1YQVH

The crystal structure of the antibody fab hyhel5 complex with lysozyme at 1.7a resolution
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
215
structure length
215
Chain Sequence
b'EVQLQQSGAELMKPGASVKISCKASGYTFSDYWIEWVKQRPGHGLEWIGEILPGSGSTNYHERFKGKATFTADTSSSTAYMQLNSLTSEDSGVYYCLHGNYDFDGWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKILD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Water molecules in the antibody-antigen interface of the structure of the Fab HyHEL-5-lysozyme complex at 1.7 A resolution: comparison with results from isothermal titration calorimetry.
pubmed doi rcsb
molecule keywords HyHEL-5 Antibody Light Chain
molecule tags Immune system
total genus 37
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2005-02-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yqvH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yqvH02
3BT2H 1I1AD 2VXVH 2C3HA 5I71C 4PGEB 1QBMH 5GQBA 5KBNC 4XPGH 1ED3A 3WV0A 3C60B 4P2CG 2I5YH 3ARGB 4IEFB 3ET9F 3FO2B 3GBNH 5AYQA 4C56B 3D85B 1GYAA 3CCHA 3BPOB 4KGJA 5DJXA 2XQYK 5HDBE 1HWHB 5GGVY 3DX6B 5GSVB 1QTYT 2XZZA 2N4IA 4OUUA 3CK0H 1AGFB 2FD6L 4GW1B 1IVLA 2AW2A 2YXFA 2GTWA 4PY7A 3S3PA 3L6FB 1LDPH 3MOAH 4MNQD 2QSQA 3BKMH 1AGCB 4RZCB 4W6XB 1H5BB 1QFPA 3V4PH 4EQ3A 1J8HE 1U6AL 4LSSH 5A2JH 3QUMA 1F3JB 2C4FU 5GZOC 1CDGA 1BIHA 3TZVC 4UTBH 5IVXF 4UZGA 4OZFB 4ZG1A 4N9GA 5I1AB 4YX2H 4Q6IC 2MQCA 4OI8A 1FNSH 3DX7A 3WD5H 1BVLB 3L3GB 2QHLA 1IAKA 5JW5B 4OZ4B 5GS3A 2PYEB 5EO1B 5TH2A 5EZOH 1PSKL 2ESVD 1EZVY 1N64L 2W0LA 2W59A 2YD2A 4JY6A 1NANH 1DBBH 2CGRL 3DUUA 1JI2A 4G8EA 1CFQA 4IRSB 4P4KA 1D9KA 2ZP0T 1RU9L 1NQBA 1GIGL 4XBGA 4M6MH 4HS8L 2J2ZA 3TVMD 2OTPA 2H1PH 4NQEA 4G3YH 4GAGL 3CXHK 4CDHA 3VFPB 4KVNH 1WCQA 1MCSA 2ZSWB 2F54B 3LMJL 4ZUVA 2Q3AA 3RIFF 1BVKA 5HVGB 4JFXA 4JY5H 5GZNC 1N5YH 3BDYH 1DVFB 3IJHB 2X42A 1GGTA 1ITCA 15C8L 2D7MA 2ZNXA 4KK9D 1TVHB 4KKBD 3P9LA 4TUKL 1I85A 2GJ6D 1YEHL 1F90L 4LHUB 1I8IB 3S8WA 1KJMA 3RVWD 3B5TA 3ULVH 3IFOB 1RZKH 5L2JB 4D0DB 4EKXA 4OZIE 1OTTD 3O4LE 4NGHL 1PG7H 5D1QD 5E03A 5ID1A 1T1ZA 4P2OD 4UV7H 4PY8J 1QP1A 4KJPD 4UU9B 3T77B 3UZVB 5D7LB 3V7AG 2WINB 1I3GL 3H8NA 1HXMB 3BRFA 4P9ML 4XNMA 5E2WH 3CVHL 4PGDB 3HZVB 5GRVL 3MCKA 4XNYL 3QRFM 4FHBD 1BIIA 3DO7B 2VDKH 2CSPA 4DZ8A 5DMGC 5DJAA 5AD0B 4L8BB 4F9PA 3GJFK 5EN2A 1ZHLB 1AKJD 4CNIB 3PWNA 2AKRB 3B5HA 4HKXA 3O0RH 1T2QL 5B38B 4Y0GA 3V5KA 5FEBA 3VXMA 3K8KA 1MH5A 2VABA 4X0KA 2NTSP 1JPGA 3KPRB 1FPTH 1XH3B 5F1IA 4MDJA 3A0OA 2H45A 3VI4E 3SDAD 5D93B 3EHBC 5D7JA 4FFWD 1ODAA 1UENA 2B0SH 2DLIA 4DKFL 5C09A 1ZHBB 4PIRF 4IOFD 1F3RB 2EDHA 2P7TB 4L4VD 4PRBB 3DX8B 1S7XA 4OT1L 1VACB 1S7TB 1ZVSA 4Y4HB 4JHAH 1DQJA 5FO8B 4KAQL 5KJRL 4K7PY 1BFOA 3VFSB 2BY1A 2CK0L 3BYTA 4CN6A 1LP9F 2NW3B 5I8EA 1U8QB 5JOPE 5T3XH 1YQ2A 3IDYB 1R3LA 4YDVB 4X6FA 4YDKH 1PX4A 1KV3A 1YN6B 2ICWJ 4KZDL 5GGUB 4X8JB 4HJJH 5SWSE 3EFDL 1W0WB 2VDPL 2BNRB 2YUZA 1WAAF 3K4ZA 4L9LB 3TESA 1BBJB 4OCLC 4YUEL 1MVFA 2HH0H 2JJTA 2CIKB 1IC5L 1F8TL 3O3DB 3ROOB 4APQD 5IFJB 1ZA6B 5C71A 1OB1B 1REIA 1LK2B 2Q8BL 4UT7L 1P7KA 3C60C 2L7JA 2GSIA 3GB7A 3V8CA 3ABZA 3QXVA 4G9FE 3UTOA 4ODUA 1OAZL 3IYLW 4J1UB 4PP2B 3GIVA 1S9YB 1M7DB 2I26N 3BPOC 5I19L 1U0QA 5IQ9B 1YEJH 3HI1B 5CD5D 5TF1H 4Y1AE 2D7OA 1OP3K 3KPLA 3GNML 3WUWA 4P3DB 3QG6A 4N0CC 4OFYA 1YPZB 1GOHA 1WBZA 4Y4FA 5IW3A 5INDB 1KN4H 3U46A 1FZJB 2J12B 4D0CB 1QSZA 4HQQH 5J13B 2Q6WB 2UY7A 5F7FA 3UAJC 1BP3B 1ZHNB 5EU3A 3IDIA 1BLNA 3OG4B 1U8LA 2IALA 4Y2OA 3QA3B 1H5BC 1F2QA 1R3JB 1GHFH 1DTUA 1RVFL 3MUZ1 4ZO8A 4ELKA 4OLWH 1OY3B 5T1MA 3D5OF 5JXAL 1EHLH 1ZGLA 1HHHB 2AQ1A 3KPNB 2R8SL 1AR1C 1YEDA 2GQHA 3H9HA 4MDIA 3FCTA 4R2GB 2JCCB 3DI2B 4PJHF 2PXYC 3HE6B 3B83A 5CP3H 5FCUH 9CGTA 5ICYA 2BZDA 4NNPL 1DUYA 4P57A 4OLXH 1FVDB 1NBVL 2VLRA 3BN9D 4JZNB 3X13A 6FABH 4F7CB 5F7EL 4MQXD 4NBZB 5DJDA 3ARFA 2ZOKB 5L9DL 5MHSD 3C8KA 4ZFZA 5F3BB 1FNEA 3QFJE 4FQQA 4L1DA 1NBZB 1DANT 1MFBH 1P4IL 1OL0A 5F7WC 1C5BH 4IRSC 3V4UH 3VXUB 3OAYH 3OGCA 2XWTB 1SJHA 1JRHI 1B6UA 1MHHB 4HIHA 3KPOB 1BGXL 1N4XH 3CFBB 3QUML 4PJAB 4XVUC 5GGTH 3EUUA 1X6LA 4MD0A 4RRPA 1TZIA 4EBQL 3JWNC 4OGYL 4X9FA 1I9JH 4PJXF 3ZKXB 3UTTE 1L7TH 2YPLA 4U1KB 4AEIH 1M71B 2Y6SC 2QL1A 2VLKD 2NY1B 3SDXF 4X98A 3FRUB 3S3JA 3VFWB 3EYVB 4OZHB 5KSUB 3GKWL 5E2UH 1FQ9C 4Z7WF 4WUUB 1BJ1H 1DVFC 1JHKH 1E28B 5IMOA 5SWZB 4YDIL 1JWMA 3N1GC 1OAYH 4NM4H 3QH3A 1XCQB 3ZE2F 1RAMA 3LY6A 3TPUA 2DYPD 2BSRB 2ARJB 4M1CC 1QSEB 1SYVB 3G6AB 2W9DL 3N1FC 1B0RA 2F8OA 3CSYA 3CZFA 4HS3B 4MA1C 1M05B 4LLQB 4Y2DB 5I1IH 1U8OA 4O9HL 1SVZA 1M1SA 3WFEL 3RI5K 5CMAA 2FIRT 1MCJA 3KGRA 1T21A 5HYIA 4YDLB 3RTQB 4YLQT 5HGAA 4DN3L 1XF3A 4DTGH 1QSFA 2BHYA 5GS0H 4WEBH 2XKUA 3T09A 2J1KA 1KGCD 4OLVH 1NGWB 1CVRA 3K46A 5ALBH 4M43L 3Q6FB 3QIBA 2IQAA 5IMKA 3TA3A 3UBXA 4Q58C 3G5XA 5FUCC 1JFQH 4U1JB 4F7PB 4PJ8D 4YQXL 4MMZC 3MRBA 4P99A 5D93C 5DWUL 4LCUA 1W72A 1MHPL 1MRFH 3VDCA 2PR4H 4RDQF 3F7VB 2FECI 1I1FB 4S1QL 5HYJD 2GTZA 5E8NA 4XNQB 4Y4HC 4LCIL 3RGVA 3CSGA 4N0UB 2PYFA 2X70B 3BOVA 3X14B 4AG4H 5HVHC 4ODSL 3DMMB 2XZAH 1KCRH 1IC1A 2P8LB 4UNVA 3L3KA 4EDWH 5BZDA 1CT8B 3WL9A 3FT2B 3KXFA 4LCCB 4F3FA 1DEDA 2P5WB 1LO2L 5TE4L 2ARJQ 5HPMB 4GRWE 4L9LC 2DQFA 3PQYD 3SEPA 5DD0H 3RWIB 4Q9QL 4GBXD 2B2XL 2CKBH 3BGAA 3B43A 5B39G 5BJTA 4Q7DA 4XGZA 4M7LH 4CAGA 4OZGA 5CJXA 1ETZA 1VDGA 4R3SA 5L0QB 3ZMRA 5HDQL 4ZXBA 4Z7VB 5I1HH 5C07B 1ZLUH 1KEGH 3HI6L 1MAMH 1HHKA 2OTUB 3TBYA 3SCMD 4QRSA 1DQTA 1NFIA 4OFKA 3MV7B 3T4YA 2DLFL 3B6SB 4DUXA 25C8H 3ZSTA 3FQUB 3S7GA 4LLWB 2RBLA 3NIDE 1Q72H 4FQ1H 5DRZB 1UXWB 3OKKB 4HT1H 3D2UD 5J13C 3DI3B 1MCWM 3QWRD 4UB0H 4E5XB 2QQNL 3LEVH 4Z9KB 5SX5K 2PETA 5FK9A 4K3DH 3MBED 4JFFD 3F58L 3FFCB 3HZYB 4EVNB 4ZFFA 4JFHE 2NY5L 4QRUA 4JFDD 4RNRA 1JYXA 4K8RD 3W9EB 5DJ6B 3FRPG 4R2GC 4W4OC 4XB8A 4F57L 3HE6C 3ULUD 4WHTA 4XH2B 4PJDF 3KPMB 2VC2L 4XXCC 1ADQH 4P59L 1RIUH 5JORA 4LSVH 3VI3E 1HKLH 3WFHB 4R6UA 3KLSA 5F21B 4JQXC 1AXSA 5IV2B 3ULUF 1U3HC 4QWWC 4LLUB 4DUVA 2P4AB 1CD1A 4K94C 3K74B 4HZLB 5FA4B 5K9KB 4M61B 1I8KA 2W0KA 3N0PB 3CFKA 4IOIB 4U7SA 1KJVB 3BPLB 4ZPTB 1B4JH 1TQCB 1I7UA 2FWOB 1CIUA 2PO6C 5K93A 2R0ZL 5EOCJ 4M48L 5FIEA 4LPYA 5DUBA 4KK6C 1IQWL 3DARA 1DQMH 3U9PL 5TQ0H 2A0LD 2EYTA 4GSDH 3OKEB 1C7TA 3TZVA 5E6ID 2X44D 3NIGF 2PCPA 5CSZA 4PG2C 3GMQA 4Q6IA 3GMMA 3NFSH 3DBXA 1QR1A 2I24N 2QQQA 2XPGA 2YK1H 4EUPB 1TCRB 3RDTC 4Z7NF 4IM8A 2XTJE 2V17L 1IAOA 5EIIB 1CD0A 2AQ2A 4PJ9C 1AHWB 2VXSL 4Z7QE 3OBAA 5KG9B 2R1YA 4U1NA 5E9DE 2PF6A 4WUKH 2HA1A 4ZUUA 1B4RA 1KENH 4Y89A 1HINL 5MERB 3SOBH 1TPXB 2UUDH 5BZWA 2X9XA 1D6VL 1E4WL 5F7YC 4NQXB 1A21A 4LEXH 4R4NC 3SGDI 3RL2B 3CLFL 3V5DB 4N1CA 1OQOA 3LOWA 1A1NA 1S5IH 3OPZL 4JJ5B 4PTUB 4U6HA 5JPNB 3U0PB 2YPVL 4NWTH 4PRAB 3A6CH 4PGZA 3G6JE 2R2HB 4X6DE 5FDWA 4XCNB 3QT2A 3AAZA 3S96B 2C1OA 5CWSB 4TOYL 5J3HD 5DHYA 5IFAL 5ACZB 2VLJA 1LGVA 5C2UB 1IGJB 4KVCL 2QR0A 5HGBB 4U6TA 5J9PB 4WU5B 3SHSA 4ZD3L 1AC6A 3FB7B 4Y5XC 4DUWA 4C54A 4RISH 5MEND 8FABB 1KG0B 1A7PH 3BZFA 4JRXA 1KCSH 2XFXB 1JWUA 1YYMH 2JB6B 2Z31A 4JPWL 5EORL 4PRHE 4JN1L 3IETA 3H7BA 3FFDB 3GHEL 3UPAA 2DBJA 3CFJB 2FYYB 1PY4A 4XP4L 5MP6H 3DMMC 4P9HH 3LKNB 2E9BA 5FYKL 3M1BA 1G6RB 3BP5B 4LCCC 4OM1H 1X5XA 1PZUB 4G43A 4KZEH 2VDRH 1J5OL 1NSNL 4RFOL 1W72L 3MMEA 2DL2A 1I8MA 4RGNE 1NGQH 3LIZH 1QEWB 1CXFA 4RDQG 3UROR 2WV3A 3U0TB 1OD7A 2OL3H 3DRTB 3OKOB 3UJTL 1BQHA 1RIVL 1KLUA 4L8CA 4NHUA 5DUPL 1S9WA 3VXSB 3CSBA 4RAVB 1AIFB 2CUMA 1B9ZA 1P4LA 4HPYH 3KPQA 3UCRA 4CMHC 2YD5A 2GJ6B 3C5ZB 2HFFA 3MJ9A 3MLUH 4YR6B 2FLBT 1FL6A 4P2RD 5EZJA 1FDLL 2HLAB 3VE0B 5IOPA 1U8JA 3S37L 2OP4H 5DMIL 3V0VB 4F7TA 5DUMH 2DAVA 1B2WH 2W07A 4HFWB 2X4RB 2VQTA 3D9AL 1CZ8L 5KS9F 3P4OB 2DTML 5F97E 5C2BH 5ACLA 2PKDA 5I30H 4O5LL 3O2DA 4RBPK 2IFFL 1G7LA 5HHOE 4QRQB 3MA9H 5I2IB 4BSVB 4GMTH 3VRJB 3BEVB 1K5NB 2EO9A 2AJSH 1CR9L 4PGEA 3BW9B 4OF8A 1A1MB 3GSWA 4MS8C 4WHYG 3X3FH 3C60A 3QISA 1DEEA 4QRPE 3TBVB 5D96C 1FCGA 3DWTA 4XCEB 1QLFA 1QKZL 1I9RH 3FO2A 4PJCF 1DE4A 3AUVA 3D85A 2HMIC 3SDAB 3LB6C 1U8KB 5I1EH 4LDEB 1YC8A 5DRXB 4YIQB 2YSSB 2OR8A 1XGTB 1AP2B 1H3WM 3MGTB 1NC4D 4HKZB 4GW1A 2NY7H 5ADPH 3L6FA 2F19L 3V5HA 4XVSL 1JPSL 1JV5B 4RZCA 2QTEA 1CE1H 1JCKA 5IHUH 1H5BA 2DIJA 3ROLB 4MA7L 5DK3A 4KMTL 1KCUH 1QRNE 5EUOB 3NA9L 1YNTB 1F3JA 3OR7B 4JRWA 2VXQL 2ZUUA 4OZFA 1HWGB 2EXYD 3MLYL 3TT1H 5A3IC 3D1MC 3MLVL 3GMPB 1KB9J 1CFSA 4MHHG 2PXYA 3ILQC 1H8SA 1YJDH 2H2PD 3FTGB 4APQB 1I1AC 3BWUC 1BVLA 3L3GA 4R97B 5JW5A 4OZ4A 4FZEL 1AHWC 2F9BT 1RUAH 5EO1A 3BJLA 4MCZB 1NBQA 4XPBH 5IB3B 3NACL 5BRZE 3U36B 3UYRH 3GKZA 3ULVD 3VU2A 2VLMD 1T03H 1KFAL 4IRSA 2UY6A 2ZUTA 3MRGA 2F15A 3PL6D 4OB5H 3ULVF 2FO1A 3O2VH 3HCVB 4ZYKB 2NXZD 1Q94B 3MLSL 2ADGB 4P5MB 3IJSB 2D0FA 3LZFH 3LS5H 3VFPA 2F54A 3WLWD 2FO4B 1WWCA 4PRIB 3FB6B 5JR1H 5EUKB 5DF0A 3RL1B 3W0WD 3BDBA 1DVFA 1EHAA 4NQTA 2V9RA 1OT2A 1G84A 1ZMYA 4NRYA 5ICZA 4LGPB 3WUZA 1MCOH 2J3SA 1WWAX 3B2VL 4X6CF 5I1DA 2GJZA 1AQKH 1NKRA 3VFOB 4D0DA 1JZ7A 2WBJD 3SKMA 5TE6H 8CGTA 1CLZH 1AJ7H 1NMBH 1C5CH 4PLOB 1IT9H 3T77A 5D7LA 3O3BB 4WFHE 1ND0A 1HXMA 4IS6B 2UZYB 4A6YH 4JO2L 3OGOE 5GJTL 3ULSA 1CFVH 2MMXA 4GG6F 3CMOH 4K71B 4ORGB 4PGDA 3HUJB 4R90H 4YHIB 3C2AL 4BSWB 4MAUH 5ESVB 4DKEH 1YN7A 4MVBD 5LBSL 4L8BA 3TVMC 1ZHLA 1SJXA 2YKLL 4CNIA 1HSAB 1MI5B 1NEUA 4Z7WB 2VXUL 2AKRA 3CFEB 5JA9A 4LASH 3QFDB 5DVNA 3H6JA 2X1WL 5I1KL 4U6YB 4ZMAT 3RZCD 3KPRA 5DFTA 2ICWB 2P45B 1XH3A 5CJQH 4ZUSB 1HN1A 3SO3B 2VAAB 1UH4A 1UH3A 2V2WA 3QDJA 2HTLC 5A1AA 4KK9C 4KKBC 4UMGA 3BKJH 5FHBH 4ZNEA 2ATPB 1ZHBA 1HNGA 3A67H 5B4MD 2BNQB 2P7TA 3RVWC 3DX8A 1D5IH 2DYPB 1S7TA 4Y4HA 2DOCA 4FTVD 5D71H 2R4SL 1OTTC 1UGNA 3IU3B 4JM2D 3WHXA 5FO8A 5D1QC 1CQYA 4P2OC 4KJPC 5AEAA 3MFFA 1WZMA 5K59F 1IM3B 4JHWH 4JM2F 4YXLH 1YN6A 5GGUA 4PJ5E 4X8JA 3MPCA 2HVJA 1W0WA 2V5MA 3VH8A 1OM3L 2GYSA 2XG4A 3SKUD 1BBJA 5E2VL 1LO0L 3M8OL 2CIKA 3OR6B 3L3HA 3O3DA 2NLJB 2Z8VC 1ZA6A 2BX5A 1P6FA 3HPJB 1HHGB 3GK8H 1ZS8B 4I48B 1LK2A 2VITB 4Z8FH 1BD2B 1UWGL 1PLGL 4LNRB 1I1RA 3FOMB 3KYKH 1HSBB 3QPQD 4N1EA 3WE6B 4J1UA 4J12A 1S9YA 4I5BA 3ZLQC 1M7DA 1BPVA 4XBEH 1SVCP 3BUYA 3SDAC 4FQPA 4Q9BA 1S8DB 4FFWC 1XIWB 1LHZA 3BXNB 3T4AB 3HI1A 5KAQF 5ANMB 3TWCL 4I0PB 2OK0H 2VZUA 1UADC 1RULH 4P3DA 1WT5C 4IOFC 3O2DL 3L5IA 4HUVA 3IDJB 2ZG2A 5D70H 2P5EE 3MRFB 1D3CA 1FZJA 1FSKB 5LCVH 3MACH 5AAWA 4HUWA 3WO3B 3BAEH 4U05A 4OBSA 1T7ZA 4BZ2L 1ZHNA 1YYLL 1ZHKB 2W60B 4NZRL 3IFNH 4AEHH 3QA3A 1R3JA 3G6DH 5BS0E 4YHPB 1BZ7A 1A2YA 3EO1A 5I8OH 3JV0A 5E1AA 3PHQB 3MSPA 2F5BL 4L29B 3KPNA 4H1LG 3HZKB 3PQYB 4UQ3B 1OAQL 3G04B 4W4OA 5B3JE 3QIWD 3HE6A 1J10A 1LO5B 5I75B 4APQC 1JTTA 1WIUA 5K9JH 5TE7H 3HAEA 2CLZB 4CVWA 4XXCA 2EDRA 4JZNA 1RZ7L 1VFAA 2Y06H 4F7CA 1NMAL 3IRPX 4JQXA 4OKVB 3QUXD 3OAZK 4D9LL 2ZOKA 1U3HA 3W5MA 5IEKB 3SCMB 1JVKA 3VXUA 1A5FL 2ZUYA 4P2QD 2P44B 1I1CA 5CD5C 1MHHA 2Z8WC 4PJAA 4X99B 4JFED 3WCYA 3OXRB 2CIIB 1A7QH 4PD4K 3T2NL 2ED7A 3SQOL 1M71A 2PO6A 2J6EH 3D2UB 5F7NC 5T1KD 3TYGL 5T5NF 5CBAB 1PKOA 4K07A 5C0ND 2IPTH 5TF0A 3INUL 3VFWA 1FAKT 3EYVA 5KSUA 5DT1H 4GRWH 3MBEB 4JFFB 5JOEA 1E28A 4WWKD 5CGYD 5SWZA 4PJ7E 1P4BL 5EO9B 1L7IH 5FO7B 3UX9B 2LQRA 3NFPB 4M1GL 4FOMA 4PG2A 1MF2H 3T0WA 1XCQA 4WJ5B 1A6AB 4R9HA 1DJSA 3STZB 3RDTA 1QYGL 2ARJA 3KLAA 5ADOL 1SYVA 5BVJB 4PJ9A 3G6AA 1AGEA 4AH2A 1UM4H 4NO0D 1TVDA 4GAJH 4JDTH 4RX4D 1MY5A 3NN8B 2GFBA 1M05A 3BN9C 1RUQH 3QCUH 1J1XH 1SEQH 4NQCD 5DJ0B 2X4NB 2O5ZH 4MQXC 1FL5B 3EYSL 3GBLA 2R1XB 1RMFL 3MV8D 1A9EA 2VE6B 2XZQL 4ELMF 4BKLB 1G9EA 4PGJA 3GJFH 2FB4L 4K71C 3CLEL 2EXWD 4KROB 1ACYL 4L4TA 3WFBL 2YBRB 2D7PA 4YHZH 2WUCL 3O6MH 1XR9B 2WBWB 2QKIA 3E6HB 2G60L 4DGIH 3CFDB 4GXVH 2Q8AL 4G42B 1G0DA 3ARWA 1JYVA 4UINL 3BN3B 4BK5A 3GMOB 4KI5E 4NUJA 1NFDE 4MXVF 2DDQH 3DVIA 4J3OC 3RJQB 5C8JB 4U1JA 1OTUD 4F7PA 2DQTL 5JQ6H 3QDMD 2IF7A 3MRMB 1K4DB 1BQUA 2DWDB 3DIFA 4Y5XA 1LE5B 3DROB 3Q5TA 3U7AA 2DJSA 2R4RL 3DGCR 4XNQA 3QXAA 3BEWB 4ZO7A 4N0UA 1CICD 4QF1A 4G6JL 2X70A 1GGCL 4MQ7A 4BQ6A 2DKSA 1MRDH 3CIQA 2ZG3A 3X14A 3CU1A 1ORQB 4MWFB 3DMMA 4DVRL 4OGXL 3EZ8A 2MKWA 3FT2A 4LCCA 3U30B 3VG0H 4F7EB 2P5WA 2A6KB 4PJGB 32C2B 1Q1JH 3LHPH 2C1PA 3RWIA 4UUJB 3MNVB 1ZTXH 5DHXB 4M9OA 3L3JB 1D6EB 3NMEA 3ARXA 4JPVL 4LSUH 1DBAH 5GJSL 5FOJA 5IB2B 4ZNCD 4Z7VA 1A3LL 2FATL 4P4RA 4I2XB 1OP3H 3L9RB 4Y19A 4PJ8C 1IC7H 4K3EL 5C0FB 1WK0A 3CU7A 5HXMA 1NGXB 5GHWL 3WDHA 4POYA 3MV7A 5J4MA 5EPMA 4KUZL 5EU6A 5MENB 3V4VL 3B2UD 4PUBH 2VLLB 4PG9B 3FQUA 4CUCA 4NBXB 2C3VB 1SJEA 1FFNB 5DRZA 4EI5D 1A9BA 5K9OB 3O11B 1UXWA 2G9HA 3OKKA 3SKNB 1FSKC 3MOQA 4QOKB 3QCVH 1GVIA 4DGVL 3TCLB 2DTSA 4E5XA 2VIRB 4GMSH 3D39E 2E6PA 3D3VE 2IADB 4WY7L 1HH9A 4DGYL 1LNUB 2ILLA 3HZYA 4QXTB 5DC4B 3LEXB 5B8CB 1E6OL 1WZLA 3SO5A 5HDOA 3QEGL 1A47A 5DJ6A 1FZKB 4S1DD 3OJVC 1OGAD 3LQMA 4FMKA 5KAQG 4GBXC 5I75C 4U0RB 4BM7A 2IEPA 4XH2A 2N7BA 1VGKA 1YEGH 2O5XH 2V2TA 4PJFF 5BCAA 4TSBL 3OAUH 4NKDA 4KPHH 5JPMB 4BA8A 5D7SH 3WFHA 1MCPL 1X5ZA 1KJ3L 1QFUH 3LKPB 5GISH 3QEQB 3UZEA 5IV2A 1IAIL 1HIML 5HTSA 3BIBX 2R1WB 4XVJL 2EDOA 4UT9L 3SCMC 1IBGL 1RZGB 4LQFH 1TJIL 2NZIA 4OCWL 1SY6A 5K9KA 2HT3D 5FA4A 4M61A 1OWRM 2ZUVA 2AK1L 3RVVD 5FM4A 4IOIA 4XP6L 4P5KB 5J56B 3MLZL 4JEGB 5KS9B 2YD9A 4NYLB 3ME0A 4AEFA 2FWOA 3TYFB 1ZVYA 2CMRH 1AI1L 5F7LB 1S7VB 2VDQL 2Q1EA 4Y88A 1KCKA 3MBEC 2NCMA 3OJDB 1INQB 4LU5L 3OKEA 1Z9OA 4PR5B 4K8RC 1FGVH 1ORSB 3VXNB 1KF9B 3IF1B 1H3UA 5F6IB 3MODL 4EUPA 4JFYB 1I1AA 1CGTA 1T5XB 3ARDD 4XBPA 4IMLB 4KTDL 2D3VA 5EIIA 3ULUC 2X4PA 4H1LB 3LCYA 1MCKA 2JB5L 1AHWA 3OF6D 1OAXL 5KG9A 4H25B 1FZMA 4PP1D 1NBYB 4PYHA 1I3RB 3VXOA 1DBML 3HC3L 5IVOA 5T5NG 4HGWB 3UEZA 1YNLL 3T3MF 3GM8A 1P1ZB 2A74A 4N9OB 2F74B 1HILB 3RL2A 5HYSG 2YD8A 4IHOA 1LO4H 3MC0A 4MXQD 1V8HA 4OLZL 4JQIH 5DFVD 4MMXC 3IDMB 4JJ5A 4HK3J 1UM5H 1NC4B 4RMRA 2Q76B 3D0LA 4MD5B 4PRAA 2EYRB 2VISB 5FM5O 2R2HA 4JN2B 4MNQA 4ONGL 3AMLA 4XCNA 5EC1B 4FQ2H 3S96A 4ZS6D 2DF3A 4WENB 3IDXL 1F4HA 4I3SH 4FNLH 1IGJA 1Y18B 5J9PA 2A0LC 4WU5A 1W0VB 4NQEE 5E6IC 5C0AD 3FB7A 1IFHH 3G5YA 3RUGB 1AO7D 5L2KB 3KG5A 1KG0A 1OF2A 1YY8B 3F7RA 2XFXA 5I1LB 1J8KA 5AWNL 4O58H 1J7VR 4K7FB 2JB6A 3QQ4B 4TNWF 2KL6A 3FFDA 4ZQKB 1VGEL 2P46B 2FYYA 2ESVA 3DV6A 4NN7C 1IQDB 2GITA 2IAMD 4H20L 2APVA 3NCJL 2XKNB 5DK2B 2BOBA 3LKNA 1WEJL 4GLRH 5D6CB 4ZTOL 1G6RA 3BQUD 4M62H 4WHDA 2OXGA 3BP5A 2MQ0A 2DQDL 5T1DL 1WICA 3GI9H 5C0CE 3RU8H 5ITBL 3TVMA 3T2PA 4ZPVA 2NXZB 1DFBH 3U0WH 2X1OA 3U0TA 4LOUD 5LGJA 3DRTA 1M6OB 1GSMA 2VDNH 3OKOA 3L5WB 3RNKA 3P73B 3BP4B 1ZK9A 4TSAH 1YEFL 5J3HC 5T1LA 3W0WB 1EHXA 2OTWB 2Z0BA 5HHNB 4FQLL 4RAVA 3KPSE 1G9MH 2AAVA 2BOCB 1AIFA 3TF7C 1F58L 5IIEA 1J1PL 2HJFA 2GJ6A 4YR6A 1YZZA 3GRWA 3HC4L 3O2WH 5SV3A 4YXKH 4NZDA 2QSCH 3VWKD 5HGDB 1T1XB 4UNUA 3V6FA 1HOCB 3GSXA 5SX5H 2FHBA 2YA1A 3VXME 4A2LA 4GG6B 4XC3L 1N59B 5D1QA 5ALCH 5D2NB 1QFHA 1JHTB 4P2OA 3F6IA 4HFWA 2X4RA 2QLVB 1QBLH 3FQTB 3KJ6L 2BSSB 1UZ8B 2DJUA 4QY8B 5C09E 3K1KC 1DANU 3UTPE 5B8CC 4OZIF 2IPUG 2XACC 4N5ED 2R0LH 2EH7L 3X3GL 4CJ1A 4QYOB 1T20B 1S5HA 4HC1L 5I2IA 4BSVA 3TP4A 3VRJA 3BEVA 4LHQB 1CLCA 4OF7A 1K5NA 2AJUH 1AKJA 1VERA 4U0RC 3SPVB 1CL7L 4MXWL 4DQOH 5DR5L 1OT1A 3U7WL 4JKMA 3RWEB 3TH3T 4HDIA 4XCEA 3RZCB 5B39A 5L7XL 3GSNA 4PGBA 3OV6A 3LV3B 3SDAA 5D1ZB 1U8KA 3EJYD 3DSFL 1SM3L 5DRXA 4YIQA 2YSSA 1IGCH 2DB8A 5JDJA 2DQJL 4XAKE 1WT5A 4FQIH 1LP9A 4L4VA 4FTVB 4M7JH 2XY2A 4HKZA 1CGWA 5FUZL 3VI4F 3UC0H 2GKIA 1TVBB 4OV5A 3Q48A 2EE2A 4WV1B 4JDZA 1FNLA 1WAAA 5T5FH 2RAMA 3ZKND 1KYOJ 5DVMA 4LSQH 1VFBA 5GRUL 1YMME 5INCA 2PUQT 2CJUL 2VO5A 5EUOA 4HG4J 1MCHA 1NCBH 3RWFA 2YRLA 3LN4B 3OR7A 4TTGA 5SV4A 1HQ4A 4YPGB 3TNMB 1FE8H 4UIMB 3QG7H 1KLGB 1BREA 4X80L 4DKDC 2V7NA 3R4DA 1SY6L 3FTGA 4APQA 2ZPKL 1KACB 3FRPA 4HD9A 1DLHB 4HUUB 1NCNA 3WHE1 5IB3A 3IFLL 5HI5D 1ONQA 2DI7A 4P3CL 5E5MB 2QHRH 5F70A 3PIQA 4G9FD 4XZUB 2NNAA 3TPKA 1QHPA 4J8RA 4TULL 3O3AB 3X12A 1AD9B 4B50A 4IMKC 43C9B 4NP4H 4LFHD 2A83B 2VLRE 3G5ZB 4Y1AD 3EJZD 4DN4L 5IR1B 5CSGA 1S3KL 1Q94A 3OX8B 4P4KD 2CO7B 2PTTB 4NWUH 4LPVA 3IJSA 4C59B 5MEQB 1WBXB 3FB6A 3RL1A 3MO1B 3RNQB 4PJHA 2QJDA 5TDOA 5GGVL 2J88L 2LTQB 4KV5E 2B5IB 2Y5TB 3T0EE 4JKKA 2EXYC 1VPOL 3IDNB 4J6RL 3QIWB 3VFOA 1MWAH 2H2PC 3CVIL 4Q2ZB 4ALAL 3I02B 1G7MB 4G5ZL 5T33L 3HMWL 3L3IB 1F45A 3O3BA 4X83A 4IS6A 3QUXB 4OIIL 3ULVC 1K3IA 2F8VA 1RZKC 4FQJH 5D5ME 4HX1A 2A9MH 4ZFGH 3HNTH 1IGIH 4ORGA 3HUJA 3V0WL 3LAFA 4LKXA 5DA0B 4P2QB 2A6DB 3QFJD 4BSWA 5IBTL 3QO1B 1H3GA 4I8DA 1Z3GH 3SDXA 3PL6C 1UWXK 3ZTJH 3CZJA 5EFIA 2CXKA 1CI5A 4L5FH 4OD2A 2NXZC 1TDQA 1HSAA 2FDBP 4Z7WA 1BVZA 4UOW0 3HLAB 5T1KB 2VLKA 3UTTD 1A0QL 1R3HB 3WLWC 2PW2B 1P5VA 1LEIA 4UT6L 3QJFB 4YHKL 2GW5A 4ZUSA 4FFYL 2HG5B 3GSRB 3VGEA 5EZIH 2AJVL 1MREL 5DMKB 2VKXA 1SMAA 2VZSA 1Z6JT 2ATPA 3FQWA 4LBEA 5F96L 1MELA 1MJJA 4P2YA 5D7KE 5IVZB 2DYPA 4K3HA 1PVHA 2XKSA 3THML 3LN5A 2EEBA 2WBJC 3IU3A 5D7JD 5FYKE 3UTSD 2AV7A 2XV6B 5KVFL 4AEEA 3QZWG 4LAQL 1R3IL 5GS1C 2VDOL 4RBPH 1SEBB 3FQNB 5E8DL 1IMHC 5C0RL 1HCFX 4AQ1B 4BH8A 3MV8B 5MEOB 4JR9H 2PW1B 3PG2A 3EYFA 5IG7B 5ILTH 5FUOH 2ZUWA 2HRPH 3BWAB 1EH9A 5CILH 3ZTNL 1OCWH 4MVBC 1CGSL 1DQLH 2OJZL 1YY9D 3IU4L 5EULV 3OR6A 5C86A 3GRWL 5D9SB 2NLJA 1U8PB 4JVWA 3WFCH 1HHGA 2CKNA 1ZS8A 1A6PA 2WSKA 1LE9B 1MVUA 1DSFH 1OPGH 1Q38A 2DM4A 4HMDA 2Q87A 3FOMA 3H42L 3RZCC 3WE6A 4PJ8A 1I75A 1QFWL 3QDMB 1PEZA 3AS2A 1UCBL 5FGSA 3T4AA 1N6QL 1P2CA 4UDUA 1RHHB 5TDPA 1CXKA 3LEYH 4PJBB 3RJDA 1DLFH 1BAFL 1MJUH 3IDJA 5HYJA 3RHWK 3MRFA 4JM2C 1TMCB 1CICB 4Y8AA 3NZ8B 1FO0B 3AM8C 4MZ3A 5H94B 5FYKU 2ADJB 2F53E 2IH1B 3KNBB 4KY1L 4WV1C 5E8OB 2NY6D 4LP5A 3SQBA 3JV6B 2CR6A 2DM3A 4AENB 3E8UL 1X4XA 5IWLC 1HZHH 1FJ1B 1A7NH 1F4XH 3PHQA 3GSNL 5CEXB 3U4BH 1CDBA 3HZKA 4QGTA 1U58B 3PQYA 1FZOB 4UQ3A 1C16B 4KQ3L 3G04A 4GBXA 1LO5A 5CJBA 4PJIB 4K7PL 2MWCA 3VGBA 2FX9H 4WI6A 3IKKA 3G9AB 4XP9L 1LEKA 5JQHC 5KZCD 1F00I 4OKVA 3QPQC 1KC5H 1K9TA 3RWCA 3SGEH 4LKCA 1PQZB 3SE8L 5IEKA 3WXWL 3SCMA 4XTRD 2BRQA 4X99A 5L6YL 4F8TA 5CIPA 3OXRA 2CIIA 2XT1B 3VFGH 1FNFA 1K85A 3QNYB 4P5TD 3NTCL 4OCSL 4PB0L 5L88H 3D2UA 3QWRA 5CBAA 5HY9A 3NGBB 4KDVA 3ILPA 1KBGL 5HVWA 4M6OH 3MBEA 12E8L 2E8YA 4XPHH 3NIDF 3TT3L 1HXYB 3QQ3A 3NZHL 4U6XB 3ARUA 5GIRA 2Z93B 2JK5B 3P0VL 1A6ZB 4FA8A 5FO7A 2B5IC 4JFOB 4EOWH 4JFDA 3GHBL 3SE3C 4R4BB 4WJ5A 1A6AA 1Q9LA 1S78D 1AR2A 3STZA 1OGAB 3QIWC 4NNXB 5C6WH 3G08B 4OCXL 3EOAB 1Q0XL 1XZ0B 1BFVH 1U93A 5DJ0A 1PDKA 5DLMH 3I2CL 2AJYL 1FL5A 2OJEB 3QUXC 2VE6A 2EDWA 3P30L 4BKLA 3S6CA 4LFHG 2VDLH 5ICXB 2YBRA 5A16B 1XR9A 2GSGB 1UT9A 3VI3F 3WIIH 4KXZI 4MX7B 2MCPL 3CFDA 2Y25A 2AV1A 5IK3A 1FRGL 4G42A 4QXUH 3LSOB 4R0LB 5C0NC 5D7IE 2QQKH 5DHVB 3P4LA 2N7AA 5D72L 1EEUA 3SY0B 1EFXD 3TJHD 5IB4B 5M95B 3L3DB 5GGSY 5F7KC 1ZLSH 4XC1H 4WWKC 5CGYC 1ZVHA 4V2BA 3BKYH 1IKFL 2YD7A 5E6IA 1V7ML 1LE5A 5DTFA 3OB0K 4TQEH 3QXUA 2Y07H 3SKJL 3ARDB 4LGRB 3PGDB 3ZDXE 3MRRB 3IDUA 5DYOA 1MFAL 3BESR 2XTJD 2V5SA 4LLDB 5LGHL 1L0YA 1MAKA 1J05B 1MEXL 1MY7A 1G9NC 4DOHB 2DICA 4HUXB 1IAIM 4RQQB 3TBWB 1ORQA 4MWFA 2DQHL 4RIRB 4MD4B 3PWVB 2J4WH 3ZZ1A 2EXWC 5F9AC 2A6KA 2YD4A 4G6ML 4Z7QF 4QTIH 32C2A 1EJOH 3HNVL 4L8DB 4K23L 4N8CH 4MAYB 3C09B 5E4EB 4OD3H 4DW2L 5I1CL 4ERSL 4G6KL 4R4FH 4W68A 1DBJH 4G80B 5EOQL 4XMLH 2CQVA 3TLRA 4X4ZA 2X4TA 3L3JA 4HH9B 2VR9A 3RWJB 4LSRL 4AL8L 3GSQB 4M4PA 1U8IB 1EO8H 4NQUA 5IB2A 1A4KB 4XRCB 2XQYG 4CU6A 3L9RA 1OTUC 1CFTB 1JNNL 5FGCE 1KEMH 4L3CB 4HXAL 5C0FA 3P4MB 1R0AH 1TITA 4GQ9H 1NGXA 1IM9D 5IB1A 1IAII 2OL3B 5C0AB 1FIGH 4X6DF 3WIFA 1JZ5A 3AC0A 3HMXH 5MENA 4QCIB 3CVHB 4HIXH 5EBMB 1AO7B 2E7BA 2VLLA 2VSCA 4PG9A 3DVGB 4KH2A 2EIZB 1DN2A 2C3VA 5JW3H 3O11A 3RBGA 5ACMA 3SKOB 3SKNA 4HPOL 5BV7H 3EOBB 1CICC 4U2ZA 1YEKH 2X89D 2R56H 3TCLA 4PRHD 2O5YL 4P46B 4GAYA 2IAMB 2BVUA 4ODXA 1LNUA 1TFHA 3PDOB 5DK0B 2XG5A 5J1AA 5B8CA 5I8KH 1U8MA 3BQUB 1BX2A 4M5YL 1A6VL 5IJKC 4WFEE 2DD8L 1FZKA 1AE6H 2P47B 1F4YL 1A7OL 4UTAL 1IEAB 3GSUA 3OAZH 3QB7C 3QJHB 5JHDD 3LKRB 1AGDA 1EEZB 3HG1E 2IGFH 35C8H 2W9DH 5C0IA 2EH8H 4Z18A 3BGMB 4JM4H 4K3JH 4Y4KD 5F89B 2R1WA 1MCNA 1UWEL 1RZGA 4UAOB 1TZHB 4HXBL 4U33A 3S97C 4R96B 4P2RA 3ZDZE 4DN3H 2Z92B 3B2UC 4NZUL 5HD8D 1HHIA 43CAA 2WQRA 1XF2A 3RI5F 1T4KB 3VWKB 4EI5C 4P5KA 5KS9A 4KRMB 5H35B 4YEFA 5J6GB 4M8QB 4JDVB 3TYFA 1P84K 2EDDA 1NCDH 2IH3A 5F3HB 4C56E 1S7VA 1BQLH 3NGBC 5LQBH 2E7HA 3IRZA 3QXDB 1CGXA 3RGHA 1FFPB 1FC2D 3OJDA 1INQA 3VG9C 4XP5L 4NNYA 4P49A 2EDTA 4X9HA 3N50A 4XCCH 4V2CB 1QD0A 3CXDL 3VXNA 2UWEB 4FXLA 4S1DC 4XVTL 5ELIA 4MNGB 5HHOD 2BNUA 3EDKA 4PJCA 1ZANH 1N6VA 4H1LA 4KHTL 1E4XL 2E9JA 5BVPL 5IMMA 5MEPB 4O02H 1X4ZA 3UMTA 3VRLE 5KVEL 4LF3B 1TETH 1QUNA 4QLRA 1W8OA 1FAIL 3W82A 3NVQA 1P1ZA 5E56A 1ED3B 2F74A 1HILA 4NHCH 2B1HH 3SE9L 4IMKA 1RFDL 2HT3C 1GC1H 3KLDA 3LRGA 3QDGD 3RVVC 4OSUH 2PYEE 3SDYL 1RZFH 4K8RL 1QZ1A 5JUEH 2R39A 1NC4A 5DJXB 3Q6GL 2Q76A 4MD5A 1NCAL 2XQBL 1KELL 4JN2A 3ULUL 4R0LC 3NCYP 3MLXH 4OUUB 4WIQA 1XGUB 5JHLH 3M07A 4TYUA 1GZPA 5CJ8A 1KPVB 3ZT5A 2XOTA 3MYZA 3I3EA 1W0VA 5DSCB 5SWQB 1HDMB 2RIKA 1JPTL 1T2XA 1INEL 3LPGA 1OW0C 3RUGA 2ZUQB 3TO4D 1KCLA 4OAWB 3MXVH 3L5HA 2F54E 1YY8A 3ARVA 5I1LA 3BI9X 3ARDC 2FJGB 4K7FA 3QQ4A 1JNLL 1E0OB 4NUGH 3T0BA 4PP1C 1IQDA 3ECBA 5EA0L 4Q0XH 3AS1A 1U8NB 3DX7B 2BHUA 1NCCH 1IAKB 1P6AB 1TIUA 2XKNA 2Z31D 5DK2A 1V3JA 4QHNB 5D6CA 5GGQH 4JCMA 4LARH 4LRIC 4OLYH 4MXQC 5DD5H 3PL6A 4NRZB 3WKNA 1VENA 5EWIL 5DFVC 5DJ8B 3DUUB 4A6YB 3C09C 5E4EC 1J88A 1CBVH 4I9WE 4G8EB 4P4KB 5D7LE 1KUMA 3O6LH 4UOJA 2YC1A 5C7XH 3L5WA 4CADB 1JHLH 2ITCB 3BP4A 5DD3L 1CL7I 4ZS6C 3KAAA 3W0WA 2OTWA 5GRWA 5HHNA 5IESL 4X6CA 2Z4QB 2B8OT 5DURD 4YXHH 2WLYA 4M1DL 1Y6MR 2NTFB 2B1AH 3H3BC 1DL7H 1IAMA 1UXSB 1T1XA 4PS4L 1HOCA 2WBJA 1RUKH 1RZIB 3K0WA 4QHLB 2VRAA 4GG6A 1ROWA 3K80A 3P9LB 5FUCE 2H2SD 3C5SB 3DPBA 1N59A 2X9WA 4YWGH 2NY2D 5GRJL 4HWEH 5GS1A 2BVTA 4K2UH 2XNAB 5LG1A 1LK3L 2BRRL 2V5YA 2IAMC 1E6JL 3FQTA 2BSSA 2FBJL 3F5WA 1UZ8A 2W9EL 3NFNA 5SX4H 3W39A 3OB8A 5IT2L 4ZNEE 1QVOB 5KANG 4LK4A 3BQUC 5ID1B 1F42A 2C3GA 4D9RE 4QYOA 4TUJB 4U6VL 4YHOL 4ONFL 3RWGB 3QHZL 5KTEL 3MLRH 3DUHA 4HEME 5FXCH 4FQCH 1Z2KA 4UIKH 3UTTB 4PGCB 4JG1H 4LOUC 4MJ4A 4YC2B 3T0XA 3RWEA 5DJAB 4YGVB 3CGTA 4H26B 1P7QD 3RZCA 3ZE0F 2BNRE 1J86A 3O6KH 2P24B 1FYTD 1MRCL 3EYUH 4KK5D 3V5KB 2YS4A 4TVPE 3B3IB 4UAOC 4NJ9L 4KK8D 4LLAA 1MOEA 4HIJB 4X0KB 1MNUH 1FORL 3V52L 1JPGB 5IROC 5HHXH 3RPIB 5F1IB 3VWKC 4DEPB 4LSPL 5IM7B 1P9MC 3FN0H 4JM2A 3PP3K 5D7JB 2XWJA 3UTSB 3BFOA 1ES0B 5KVGH 1TVBA 3ARBD 3AM8A 2ZG1A 3DYMA 4M03A 4YBLB 4WV1A 2EEDA 2WMPA 3EBAA 4JPIA 1FG2B 1ZVSB 1CXIA 2HT4D 2HFGH 5IWLA 1FH5L 2HFTA 1TJHL 3OKDB 3GMRA 4DVBA 1YPZE 4N5EC 2MCG1 4RMQA 3BT2L 4PJ5D 4YPGA 2H32B 2VXVL 3TNMA 4PLJD 4S1SH 1QBML 4TPRH 5E94B 4X6EA 3KJ4C 3QNZB 4UIMA 4XPGL 1B0GA 4LPXA 1KLGA 1CLOH 2I5YL 2UZIH 4WWID 1RQ5A 3GBNL 4TRPL 1C5DA 1DLHA 4HUUA 3EFFB 4WCYH 1X4YA 5E5MA 2W91A 5CP3A 2VSDA 5I1GH 3MFGB 5HI4D 3CK0L 3EJYC 1U95B 2JCCE 3EKCA 2AXHA 3O3AA 3CH1A 5FYKH 3GB7B 43C9A 1CDUA 1LDPL 3F62A 3MOAL 3G5ZA 1ZA3A 5F9OH 3BKML 1UCTA 5IR1A 2BJMH 2MPAH 3OX8A 5DEGB 3Q2CA 2VQUA 5MEQA 3V4PL 5CP7A 4B41A 4LSSL 3WUWB 5GGTA 1WBXA 3QG6B 2FEEL 3ZKNC 1WBZB 2NY6B 4UTBL 1NH6A 3U46B 3JTSB 4OUOA 1L0XA 4PJAE 4YX2L 2FX7H 1SBSH 3BISA 5IBUB 1FNSL 5BS0D 2DKMA 4EXKA 5B21A 3SE3A 3WD5L 3IDIB 1BLNB 4OCNC 2Y5TA 2CLRB 1U8LB 2ZUQC 4Z0BH 3IDNA 3QIWA 5EZOL 3DOSA 1MHEB 1OHQA 1Z5LA 4OZHE 1DBBL 1G7MA 3I02A 3U7YH 1ZGLB 3MCLH 2F5AH 3T3PF 4WUUE 1YEDB 2HKHH 3H9HB 1SBBA 1BJMA 3FCTB 3L3IA 2VL4A 4WTWA 2NY3D 3QUXA 1PZ5B 4Q6YA 5B3JF 5TDNB 4MA3B 4M6ML 2D31B 1DUYB 1QFWM 4OFVA 4AYFA 2J8OA 5T3ZE 1MCDA 1MCCA 2H1PL 3HNSH 4G3YL 3X13B 4P2QA 2A6DA 1UZ6E 3QO1A 1JN6A 3L5XH 3HR5A 1QSEE 2AEQH 3ISWA 4JFEA 1HQRA 5HYQB 1NAMH 4KVNL 3EJZC 4QXGH 3H9SD 5HYSA 4JY5L 4P4KC 1N5YL 3BDYL 3OGCB 5T1KA 1SJHB 1MQKH 4NC2B 2PW2A 2DWEA 4JZJB 4MD0B 3ZHLA 1CYGA 1HKFA 1QG3A 3OKYA 1KIQB 2Q3ZA 2X4QB 2YPLB 4ODTH 4MQSB 4WWKA 2HG5A 3GSRA 3ULVL 1RZKL 5DMKA 3AY4C 5EG6C 2KUTA 4J3VA 4X98B 5ESAA 3MRNA 3AGVA 3N1MC 1QFWI 1YNKH 4MJ6B 1PG7L 5IVZA 1XAUA 3MOBH 4UV7L 1R24B 3TIDA 3WXVH 5IMOB 3QDJD 1JWMB 3QO0B 4PJEF 4NO0A 4RX4A 4PJ7F 2GIYA 5E2WL 3ARQA 3QQNA 4NQCA 1KB5H 4Q9RH 1SEBA 1ZT4B 2WANA 4XVSH 4IDLA 2VDKL 5MEOA 1XF1A 4M00A 4JG0H 3CZFB 3VFRB 1RSFA 5IG7A 3I6GA 3CPLA 2H26A 3TIEB 4GKZB 3O0RL 5CMAB 4QRRD 4N0UE 4ZOCA 3X11A 4HKJB 1KTDB 1T21B 4XX1G 3K4DA 4J7RA 4YE4H 1U8PA 4U1GB 1KT2B 5HGAB 1QSFB 5LWYH 1FPTL 3EO0B 5EU7C 5GGSB 3EIFA 1ZSDB 1LE9A 2VKWA 4H88H 5AZ2H 1EFXB 4HWZB 4KI5D 2B0SL 1FG9C 2P5WE 1YEEH 3TV3H 3QDMA 4LPCA 2XN9D 3UJJH 2HN7B 3MNZA 4XT1C 5DZNA 4JHAL 4RGMC 1GGIH 3S5LG 3NPSC 3T0DA 1RHHA 4KI5F 1DUZA 4I0CC 1NUDA 1NFDF 2NY0D 4K9EH 4JRYD 4DEPC 3MRBB 5D7JC 4LCUB 4YDKL 1CICA 4Z7VE 2AJXH 1FO0A 1PKQA 4YBLC 5C07E 3SDDD 2ADJA 3KNBA 4HJJL 2Q20A 5KSBE 3HHRB 1XGPA 5E8OA 5KVMC 3JV6A 3MV7E 4AENA 3RGVB 2HH0L 3FMGH 3MRKA 1FJ1A 5DD1H 2IPKA 2PYFB 5IJKA 3P0YH 1I8LC 1N26A 4IJ3B 2A77H 5F44A 1U58A 1C16A 3P40A 1YY9C 2G2RA 3O4OB 3MJ6A 2GT9A 1W0YT 2OI9B 3WL9B 4DFIA 4F3FB 4Z7UB 4PJIA 3RX7A 4I0KA 2AABH 3FFCE 2DQFB 2YEZB 4M5ZH 4X6DB 5JW4R 1YEJL 5TF1L 1MCBA 4KRPD 3GMLB 4XGZB 1PQZA 4OZGB 1MQ8A 3JBG7 3VD4A 1EA9C 1IM9B 5JLZA 4HQQL 3JTTA 4NCC2 4GKSB 4EI5A 3QAZC 4G8GD 1HHKB 3QNYA 4QRSB 2E27H 3DVNA 1GHFL 4FP8H 4YHYB 3F6LA 4HW6A 4OLWL 1NUFA 1JP5A 1EHLL 1X9QA 5F9JB 2NY6C 3D39D 3D3VD 1N2RB 5EOTB 4HH8A 4KGLA 2JELH 5CINH 2W65B 4U6XA 4O2CB 1A6ZA 5FCUL 4AIXA 4PJFA 3I3BA 3E3QC 4OLXL 1BBDH 4MYWB 5HHQA 4R4BA 4ZUWB 3WKMH 6FABL 1OGAA 1NDMB 4ZFFB 3G08A 3V6OC 3CDYA 4XB7A 2YA2A 3RVUC 5JHDB 4OD1L 1XZ0A 3I84A 1LD9A 5C0DA 1MFBL 1C5BL 1PG7X 3V4UL 2OJEA 3MNWB 4WFGE 4XWOD 5GGTL 1UWXH 1N4XL 1UH2A 1EERB 1A6TB 4DJMA 2EICA 5ICXA 3C08H 1I9JL 1KOAA 2BVPA 1H15A 4WDIA 4XTRC 4AEIL 5JORB 1EK3A 1RUMH 3R0MA 2D4FA 2GSGA 5LXGH 1CXLA 3EOTH 1AXSB 2LU3A 3BP6B 1WVZA 1AQDA 2G5BB 4MX7A 4JQVC 4V1DD 5DQJB 2PTVA 4RAUA 1YC7A 3ZTJG 4P5TC 2IANE 3MJ9H 1CD1B 4R0LA 1JHKL 4JZJC 3SY0A 5IB4A 1SYSB 4ODHH 1OAYL 5FFLA 1VEPA 4NM4L 4CVZB 2X05A 3VGGA 3FQXB 4JKPH 2H8PB 4UV4H 1QA9A 1OW0A 1Z9LA 1S78C 3BH8B 5I1IL 3HZMB 3ARDA 3MRRA 3GBMH 1BM3H 4ODWB 3TZVB 3UZQA 5L8LB 3DV4A 3OF6A 3ARED 5CSZB 1IGTA 1J05A 3GMQB 4Q6IB 1I3UA 3DBXB 4DTGL 2XPGB 4IRJD 3GJEB 1MHCA 4HUXA 3WNNA 5GS0L 2FBOJ 4NZRH 3TBWA 4WEBL 4UQ2A 4X8XA 1NMCB 1F6AB 4RIRA 2BP3A 4MD4A 1HHJA 4LRIA 4OLVL 2R1YB 4U1NB 5FYLE 5ALBL 4L4JA 4H0GA 3O6FD 4ZUUB 3QDGB 5GS2H 3J7HA 4D0BA 3MRJA 4U1GC 1JFQL 3MREA 1OAUH 2L4OA 4WI4A 4PTTB 3LD8C 1K3ZA 3GSVA 1A1NB 3JWOH 1GRWA 2E9IA 2R0WH 3NAAH 5CKGA 3TJHC 4OF5A 2X9YA 1MRFL 1OAKH 1A4KA 4XRCA 3D6GA 4ODBD 1G9NL 2PR4L 1CFTA 1KPUA 1MIEH 2UVEA 2AK4E 2XIDA 4BZ1H 2APTA 5J7CC 3R06B 4U7MA 3T0AA 2A6IB 2OL3A 4I3RH 3NA4A 5C0AA 2C1OB 3VRIB 3QPXH 4QCIA 4IDJH 2OYPA 5DHYB 1AO7A 3TO4B 2VLJB 2K9UA 2EIZA 1ITBB 2QR0B 2LU4A 5AG8A 4XMPH 3SKOA 1ZWIA 3HC0B 3RFZC 4OZFH 3VXSE 2XTJC 3EOBA 2M1KA 2P1YA 4AG4L 2XZAL 1KCRL 4EDWL 1RUPH 2IAMA 3MLWH 4JRXB 2GJ6E 1RK1B 4XHJD 2Z31B 3QZWA 1GZQB 2EECA 5DD0L 3BQUA 3IETB 3H7BB 3IVKB 3CUPB 4JGMA 4M7LL 1X5GA 5HSFA 3RVTD 5C0CD 5C0EB 1XF4A 3M1BB 1IEAA 3UDWC 2X41A 2OI9C 1VFMA 5I1HL 3ZKMD 3LKRA 3UO1L 1MAML 3HR6A 4JO3H 1JPFA 3BGMA 1E4XI 4WVRA 5DURB 25C8L 3IXTA 4CN4A 1H0DB 4BUGA 4NT6B 1Q72L 4FQ1L 3KPSD 5F9WC 1FP5A 4RWHA 1BQHB 3JXAA 1KLUB 4NHUB 1S9WB 4HT1L 5IROA 3AB0B 3FHAA 4X6BB 4UB0L 1P4LB 1P9MA 3KPQB 3S5LB 4M8QA 4K3DL 5CLWA 3VFMA 4OZIA 1G7PB 2NY2B 3N9GH 5F3HA 4DAGH 3MR9B 4MSWB 3QUYD 3QXDA 4JZOA 1WSST 4L8SB 2P49B 2VDMH 3BSZH 4F7TB 4HULB 1ADQL 2E7CA 1RIUL 4MNGA 4DK3A 4LSVL 1HKLL 1WAAE 1V5JA 1DR9A 2J8HA 2RQ8A 4RGOH 2VQ1B 3MZTA 3KYOB 1G7LB 1WFNA 5EUOE 1GOFA 5MI0C 4AIZA 4WFFD 5MEPA 5AZEL 4LF3A 5ISZD 3B9AA 1B6DA 4Y4KC 4YHLH 4N8VG 3PWUB 1FYTB 2DMCA 5H37G 3GSWB 1DEEB 1B4JL 4OGXH 3TBTA 2IMNA 1QLFB 5HD8C 1DE4B 4U1HB 1F4AA 2ZKHH 4FZ8H 3KPTA 1D5XA 4Z0XA 5DJYA 4BQCA 1JGUH 3ARBB 1DQML 3U82B 3H0TB 2DQIH 1ERNA 5TQ0L 4GSDL 1XGUA 4HK0B 1KIRA 1H9VA 3FB5A 5A43C 4XWGH 1KPVA 4E0RA 3HPLB 3OB0H 3H3KA 1YMMD 3NFSL 2YK1L 3V5HB 3JWDH 2R0KH 2IMMA 2ARWA 5DSCA 5SWQA 1HDMA 5GHWH 1CE6B 3L7FB 3LQAH 4OAWA 1CF8H 1IEBB 4S11A 4NFCA 4PRIE 2FJGA 1KENL 3SOBL 2AS5M 4PPTA 3DXAE 4U7KA 1NUGA 4LEXL 4TVPH 5FYJU 4HFUH 1CFSB 2PXYB 1U8NA 4XAWH 1MWAB 4QTHA 4G9FA 3BGFC 4QHNA 1NMCC 1S5IL 1UB5B 1C1EH 4NWTL 3AXLA 3A6CL 3DJ9A 4NRZA 2WP3O 3QEGH 4Y1AA 5DJ8A 2XRAH 4A6YA 1N5AA 2L7UA 3MRGB 1M7IB 1A3QA 4CADA 4Y16D 3U83A 2ITCA 3HUJE 4LNVA 3GGWA 2CUIA 4RISL 2Z4QA 2A38A 1M7XA 4YAQB 3WDJA 3AY4A 2NTFA 1A7PL 1KCSL 1YYML 4M93B 3SGJC 1MI5E 1D5BB 1X3DA 5T1LD 4Z77A 3Q0HA 3TO4C 2D2OA 1UXSA 4LLYA 1SMOA 2R23B 5F1SA 2HTLD 1RZIA 4QHLA 1BWMA 4NRYB 5JNYB 5ICZB 5MP6L 3C5SA 2DLTA 2BK8A 4KV5F 1TCMA 3P11H 4P9HL 3OHXA 2XNAA 1I9IH 4H0IA 5I1DB 2GJZB 4OM1L 4KZEL 5EBWA 2VDRL 4LDLB 3SKMB 5ITFB 5JOFB 2W9LA 3MLTB 3MRPB 1QVOA 4B7IA 3IB4A 2Z31C 4MA1B 4HMEA 3W9DA 1EGJH 3S34H 2BNQE 1MJ8H 3QFJA 1NGQL 2OZ4H 3LIZL 3MBXH 4TUJA 1ND0B 2ICEA 2OL3L 3SBWC 3ULSB 3RWGA 2VR5A 3UTQA 3H9SB 4JJHA 5D5MF 4Z78B 4K94H 1G7QA 2EDNA 3UTTA 1NKOA 4PGCA 5ENWB 1YN7B 2A73B 4HPYL 4YGVA 4H26A 3FT3A 4NZTH 3VXPB 3MLUL 4LLVB 2P24A 1OOAA 1A64A 2X4OB 1B0WA 4X5WB 5KVDH 4PJEB 3B3IA 1KGCE 4PJ7B 1T22B 4HIJA 2VXTH 2OP4L 1T83A 2BXYA 2VL5A 3AB0C 5DUML 3RPIA 1BD2E 1B2WL 4O51A 1KULA 5IHZB 2V2WB 5IM7A 3QDJB 4YFEA 3UTSA 2K1MA 2H2SC 1ES0A 3EAKA 4ODVH 5T3ZH 2NY2C 1CLYH 5C2BL 3MCG1 4YO0B 2HFEA 5I30L 1FG2A 1X5LA 3FB8A 4O2FB 2DBLH 3WHXB 3AS3A 5ANME 3OKDA 4LAJH 3MA9L 4GMTL 3U4AA 2FEEI 4L8SC 2H32A 1I8LA 2AJSL 3TCXA 3MFFB 1XR8B 1JJUA 5E94A 4QRRB 3QNZA 5HVHB 3X3FL 1RI8A 1GGBH 1AY1H 4HWUA 1WISA 2HVJB 3VH8B 1I9RL 3KPPA 4Z95H 3LQZA 1Q9WB 3TJEH 4NKMA 4JFZH 4PRNB 5CZKA 5I1EL 3EFFA 1NANI 4QNPF 3L3HB 5C6TH 5J6HA 2XN9B 3PQYE 1U95A 4KK5C 2MOVA 4WGWB 5D1XD 5FV1L 2NY7L 4KK8C 4J3TA 4X5XB 5ADPL 3LN9A 4EI6A 2X7LB 2NY0B 1TNMA 4X9BA 4I5BB 4JRYB 3BUYB 3W5NA 1CE1L 5IHLB 3ZYOA 5DEGA 3ZDYE 5IHUL 3WFZA 3ARBC 1KCUL 1HEZB 1JNHB 4HUVB 4IRZH 1FCCA 5CJOH 2F53D 4RWYH 4KDTC 2HT4C 3JTSA 2N1KA 3TT1L 2BFVH 4KJWD 4HUWB 3VFNA 1YJDL 3WEXA 5HJ3A 2A2QT 1DQDH 2CLRA 4PLJC 1X7QB 1JNJA 1RUAL 1BZ7B 1A2YB 3V6OA 3EO1B 4ZOBA 4M3KB 1MHEA 5DJCA 5E1AB 3UYRL 3EYQD 3PABB 1JBJA 4JFFE 1T03L 3NCEB 1IGFH 4WI2A 1X5JA 4B5EA 1FL3B 1KTKE 1PZ5A 4KRPB 4X7EC 5TDNA 4MA3A 4OB5L 2D31A 3DVFA 2HJLA 3HAEB 5HI4C 4EN3D 4LLMB 3O2VL 4BQBA 1VSCA 4U3CA 1VFAB 4NBYB 1F97A 1WC7B 4N8VB 5HYQA 3LZFL 3LS5L 4U2YA 5KSAD 4JQVA 5JW4N 4F33B 1U3HB 4G8GB 5JR1L 4P5TA 2FHCA 5E8PB 3GJFA 5TGBB 3I9GH 4E42A 1JI1A 1MLBB 2WIIA 4JZJA 1B90A 5C0BD 1FGNH 1KIQA 3TN0A 3MRLB 2X4QA 4LVNB 1MCOL 3D3VB 1CDJA 2PO6B 3VGFA 1AQKL 4KKAD 4JPKH 4N1HB 3AS0A 4M93C 5TE6L 1CLZL 4H8WH 5DD6A 1AJ7L 4MJ6A 3MA7A 1NMBL 1GOGA 1C5CL 4K3GA 2ZJSH 4Z76A 5HDLA 4MJ5B 1R24A 3QUKB 1IT9L 4WEMB 1H8OA 3QO0A 5F71A 2VZ1A 4A6YL 2R29H 1CFVL 5HHMB 3CMOL 4Z7NE 1ZT4A 4R90L 3RDTB 2NY3C 4MAUL 4DKEL 3KLAB 4PJ9B 1AGEB 2FX8H 3CJJA 4AH2B 3VFRA 4OQTH 2I9TB 2GFBB 1KCVH 1AXTH 3TIEA 4GKZA 3IAPA 1A9EB 4V1DB 4HKJA 4LASL 1KTDA 4OCYH 5LJYH 2H6PA 2DQGH 5I16B 4XNUH 1KT2A 1MIMH 4L4TB 3G5VB 5CJQL 2CDEA 2C7UA 1T2JA 3EO0A 5GGSA 1VEMA 1ZSDA 1EFXA 2QKIB 1FLRH 3BKJL 3IS1X 2Y72A 4HWZA 5FHBL 5D4QA 4PJGE 1EV2E 3CFCH 5FDYA 3A67L 2L0DA 1KB9K 4LCWD 1D5IL 2HN7A 5C08D 3OL2A 3RY4A 5D71L 3PP3H 4U1MB 4NUJB 4FQHB 5D7IF 3K2UH 5AYUH 1T3FB 1KN2H 4CGTA 2YD1A 4HKBB 4JHWL 5I15H 3DIFB 4YXLL 4Y5XB 4GO6B 4I2XE 4KKLC 2V9QA 3A6BH 4EUPH 5CD3B 4P0DA 3SJVD 1K6QH 4CVXB 4IRJB 3R8BB 5TPWH 4X7DC 3IXAB 4TNVK 3QXAB 1F4WH 1ZLWK 1QOKA 3ZDXF 4X7TA 4QF1B 4JVUA 3B9VA 2B20A 4MQ7B 3O6FB 4QOKE 3GK8L 4Z8FL 1BQSA 1R3KB 1T0NB 3D69B 3UDWA 3RWDA 3QRGH 3KYKL 4Z7UA 1QR4A 3A6OA 3WS3B 3I85A 2YEZA 4XBEL 5DGRA 2IWGA 4X6DA 4IIQC 2C1PB 4KI5C 1OSPH 2OK0L 4GUPA 5CFHA 1RULL 3GMLA 1EEQA 4HK3N 2C26A 5D70L 1IM9A 4LP4A 5LCVL 3ZL4H 3MACL 3MZGB 4GKSA 3BAEL 4P4RB 4Y19B 2NY0C 2EC8A 1QHOA 3F12B 3IFNL 4AEHL 3X17A 4CMHB 4WW2F 3G6DL 3QEQE 2X89A 4JFPA 2P8PB 3SDDC 5EPMB 5EU6B 4TSCH 4PRHA 5I8OL 1G7JB 5F9JA 5FYLH 1SJEB 2R69H 3ARSA 1A9BB 3LRHA 5GGRY 2G9HB 1N2RA 2VNCA 4NN5B 5EOTA 2W65A 4O2CA 1MLCA 2C5DC 3NBNA 1ZT1B 5K9JL 5TE7L 4R7DB 1DN0B 1HH9B 1U3YA 3Q5YA 4ZUWA 3U1SH 3O45A 1G6RH 2Y06L 1NDMA 5C0CB 2EDFA 3RWHA 1SQ2N 1BOYA 2FL5B 5JHDA 2MFNA 4ZS7H 1BFSA 1MAJA 3BIKA 4MA8H 3MNWA 2EE6A 4Y4KA 1KIUA 4KRPC 2DMKA 2H9GB 1VGKB 4DCQA 4YPJA 2V2TB 1A6TA 4LMQI 4J23A 5HBBA 5C6PB 1A7QL 3KPSB 4NKDB 3C2SA 3EGSB 1O7VA 5D96B 2YMXH 3MXWH 4RMSA 2F58H 3BP6A 4G7YH 2G5BA 5DQJA 4D3CH 3DO3A 1LMKA 3PGFH 1DBKH 5DT1L 5FHAH 3ARGD 5JIHA 1PGRB 4OQ1A 1NEZG 1VB9A 4C56D 1L7IL 1SYSA 3ZDZF 2A9NH 3QUYB 1UKSA 4LVNC 1BZ9B 1LEGB 1Z0MA 3RP1A 4CVZA 1OD9A 1MF2L 3VGAB 4EDXA 1CU4H 2X6MA 3FQXA 4GXUN 3EJJX 3U9UB 2H8PA 1F3DJ 4PBWD 3MTRA 4XPAH 4YHMH 2BVYA 4Z7OE 1UM4L 3S3SA 4JDTL 4GAJL 2CO6B 3MUGB 3BH8A 1QQDB 5HHOA 1RUQL 3QCUL 2EIBA 3HZMA 4OF3A 4OGAD 1Z0NA 5M7QA 2NY4D 2O5ZL 4KHXH 4ODWA 3DYOA 5JMRA 5FKPB 1KTRL 3P77B 1CVSC 3V79C 1D7FA 1NLBH 2HKFH 4ZDHB 5D6DC 3BD5A 3GJEA 3HRPA 5ISZB 1YQVH 4KY1H 1I1AB 4ONOA 4XBPB 4YHZL 3O6ML 4XWOC 2X4PB 1F6AA 3RHWF 3RUGE 4AK1A 5L2KE 4DGIL 1FZMB 3PV7A 5F7MC 4N8PA 3VXOB 3QDGA 3VRLF 3BDXA 4JO4H 1OVZA 4L1HA 2A74B 2DDQL 4ZSOB 2PYED 3ALWA 1Q0YH 2AJZA 4IHOB 1P7HL 2VLME 3PGCB 5JQ6L 4PTTA 4A2MA 4MGXA 3D0LB 4UILH 5FB8A 1YMMB 3R06A 4MNQB 2A6IA 4NFBA 3SGJA 5IVXB 3VRIA 5FYJH 3RA7H 2ZCLH 3TO4A 5IW1A 1JGLH 2JKXA 3W2DH 4ZFOA 1DQQB 4HBQA 1MRDL 3HC0A 4GJTB 3W0WE 4F58H 1BHGA 3OZ9H 2LVEA 2B4CH 3G5YB 3AREC 4I18C 2KZWA 5CCKH 4IRJC 1OF2B 2RGSA 2AQ3A 4JCLA 5BQ7B 1EEYB 1RK1A 1Q1JL 1GZQA 3L95A 3IVKA 3LHPL 1AFVH 5BV7C 3CUPA 1NGPH 4LHUD 4BFGA 2ESVB 3DV6B 2GITB 2P48B 4GG6E 1ZTXL 3O6FC 3VD3A 3HB3D 4JY4B 3SBWA 5D2NE 2BOBB 4MNHA 5C0EA 4LSUL 1DBAL 4NKIH 1G7HB 1H3PH 1N3NB 4I9WD 3MUY1 4YBQD 5BO1H 3ARTA 1IC7L 3PWJB 5HHPB 4Y16B 3DUSB 4OJFH 1GAFH 1Q0XH 5ESQA 3TVMB 4ZPVB 3FAXA 3WBDA 1EUUA 4PUBL 3WFDH 1CK0H 1H0DA 1C08B 4NT6A 5LGJB 2ADFH 4RMWA 3CD4A 4RFEB 3RNKB 1S9VB 4W6YB 1I1YB 1FN4A 3QCVL 5T1LB 4G7VH 4X6BA 1JGVH 3KDMA 3QHFH 1VFUA 2ICCA 4GMSL 2GUOA 3S5LA 5IIEB 2HJFB 1G7PA 4OTXH 1KPRA 1RJYB 1K8IB 3DETD 5BW7C 1JGEA 1Z9MA 3MR9A 1QACA 4MSWA 1JPST 3V6FB 2FH8A 3GSXB 4WHCA 4NN5C 1RV6X 4XHJC 4AMKH 5TQ2H 4PRDB 4L8SA 5D1QB 2AXGB 3CX5J 4P2OB 4FTVE 2O5XL 1YEGL 4HF5H 4NJAH 3OAUL 5IEHA 3RVTC 4KPHL 1VADB 5E00B 5C92A 1NCTA 5D7SL 2OXHA 1QFUL 4NZJA 5GISL 2VQ1A 3KYOA 3ZKMC 1S5HB 2FJFB 2J8UF 4NM8H 4LQFL 1P7QA 4RA3A 1AKJB 1HI6B 3PWUA 1FYTA 5F88B 2BNRD 5C0GB 3AU1B 1BMGA 3VA2C 1NCWH 3F8UB 4HDIB 2CMRL 5B39B 2VB5A 4U1HA 3GSNB 4PGBB 3ZHKA 2ID5A 4PB9H 2D9CA 3ARBA 1YECH 3UYOD 3H0TA 3WO4B 4ZUTA 2OMBA 4HK0A 1LP9B 4AT6B 4L4VB 1WZ1H 7FABH 3MV9E 5DZLA 3QUYC 4KDTA 1PG7W 2ZWLT 1FGVL 4WU7A 3HPLA 3VGAC 1CFNA 2I9LB 1A6UH 4OV5B 4LHJB 4PJ5A 4JDZB 4WO4D 1T7WA 4PFEA 3FO9A 1L6ZA 1QPPA 1CE6A 1VFBB 2WK2A 3L7FA 5INCB 1IEBA 5FF6A 1RZ8B 2DQCH 2AGJH 3RWFB 1HQ4B 1O5DT 1YPZF 5GXBB 1UG9A 3L1OH 3OKLA 2V7NB 1LO4L 4BFIA 4B53A 4OLUH 1MWAA 4JQIL 3R1GH 5CEZE 5CLTA 1UB5A 1X5AA 1UM5L 3L3OA 5F72S 5D1XB 1CG9B 3MX0A 5E8EB 1ONQB 3DRQB 5JO5A 2E9WA 4DKAA 2ENSA 1UC6A 4FQ2L 3PIQB 2NNAB 4WI7A 2Y23A 5E2TL 4J8RB 2P5EA 4I3SL 3X12B 4FNLL 1M7IA 2P43B 2JCCF 1VA9A 2X5PA 1JF5A 2F53B 1AH1A 4P2QE 3GO1H 1IFHL 2EDKA 4YAQA 5GRVK 4KJYB 2BCKB 5BS0A 4E41D 2EYSB 4O58L 5E70A 2CRMA 4LDOB 1D5BA 4O00A 5L8KB 4G6FD 2VWEC 2XA8H 4PJHB 2ADIB 2R23A 5TDOB 2NY1D 4FFZH 5JNYA 2XZCH 5IP4A 1MPAH 4M62L 2E3VA 5E08H 1OLLA 4WUUD 3OJ2C 5J12C 4DFHA 5ITFA 5JOFA 3GI9L 3RU8L 3MLTA 3MRPA 4HJ0D 4M3JA 1PX3A 4EN3B 3ORJA 4OZHF 4AM0B 3GIZH 1DFBL 3U0WL 5T3ZD 4FQXD 1IZKA 4M02A 1Z9SA 5KSAB 1GH7A 2VDNL 4PRPE 2XA3A 3WS6A 4PJXB 4HX1B 3H9SA 4TSAL 4Z78A 4Y2DD 4LKXB 3NABH 1EXUB 4NQDD 1JZ8A 5ENWA 4ZFOL 3MV8E 1G9ML 3SDXB 3L5JA 2A73A 3M45A 1UZ6F 1QNZH 5EFIB 4Y16C 5T3XD 2X4SA 4IBLT 5C0BB 1A4JA 4OD2B 3VXPA 4LLVA 1BJ1J 3RTQD 3O2WL 1JZ3A 4YXKL 4HS6B 2X4OA 2VLKB 4Z5RB 2QSCL 4X5WA 3VXRD 4FS0A 4PJEA 4F37K 4HLZH 3WIHH 4PJ7A 5LAXA 1P53A 3MRQA 1T22A 1LEIB 3DYPA 5ALCL 5A2KH 1EDQA 4DZBA 3Q1SH 1K2DA 3T0EC 1OARH 5IHZA 1EX0A 5DS8A 5D2LE 1QBLL 1BECA 2HWZH 5IQ7H 1WCBB 4JO1H 1J0IA 3FQWB 4LBEB 1MJJB 3QDME 2AI0H 4YO0A 2BHZA 4LHUG 2R0LL 5D8JL 4EIGB 3NCCB 4O2FA 3LN5B 2C4XA 3I6LE 3MQIA 4LIQE 2AV7B 4PJBE 3S35H 4JFQB 2AJUL 1EJ6A 1I3VA 1XR8A 2RR3A 4DQOL 4QRRA 2X09A 4BH8B 6CGTA 5ID0A 3MV01 1INEH 1CWVA 3EYFB 1TTUA 3HI5H 3HE7D 1Q9WA 3KLHD 4PRNA 4IIQA 1GGUA 5D7IB 1IGCL 4X7CC 2RCSH 3E2HC 4CMMA 1NFDA 1FFRA 2EDJA 4FQIL 2XN9A 4LCWB 3QEHB 5C08B 1MFDH 3ESVF 4M7JL 1FBIH 1MVUB 5B38G 4HAGA 2FJHB 3QCTH 3BE1H 1Q9KB 4I77H 4X5XA 3UC0L 4PJIE 2X7LA 1QLEH 4PJ8B 4JRYA 5T5FL 3D25A 4WNQB 3UP1A 4WTZG 3SDDA 1P2CB 4UDUB 2O61B 5TDPB 1HEZA 3ARZA 3WO4C 1JNHA 1NCBL 3SJVB 5C07D 5I66A 5HYJB 4ISVA 5FOBB 1MJ7H 1FE8L 3GSOA 3KWWA 4X7SH 2Z8SA 1II4E 3QG7L 5F7UA 4MJIE 4QHUB 1I7RB 5CUSH 4WI8A 1X7QA 5KSBF 4JREB 1RZJH 4CN1A 2Z8RA 2CDFB 5E7FA 3B8SA 3PABA 2QHRL 4KU1A 1MCWW 4J3SA 1FL3A 4NCC1 3FFCD 4W81A 4GBXB 1LK3H 4YK4B 4NP4L 1ZEAH 1U92A 5C3TA 4LLMA 4N90D 1T89C 5FGCB 1OGAE 4WW2B 1LEKB 1QO3A 5TFSH 2OR9H 5D1XC 1WC7A 4NWUL 4N8VA 1LO3H 4ONHB 7CGTA 2RHEA 3RWCB 3E6FA 4LGSB 4F33A 4G8GA 4LKCB 5E8PA 4GW5A 2ZCHH 1A6WH 5TGBA 2HRLA 1HCVA 1MLBA 3FN3A 5GGRB 5K9QI 4HIEB 5ETUB 2AJ3B 4EXPX 5CIPB 3HFMH 2EEAA 3MRLA 1YEIH 3D39A 4GKNA 3D3VA 3GUTB 1U41A 4KJWC 5BMFH 4J4PD 5HY9B 5F8QC 1MWAL 5GS0D 1RURH 3PNWA 3ILPB 2ED9A 1MCQA 1RD6A 1TZGH 4Q74A 3QQ3B 4MJ5A 4NN6C 3TH2T 3QUKA 5GIRB 1FFOA 5I9QB 2Z91A 2FIKA 4CDGC 4PJDB 3EYQC 4FQJL 4JFDB 4GOSA 2NZ9D 1IC4H 2A9ML 4ZFGL 3HNTL 1IGIL 1WTGT 5D6DA 1Q9LB 2I25N 4XNXL 4NQVB 1KJ2H 1Z3GL 3KHOA 5EOCH 1MFCH 1S9KC 3TNNB 4WFGD 4EN3C 2I9TA 4D8PB 4GH7B 4L5FL 1U93B 2VH5H 3D18B 4OM0H 3T0VA 3T8XB 3DGGB 4Z6AT 4KQ4H 3RY6C 3T3ME 2JF1A 1I7TA 1CGYA 5KSAC 4V1DA 3W11D 2BSTB 1N0XH 3FO0L 3RKPA 1TENA 2A1WH 2Q7YA 1R5WA 1TQBB 5I16A 1KYOK 2JIXD 4NO5A 4CJ0A 4DOHE 3G5VA 4HG4K 2IAND 5EZIL 4TRPH 3CAFA 1JZ2A 1J1OH 1UA6H 5HGHB 2AV1B 4R7NB 4BSJA 5IK3B 4HGKC 4KKAC 3V95A 4U1MA 5IVNA 4FQHA 4LSTH 3BH9A 2XXCB 4QKXB 2QQLH 3HKFA 1T3FA 2V2XB 2WUBH 1ZXQA 2J5LB 2NY4B 4HKBA 4YGAB 2GEEA 3UXFA 5E6IB 2GK0B 4LEOA 3AREA 4I18A 3WSQH 4JR9L 3IAGC 4U1LB 3HMXA 4LVOB 5ILTL 5CD3A 1XF5A 5DTFB 4CVXA 4IRJA 5FUOL 2HRPL 5CILL 3IXAA 4H1LH 4JB9H 5C0AE 1OCWL 5DYOB 4URTB 4K9EC 4PV9B 1DQLL 5DQDH 3IJYB 1AO7E 5IGXH 3FO1B 1RY7B 5I18H 5A2IH 2LAGB 3VFUB 2EE3A 4NN7B 1RJCA 2DI8A 4F7MB 3WFCL 3HN3A 1EMTH 3O6FA 4NPYA 5DC0A 5FYLD 2D7TH 3N1PC 4W70A 1R3KA 1DSFL 1OPGL 1T0NA 3D69A 1BOGA 3MV11 5FCSH 4TTDD 3NH7H 5HHVH 3EO9H 3MRDB 3WS3A 5I73B 2AEWA 4FN0A 1Y0LA 4UDTB 1TXKA 2I60H 1QLRB 4S0TD 1G0XA 3LEYL 1DLFL 1MJUL 3DTXB 3QEUB 4XPFH 2X4TB 4XPTH 2AK4D 2CLVA 4TN9A 4S1RH 1VEOA 1UVQA 5KN5A 1S7SA 3O41A 2NX5D 3F12A 4HC1A 3C8DA 5IB1B 1UEYA 3BRDA 3WIFB 2O93L 2P8PA 1HZHL 4PREB 3VXSD 5BW7A 1A7NL 1F4XL 5GRYA 1G7JA 3U4BL 1VKXA 2CRYA 4HWBH 1XFPA 3PWPD 3C5ZD 1ZT1A 5DI8A 4YFLF 3P9WB 4GAYB 1PBYA 3PXJA 4R7DA 2AVGA 1DN0A 3QWQB 5A2LH 4ODXB 2FX9L 4JREC 1JL8A 1KXVC 5C0CA 2APBA 5J1AB 3S36X 5EZLB 1U8MB 2ORBH 2Y36H 1QFOA 1BX2B 5E2JA 3WYRA 3OWEA 4M7KH 1KC5L 2FL5A 1FV1B 2AEPH 4GS7B 3K1DA 2QSTA 2Y9RT 4NSKB 3B9KD 2MHAB 3GSUB 4FFVD 2H9GA 4YK4C 2UWEE 1AGDB 3KPSA 4MNGE 1JUFA 1RJZB 3VFGL 3EGSA 2NR6D 4WW2C 5C0IB 4I13B 1UACH 3LPWA 4JHBA 5L88L 4OIBA 4D9QE 1HYSD 5C9KA 4WTXA 4M6OL 3FOLB 1JRHH 4XPHL 4FMFA 3BPCA 4P2RB 2YUWA 1HHIB 43CAB 1XF2B 3REWA 1SHMA 4EOWL 1TJGH 3QUYA 1BZ9A 1GPOH 1LEGA 3NIFF 3U9UA 2IH3B 4LRNH 3T2OA 4BQ9A 2J8UB 1RPQA 1BEYH 3MUGA 2F8XC 1A02N 1BFVL 2GCYB 1QQDA 5EC2A 5KW9H 5I6XC 5DLML 2K7PA 5I9QC 4ZAKD 4NNYB 1T0PB 5F7DB 5FKPA 3P77A 4L3ED 4ZDHA 4C83A 2VDLL 5FYJD 4OLEA 5ISZA 2BNUB 2VERN 4PJCB 3V7MA 2AP2A 1INDH 3WIIL 3DHMA 3H3PH 5IMMB 4QRTB 5EUOF 4QXUL 3B9EA 2QQKL 1TQBC 4ZSOA 2IG2H 1MFEH 3ARGC 1ZLSL 4XC1L 3PGCA 2LAAA 2N56A 4N0FA 1XGRB 4CKVX 3BKYL 3D0VB 5DDHB 2KH2B 5KSVB 1IEHA 1RIHH 1YMMA 4TQEL 2Y07L 5HDBF 2RB8A 1IGMH 3T1FA 4WO4B 1KTLB 5IVXA 4WI3A 1L6XA 2EDLA 1GZPB 4FABH 3JWOC 2E7LC 5JDSA 1K8DB 4ORZC 1DQQA 4OGAC 1NAKH 3CC5B 2NY4C 1E27B 2J5LC 1UM6H 1J8HD 4PRID 4GG8A 1ZLWH 5DA4A 5KANI 4LVOC 3DXAD 2J4WL 1U9KA 2NW2A 5BQ7A 1D5MA 3VDAA 5F7HA 4QTIL 1EEYA 1EJOL 4HCRH 3QBTB 4EUPG 4ZTPH 4N8CL 4OD3L 2R9HD 4X4MA 2IFGA 4YZFE 2CPCA 4R4FL 1DBJL 4XMLL 3ECBB 4JY4A 3VW3H 1A3RH 2DQEH 1F6FB 3O9WD 1EO8L 3NPZB 1G7HA 1N3NA 3ARRA 1H8NA 5I73C 2V5TA 5HHPA 3PWJA 1KEML 3PL6B 4Y16A 1R0AL 4GQ9L 3DUSA 2OMNA 4OCRH 2UZXB 1UYWH 4OD1H 5TJWK 1FIGL 3HMXL 3UJIH 4YJZL 2DMBA 1FNGA 4HIXL 4S2SA 3PF2A 2ENYA 4R26H 1F02I 1C08A 3W81A 2EDXA 2YC1B 3RIAK 4E41B 4GRLD 4RFEA 3WNLA 5JW3L 1S9VA 2IBGA 1I1YA 1NL0H 5BV7L 4G6FB 1YEKL 2R56L 4X6CB 5EU7E 3HUJF 1MI5D 1K4CB 3T0EA 1EUTA 2H3NB 4HBCH 1FNAA 1RJYA 1K8IA 5I8KL 1S7QB 5CEZH 2EKJA 1CIDA 1XMWA 2WBJB 5IMLB 4NO3B 3FHQA 3KVQA 4PRDA 1AE6L 3O4LD 5D5MA 3STBA 3BKCH 2DKUA 2AXGA 5GS1B 4FQXB 2BNQD 2ZCKH 4O4YH 3UTSE 3F5WB 3U2SB 5I1JH 3NFNB 3W39B 3HB3C 2IGFL 35C8L 3JUZA 4HV8B 1VADA 4Y7MA 2EH8L 5E00A 2D03H 4JM4L 4K3JL 4NQDB 4M7ZB 3GI8H 4YBQC 1QSVA 2FJFA 4GS7C 1CQKA 1I4FA 3MJ8B 5E99L 3KYNB 4KTEH 3ZYIA 1HI6A 4FG6D 4CRPA 4MLIA 5F88A 1A7RH 2DQUH 1IL1B 5C0GA 3AU1A 1XGYH 3PJSA 4NQSA 4ZO6A 3VXRB 4TUOB 5C9JB 4LCYA 2ZSVA 1IZJA 5I0ZA 4KKCD 4AQOA 1NCDL 4KDWA 2SEBA 3TBSA 1BQLL 5LQBL 5EU5A 2WWKO 2GK2A 3BHBB 1BD2D 3O8XA 5DQ9A 4XCFH 4AY0A 2OS7A 1J0KA 3N1QC 3DETC 4AT6A 5IFHH 3IAQA 4XCCL 4JM2B 4XP1H 2XWJB 2I9LA 1XIWD 4I0PD 1G9NH 4N0YH 1X44A 4X4XA 1ZANL 4JPIB 4HLJA 5JOPD 4XNZB 1RZ8A 3GMRB 4O02L 3MRHB 4DVBB 1Y6NR 4LVEA 3QXWA 1TETL 3BZEA 1NLDH 2C9AA 3HE7B 3JWDC 3LH2H 5SWSD 5CZVH 3V6ZB 4JKLA 5IJVA 1N8ZA 3IDYC 4X6EB 1HNFA 1B0GB 1YDPA 4NHCL 4F8QA 3C6SA 3LQAC 2B1HL 4HJGB 4Y5VB 3N85H 2K7QA 2KBGA 1UJ3B