA 4ZVUB 2C2EA 1H7XA 5E3PA 3DU5A 3MM7A 1UZDA 2DYAA 1R8PA 2YKPA 2WOMB 4IOBA 5KFRA 3MCMA 2B6AA 3GJRB 2AP6A 3MPDA 3TJAA 1D0EA 3G8SA 1SUQA 1WSVA 2C2NA 3W9JA 5K8MA 3T1YF 4OJ1A 1M1HA 1PBUA 4PCQA 4MK9A 2FJVA 2QRRA 3NGTA 2FHJD 3S7RA 3IRWP 5E2QA 2ZH6A 1Y7PA 3L9ZA 3SDEA 4U7CA 1MNEA 2Z57B 3VF0B 3KJVB 1EB0A 3BB5A 1JKHB 3GWCA 1P1LA 5GAGU 3GZ7A 4TYBA 1JLQB 4I68A 4F36A 3Q24A 3K57A 1ICEB 2VDIA 3TEHB 1TKTB 1S1WB 1VHIA 1IQZA 3GJQB 1WHXA 2CPJA 3AAWB 4F3OA 1U1PA 1VI7A 2DXFA 3B6BA 4RW9B 3I9V9 4B3OA 1TKZA 5ETMA 2MKIA 1N33F 1NRKA 2FHJA 2GJ2A 2WHOA 5IT4A 3AD9C 1MWYA 1FJCA 5THWA 1KFDA 3CULA 1DY3A 1R89A 2U2FA 4LRAA 3SYZA 1U1QA 5KFEA 1KOHA 3CJRA 4NYPA 2MZRA 3W2WA 1AT1B 5IM0B 4JV2A 1T9WA 3ENQA 3CCRS 1UVKA 3I9ZA 5DG7A 1VBYA 3A3NB 3BGRB 1HNVB 4PQAA 3OTEA 5CCLA 2OFHX 3HSDA 2EFGA 2MQNA 3GG1A 2P8IA 2XYHB 4ZVFA 3CCQS 2KI2A 3J81Y 2BXJA 4FPRA 4HDGA 4WE1A 2NYIA 5D4OA 2I0XA 2KO1A 1YKWA 3DN9A 4HHHA 4LUBA 3OR1B 2ZBIA 3H7HB 3HJVA 4UUWA 3IWLA 3IG1B 2EW9A 2NSBA 3A1YG 3D6TB 1GXTA 2JRSA 1K44A 4FYYB 3L4BC 4P2XA 5KT7A 5SZTA 4KPYA 3ZTOA 2FQQB 4LF9F 2AEJA 5T41A 1IKWA 5JJBA 1HYSB 3R5AA 4WKYA 2IM1A 5F8HA 4PG8A 4J9PA 1Y10A 4C7QA 5KG7A 1URNA 4P7VA 2VKZG 5MAOA 1U7LA 3ZZYA 2IA6A 4RUHA 3H5XA 2KYXA 5L9XA 1SKUB 3PHTA 2YWKA 1HW9A 4OJGA 2K7JA 5HROB 1S6UA 3RZAA 2XWXA 3ZXWA 2OP5A 1HI1A 2Q6BA 4K0KJ 3CDUA 2VIHA 2F4VF 2HRUA 1MROB 4DFKA 3PW2A 1IR1A 2MLYA 3M8SA 1FRXA 1K9MT 1XMOJ 3OJSA 1X4GA 2MLZA 5BR8F 2W9BB 1VC5A 2CQPA 4DSKA 3I87A 1YRTA 1ZOTA 2F8EX 3NCPA 3CDBA 3RRKA 4GKJJ 1PSDA 3HULA 3OXLA 1EQMA 4YB6A 5HVHA 1VC6A 2V2KA 4I64A 2DJWA 4WPAA 1QDUB 3DYAB 2JEIA 1U1MA 2G2YA 4B3RJ 3I5BA 4DV0F 4GVBA 4OFZA 2AEMA 1U26A 3KUHA 2EKNA 1RCXB 3CWJA 3I0SB 3T41A 3BGFA 4GMKA 3UNYA 2VQFF 1NKCA 1FJEB 3RTVA 3W2WB 3BSCA 4PPDA 3KLFA 4HTIA 5BYQA 4ED3A 4PPZA 1VQMS 3DDIA 3M6WA 3A13A 3DYAA 2K06A 3EZOA 3H42A 1S10A 2HBYB 2BJ7A 1S9GB 2G9OA 2IM0A 3AH6A 2HMIB 3LP0A 5J2MA 1T8EA 3KK1B 4DEZA 2ATCB 3J7ZT 5J1PA 4DJBA 5AXNA 1JNRB 1UJ5A 2LEAA 3R6LB 4LFCJ 2D9PA 3TVYA 1CJTA 5CABA 4DHVA 3KJNB 4Y65A 2F4VJ 3PX4A 2XNQA 1FRMA 3MM5B 4UW2A 1NH7A 5KFIA 1NK0A 5AT1B 2UUAF 1B70B 1BE4A 1VK3A 2FC9A 4NLGA 4NI2A 4I7FA 3HM9A 1JNZB 1NLKL 1PG5B 1RWPB 4OYMA 1YQHA 3QGHA 3K59A 4DR3J 3G8TA 3V6KA 3JSMB 2DNZA 2YKOA 2XNRA 1MWQA 4O3QA 4DUYJ 3IG1A 1KWMA 2RQ4A 3M1VA 1JLBB 5K9FA 2ZZTA 3KLGA 1VGYA 4OX6A 2JEFA 2AMCB 1KHVA 2DNGA 4OZ1A 2V4QA 2NXCA 5HROA 1IKWB 2EPIA 2J0WA 2FIUA 2LEPA 4KYZA 2CDQA 2GFFA 3DLHA 2NZCA 1X4FA 4O3SA 4DV2F 2YNIA 2CPYA 2DBBA 2HAFA 5E3AA 4CO3A 2M9KA 4M63A 3U1LA 4XPCA 4YUDA 4HHJA 2RKIA 3I96A 1Q5VA 2GW8A 2EEYA 3JTOA 4Y0FA 2NYHA 3K8WA 3WX8A 1N8RT 3MTKA 5I4MA 2B0GA 3H25A 1UJ6A 2BW2A 3FSIA 1WOOA 5IOLA 4J9NA 1ROFA 1NEEA 2KXHA 5K8NA 1U8WA 3DHXA 1I94J 2FZKB 2FJXA 1LFWA 4O4GB 3PIPQ 3PZPA 2LDYA 1ZM2A 2JLFA 5FDLB 3PRDA 4FF3A 2L9NA 1SH2A 2XG8A 1TK0A 2PI5A 3H8YA 3H2LA 5ETRA 1PO6A 4WU2A 4KHRA 7FDRA 3WBZA 5ETLA 4KJIA 3KHHA 1S6QB 3H0PA 2N82B 5AE1A 2CJBA 1SPBP 2VKRA 1VQSA 3ETMA 3HF5A 2HBZB 4C8OA 1B0TA 4RX6A 1H98A 2BR0A 2E1RA 4U6PA 4QR1A 2JSXA 1Q0NA 1D8ZA 2CPEA 5DO2A 3KHLA 3PW4A 3LGMA 2X7IA 1MG7A 2C2OB 4K4XA 2ADCA 1T94A 4KH1B 2JFKA 4DR1J 2V8GA 3O1LA 1FWKA 4USHA 2RE1A 4WJBA 1L3KA 4OYOA 4M5DA 4F67A 5KFJA 3RAMA 4DI6A 2KB2A 3EZ5A 4PAAA 3LQVA 1S9EB 2HRTA 1NB2A 2OGUA 3AXKA 3B8HA 4J9QA 4CO2A 1SKSA 1MU2B 3VQTA 3I4PA 1SJ4P 1QM9A 1PKUA 2WK4A 1VIOA 3DMJB 2BJ1A 5ETTA 4KRWA 2DKOB 3M4XA 2J76E 2YPYA 3PRVA 4LBIA 2VPWB 2YNFB 4NXMJ 3W66A 1VQOS 3PR4A 2HHQA 1MLAA 1FKPA 3GV7B 1I5OB 4LF8J 1RUSA 2AJ1A 6FD1A 2VL1A 2NXNA 1CS4A 3D6FB 2EBGA 3MR6A 2B6AB 3CJSA 3TA0A 2ZITA 5EX0A 1RGVA 3M8WA 1WG4A 1ZS6A 4NRUA 1WI6A 5E3QA 3UD4P 2I9SA 3MM9A 1TFWA 3G71S 4F02A 4C4WA 1F3FA 4K2JA 5C7PA 1PYOB 5F3ZA 3BO3A 3IM9A 1ZM3A 1LXJA 4ID5B 1IKYA 4OHXA 5HBMB 2R2UA 2B4PA 1S4FA 1D9FA 2VC0A 4NLYA 5IC6B 2R2RA 4LF4J 2E5JA 3KLEB 3ICLA 3D5MA 7AT1B 3R2CJ 2DNRA 4DL4A 4C8YA 4DQQA 2DNYA 2HLTA 2IA0A 3VAMA 2RVJA 5C5JA 4I2PA 3NGDA 3RRHA 1VC0A 2OPSA 2OPSB 2CNKB 1LW2B 1VLYA 1DTQA 2V4JB 1IJFB 3LPEA 4AYBD 5E41A 3JAMU 4KC5A 4PR6A 2NSCA 5LJ5Y 4LF5J 5LSRA 2HHPA 1RWKB 2OPPB 4X64F 3PFOA 4N8NA 1SL1A 3UO0A 1N56A 2N7YA 4PG4A 1IKVA 2QLWA 1FFWB 1ELOA 2IYIA 5F0UA 3ZTRA 1SL0A 4PEOA 4LQ9A 2KRBA 2Y0SD 1EHWA 1HWLA 2OI2A 4C2MA 3HHDA 2XSJA 1FNOA 2ZNYA 4CLPA 3MD3A 3MR7A 3SXLA 1SV5B 1NJWA 2GV1A 3EVMA 4R8UA 3C6UB 2V63A 3A3PB 3LOUA 1Q16B 3HVWA 3IFEA 2J6SA 3PJ9A 1H73A 1YTYA 2KZZA 1TL3B 1T95A 1XNQJ 1BY9A 1FERA 4DL5A 3EGWB 4M95A 4UOFA 1S4EA 1VQKS 3KOAA 2ILYA 1CG2A 3M2UA 4NLTA 4P73A 1HNXJ 5KG0A 5IWAF 1NSQA 2QIFA 3US5A 3KMQA 2UXBJ 1QE1A 3W5ZA 2JLEA 1R8AA 3OT9A 2ZWPA 1SJRA 3F73A 1S9EA 1H2VZ 2KYZA 3N79A 5K5MA 4ELTA 1BGXT 4OZJA 1HBMA 2MYFA 3UD3P 2RDDA 2OO4A 3PYFA 2E5HA 4NL5A 4C9DA 4IH7A 2EBEA 4RUAA 1EETB 4X64J 4K50A 5LMUJ 4ZLPA 1YJUA 4B3RF 3TX0A 2HS4A 1RAIB 1VYAA 2KL8A 5LMNJ 2JWNA 3W63A 3QIPA 4F4XA 4XTTA 1JLFA 5I3UA 2AWZA 5KOXA 2FD2A 1LWFB 4IG0B 3CMES 2VG6A 1LWCB 2VBZA 2ZZNA 4P74A 4CLLA 2HK3A 2ZE2A 5C2GA 3CXCR 1X9SA 2ERRA 1RT4A 4Q43A 5AXMA 2YTCA 1KNZA 2MQPA 4EO8A 2VASA 2M8HA 4ELUA 3QATA 3BN4A 4A8MP 2K7KA 4ZK7M 3C15B 4U95A 4WFBQ 2KRRA 2QT7A 2AV5A 3JAMY 2CQBA 3CD5A 1TKXB 1M5KC 4BCAA 4X4TA 3P4UB 4UZBA 4A8WA 3RBZA 5DG9A 3J80U 3FKBA 4DR5F 2VODA 2P2CB 3PXGa 3C8YA 2QGFB 2E9TA 1RT6B 5K20B 1RT2A 1TUWA 5AE3A 3BSAA 4NZ7A 1RWVB 5GAHI 1RWOB 4UY8T 4ECWA 4B3MF 4DUZJ 2ASJA 2MQ8A 3BPDA 5F9NA 2ZBQA 2N4CA 1WTBA 1HARA 2LA6A 4OYBA 2CJ9A 4USWA 3PIOQ 2F4FA 1P1TA 2RRAA 2VFSA 4B9VA 4BDPA 4H4OB 5IZHA 1AFJA 2RAQA 1PCAA 1URRA 4P2SA 4TNOA 4BC7A 3THVA 1QAYA 2CJQA 3LUYA 2DCUB 2UUTA 2Z56B 3QBCA 4F7VA 1HQUA 2P9CA 1JIHA 4DSIA 3T5LA 2Z58B 4WE1B 1RSCA 4YR0A 2RUSA 4ED4A 1OJ4A 2DHGA 2YXLA 3KKFA 2E5GA 1HD0A 4Q8FA 3ISND 2F7VA 2YKNA 3V6JA 1FXRA 4P2MA 3H2VE 1F0XA 4NLDA 3RBDA 1JLBA 2PA3A 2EFPA 1OSDA 3MZIA 3RB0A 4C3MA 1TVRB 1SH3A 4O23A 5FLXU 2KFYA 3LALA 2BOPA 3QAEA 4MT1A 5KFAA 1NJIT 1YBTA 3G6YA 1JXVA 2O66A 3M9MB 3A8EA 3D68A 2W2MP 5E7OB 3CCSS 4A8QA 4ECYA 3PX6A 2CAJA 2N3LA 1MMLA 3JSYA 3L7UA 5A8WA 2ZHOA 3O2IA 1V5VA 1OIAA 1Q4RA 4JB8B 3OLAA 4KIAA 3QLHA 3MUMP 2D1CA 1X4HA 1S1WA 5HMZA 1TUVA 3HFZB 4LR8A 2GJIA 3J7YI 2XLJA 2FY1A 4LFBF 1C0UB 1AZSA 3MMAB 1O5JA 3JQJA 4A8OA 2I5JB 5M2RA 3CC7S 4ZPTR 4DV5J 2A18A 4I2QB 4IQXA 4ZLNA 4OYIA 5EHHA 5ITHA 2ZH5A 1HW8A 2J9DE 2LECA 3VAFA 2FLOA 2KM8B 4DR4F 3CC2S 2ZHBA 3D9BA 3EJMA 1SIWB 3V81A 1X8DA 1LQ9A 4AE5A 3Q2TC 1U6ZA 2VHGA 2FVCA 4X66F 1PC4A 2BV3A 4TU8A 1UEKA 2DGQA 3BH7B 3CE8A 3DLKB 2YNGB 2ZUGA 3GFZA 1HL6A 1RT7A 1SQFA 2DT9A 2Z0GA 3GCWP 3PYDA 4NLSA 3EM1A 4CT8A 3LWMA 4L72B 2XS2A 3HJFA 3C14A 1BQNA 1B64A 4DF4A 4G1PA 4Y2IA 2E1AA 4ZN1A 4O3RA 2YPZA 4HI2A 3JXOA 5DRKA 5KFBA 1O51A 3MM6B 4DQPA 3C2PA 2MZ1A 4LF4F 1VQYA 4G3IA 4LFBJ 3GIKA 2AZ3A 2X51A 3C6TA 2FGOA 1SI9A 5CYQB 2CVEA 2DR6A 5I3QA 4J9MA 1VQ5S 3N4WA 2QZ8A 4KFBA 2O3DA 5KFFA 2C2DA 1Q1KA 3LANA 1PYTA 2HHHJ 1JLGB 3CCTA 3AQOA 1YX2A 1QUPA 3MEEA 2MZQA 1NK4A 3S01A 1HWKA 2CZVC 3DOKA 5CAAA 4DR4J 1UPMB 2V94A 2CQIA 2PC6A 4JBCA 2AJ4A 1F9EB 4L74A 3T6JA 2DNKA 1F9HA 2I38A 4B17A 2XC9A 3MMBA 5DGAA 5C2CA 2C22A 4CO5A 3M6UA 5I42A 3IA0A 1N5QA 2R9LA 2W01A 1J5OA 4WTYA 1P8GA 3TANA 3M1VB 5BJRA 1RKJA 4QCLA 3GILA 3D4JA 4JI6F 1VQ8S 3KTQA 3AODA 2CWKA 4XDDA 2HBRB 1VFJA 2WOMA 2YH1A 2FTRA 2PN6A 4DS5A 2V5HG 3KUGA 4FYDA 3NOCA 3EXYA 4LBPA 1UMJA 5I3UB 3Q22A 4DV6J 3UI3A 1RLCL 2IJRA 4FF2A 1TL7B 3ENVA 3FMWA 4X84A 2ZUAA 4KKOA 3WQPA 1RHQB 4KV8B 5HSPA 4F4YA 3ZZUA 1EARA 1XNQF 4KPCA 3K5PA 2DGOA 4QWEA 4EZ9A 3AY0A 4HHUA 3KJQB 4ECUA 4D3GA 4X4RA 2ZM6J 4IYQA 2G2ZA 2MTLA 3BEGB 3LP2B 1R0BG 2GX8A 3NOGA 2MJNA 2NUUG 2D3O1 2UUBJ 3EICA 4KBIA 3TJ8A 4DV4F 1EQ0A 1NM2A 1WTFA 2WAQD 3NGUA 1NU4A 4WF9Q 1N5VA 3CCLS 3LP2A 3PO5A 3CMQA 3UQSA 4JUZA 3H5SA 4FYVB 4Y00A 2VONA 1RQ0A 1RABB 6FDRA 5J2QB 3FRYA 2ASDA 3M2RA 2CJKA 4ZVOB 3VHQA 2BW7A 3VGUA 4WFYA 2XO6A 1TK5A 2VJVA 2P9EA 1VQLS 4O3NA 1ZAVA 1T3OA 2B9WA 4LRDA 2RUGA 3U02A 5KT6A 4ECVA 3RW6A 4DV6F 2FPHX 3H98A 4RL1A 2GAGC 3AJ1A 3KLIA 2X1AA 1ACMB 2C2KB 3DRSB 5AE2A 4V19X 1HIYA 5B0EA 4YY3J 4K4TA 1GMUA 1S6PB 1SBRA 3OR2B 1U2RA 2CQ1A 2LQJA 4H4MA 3EPGA 4BHQA 2CQHA 3ISZA 3TAPA 1W7WA 4WFXA 3P45B 1BQNB 3HVTB 2KT5A 3CCZA 1Y3KA 4M5DB 3HVRA 2P6SA 3TRGA 5KFDA 1RA6A 5DM6Q 5T7LA 2BBEA 2QEXS 4F4AA 3AD8C 4DV4J 1GMVA 1VS3A 2GHVC 3MEEB 1SCJB 1V9OA 1NK5A 4NEZA 4RBTA 3OBIA 4YP3A 1C2PA 4LSNB 4R5PA 3FZBA 3HFKA 5AJ3J 2C1EB 4DV3F 2UZAA 3RB4A 4PWUA 3OL6A 1HYSA 1RAJA 1UP1A 5KFZA 3IBCB 3RBXA 4DPUA 8AT1B 3HPOA 3BKUA 3MD1A 2BMBA 4U8YA 4QR2A 2GVZB 3ZZPA 5I42B 2D41A 1IBLJ 3BDPA 5F8IA 3T5JA 4ID5A 2KG0A 2KXFA 2ZD1A 3IS9A 3FEXB 3HD2A 3NS5A 3IS9B 4EUVA 3GQCA 2D9OA 3TUIC 1VLOA 2W2NP 2CQ4A 2LQ9A 2WVCA 3ZTQA 3NNAA 3I82A 4YN3B 1DLOA 1FKAF 3CO0P 3NRBA 4ED5A 3WIUA 4OYXA 2W1BA 3CDAA 3M30A 5L39A 1D1UA 1TMJA 1WDDA 1WHYA 3I31A 4C0OC 4TY9A 3THPA 4DMZA 1U45A 2GHPA 1SJFA 4LF8F 1RAFB 4OX8A 4K8RA 1YITS 1WKLA 2AX0A 1RT3A 2QX0A 5GAGI 1HI0P 4XIUA 2GHWA 3ILJA 1Z2LA 3SSSA 4F4WA 2CNOB 4FXWA 4J37A 1W26A 1TELA 2KM8C 3U1MA 1JJ4A 3J7A1 3OVAA 1N5SA 2PMZD 4DLEA 4NCAA 4QW8A 1OYDA 3RJMB 3CC4S 3G9CA 1K0VA 1A0OB 4IR1A 2Y8YA 2RQMA 3PCOB 3I0SA 1B99A 4LR9A 4ES3A 1I6JA 3DLLQ 5GAHU 4JV1A 1NKEA 2AGQA 1MSWD 5LXRA 4HH1A 4GKKF 1R8HA 3PW5A 1F5CA 2BUNA 1KEKA 4WBFA 4JV5F 4F0KA 2DRBA 4ZCMA 3RB6A 1HBOA 1OYEA 2B43A 3GE9A 4OI4A 2RQKA 2MY8A 4IUFA 1JWWA 4K4UA 3E01A 2PIIA 3JB9k 1A9NB 1HR0J 4U7UK 2D74B 2J5AA 5CYJA 5HQ8A 2AZ1A 3ETOA 1YZ6A 4RW4B 3TO8A 2J6TA 3HVAA 2DNHA 4CYUB 2V2QA 1FDBA 3VV2B 3ZNUA 1VQNS 2XS5A 3PJXA 3R6GB 4OYWA 4DZ6A 5JXSA 3BO4A 2CQ0A 1TV6B 2JC0A 4CLUA 1NK7A 1TKDA 4MIWA 3DGPB 4F4ZA 3T3FA 3DRYA 3CEDA 3LWLA 1NNDA 1FRKA 3PVXA 4F4KA 3OL9A 1W25A 2ROPA 1U0SA 2VBWA 2ALZA 3CUNA 1GH8A 4ILRA 2J7WA 2RRNA 2DGXA 5IT9Y 3LAMA 3D0GE 3MECA 2WRMA 3W9IA 1VR6A 1BLUA 1RHJB 2D7SA 3BGLA 2UXCJ 4FF1A 4GKKJ 3PG9A 1FDDA 2VJUA 4JI4J 1NK8A 1RCOB 3NWGA 4RW6B 3WC2A 2AJ0A 3KLEA 3MAAA 3PY8A 2KN4A 3FBCA 3HHLA 3TI0A 5EWGA 4M5MA 1HNXF 2M3DA 1KDNA 1Q8BA 4ZPBA 1X31C 4WK3A 5HQLA 5J1EA 2P9GA 3ONQA 4EMDA 3W2VA 1V3RA 3DLEB 4DU8A 5HQMA 3DNCA 1OO0B 1WACA 3VR1A 3RB3A 1FTRA 2YBVA 2QFJA 2Z8QA 1WKKA 4EI2A 4ED0A 2DVIA 2HHTA 1GQEA 5A2QY 1P9YA 3DXBA 1RA7A 2F65A 1ZPWX 2CQ2A 2DHAA 4P2FA 2FZCB 3NS6A 5HN0A 3KMSA 1KQSR 1IBKF 4I67A 2HGNA 1RXOB 4Y3CA 1JLEB 1LWEA 1YSJA 2IJNA 2OEJA 4IRCA 4NLOA 4LFAF 2HZVA 2LXFA 6AT1B 1NHKL 1OQ3A 3K89A 3W61A 1NZAA 1RT2B 4KGVB 1RT6A 3EWGA 1TK8A 3QPIA 1XQIA 1Q5YA 3CJ2A 4ZCIA 4DBQA 2RDJA 1H2UX 3PJWA 5B0DA 1L3VA 3GMGA 1AB8A 1DTQB 1Q8IA 2UXCF 1Q7LB 1Z2ZA 2B8PA 3PM9A 3POTA 4NYOA 4LIWA 5DS7A 3NGSA 4OX9F 2QL7B 4JI7J 3U27A 2Z30B 1WOPA 3GIMA 2M5YA 5KOWA 3I5AA 3R5DA 1HWUA 1U4BA 3FSYA 5JVHQ 1RAAB 1Q78A 2ZEJA 3EMTA 4WP9A 3IR5B 3M2RB 1HBNB 3P3DA 1GMWD 4C8LA 2F1FA 5GAEU 2AYGA 3OTCA 4WP8A 5FIIA 5ETQA 2ZWOA 3CJ5A 4QIWD 3M2UB 3CVKA 2B4VA 3H20A 3OR1A 1E6VA 4FNIA 3OFFA 3OSNA 4OI0A 2MKYA 1S7HA 1QAXA 1Y5NB 4YDDB 4ERDA 3R27A 4X4VA 4AQYF 3ULHA 3V4IB 1GXLA 2GCFA 1H6KX 3BM7A 1HBMB 2VQFJ 2RQCA 4ZLJA 3T5HA 5CHCB 2E5LF 3MMBB 3GJTB 5E3CA 1VJWA 5KG6A 2RU3A 4K59A 1GMWA 2HVDA 2VG6B 3ENWA 3BDEA 4USVA 4ITSA 3WIVA 1LW0A 4FPIA 4Z7YA 5EX3A 3K5MA 1FX2A 3EDQB 3PX0A 5L1LA 1KR4A 4N41A 1AZSB 2ZKUA 5H9FK 3F44A 4MIAA 5D0HA 1W2BR 2OSQA 3GSIA 2OAUA 4HACA 2BQ3A 1QSLA 1PJ7A 2GMLA 1PGZA 1RWXB 2GQCA 4OIXA 2HNYA 1K1SA 1H2TZ 1UPPA 4C11A 3SV4A 1U6FA 5FLXY 4ZMMA 2FJAB 3IAS9 1X5PA 4HEA9 1BHNA 2ZD1B 1O6XA 3QNWB 3KLVA 4LF7J 5H9EJ 4ZHRA 5DGBA 5HP1A 5C24A 3C19A 3PKYA 1HKAA 2QA4G 1DLOB 3D7SB 1SIZA 2MKSA 2O01C 2YWGA 3OSPA 1KQFB 2HVEA 4KH0B 2FVQA 1HPZA 1KHWA 1HPZB 2YNGA 3K2YA 1SKRA 3FVYA 1JLEA 1LWEB 4YB5A 1RTDA 4PYAA 3C15A 4YR3A 5RUBA 1ZM9A 4Q8EA 3QWPA 4EGLA 2V2VA 3TUPA 2L9DA 4JYAF 2OFGX 5L46A 1YWXA 1T05A 4PRFA 1EAYC 2BJ8A 1Q8KA 4LREA 4IO9Q 2MHEA 1F1BB 4MK7A 4ZA1A 4J9SA 4ICLA 4EK2A 1HQUB 4C0HA 4BWMA 5B0GA 4DR2F 5CD4A 2HKEA 1HQEA 4QIGA 3H4BA 1FD8A 2FHKA 1W2IA 4OHVA 4RU2A 1KP6A 2VQEF 4L3KA 2KJVA 3C14B 2EC0A 1FRJA 1S1UB 1TR0A 3FFIB 4H4OA 4KFBB 4DV5F 1N6QB 1RBOB 2GVDB 3IR6B 3AT1B 3PEJA 1S99A 3MM5A 3LPYA 4OZ3A 1RT7B 1EKSA 2GO8A 2C3YA 2WSEC 4FVMA 3TVZA 2CQDA 2RMLA 4K4ZA 4ECZA 3C6TB 1M5VC 3T9ZA 2NXJA 4QWBA 4M94A 3HCXA 3ZZTA 5IM0A 2DGTA 2IFXA 1S1VB 2QLFB 3OQ2A 1QTMA 3O8WA 3MTJA 3Q2SC 2NPFA 4X66J 5F8LA 1PAEX 2KVQE 2ROGA 3DKDA 1VDHA 4OQJA 1NHUA 1SKWA 3D3BJ 1SC4B 4JOUA 5DQIA 2DY1A 3W3SA 1U1KA 2BDPA 4IFYB 4QZVB 5KFWA 1Z1ZA 2W9AA 1Q86T 2R8JA 4QQBA 4DG1A 1RAGB 1IN0A 2V0NA 2YKAA 4E98A 3U1NA 2FLPA 1RHKB 3R7SB 3MR5A 3W8GA 1S0VA 2PMHA 2M4MA 1Y00A 2XMVA 3MUTP 4DR7J 5LXYA 4TQSA 1PJ5A 2C3UA 3M8RA 4J7CA 2OEKA 4NPOA 3AHPA 4DUTA 3QZ7A 3BKFA 5ETPA 5FD1A 1IR2A 3TOQA 3PEHA 1S77D 2DNMA 1JJCB 5IFMA 2FB0A 2GAHC 2XZTB 3K58A 4I2QA 5ETSA 1Y11A 1KS2A 4F0MA 1UVLA 5MLCV 1R6YA 5HVFA 4CLWA 2LEBA 3A8JA 3CJ8A 4H4KC 3FCWA 4NLRA 1TL7A 5KG1A 1RP5A 3KLFB 1VQ4S 1RTHA 4PQUA 4DFPA 2XHCA 2XY7A 2DNOA 2WONB 2N3OA 2CPZA 2DXDA 4CDIA 4GVBB 2CPIA 4DX5A 1UA1A 1NKBA 1HHTP 2HMIA 3IBFB 3J7AN 1U2CA 1VRTA 1TL5A 4I56A 5HAOA 4NWBA 1FRHA 1TL4A 2MKCA 5L38A 2CPHA 2KU7A 4HTJA 4RZRA 3CPWR 3RR8A 4FXDA 4USIA 1S1UA 3FFIA 4NLQA 2G0CA 4F04B 2DH9A 3R1HA 4MH8A 3VZHA 5GVQA 1FO1A 3DLGA 4WFNQ 4I1TA 3MOZA 3V5RA 3W8PA 5CYMB 2OIHA 4FP9A 1VRQC 4OJHA 1RKIA 3DLBA 5BXIA 2F9JA 1IM6A 2F8HA 4GO5X 3P5TL 1FX4A 1FK9A 1R6VA 3T1HJ 1QVFR 4Q0BB 1G7CB 2HPUA 2C3MA 4Q5VA 1HQ2A 4FS2A 1YGYA 4EBDA 5KT5A 1RBLA 4AL6A 2PA8D 3IMQJ 3JQMA 3SV3A 4W4MA 3IBWA 3FSXA 1YZ7A 3QAUA 1NHVA 2BKNA 2A0FB 4XK8C 4C97A 3CJKB 2YX4A 5KFCA 5IXUA 1RTIB 3VTIA 2XYGB 1XMQF 4LFAJ 3NCQA 1RLDA 4RW7A 3OR2A 5KFHA 1VMBA 2J0QD 4M5JA 3Q23A 3NL0A 1WC5A 2HEKA 1RT5B 5D78A 4X2BA 2E44A 2ZNZA 3EDRB 1D3WA 5A8RB 4E0DA 2M52A 2Y1LB 3M6VA 4RU9A 3NEKA 1YIJS 1F5AA 3HX9A 1FI4A 1FCAA 1UFWA 4N47A 2MQLA 4U7UD 1UVIA 3UDLA 2OPQA 4N7TA 1T9TA 1QAJA 4YY3F 2G4BA 3AFGA 4AL7A 2DK2A 3NY0A 3PYEA 3TA1A 4EZ6A 1JLCA 3MCOA 3KJVA 2D3OR 1A7GE 3IXQA 1XWLA 3M8PA 1HLWA 4DQRA 2OD4A 3MM9B 2HVZA 2LQBA 1OPZA 3JYTA 2IAJA 1SQGA 2DEJA 2UUWA 2CWXA 1K0TA 3PACA 1S97A 2YKMB 1DRZA 4RNNA 2U1AA 4LBHA 1T7PA 5HMXA 1C0UA 2AJ2A 5FDLA 2F5GA 1GEHA 3Q89A 2PFDA 4U9RA 4PWDB 3LGHA 5HLFA 1UVMA 5LMNF 1EX8A 2BJ9A 3GTYX 4NCBA 4PWDA 2R7XA 3KDNA 1FFSB 1XERA 2HQFA 4IKAA 1UAWA 2BANB 2QL9B 2A6MA 3JQKA 3Q86A 3ZNJ1 1IKXB 2VF3A 2VV5A 2GJFA 2OPPA 1UVNA 1V5IB 1VQ9S 4X62J 2FGCA 1WEZA 2C2MB 2XMJA 3AA8A 1LEOA 5B7WA 1TU0B 2EI5A 2R8HA 2K3KA 2B7CB 3GYNA 3DC2A 4OZ0A 1Y5IB 1KN6A 1RWUA 1NSKL 4QPXA 4MKAA 3QRPA 1G3OA 2BKPA 2ZVIA 4DN9A 2H54B 3GB0A 1X4EA 4TYAA 1R8BA 2YKNB 2LQ8A 5G4DA 1QE1B 4IQMA 1DZ5A 1N6QA 4NXNF 5KG4A 2QO3A 1TL3A 4KGKA 4AXJA 3MM7B 2ROEA 4DV7J 3RW7A 4ES2A 5DM7Q 1S6OA 2EFNA 2BOAA 5E33A 3P8BB 4I7FB 5J1NA 1UWBB 1OS5A 2FJWA 4XAKA 2FDNA 5HI7A 4B3MJ 1XNRF 1WUUA 1VQ6S 4N8OA 2I8EA 3ZTPA 2ATLA 4L75A 2ZBCA 1JLAA 1RTIA 2A3JA 2MY7A 3A4TA 4QWDA 3K5NA 2XMTA 2VBXA 1NMEB 2ZDPA 4ZOSA 4IOAQ 1SJ1A 2VG5A 4RNMA 1RT5A 4N56A 4C48A 3WZ0A 5A0YB 5D15A 4ECRA 1Y4ZB 2W4CA 4X4OA 2R8GA 1R8CA 3W9HA 4CT9A 3UDVA 4K5RA 3ITHB 4L73A 4BLGA 2MLXA 2ZH3A 2WSCC 1IKYB 3FK4A 4MAKA 5HBMA 3KLGB 1AUSL 3K7RA 1NDKA 4CLSA 1RTDB 2VQEJ 1N88A 2PGCA 1P6TA 2AX1A 4B02A 2CVIA 4LR7A 4IG0A 5IC4B 3RU0A 1U1NA 3CCWA 4L3NA 5ETKA 4I2PB 3CGIA 5B08A 3H5YA 2F40A 4URQU 2NS1B 1VRUA 2MZJA 1OPIA 2GO9A 1CJUB 1E6YB 2JVRA 4ZIWA 1KLNA 1DBDA 4PZVA 1HNIB 3TZWA 4K4WA 2DH7A 3EPIA 2AQ4A 4G6VB 4K7QA 1RWMB 2MHNA 4DQIA 1Q81T 2XS7A 3W64A 2M2BA 2JVOA 4XPEA 3AXMA 4WFZA 2DNLA 4XDCA 4ILLA 1B0PA 2BANA 1X60A 2XY5A 4O44A 5IWAJ 1F5BA 3BJYA 2Y0BB 2GIRA 1JB0C 2WZ1A 3VGTA 4DWIA 3SEOA 3KYLA 3EXCX 3BQ1A 4J9RA 4RW8A 4ZS6A 5D4PA 2RSQA 3W5YA 3C66A 2NLWA 4CLZA 3TZZA 4A8FA 1KSPA 3H59A 3LGNA 2A2DA 3CJ0A 4O44B 4ILMA 2HHUA 3TWZA 4QYZJ 4KT0C 5LL6d 3MXHP 3HFVA 5G0RA 4URGA 5B0FA 3LAKA 4R0JA 3F0NA 1NSAA 3KLHA 2EKYA 2BM0A 2F3JA 1NJXA 1NPKA 1OQ6A 4KO0B 3IGVA 4WU3A 3EGZA 1TVRA 3V4MA 3UR0A 3HHLD 2L08A 3P5BP 2HWTA 2D3UA 3CJQA 1RDRA 4KQZA 4UQTA 1S0NA
chains in the Genus database with same CATH topology
1GNKA 4AFFA 2YWFA 4JI7F 3DXSX 2VFRA 2GC8A 3MFHA 1K8AT 3UW1A 1BD6A 1R3NA 1XMBA 3CJKA 4G1QA 3BS9A 2EK1A 3G6ES 2RD5C 3S8SA 1GTHA 2UV8A 4CQ1A 4ED1A 1REVA 4ZVEA 1EP4B 4LVNP 2DNPA 4C8ZA 2E1MC 4JI2F 2HNZA 2HNZB 1YJ9S 2X1GA 4ECXA 1X5TA 4F8RA 2VH7A 3N6NA 4LSLA 3Q8QB 5D6GA 1N34F 3O6QA 2XEXA 1IUJA 5EUHA 4QIVA 4NRTA 5KFTA 4Y2MA 2JZ5A 2ZVSA 1FF2A 5M2PA 2L41A 4I6YA 2VFUA 3OTBA 4M1KA 1XMOF 2CQCA 3DRPA 5HMYA 1TKTA 2IRYA 1M5OC 2BACA 2PD1A 4I4BA 1H38A 3TX8A 2RDIA 1VRTB 1X7VA 2MQOA 2VZ9A 4AUKA 2DITA 2DPJA 1KC8T 2UVWA 3OL8A 2L9WA 4ZPVR 4JI5F 4HLBA 2J0SD 1KOOA 3MF5A 4X4UA 3UCZP 4OLPA 2UVVA 1X4CA 1WD6A 3VCDA 4R0EA 4P7TA 4FBUA 1F60B 5J2PB 1N5YA 2E9ZA 1UJ4A 1DTTA 3DRRA 2LU2A 1K1QA 4LT6A 4NLPA 1E6VB 2YX1A 1NJYA 3TAQA 1AXQA 4GKJF 2Y1RI 2B9YA 1S72S 1TAUA 3UCGA 3F41A 3V6HA 1HBNA 2LMIA 3PKMA 1HBOB 1UVJA 2B3TB 3OUYA 4CNYA 5DQHA 3QGGA 4RW8B 1DJ0A 2ASLA 3OFEA 5JVGQ 3MI7X 2JL9A 3CIMA 3R5BA 3B4DA 1NO8A 4EYIB 1AW0A 4A4JA 1MMNA 5KFOA 3TARA 1EETA 1WG1A 5KFVA 5F8GA 3IWXA 4OZNA 1DURA 3L95X 3DOKB 3TUZC 4O4GA 1JK9B 2YVSA 1U2FA 4LQ3A 3IRXA 3LW5C 3QJPA 3TNVA 2EK6A 3S1TA 1L3TA 1U8SA 4ZKAA 4IO1A 1CC8A 2HGLA 2BE2B 3WDOA 2RKIB 1NJZA 2WBMA 1YRXA 4CCHA 1DQ9A 3VAJA 3MEDB 2X1FA 4G1IA 3FZ2A 1MROA 2HFZA 2LA4A 2Z4PA 5F8MA 4ZP8A 1GAOA 5BYRA 1N56A 1XN9A 2DISA 2JHEA 4C8MA 3RBEA 3DDKA 4NLXA 2VA2A 3MEDA 3T1AA 3DU6A 1R43A 2AYMA 4ETZA 4K4YA 3DRRB 4KTQA 1HBUB 3HHNB 2BVZA 3CJ4A 1T05B 4Q0BA 5B09A 1VBXA 1I94F 2BRLA 3B78A 1X4BA 1CC7A 3TQ1A 2SXLA 3GIJA 2O1PA 1KFSA 1M1KT 2HHHF 4KHMA 1RYSA 2MKJA 4A48A 3JSMA 2W9CB 4WIIA 5EN1A 1XEZA 2XHWA 4IR9A 4YB7A 1KVJA 2YWEA 1LOUA 3T19A 4H4MB 4QBUA 2VB6A 1SB6A 2CKWA 4B9LA 5CYQA 3MMCA 4PXBA 3M8QA 2ZH7A 1XR5A 3MEGB 3CO9A 5CQGA 4HKQA 1S1VA 3H2UB 3M05A 3KLHB 4TLQA 1YJVA 1XK8A 1BQMA 4NZ6A 3H4DA 2AU0A 2B5JA 3I6PA 1Q7YT 3EGNA 2JDJA 4KHPF 4QIEA 3UDCA 2AF6A 1R27B 2MZSA 2MMYA 3HK2A 3JYTB 4PUOA 2R7VA 3T1HF 1V6HA 2MJUA 2M70A 2M7SA 2UV8G 3C3LA 2GGPB 5GADI 5K8PA 3KNGA 1U47A 1HR0F 1S79A 4B3SF 2JC1A 4DL0C 3FNNA 2QLXA 3FCHA 1H0HB 3HI9A 4KV8A 1S48A 4DX8H 2HYIB 3CMAS 3ZZRA 5C25B 2XSFA 3NAHA 4HT7A 2BQUA 3SCLE 5KG2A 4Y34A 2DNNA 1ZBTA 4FF4A 1JJ2R 5HMWA 3CCMS 4MFBA 5C24B 4J9LA 4KR0B 4LMZA 2AJFE 4DDFA 1SL2A 2MKHA 3ZZZA 5B0CA 2UU9F 1S6QA 4I0WA 1CLFA 4NZ0A 1FKOB 3CD6S 4AXIA 4DR3F 2HNDB 2UVRA 2ZH8A 4DL3A 1UW4A 4TY8A 2B4OA 3M9NB 1O8BA 1FK9B 3NLCA 5AXLA 2RF2A 3OLBA 4YOEA 3BREA 1S6PA 2P5VA 4FN5A 1T03B 2GIQA 3FGVA 3HDSA 2KTQA 3DLGB 2HNDA 1HQEB 2LVWA 1J2VA 1L5UA 4ID8A 3PNIA 3FMBA 3RR7A 3OVSA 4NMLA 4DSEA 3CF5Q 2ZC4A 4U67Q 4G1QB 4EO6A 2IMOA 3HT3A 1FKPB 1S9FA 3CSKA 1C4CA 5KFQA 3J7YU 2OTJS 2HLUA 2MDAA 5CYMA 5L8RC 4ED2A 5L1JA 3RRGA 2FLNA 3TAMB 2W4DA 4X62F 1LWFA 2G1DA 2R4FA 2MKKA 1QSSA 5J1EB 1LFPA 3G86A 4I6AA 5T7LB 4TXSA 3MEKA 5A6PA 1N48A 1MW7A 5CCMA 4EEYA 4WCEQ 2J7UA 3DM2A 2X1BA 5A0YA 1R0AB 4QW9A 5E0OA 2HHVA 4E8UA 2HNYB 3JSBA 4MTPA 1FE4A 3DI6A 5EWFA 4D3HA 2R2SA 4FBTA 2CZ4A 1IM4A 5ADZA 3FEYB 1WF2A 1IR0A 1U49A 3HO1A 4CZCA 2MGZA 1NB7A 4UQGA 1NH8A 4DQSA 5F3TA 3K5LA 3ISNC 4GO7X 2F8MA 4HYKA 4GC6A 3K0JA 4DFMA 2RIJA 1C1BA 1ZTTA 1JLCB 4HH0A 4LJMA 1N0VC 4C98A 2CJAA 1HMVB 2HAIA 2IAJB 4EU0A 5B0BA 1D9AA 1YG0A 2X3GA 4RBUA 4ZPCA 2JX2A 3IGNA 4MMOA 2BRKA 3BO2A 1HNIA 3MOJB 2HZCA 2K1RB 2H5EA 2J9CA 2RNEA 2C3PA 3C46A 3MAHA 4NXMF 1VK8A 2XLKA 2DCLA 1QVGR 1Y3JA 3KWMA 4ZPDA 1FKOA 4URSA 2FHMA 5KFGA 1AROP 2G13A 3MM8B 1FEEA 3Q8PB 2BM1A 5KG3A 1YRUA 2R7OA 3B4MA 3MPWA 1LKZA 3MUVP 2JOQA 2R7WA 1F9FA 2FC8A 4HVZA 3HMJG 4DUZF 2NR0A 2PO4A 2NQPA 2QSWA 2C28A 5CD4H 1TV6A 3FRZA 4RWWA 4B9TA 3IWNC 3MFIA 1REVB 2YX7A 2VG5B 4HL9A 3N9UC 1VBZA 1UKUA 3PRBA 1CVJA 1C4AA 4RW4A 5H9FJ 1N32F 4DSLA 5I3PA 1Q79A 1P27B 4P6QA 3SFGA 1RT4B 4X4QA 2RH3A 2IC3A 1FA0A 3JTPA 4NA1A 2R7UA 5A8RA 4TU7A 5C42A 1S1TA 5IQQA 1LXNA 1YI2S 1JLAB 1X9MA 4LSLB 2WW8A 2J6UA 4A47A 4J5OA 3AA9A 3CCUS 2EG2A 2R7QA 3TP2A 4DLGA 2M0GB 5LSLA 2FJBB 5D4LA 4Q2MA 2AYEA 3OTDA 3TUJC 3L09A 1TKXA 1M0SA 3D28A 2YH0A 2H9ZA 3OXGA 4OHZA 7FD1A 2LXIA 3HHLC 1YHQS 5K14A 4MKYA 2DD8S 1CEZA 1B0VA 1E6YA 5J2MB 1VQ7S 4YMEA 1WHWA 3MURP 5DQGA 1H7WA 2ILZA 1TAQA 2OSRA 3H5UA 3GYXB 4RLEA 3MGJA 3JTNA 3HKWA 4ZCKA 2DR8A 2LYVA 2A10A 2L3MA 5IS2A 5KFKA 4DL6A 4DR6F 4QYRA 2CIMA 4C8KA 2O5DA 4W90B 2FVPA 1R31A 3PFEA 1ZPVA 3BR9A 4O0IA 3OXFA 3SSQA 3OW2R 4ZP9A 3VAKA 2XMWA 2VOPA 3HP6A 5GAEI 3M32B 3KK2A 4JI0F 1VHFA 1CPZA 3L7PA 3OUYB 1ZETA 2JEGA 4CI0B 4OMFG 4IH6A 5SUHA 4NOHA 2ABYA 2DHXA 2C42A 3F56A 4QPTA 3DFEA 2BZ2A 2KFNA 4ZPWR 3M32A 1YJTA 3KK2B 2KKHA 3MR3A 3I5CA 3N28A 1XR6A 5KFMA 3OVBA 5A8WB 2QSFA 2K8GA 4NLWA 2L48A 2FVRA 4LF6F 5EWEA 5D77A 5DDPC 3X3UA 2VFTA 3SSRA 1PC5A 5KAKA 1HWJA 2RU9A 1FNMA 2NREA 2ZKTA 2VFVA 3E2EA 4LF7F 2Q66A 2XCPA 2IM3A 1ZYQA 5D8HB 3WC0A 1C0TB 4DG1B 2FHOB 2IBOA 3NBPA 3S6EA 3SCJE 5DG8A 2AGOA 1RYRA 1U6BA 3MCSA 1OSCA 4WYWA 3PW7A 3DRPB 5F41A 1L3UA 2XI3A 4TN2A 4W92B 1CSJA 4YFUA 4O3PA 2C2RA 5K14B 4Y6IA 4YEAA 1UEVA 1UETA 4L6V3 2KVIA 2CPXA 2XO7A 3OFHA 1F2GA 2HHXA 1QSYA 2BJDA 4WK1A 2VPZB 3NG8A 1N0UA 3W2VB 2FJDB 4K5SA 4O4RA 4AL5A 5DDRC 1HNZF 1XBWA 4MK8A 5IQ6A 2KJWA 4ECTA 1UFLA 2ACYA 2HWTA 4Y2KA 2V8VA 4JI8F 1JKHA 3DDNA 4WKRA 2QMWA 3DHWC 3N01A 4IG3A 2EWHA 4ZVHA 4I69A 4ICLB 3BQ0A 4JI1F 2HGMA 3BR8A 4OJ3A 1S9GA 2EFQA 2R8KA 4B3OB 4QJVA 2COLA 2XULA 2R2TA 2DGVA 1LK5A 4X4PA 1FNXH 1KVIA 4IG3B 5J2QA 5DDQC 2BABA 3GFHA 2VPYB 3LP1A 3MDFA 2JFDA 1Y0HA 3Q8RB 1GXUA 1BQXA 3HXMA 2B4UA 4CTAB 4EBEA 2HWHA 5LJ3Y 4IOCQ 3D2WA 2EFOA 1IQTA 2YWHA 3KK3B 4NX9A 1FJGF 1X4DA 4QWCA 1OWXA 1WEYA 2J9DA 3DM2B 2DR5A 3MMCB 1KD1T 3RAQA 3M6XA 2OH2A 4Z37A 4RUCA 4A8SA 2E29A 1D9DA 1U48A 4HI1A 3UR3C 3V6DB 2YKMA 3VAGA 2AJQA 2W24A 3UWTA 4J9OA 2KHCA 3ZZOA 4Q44A 4UOCA 4GC7A 4TLRA 4WZQA 3QYYA 4OI3A 2GA7A 3CCJS 5J2NA 5HO4A 5DDOC 2V8DA 3SQGA 2AD9A 2XI2A 2W7OA 1RT1A 2KT2A 2AW0A 4PG5A 1N5TA 1M5HA 1C0TA 2MSTA 1DFDA 5AJ3F 1Y9OA 3KFWX 5F9LA 4EYHB 1QUVA 1RTHB 1FVQA 4WYLA 2MXYA 4PQUB 1FXDA 2M88A 2C3OA 1H3DA 1U25A 2NXUA 4H54A 2RF2B 3MMAA 2CRLA 2W8LA 2QMXA 4FXVA 1JXEA 2UUCF 4IH5A 3P49B 2KHDA 4K4VA 2VOOA 4X4NA 3VWSA 3GV5B 1UEUA 4MYUA 5CA5A 2W7AA 4UUXA 1FHTA 1M5PC 2WB4A 4MIBA 1ZZFA 1MU2A 3NKYA 4K2XA 3GR0A 3NP5A 3CCVS 2MQMA 1D8YA 4NA2A 3OJUA 3I4HX 4K0KF 2DHSA 3DRSA 2LXUA 4TU9A 3UPFA 2IRXA 4C8NA 2ZH4A 2VG7B 4ZPAA 3PV8A 4BWJA 1KTVA 4Y2AA 1X9WA 2KFZA 4OLOA 3B82A 2OD6A 4CNZA 1IBMF 3TA2A 3OFGA 3IN5A 1HFEL 5HL7Q 2XB2D 5CZVA 3D54A 2Y1JA 2VUGA 4OHWA 3QGPA 2Q43A 3CJ3A 4XO0A 3HHLB 1MWZA 2QA2A 1RTJB 3EX7B 3KHGA 4KKOB 2UVUA 3FJ2A 4LF5F 3LH2S 3GSDA 2DTJA 2VBYA 3NNHA 3W7BA 3GIIA 5KFNA 3NMRA 2O67A 3TR5A 1R0AA 1TP7A 3V2UC 5A8KB 1P9QC 4MFBB 4NLVA 5K8OA 2W7PA 2Q79A 3NMAA 1Q53A 3DI6B 5L1KA 5C25A 4IRDA 2B7BB 3OV7A 2W9BA 2NUHA 2K2PA 1FVSA 3UNGC 4DL2A 3T9NA 2UP1A 1G1XA 4CH7A 1Q82T 5J2NB 2PFFB 4KB7A 1Y5LB 3CCES 1VRUB 1LK7A 3TVKA 4NLUA 3DOLA 4PXCA 1SXLA 2OMLA 4YQWA 4DN0A 3N5BA 4IDKA 1XR7A 3I0RB 4OL8A 3GFYA 2HIQA 1RISA 3BZQA 4DFJA 2UXDF 4ZCLA 4ED6A 2HQIA 4QIFA 2CPDA 3CDWA 5D3GB 5F8JA 2HRYA 1FDNA 3V4IA 3MM8A 1FTCA 3M2VB 3DOMA 3M2VA 5KG5A 1SH0A 3E3XA 5DETA 2XWYA 1FRIA 2ZC3A 2CFXA 4N76A 3THTA 2DIVA 2DGWA 2IC3B 2OPRB 2NZ4A 4NYZA 3DGPA 2MB0B 3I32A 2WCXA 5BYSA 2WTFA 1U24A 2BA9A 2YNFA 2ZOMA 4MYTA 1NAQA 4ZP6A 2MSSA 3R5CA 3CDEA 4IRKA 4DOZA 3NNCA 2KH9A 3VAIA 4RW6A 1DAXA 1DQAA 3CD7A 1FDAA 1QY7A 1TL1A 4QU6A 4OX7A 3QLHB 1IXKA 2Z2MA 3MECB 3E8OA 2DB1A 3I56S 3BGUA 2HHSA 5F8NA 3G6XA 2XMUA 3WX4A 2KG1A 2MPUA 1HHSA 1JLFB 3CTRA 4Q2LA 4BBYA 2MGZB 2PDAA 3AB2B 5HP1B 1M90T 2XGQA 1TL1B 5A8KA 2BJEA 3E51A 1S0MA 2D3ZA 4ETXA 3OL7A 2E9RX 3PHEA 2QE5A 2GQQA 3MPVA 2FVSA 2JEJA 4B9NA 1LW2A 2V4JA 2YY3A 4ES1A 5E5NA 1K73T 3POTB 1JX4A 5J2PA 1N5YB 4JI3F 5KTQA 4LVOP 1HMVA 2KT3A 1FJ7A 4HT5A 3AJ2A 2E5IA 2RRBA 3CIZA 3M30B 2ZJPQ 1SJ3P 1C1BB 3OHBA 4IFVA 1FD2A 1ZTWA 1B7FA 2V9WA 1FXLA 1CQMA 1RT3B 2HVIA 1C1CA 4ZVGA 3SMZA 5F0WA 4R8UB 1UA0A 2MZTA 2HWIA 1S0OA 3IO1A 3H40A 2OPRA 4UY85 4F2RA 1HI8A 1KTQA 3ZZ0A 4RBVA 1Z4UA 2CG4A 2LDIA 1FEHA 4ELVA 3V6DA 1Q8LA 1NK6A 1EP4A 4RKUC 5KT3A 4V19J 2ZOGA 5EWGA 3TAMA 3BQ2A 2ASYA 2GNKA 4TQRA 3HKZD 1FRLA 4H4KA 3K5OA 2HS0A 2J9EA 2ZOFA 2R8IA 2K3IA 2KDOA 2ZJRQ 1X5SA 4LSNA 4R5PB 2ADBA 1UWBA 1IJEB 4KSEB 2W8KA 1SUQB 3GG0A 4FVCA 1JLQA 2GMJA 4WZMA 4B3TF 1LWCA 4C11B 1WELA 2PI4A 1FESA 1GX5A 2WONA 3DLEA 2EVZA 5AXKA 5EDWA 3U7JA 1X5OA 2WBRA 1TZ0A 1S1XA 2DIUA 2IRUA 2YQ3A 2NPIA 4CH1A 2IHR1 1MMDA 4OZ5A 3J80Y 5L1IA 3R1LA 2ZE2B 2EG1A 4ATNA 4WXWA 3QJJA 4MKBA 1N4LA 2E7WA 2XY6A 3OTOF 2I5JA 4FS1A 1X4AA 2V9KA 2V4RA 5H1SV 2AGPA 4F25A 1HWIA 4BC9A 2DNQA 3DLKA 3O3LA 2RS8A 4DS4A 2BYCA 2HQ3A 2YKQA 5DLFA 1N52B 2DGSA 2RS2A 4CO1A 3Q8SB 3KG0A 3L7OA 3NAIA 4HDHA 1DTTB 2YNHA 4CTAA 1KRPA 3X1LB 2HW3A 2LQ5A 1GX6A 3AQPA 2E7XA 3C6UA 3IAM9 3VZIA 4EBCA 1V3ZA 3TW0A 4F2SA 4PG6A 1HD1A 4C3KA