1YQVH

The crystal structure of the antibody fab hyhel5 complex with lysozyme at 1.7a resolution
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
215
structure length
215
Chain Sequence
EVQLQQSGAELMKPGASVKISCKASGYTFSDYWIEWVKQRPGHGLEWIGEILPGSGSTNYHERFKGKATFTADTSSSTAYMQLNSLTSEDSGVYYCLHGNYDFDGWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKILD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HyHEL-5 Antibody Light Chain
publication title Water molecules in the antibody-antigen interface of the structure of the Fab HyHEL-5-lysozyme complex at 1.7 A resolution: comparison with results from isothermal titration calorimetry.
pubmed doi rcsb
molecule tags Immune system
total genus 37
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2005-02-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yqvH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yqvH02
3H0TB 1DEEA 2KH2B 1VCAA 1BP3B 2JLLA 1I1AC 3REVA 1N2RB 1EVTC 5MEQA 4C4KT 4MD0B 1UZ8B 4U6YA 1NLDL 3O3BB 1X44A 1D5ZA 4M7JL 5CEXA 5GIRA 4ZAKB 1U95A 2KUTA 4JDZA 5HYSA 4X4ME 4MDIA 3VE0B 3MOBL 4P57B 4AYFA 2RIKA 2Y6SC 1NJ9B 3NZ8A 2EDQA 5HHXL 1LK2B 5BS0D 2QQQA 5C08A 1WTGT 1NC2D 3PWPA 5GJSL 5GRJL 5CP7A 4K8RC 1UM6H 4RMRA 1OTSD 3S5LB 1NLBH 3KS0H 4QRTA 3LKRB 2YWZA 2DWDB 2X10A 3BP5B 5L2JB 1ZVYA 35C8L 4EN3D 1JCKA 2XKNB 2OR9L 2FJGB 3MCLH 4MAYA 2NY6D 4Y19B 3BN9D 1IJ9A 2ZNWA 2D31A 1FZJA 3VFVA 1K6QL 3BH8B 2IAMB 4JFZH 3GBNH 5CJXC 3KJ4C 4LLWB 1S7VB 4TSAH 3SJVD 2O93L 2F15A 3MGTA 3AMLA 3RL1A 4NKOA 3RA7L 2APXA 1CU4H 4H5SA 5DO2C 2EC9T 1QKZL 3IU4L 4JFDB 3TC9A 3MV7D 5J3HD 3MBEA 5T1KA 5CD3B 3TBSB 6FABH 4JJ5A 1YEGH 3QUML 5D7LA 2BSSA 4ETQB 1BHGA 3FOLA 4U1IA 2ICWB 4LCWB 1JPSL 1OQOA 5IKCA 3RVXC 1O7SA 3K7UA 1F2QA 4RIRB 5T33H 4RISH 1QFUL 4WWKC 2B2XH 4FTVA 2IFGA 3C6LC 3D25A 2H32H 3UTSD 1T4KB 4JG1H 3VW3L 1P7QD 1CICC 3JBG7 3A6BH 4YFEA 4Z8FL 5I1CL 1DQLL 1L9MA 2DM3A 4Y4KC 4UINH 5C2UB 1MRCL 2VUYA 4LNRB 5HHVL 5IW1B 1S9KC 5EOCH 5IV2A 3KYMA 5INDA 2VLKA 3MRHB 3NTCL 5CIPH 1SMAA 4UNVA 1R3IH 3WMSA 4HZAA 4N5ED 3SKNA 3GSRA 2IQAA 3UYPA 2MNUA 4WU7B 4APQA 3VH8B 3L5XH 4HT1H 5KVEH 4UNUA 1PFCA 5ICZA 4W4OC 3ULUH 4YDLC 3KPPA 4LPXA 4PGCA 1S9YB 4IRZL 4KMLB 1CGUA 1P1ZA 3WUWA 3DVNA 1VEMA 3MJ6A 3BGFC 3KNBA 4MB3A 2YXMA 1ED3B 4RRPG 4FQXD 1DN2A 4XCCL 1SYSB 3TN0C 2D0HA 1LO5B 3B4NA 4ONHA 1YNLH 4NNYB 1RFDH 3O81A 3ARBC 5EH1A 5D7SL 5E94A 4K7FB 3NGBC 4P9HL 1QHOA 3MLYH 3THMH 1JNNL 1TVHA 1VB9A 2A77L 5C0EB 5JMRA 1BQHG 5MP6L 3HNVH 5GGSA 4WI8A 5CINL 2XICA 1IT9H 4OQTH 3DIFB 3QR2A 2VXTH 3S7GA 5E2WH 1PX4A 2O26U 4PRHB 1I1AD 4YE4L 5E08H 4JFXB 2P24A 3T0VA 2JELH 3DX9B 5JA8B 4JPKL 3NACL 4RCAA 1JZ3A 1VFBB 4M6NH 1ORQB 1DUYA 4JFYB 4Z7WA 1FFOB 4L4VD 2WBJA 4P2YA 2Y6SD 4M93C 1MRFL 4N8PA 5EBMA 4D9LL 4ZNEA 1OGTA 4R4FL 4Y8AA 2WINA 1IFHH 4K8RD 1WZLA 2WNGA 1G9NC 1U3HD 4PG2A 2CLZB 3SEPA 3ZKNC 2YPLD 3DMMA 1ZHBA 3HE7A 4WI4A 5HPOA 5FXCH 3QG6A 4DZBA 4NO2B 5FM5M 3O6KL 1MSPA 4LPTA 2EZ0C 5DDHB 1KPRA 2ATPB 4KVCH 4HJGA 4OD1L 2VLJA 4KKNA 3S97C 2VN7A 5JW4R 1T03L 1G6RA 3BRGC 2DL2A 3UBXG 2VL5A 3GMMA 1BFVH 2E9BA 5A1AA 5F6HJ 4I18A 1JIBA 3RVXD 1E28B 5KSVB 1RVFH 1V3LA 1RULH 3ORJA 5DMKB 4RBPK 3FRPG 1MI5A 3BEWA 1QLEH 1G7IA 4IIQA 1T04A 9CGTA 3Q3GB 4JFFE 2QBWA 3MNVB 1CFVL 4QRUB 1CE6B 2A38A 2ED7A 4HS6A 1CICD 1YNKH 3REWB 4CRPA 4ERSL 4OF3A 2ESVB 2DICA 4X80H 2F9BT 4JY5L 1OWWA 1V7NL 2YN3A 5CD5C 3F7PC 4ZFOB 4X9HA 1WAAE 4PJ5E 3V0WL 4NRZB 1QPXA 2CGRH 3P11H 2R1YA 1NCCL 2GHWB 1DSFL 4R26H 1Q38A 4QRRE 4WFHE 4A6YB 1RUQH 2VSCA 4KH2A 3JTSA 2IBZX 3OKOA 5K59F 5JNYA 2BVEA 2RJMA 4HWEL 5F71A 1CLYL 3GI8H 4CN1A 3C08L 4Y2DB 4ODSL 1NC4D 4N8CL 4FFWC 4NNPH 3T3MF 1HHIB 2DQCL 3UJIH 3C60B 3VXOB 4PRAB 4P48A 4OZFA 2X89A 5FUCC 4ODWB 3LS4L 4U1LA 2VQTA 5ID1A 5EOQH 3TIDB 4OZHB 3ZHDA 1OT2A 3QUZA 4XNMA 1KG0B 5CAYB 2Q6WB 1SY6H 1HINL 5E1AB 1MJ7L 3RDTA 2DKUA 3ARWA 2BY3A 1AP2B 1G6VK 1M6OA 1N26A 2EYRA 3QDGB 4NKMA 4RFOL 4WEUD 5EBLA 3DHJA 2C9AA 3HC0B 3EYVA 3MGOB 4JDVB 4U2YA 5BV7B 1YEJL 1K4DA 3PJSB 1NUNB 1NSNL 1N8ZA 1WEJL 1V3JA 3OF6A 4D8PA 2DLEA 4LU5L 3ZDYF 5C0NC 1UM5H 3GSVA 3JV4A 4LHJB 4GKNB 3V6OE 4HK0B 1EFQA 4TPRL 1J5OL 3VGBA 1TTGA 1AR2A 4NRXB 2YRPA 3UXFA 5DR5L 2FGWH 4C83B 1WBYA 2ZCLH 3IAGC 2AW2A 5FGBA 2R0WH 5E2UL 1URLA 3S96A 2D03L 4LEXL 4NC1E 3MV9D 4LGRB 1RZIB 2VXVH 3DI3B 3NFSL 3WV0A 5JPNA 3WJJA 2X4OB 1KIPA 1JF1A 3WXVL 1J11A 2VLLA 3QQ3B 1MCCA 3UTTE 5ITFB 1BAFH 2AABL 4NO0A 1CDGA 1VPOH 4M6OL 1QR1A 3IETB 4S1SH 3BGMB 3ZHLA 3MA7B 4MNHA 2DQDL 4U1GC 4GRWF 4NQSA 2OZ4L 4NQDD 1T6VN 2R4SL 2QADB 1BIIA 4HJJL 3BMWA 5JDJA 1Y0LB 3B3IB 3EZ8A 1UVQB 3VDAA 4NUJB 3UTQA 5GRWA 2G60H 4XBPB 2YPKA 4O9HL 3DOSA 1RZGB 2Z8VC 3DX7B 4PUBH 4AG4H 4UAOB 3CVHA 5F7KC 1ZT4B 4HS8H 4P5MA 3OB0H 4HWBH 4GMTL 4MWFA 5ETUA 3CXDH 5F3HB 2X42A 3S4SB 4QTHA 4WI7A 5JORA 1DLFL 4HGWB 4Q9CA 5EU4B 7FABL 4XP5L 1HH9B 5KSAC 3TBWB 5D6CB 3H42H 4D0BB 4X7SH 5ADPH 5C0GA 4Q9QL 3LPWA 4H8WH 4TRPL 1FGNH 3CCHB 5MI0B 4QY8B 4NNXA 4YHYC 4P9MH 5HHOE 5IBUB 3CFDA 3D0LA 3VFPA 4Z7UF 4P3CL 2RHEA 3AFLA 4PRIB 3QQ4A 4LGSB 1HOCB 3RWGB 3HB3D 1NC2A 3V95A 4Y5YA 1A3LL 2R56H 1OF2A 5DT1H 2FX9H 4WHTB 1S3KH 4ZUTA 1FORL 1GPOL 3ARDA 4GRLB 4EN3A 3WIFB 2ENYA 5FYKH 1UWEH 3OJVC 3FJTA 1WBZB 1T1YB 4F7CA 3TBTA 2AJ3B 5F8QC 5I1EL 3CDGB 1MJJA 3QAZB 2YZ8A 4P4KC 4RX4D 5IJVA 3GSNL 4JQXC 3SJVA 2HG5A 3L3GB 4HXAL 4KQ4L 2XQYK 5SWQB 4ZNCD 5E6IB 3MV7A 1YEFH 2PW1A 4I77H 4HIJB 4D0DB 5EPMB 1I8LA 4P4RB 4OKDA 5I17B 3N1GC 3OJMB 1C16B 5C0ND 1E0OB 2NX5A 2YD7A 3DPBA 5I1DB 1OHQA 1BREA 1KB5H 4I0CC 3TYGL 3KYAA 4D9RD 2X4RA 3RBSA 1ZSDA 1HYSC 4QWWC 1AO7B 5C0RH 2PTUA 2X4PB 5SWZD 1KEMH 1QFWI 2JJTA 3UTSA 3WHXA 1A9EA 1S7QA 1P7QA 3F62A 4N9GB 2VXSL 4ZTPL 3IFLH 4LVNB 1E4XH 2AERT 2CIIB 4HH9A 4WFGE 3QG7H 3HAEA 2ZUYA 3TCLB 4YWGL 1LDPH 5F88B 1Q1JL 3NABL 3UYRH 4PJAB 4LOUD 2W92A 5JR1L 2AJVH 4X5XA 4RA3A 3ZO0A 5KSBF 1N64H 3ABZA 5BVPH 3FMGL 1A1MB 3MYJA 1XIWB 2I5YL 1ZLSL 4BFIA 1NL0L 3BXNA 1K5NA 1RV6X 3VRIB 1CK0L 3U9PH 2V5TA 1OGAB 1WWAX 1QR4A 2ADGA 4QHNA 5DJ2A 4E5XB 4EJ1C 1KN4L 4LFHG 1NFIA 2ADJB 5IHUH 4BSWB 4MJIA 4AIZA 3OZ9L 3BH9B 3W0WE 4HC1H 1NMCC 2X4NB 3QNXB 3I6LE 5IHBA 5IT2L 2DQUL 2KZ1B 1NFDF 1U93A 2VZ1A 3VFWA 3E3QC 4DN3H 5T1MB 5KSAD 4G6FD 4TNVF 1Z5LB 3MNZA 1R5WB 3RWDB 4S2SA 3M17A 4P2RA 3FONB 3D2UB 2PYFB 1G7PA 5DUMH 4WEBL 5JW4M 4M61A 4PJXB 2DQFB 4CN4A 3FAWA 5JZ7C 1HQ4A 2AK4E 2M26A 2WLYA 4NKIL 4Z6AT 3GM0A 1TLKA 3WFBL 3H9SE 1C12A 4ORGB 4ODVL 4A6YH 5IF0A 5K9QI 5AAWA 1DFBH 1L7TL 4YGVB 3LCYA 5ANME 4AT6A 3TVMB 3ULVH 3C5SA 2X4QB 3HMWL 2GSIB 1D5XB 1OAZH 3O41A 1JWMA 3O11B 1U3HA 3KPMA 2NXYC 3T0WA 4YEEA 3U79A 2BNQE 2W9LA 3VG9B 5HVFB 1T7VA 3VFGL 3T1WA 1BVZA 3GB7A 3MTRA 4IS6B 4P4KD 3SCMA 5IB1A 3SDYL 4Z7UA 4AH2B 3IF1B 2DQJL 3LPFA 3B2VH 1B6DA 5IUSA 3MQIA 1IC1A 3BP7B 4NQEB 3EYOA 4GMSL 4TUKH 1A4JB 3D3VD 3MRIB 3LS5H 5GRUL 1DR9A 5IMMA 1OSPH 5GGRB 5AUMB 4AL8L 2HVKB 5BXFB 2LU3A 4L8SB 4O4YL 1HXMB 3CFCH 2OL3A 1V8HA 4LSQL 5I73C 1M7DB 1I7UA 1RZ8B 4N0CC 4PLKD 2IADB 5D7JC 2J4WH 5EO1B 2FBOJ 1KLGB 2YA0A 4W68A 4FZEH 4JKPL 3MRFB 1F3DJ 1BOGA 2QSVA 2X44D 1G7LB 1JRHL 3N0PB 2FIKA 4P49A 2VABB 5DQ9A 4RRPA 4JKWA 2VITA 3R0NA 1S9XB 1DQMH 2ZCKL 2ZNXA 1HSBA 3MRCA 2R2BB 1UH2A 4X6FA 3O6FD 5D2NC 1YMMD 4XBEL 1R5VB 3KXFD 1BQHA 1CGYA 2IG2H 2AEPH 5I71B 2H9GB 5C0CA 1RZKH 1PVHA 2JIXD 3QPXH 4R0LB 3VXPA 5E2VL 1I8IA 2GSGB 5CJBA 3T08A 1MCFA 1D9KA 5E56A 2ORBH 3I3BA 1NC4A 4PLJC 3RNKB 3H9HB 3EO1B 3O2DH 3L3JB 4PJ9B 5HHPA 5BJTA 5HJ3A 4ELME 3BP4B 5FO9B 1X3DA 3P30H 4M43L 1WSST 4FP8H 4R3SA 5FUCE 5HI5C 2NR6C 2Q76A 4NUGL 5KSBA 4WI6A 4F7PA 1YEDB 2VQUA 4MXQC 1WWCA 5BO1L 4Q97A 5BW7A 3ARFA 4UUJB 2A74A 3BW9B 2B5IB 3NPSB 1BVLB 1AKJD 1S7UB 3TT1H 1DL7H 4RWHA 4DUVA 2AJSL 3W9DB 5JZ7D 5DJZB 5MENE 1NAML 4PJHF 3WS6A 2ITCA 3LH2L 4R8WL 3PIQA 2VAAA 5C0IB 2E9JA 4BJLA 3D0VA 1RURH 1A6TA 4POUB 4IMKA 1NFDA 5KJRL 4CAGA 1WT5A 3OPZH 2OTUA 2PXYC 4LGPB 4OF5A 3UBXA 4KKCC 2AI0H 3BJLA 1BZ9A 4Y88A 1XR8B 2Q8BL 2AV7A 4UV7L 5E99H 1YECL 3ECBA 2P45B 4PFEA 1MCOL 2R39A 3S34H 2ED9A 3ARGD 2GT9A 4Q9BA 4UDUA 3RVVC 3FRPA 1JFQL 3ZE0E 3V4VH 1RU9H 2J7LA 4MCZB 5C1MB 5I8OL 3LKSA 1MH5B 2BJMH 3QB7C 3D87B 2O5YH 1N0LA 3BRFA 3BX7C 4I3SL 4BH7B 4N90E 4I48A 2XZAL 3K1DA 1KIRA 5EZOH 4OI9A 4UIKL 4M7ZB 5EU3B 5A16B 1INDH 4XHJD 3TPKA 4YDIL 2XWTB 3LSOA 1H3PH 5DC9B 5KTEH 4EDWL 4DCQB 4KI5C 2JB6A 1P4IH 5GRVK 5DFVC 1DBBL 2AK1H 3MFFB 5DURD 4N0CD 1IEHA 3ULSB 5D7JD 1LMKA 2XXMB 4XCEB 3MYZA 1F4WH 4ZFFA 3WKMH 1ZGLA 5I74B 1F3DH 1QRNA 3CK0H 3HNTH 1ULVA 1IQDA 5C09D 2GAZB 3LEYL 2ADFL 2A6DB 2ZP0T 2ZSWB 4JG0H 4F7EB 4BKLB 4QLRA 1OP5K 5HXMA 2X7LA 4OI7A 1P5UA 3ES6A 3SDDC 5FV2A 2CMRL 3TF7C 5B3JE 5FEBA 4K94L 3CH1B 2W07A 3B5TA 4M62H 4G6MH 1KV3A 2FEDC 1LDSA 4TUJB 5GS0H 1MHCA 3U1SH 32C2A 5IK3A 1A6UL 1JWUA 5D2LB 3BKML 5FA3B 3HG1D 5ACMA 2GK0A 2LTQB 3C2AH 2C1PA 4CN6A 5C6WH 3EYSL 1HSAB 3V0VA 3ZDZE 3QFJA 1UM4L 4YHMH 4I3RL 1MQKH 1S7XA 5HI5D 5ISZA 2NY5H 4C58B 1Q72L 1S8DB 2NR6D 5IB4A 3E6HB 1P7KB 1XGQA 3BJ91 1ZLWH 5ERWA 4NZUH 1RJZB 2I26N 1KCUL 4F7MB 4KWUA 3RWIA 1HH6B 4RX4A 4RFNB 4O2FB 1E6OL 4ONFH 2O61B 1FZOB 5JOPE 3G5YA 4NO3B 1B0GA 3UPRB 1OM3L 3FQXB 3PL6B 4JZNA 4X4ZA 2OJEA 1PSKL 2R4RH 4M8QB 1FGVH 3T4YB 1IEBA 1JYVA 2AVGA 1QNZL 2FATH 3PWUA 3QIUC 3VWJA 4PJDB 5I1GH 1D5BA 1NANI 3D9AL 2IAND 2X41A 2PXYD 1QFWM 4KKCD 2F74B 3O8XC 1QBLL 5CJOL 3QULB 3SGKA 4N5UA 4DK6A 3EUUA 5MERA 1NGYB 4YDVA 4PJHA 4G42A 1PQZB 4E41D 3U0TB 3ULUC 5CLWA 1LO2H 2J5LB 5FUOL 3N85L 4XVSL 4PJ8A 5KW9L 1QFWH 1NFKA 5ELIA 2GI7A 3MJ9L 5IB2B 4LP5A 2LABA 4MCYB 1GOHA 1UZ6E 4GAGH 2XTJC 2I60H 1QRKA 1YMME 2E5EA 3JV0A 2R69L 3MLZH 1ZT7B 5IMKA 4GW5A 5IW6A 3GGWA 2HT3C 2VOTA 3STBA 1N5YH 3FQRA 3F8UB 2CLVA 1T1ZB 1RUML 5TFSH 4KAQL 3RAJH 4F33B 1MEXH 4QHLA 1CFQB 4RGMC 4L3ED 4YBQC 4YDJA 1IGJB 3INUH 4MX7A 3RJQB 1ITCA 3LQZA 4HMDA 4ISVB 1CZ8L 3BIKB 4J3WA 1VHPA 4R97C 5IBTL 1LO3L 4JRYE 2Z35A 3LKPA 4HZLB 1K2DB 4X83A 4WO4C 3NAAL 3E3QE 3SDDD 4DKDC 1JPGB 4ZO7A 4EUPH 1VGEH 3CIQA 4X4YA 1WQVT 1EBAA 4LLYB 4X6EB 1DBAH 3MV8E 1WICA 4XNQB 4WTXA 2FEDD 1I1FB 1CDCA 4N9OB 4HUWB 4M7LL 4JR9H 4UTAH 3TNNB 2OI9B 1W72A 5DXWA 4JB9L 2J8UE 1J1XL 2JJSA 4P3WA 2DQIL 2IH3A 1PEZA 2CIKA 5KVGH 2CKBL 1IAII 2XN9B 3FT4A 1P9MC 5BZDA 4NDMA 2Q1EA 1OAUH 2HJFA 3L3HB 5DEZA 4K07A 2EEBA 2BVQB 3GRWL 4DN4H 4AEFA 4OZGB 1ZHKB 1IGFL 4H26A 4ZXBB 5D93B 2IWGA 2WV3A 3OKYA 1XGYH 5IR1A 3FQWB 5DJXA 3VGDA 2NXZC 5IVOA 3IRZA 1QHPA 2X4SB 4ZYKB 3V2AR 1PAMA 1WFOA 3L6FA 3KPQA 4X6DE 2DLFH 3IXAB 2AP2A 3CZFA 4U49A 3D3VA 1N6UA 3RX7A 3IDYC 4K3DL 1VSCA 2DYPD 1RSFA 4RQQB 3D48R 3QIUD 2BRQA 4N0UA 5EA0L 4HFWA 1ZLUK 4CU7A 3U30C 1TMCB 3GMQA 4LLDB 4P59H 2PO6C 3O8XD 1MPAL 4ZMAT 2NLJA 4KDTC 5GSVA 1IL1A 5F96H 1ZMYA 2ITDA 4LARH 5T3ZH 3DBXB 2BFVL 1RUAH 4XXCA 3R0MA 1E4KA 3EJZC 3I6KB 3TZVB 5CZXC 2NY2D 5D1ZB 5JW5B 1BLNB 5C6TH 3LRSA 4N8VB 2QSCH 1ZA6B 2X4TA 1ETZA 1DBML 5HI3C 3O6FA 2K7QA 5L6YH 5EU6E 4LLQB 1UJ3C 2XTJD 2GJ6B 3D39D 5D2NE 5IM7B 3STLB 3QFDA 4HUKB 1N5AB 1FZMA 2JIXA 2QQLH 5F9WB 4FQLH 3VI3E 4U1JB 5F9OL 2B0SL 4PY7B 2O5ZH 2QEJA 2EIZB 5KZCD 3P4MB 1U8LA 4Y7MA 3HHRB 1LO0L 2F5AL 4X9GA 3VG0L 1WF5A 1H5BB 3A6CL 1C5DB 2XZCL 3FFCB 1QZ1A 2C5DC 4ONGL 5CEYB 4C56E 4OD2B 1ZVSB 5FUZL 2FX8H 1ACZA 3GKWL 3GJFB 4TVPH 3L5WB 4M5ZL 3ZT6A 2VMFA 4JJHA 4HLZH 3WO4C 2CDFA 1ODAA 1FL6A 4X7TB 1DJSA 1RHHB 2Z93A 1UB5A 1JGLH 3FRUA 1JNLH 4V2BA 3K74B 1MFEL 3KPRA 4XPHL 1GZPA 1SEQH 2X1PA 4BZ1L 5DRNB 1WJ3A 3U0WL 4NSKB 5I15L 1D6EA 3QEQD 1YYLL 4KK6C 4PYGA 4Y4FA 4KRLB 4YXHH 2R8SH 3GFUA 4FQ1H 3PV7A 1MIMH 1Q0YL 3NCYS 1OAYL 4NN6C 5TH2A 5MEQB 3KLAA 1RIHL 4YZFF 1MFDL 1D5ZB 3ARGA 5CEXB 1U95B 5CHNB 4JDZB 3OTTA 5HYSB 4IOIA 3O6MH 1QBMH 1OWRM 2NXZD 2Z92A 4Y5VA 4WCYH 3NZ8B 4FQ2H 1X4XA 4QHMA 3SE3A 4NO5A 4HHAA 3JVGA 5C08B 4PD4K 1OW0A 5JDSA 2G9HA 4JM4H 2JKXA 4X9IA 1TJHH 3NA9H 1I3RA 5JUEH 4QRTB 3KPSD 5E8NB 2NZ9C 4PGBA 3KWWA 2NNAA 5CGYC 1J8HD 4LIQE 4TUOB 4JHWL 3MR9B 3QBTB 1FZJB 4XC1H 5HGBA 2BOBA 4L4TB 4KI5E 1U3YA 1U6AH 12E8H 3G5VA 1TCMA 3QDJA 2XNAA 1QVOA 4PRPD 3ROOB 3RL1B 3HRZA 3ILPA 4MA1B 4H8WC 4OLYH 1T0PB 4H5SB 3IDIB 5CZXD 1WITA 2F5BH 3MBEB 4KRPC 2HWZL 3W9EA 4JJ5B 3VGAC 1SJHA 1YQVL 5DSCB 2BSSB 2VISA 3FOLB 4U1IB 2BNRE 2JK5A 4WU5B 4OD3L 2OS7A 3QIWB 4IOFC 4DGVH 2X9YA 1BFOA 3SGDI 3OAZK 4FTVB 4PRBA 4MD5A 4WUKH 1YUHA 2X70A 3QEGL 3HG1A 3GMNA 3D25B 3K4ZA 4LQFH 1WC7A 2D9CA 4QXTA 1OCWL 4IDLA 1EVUA 4ZTOH 3VH8G 3PGFL 2HT2C 2XKUA 3KYMB 5FHBL 5INDB 4PLOB 2DS4A 1KJ2A 1MNUL 1BBDL 2Y25A 4OGYL 1NAMA 3SKNB 5GRVL 3GSRB 3RWHA 1T21A 5A2FA 3UTZA 5IP4A 4ZAKD 5DYOA 4APQB 3HLAB 2IGFL 3D18B 2UYLB 3BPCA 5ICZB 1T83A 4LHQB 3RNQB 3LMJH 2HFEA 1V5JA 3KPPB 4G7YL 3GHEL 4LSDA 1TZHA 1TVDA 4JPVH 4M1CD 5F9JA 1XF5A 3KNBB 4POZC 3P77B 1EA9C 4ONHB 3IDGA 4YR6A 3CSPA 5MEOB 4XNZB 5E00B 5JHDE 3MBXL 2D7TL 4Y19D 1IGIL 3RGVB 1D6VL 5KOVC 4P5TB 2IAMD 4LSRL 4MA7L 5EO0B 4KK6D 1AE6H 5LWYH 1BBJA 4MNGE 3ARYA 1YJDH 4LCCA 4OV6F 3QEUA 1GHFL 1BWWA 1KYOK 1TQCC 2P24B 3QCVH 3J8F7 1G9NL 4JFDD 2CXGA 2V2TB 2ZG1A 1MHEB 2A6IB 4E41A 3CSBA 5EORL 5IEKA 1S5IH 4CNIA 1AGBA 1XF3A 1J1OL 4LVOB 3FO2A 4LCWD 3ULUE 4JGJA 5EBMB 1OGTB 3LAFA 2WINB 2Z4QB 3ROLA 4YX2H 4AENA 3RIFK 4XCFL 3QHFL 3MLXL 1P7HL 3MLWL 5F21B 5CGYD 3L3DA 4JQVC 1Q9KA 4WI5A 5FF6A 1ZHBB 3HE7B 3M07A 4JHAH 2GK2A 4XWGL 3VRLF 5DJAB 5KS9B 1ZS8A 4YDKH 3VRJA 2YKLH 1FVDB 3L7FB 4NT6B 1ZGLP 3SKOB 1EUUA 3TWCH 1KGCE 3PGCA 4L3EA 3CFKA 5IBLC 4BUGA 3F65A 4MLIA 1KPRB 2CR3A 3VXSE 4G6KH 2FECL 4GXVH 3MOAH 1UH4A 3LN5A 3SKUD 1KC5H 1CT8A 2V7NA 3V4PH 1G6RB 1RIVL 4Z7VF 1EFXB 4HIHA 3FT2B 3IGAA 1MFBL 1F4YH 4PRDA 1FAIH 3KPOB 2VL5B 3GMMB 4XVJL 3ULVC 3TV3L 5HDQL 3MJGX 5DHXB 1OAQL 2PUQT 3ZL4H 4WWID 3WNNA 1MCNA 2E7LA 3I02B 3EFDH 2EO1A 1BZQK 3PWNA 4OSUL 4UDTB 4U1HB 5DUBA 4MXWH 5TQ0H 2YN5A 4MVBC 1MI5B 5FYKD 2AXGA 2BZDA 1G7IB 2G5BA 4IIQB 2D3VA 2B39A 3B43A 3WFEL 2QHRL 3VA2C 4PJIE 5J6GB 4AMKL 1AY1L 4OAWA 1IAIM 3BZ4A 4HS6B 4JFHE 3BO8A 3PG2A 2G2RA 4K2UH 2OJZH 2Y7QA 1G7JB 3HNSH 4PGZA 2HT2D 4KPHL 5KN5A 4PRHD 1X5JA 2ARJA 3QNZA 25C8L 2VDOH 4UQ3A 1LK3H 1NMAL 3BI9X 1PZ5A 3RHWF 5IQ7L 2IBZY 5D5ME 1FE8L 1Q0XH 4LF3B 5F7UA 3AGVA 2EDOA 1EUTA 1X9QA 3U36A 1DBJL 1MUJA 3OKOB 3LEXA 4OUUA 4BQCA 2VDPH 3U9UB 5I1JL 2HJKA 4POZD 1IAOB 3P9LA 4Z7QF 4U1LB 2FD6L 1CGTA 5ID1B 5IROA 2Y5TA 3RUGB 3LKQA 2RFXA 4Q2ZA 3VXMB 4EDXA 1I3VA 3EAKA 5D96C 4WHCA 4NJAL 1F6AA 4EOWL 4GAYB 1UQSA 4YHIA 4HIXH 2ZUQB 3A67L 4V1DE 5FO7B 1SVCP 1M6OB 2IFFL 5FIEA 1RZKC 4NKMB 3T77B 4CVZA 3DO7B 4S1QL 2VWEE 1V3MA 4H88L 2Z31A 2YRZA 4HG4K 1N8ZB 1EHLH 3BKJH 1Z6JT 3L5HA 4D8PB 3CX2A 4KUCD 1CFNB 4KDWA 4PTUB 5I1KL 3GSVB 1AGFA 3JV4B 4TVSa 2Q8AH 1UH3A 1B9ZA 3D39A 5EO9A 3BKYH 1WBYB 4KI1A 5DHYB 1MF2H 1UKTA 4Z95H 5J8OA 4K7PH 5J6HA 2Z91A 2HH0L 1UXSA 2YEZB 3NCCB 1JP5A 2ESVD 4I2XB 5JPNB 4LASH 4NQTA 5IBLD 1JPFA 2A0LC 5E2JA 2VLLB 4KROB 5B39G 4X8XA 5D72H 1HHGB 1NAKH 1BM3H 2IALA 2W9DL 5HYQA 1YN7B 3T0EE 2ZPKL 4QRRA 4MXVE 5F6IC 4IJ3B 3Q6FB 5ADOL 1JGEA 5MI0C 1FYTE 3ULVD 2LV4A 1R3HB 3VDCA 4FHBD 4UOJA 1ADQA 5C0DA 1JK8B 1FO0A 4Y2DD 4YNYB 5EUOE 1JTPA 4JAMA 4BK5A 1HWHB 3I9GH 1S5HA 1IM9B 2BNUB 4FXLA 3C60D 3I84A 5H37G 4M1DL 2OK0H 1CXIA 3T2PA 1KLUA 2VSDA 2CDGA 4UOW1 3GK8L 4GRLC 4Z7VA 1T89A 2F19H 4P5MB 3MRBA 5ICXA 2E27H 4QTHB 1RAMA 1FRGH 1F8TL 4GLRI 3QAZC 4P23C 1T7ZA 1U8IB 1CXLA 2QQKL 1EEUA 3QDGD 4O2EA 1DE4A 2HLAA 4JGUA 3RWCA 5E6IC 3AS0A 3B9AA 4QHUB 3TBYA 3LRHA 1OLZA 1N4XL 3VXUE 4TTGA 3PWJA 3RPIA 3X3FH 3CFDB 3OXRB 2X1QA 3ALWA 4JN1L 4DGIH 1ZLVH 3V6OA 3UEZA 3M1BA 1AJ7L 5GGVL 1CXFA 2D9QB 1F4HA 2YMXL 3RWJA 3KPSA 4U6VL 3ARDB 3P0YH 1CR9H 1J8HA 3QIBB 4Y5XC 5DRZA 1JZ8A 3GBML 1CIUA 4F7CB 3MLTB 5GGTL 1BFSA 1OVZA 3G04B 1MJJB 3AY4A 3P0VH 5FGRA 4HUUA 3VFNA 3P9MA 2QQNH 2HG5B 1HHJA 1MHPL 4J1UB 4PRPA 1X5YA 5C9JB 1CVSC 1XGPA 3V5KA 2NQCA 5GS0C 3N1PC 2X1OA 4KJPD 5I18H 2BDNH 1UA6H 2NY7H 3WKNA 2QADD 1QSFE 1KCSH 4UT7H 4EI5C 4MAUH 4MNQE 1XIWC 2A9NL 2NX5B 4CJ0A 1JGVL 2ICEA 3BT2L 4PJGF 2AS5M 2NY5C 4XMPL 3WLWC 1MY5A 2J8OA 1ZSDB 1OLLA 4RAVA 5FYKU 3SGDH 5FYKE 4L8CB 4ODTL 1YEEH 5E5MB 4I13B 4OFYD 5EZIH 3BIBX 1NKRA 4OCSL 1E4WH 2XRAL 2GKIA 5E0QA 4OLVL 4HH9B 4O2CB 2P48B 1N2RA 3HAEB 4Q6IA 4MD0A 1C5BL 1UZ8A 5INCB 3IJYA 4CMHB 4ZAKA 1YEKL 4X5XB 4HWUA 3SOBL 1G6RH 2F54B 2XA8H 3WSQH 3IU3B 4P57A 5HHOA 1RK0A 3MYJB 4J7RA 3BDYL 5SWSE 4PRID 2GUOA 5FKAB 1LK2A 4BFIB 3GHBH 2PCPB 3X3GH 1D3CA 4NWUH 3VMOA 5I0DA 3CLFL 4QHNB 3LKRA 1K8DB 3BP5A 4GRLD 1SBBA 1NFIB 2DQHH 4Q9RL 3QCTL 2AGJH 4AIZB 2FJGA 4OCXH 4HUMB 2AQ3A 1D7FA 3V7MA 3BH8A 3BKCL 1A8JH 2IAMA 1KENL 1U93B 4JO4H 1QEWA 2ENSA 3JV6A 4LLWA 2LQRA 3CVIL 5IWLC 1TETH 3QPQC 4OGXH 3BPNB 3BZEA 4S2SB 3M17B 4P2RB 1G7PB 4JFDA 1FL5B 1LVEA 5E6ID 3VXRB 1RUPH 1MCEA 1HQ4B 4WUUA 3TBSA 1QTYT 1C12B 4WHYH 5F7DB 4J3VA 4IDJL 5IF0B 4O58L 3QEHB 4ETQA 1FH5H 4UILH 2ICWA 4RMSA 4L8SC 1KTRL 4AT6B 1U3ZA 3VD3A 3C5SB 1I7ZA 4PBVC 2BY1A 2SEBA 1F4AA 1UWGH 3ZKSD 3O41B 1F6FB 4G8GB 1M05B 3KPMB 5J13B 1T2XA 5J57B 1AO7D 4OZFH 4CDGC 2HKFH 3U7YL 2HMIC 4OM1H 1R0AL 4HKZA 2FBJL 1PW3A 3QUMB 4LNRA 4CVUA 1UACL 3CLEH 3SCMB 4Z7UB 5ESQB 2YRLA 4Y4KA 3MRHA 2IPUG 1NCWL 4ELMF 1GIGH 5GS0D 3T4AA 3NOIA 4OZHF 4TSBL 5FCUH 5I19L 3H9ZA 3RTQC 3IDMB 3VH8A 3PQYE 4OBSA 2EE6A 5IMMB 1WIOA 3BP6B 4LVHC 4R0LC 5TDOB 3SBWA 5FYLH 1XIWD 4NWTL 1YYML 3UBXI 1MREH 1QSEB 3C8KA 2FEEL 1OGAD 4PJ9C 5I9QC 5DK3A 1ED3A 2H8PB 1LO5A 5BCAA 4X6CB 1Z3GL 4NKQB 4JHZA 4NNYA 3KVQA 5EUKB 1JWSA 3W0WA 1BOGB 3TLRA 4K7FA 3MA9L 2X6MA 2HKHH 5C0EA 2WP3T 3NIDF 4AEEA 1VFUA 4PJFE 4NYLB 1WVZA 5E03A 5BZWA 4BA8A 3HMXL 4DTGH 3AROA 1F58H 3EDEA 3KLHC 5AYUH 2VKXA 1EGJA 2NY1B 4JFXA 2B5IC 3NPSC 4X6FB 4PJGA 3C9NB 3BESR 3D2UD 4L29B 3DV6A 3ZKMC 1BQHB 1F13A 1X4ZA 3DX9A 2XQBH 3NN8B 5C0CB 1A7NH 5HI4C 4DW2H 4JFEE 3M45A 1ORQA 1I4FB 1Q9WB 4LRNL 4M1GH 4CL7A 1FFOA 4HFUL 3T1FA 1MWAA 3VXPB 1XMWA 1I8IB 5E2TL 1KFAL 4JREB 1O0VA 4WW2F 3OB0K 5ANMA 1D9KB 1IZKA 3TVMD 1Z9OA 5CEZE 4R2GC 5JHLL 4NZRL 5DI8A 5HHPB 5BJTB 5HJ3B 1UADC 4Y8DC 2GEEA 3HCVB 4R3SB 4LSPL 1PKOA 3TJEL 4PJ7B 1FIGH 1M71A 5CP3A 4PB0L 3FTGB 3CVHH 1Y18B 5KSBB 5ESAA 2N1KA 4NO2A 1A02N 3UO1L 2Y72A 3ARFB 3D6GA 4OT1L 4NQED 3V6ZA 2YK1L 1LP9B 2UZIH 1T7XA 4OGZA 2VDQH 4A2MA 4NZTL 4M7ZC 3KGRA 2UY6A 5DMIL 3CZJA 5F72S 2ITCB 4K3EH 3PIQB 5EB9A 2PYEE 3D0VB 3O3EA 3T65A 4AY0A 4K23H 5E8DH 1A6TB 1E28A 2E8ZA 4OLZL 1NFDB 1WFUA 2XZQH 5KSVA 2OTUB 2NZIA 3RU8L 3UBXB 3W39B 4PJBB 5B3JF 5LKNA 3EO0A 2Q7NA 4M9PA 5HHQB 4U0QB 2CO6B 4XAWH 5I74C 4QRUA 1CE6A 3ECBB 3V6FB 2VTFA 3REWA 4JHBA 1EERB 2ZUXA 4LSSH 2V5SA 5BMFH 3L9RB 2GT9B 5JIPA 4UDUB 4IRSB 4YO0B 2FJHB 4YHLH 1QLFB 1IRAY 5ITBH 1Y6MR 1BQLH 4XB7A 2LAAA 2WMPA 4RA0C 2WW8A 2XWJB 5IJKC 3T8XA 1NCNA 4Z0BH 4YXLH 3U2SA 4F58L 4HPOH 3LSOB 4Z78A 4OBRA 5L0QB 4I8DA 3H9YA 2EEAA 3RVUD 4Y2DA 2VZOA 2JB6B 3PXHA 4D9QD 1A7BA 1OAKH 2M1KA 1QFHA 4XPGH 3C60A 3VXOA 4PJ9D 1FNEB 3IB4A 4ELMA 2J3SA 3HI6H 2KPNA 1OB1A 3BUYA 3TIDA 4OZHA 4ZFFB 1ZGLB 4MMZC 2A6KB 1QRNB 3IVKB 4G9FE 1KG0A 1IQDB 3IXTA 2D7OA 1CDBA 5I75B 1SEBA 3P0GB 4JFZL 3GBNL 4M3KB 3ZT5A 4TSAL 4ZSOE 4IRJB 5D7IE 1GGUA 3QDGA 5L8JB 4Y89A 2G75A 1AGDA 3ZKMD 4GLRH 1FFRA 4MQXD 1CU4L 3HC0A 4JDVA 1R5IB 3HAEH 5MENA 1CLOH 1DP0A 5C07E 1MHCB 1KJMB 4NP4L 32C2B 5IK3B 5A3ID 1U8QB 3ESUF 1GC1H 3BPLB 2C1PB 4QCIB 2BXZA 2P8MA 3PHOB 3TH4T 4GKNA 4UOW0 1CL7I 5DEFA 3V0VB 5T3ZD 3Q5YA 2MCG1 5T33L 2E7BA 4RISL 2FR4B 4NRXA 3QFJB 2B2XL 4C83A 4PJAF 3RBGA 4YHKH 5B38B 3V5DB 5ISZB 3WO3B 1JTOA 5IB4B 4BFBD 5CJ5A 1RZIA 4JG1L 1A14H 3A6BL 3R06A 2X4OA 3MLSH 4UINL 2J5LC 4HX1B 3LVEA 4WW2A 4TTDC 5EOCL 3MRNB 3QQ3A 5FYJH 5J9PB 3IETA 4TYUA 1R3IL 4LKCA 3VXQB 4JZNB 2J1KA 5GJSH 2PKDA 2X40A 5C70A 3L5XL 4HT1L 4NQCE 5L88H 1IEBB 4QO1A 1RY7B 5KVEL 5B39A 1J9CT 3VWJB 1IILE 1D5BB 3ULUL 3CC5A 4RGOL 1EAJA 4OLWH 4EIZC 4XBPA 3O3DA 2IPTL 5CJQH 5DQJA 4M9OA 3DX7A 3QDME 4PJXF 5C0BB 4TVPD 1WZKA 5I1HH 3F7YB 3AS2A 4JO2L 1YNLL 3X12B 4U6HA 5MERB 3PP4H 2QTEA 4YDVB 5DHVB 5F3HA 5J1TC 1NEZB 3THML 5L2KB 1IT9L 1DQDL 1HH9A 1OP3H 1JYXA 5DMYA 2VXTL 4PJ8B 5E2WL 3ZSTA 5E08L 4PGDB 5FM5O 4FG6C 2ZSVA 3I2CH 3RZWA 5E95B 4M6NL 4QY8A 3RIAK 5IW6B 1R3KB 3FQRB 1F11A 1YJDC 2DMCA 4PRIA 2CLVB 4WV1A 1HOCA 4JZJB 4QNPE 1ZANH 5E1HB 1IFHL 2Q87A 5HPMB 3PF2A 3UJJH 2OL3H 4QHLB 4WHTA 1BVKA 4YDJB 4MX7B 1IKNC 2ZZUT 3PWVA 3OL2A 4HDIA 3NTCH 4QT5B 2IQ9H 2NTFB 2UWEE 4DAGH 4K9EH 1WBZA 1RJLB 1T1YA 2XY1A 2AJ3A 2L7UA 2AJZB 5D93C 3DV4B 5JXEA 1B0RB 4C54A 2Z35B 4OIIH 3CFBA 1E27B 4LMQI 5DVLA 3UROR 4KVCL 4F15B 3PL6D 3LEVH 2CK2A 1TZIA 5FKPB 1EK3A 3UC0H 3MLUH 1S7WB 5I6XB 5H8DA 5EPMA 4D0DA 2C3WA 2V6HA 1T5WB 5SX4I 1BFVL 4JRXE 1NGQH 4Z7OE 4HV8A 5E7FA 5I1DA 3DGCR 2ZCHH 1MFAH 4BSJA 1RVFL 3GSNB 1RULL 2VDLH 4QOKE 1UXWA 4QKXB 2VLRD 5BZDB 1F6LL 4NDMB 5DC4B 3VI3F 4JPWH 5T3XD 1YNKL 4N9GA 4YH6A 1ZEAH 5D1ZC 1FCGA 4X80L 4TTDD 5IR1B 1INEH 4AQ1B 4Q0XH 1YPZE 2PETA 1AQDA 1HNGA 2VH5H 3TCLA 3SDAB 1Q8MA 5F88A 4XX1E 2CGRL 3P11L 3WE6A 3CZFB 4PJAA 4R26L 3EYQC 5BRZE 2QL1A 4IBLT 1VESA 1LEKA 4Y4HC 1MQ8A 1RUQL 5F9WC 1BJ8A 3HN3A 4N0UB 1A1MA 1IQWL 3NCJH 1R24A 1FL3B 3J7HA 1RZ7H 4NNPL 3UJIL 4WNQA 2P46B 1OGAA 1YY9D 2NLJB 5GSVB 4N8VG 1IL1B 1CYGA 2O5XH 4E5XA 2ITDB 3O6KH 3B9VA 2ADJA 2P7TB 3BH9A 5EOQL 3QNXA 5AZ2H 4HMCA 2C7UA 4ZOCA 2BC4B 3KR3H 4KKAD 1SY6L 3AS1A 5T1MA 2A83A 4JRYA 3JWDH 5MEPB 1CGVA 1JJUA 1ETZB 1Z5LA 4PJEB 3FONA 2V9RA 4UU9A 1C7TA 1U42A 3MV8A 4ZPVA 3H6JA 4PJXA 5H94B 3KJ6H 3P9WB 3G6JB 1AXSB 1TJGH 5B4MC 1P4BH 4ORGA 5LXGH 3S3JA 2VZTA 5F7WC 4YXKH 1CFVH 3TVMA 4S0SD 5GGQH 1H15A 1UM5L 2X4QA 1NUGA 4WY7H 5IVXE 2CUHA 1KPVA 3O4LE 1V7NH 2FGWL 2XN9D 2ZCLL 5DRXA 1IGMH 4KQ3H 2KDGA 4L8DB 2R0WL 3D69A 4OKVA 3WIHA 1T1XA 4GXUN 1LD9A 4IS6A 2VXVL 2BHYA 1P5VA 1U8HA 1FL6B 3IDNB 2G5RA 1KCVH 3BP7A 4NQEA 1UB5B 4DKAA 1A47A 3FRUB 1JZ6A 3MRIA 4N8CH 4S1SL 4DGYH 3NIFE 1MFNA 2PN5A 4J6RH 3O4OB 4OLXH 3KPRB 4XT1C 3S35H 1GZPB 5AUMA 4E0RA 1AD0B 3WN5B 4J12A 1UB6B 5TE6L 4MAYC 3NMEA 2WK2A 4GKSA 1HQRB 4UQ2B 1ZLWK 3SHSA 1M7DA 1ZT1B 2G60L 1RZ8A 1BIHA 1D6EB 2A9MH 4Y4FB 2IADA 1CFSB 5EO1A 5JW3L 1HINH 3X13B 4AG4L 4PUBL 4NHCH 4UIMB 4S10A 3NH7H 4MA1C 3PHQA 5TH2B 4HS8L 2APFA 4ODBD 3KLAB 4HWBL 3TZVD 4ACPA 5D1ZD 3CXDL 3IJHA 3MBEC 1B2WL 1DUZB 2VXUL 5KVFH 1IC4H 2UY7A 1S9XA 3E0GA 1YEJH 1NSNH 2Z92B 1VACA 4DJMA 3H42L 4EQ2A 4AM0A 4GO6B 4QHMB 5EU6A 5HHME 4HBCL 4NO5B 4HHAB 4X7SL 5ADPL 2GJ6D 4LU5H 3EYQD 4LRIA 5HYJE 1I3RB 2F58L 2EXYD 4DKFH 1FGNL 5DZLA 3UPCA 4LPYA 2GSGA 2ZOKB 3OHXA 4P9ML 1HE7A 1YNTB 3DXAB 3BGAA 2HA1A 3H9HA 5HGBB 2D03H 4LEXH 2BOBB 2XZZA 4V2CB 3G5VB 3FFCD 5FO9A 3BP4A 3WFZA 3QDJB 2W65B 2R56L 1QVOB 5DT1L 2FX9L 3VD7A 1S3KL 3WXVH 3H2WA 3BZFB 1SJXA 2DWEA 5FYKL 4PJDF 4YK4B 1UWEL 5F7MC 1KBGH 1ZTXH 4APQC 4YQXH 1HHKB 5DHVH 4UUJA 1BVLA 2JK5B 2HFFA 2P5EB 1TFHA 4F2MB 3W9DA 3KYOB 4NGHH 2P8LB 5B4MD 2OMNA 4MD5B 1YEFL 4I77L 2CSPA 3WD5H 1O7VA 1S7SB 5EN2B 1A3RH 5BOPA 4F8TA 1KB5L 2VAJA 3HZVB 1JN6A 5FHAH 1XR8A 2A73A 3RRQA 1OTUC 4XP5H 1CL7H 2N7AA 4PBWD 5C0RL 4NM8H 1NBZA 1KEML 1NAMB 4XMKH 2VLRE 1T21B 4X6BA 3RWHB 3M8OH 2HTKC 5DYOB 1KSRA 5F7FA 1KNOB 5E5RB 5E24E 1KLFA 4RMUA 3ZYIA 1MH5A 2WBJC 3IFLL 5D6DA 1JHLH 1E4XL 2H1PH 1SBSH 3VGFA 4FXGA 1KELL 4BH7A 2HFEB 4PV8A 5C08D 1NGPH 2V2WB 1TZHB 3VD4A 1LDPL 3UTOA 5F9JB 3UX9B 3UYRL 5A16A 4GW1B 1A6AB 2AJVL 4PG2C 1N64L 2XWTA 2BOCA 3IDGB 3DMMC 4YR6B 1T1WA 5BVPL 4DCQA 1FORH 3HE7C 3ILQC 3EYUH 4IEFB 4MA8H 3MFFA 4L4TD 1V7ML 1U9KA 3ULSA 3A6OA 5LGHH 1BBJB 2IF7A 3LPGA 3U9PL 4XCEA 3MLRH 5J56B 4LAQH 5DD0H 1QOKA 5IHUL 3FN3A 1JGDB 2AEQH 4HC1L 3NVQA 4RGNE 4DOHE 3QSKB 2GAZA 4JZOA 3MBED 2UUDH 1A6VH 1F00I 2ZSWA 3VGHA 3RI5F 3D85B 5IOPB 1AR1C 5IEKB 1I9EA 2V9TA 4DN3L 5ABDE 4BKLA 2NYYC 1AGBB 1I8KB 3VFRB 2OCFD 3FO2B 1T0MB 4I18C 2Q7YB 3QIWD 4FNLH 4DFIA 4JANB 4KTEH 3PDGA 3ZYOA 3ROLB 4ZFOL 4FTVD 5D1QB 5FGCE 3FB5B 1CGWA 4IIQC 4S1DD 3L3DB 5FA3A 4K55A 4A6YL 1Q9KB 3MUHL 1DFBL 4GQ9H 2VZ3A 1ZS8B 4Z77B 4JDTH 3ARSA 3WS3B 3ULVL 1LWRA 4XCNA 2YD2A 1OAZL 3PGCB 3UJTH 3CFKB 3QCUH 3E6HA 1P7KA 2YPVH 3ZYJA 4HIHB 3IGAB 2EDKA 2DAVA 4APQD 4F7MA 1KB9K 1B88A 3UTPD 1FZOA 3B2VL 4P2QE 4NO3A 1U8KA 2COQA 5E4EB 3PWNB 3PL6A 4TUKL 1UJTA 4ZS7H 5DUBB 3TO4A 2FO4B 5TE4H 3F7RA 4L9LB 1FCCA 3LS5L 3V52H 4M8QA 4HMEA 3T4YA 3QT2A 2D2OA 1OSPL 2PTVA 5GZOC 3RGVD 5JHDA 4PJDA 3QUZC 1KXTB 1G9EA 3QJFA 3BO8B 5EWIH 4P5TD 3QYCA 1FIEA 2G2RB 3CFCL 2Y7QB 1P53A 1I1YA 2F74A 3RDTC 1BPVA 2DQUH 2APBA 3RFZC 5SX4H 4MNGA 1OTUD 1MCDA 4Z9KB 4BK4A 2ARJB 3QULA 3QNZB 1U8MA 1S7TA 4FQIH 4RMWA 1NGYA 1MCPL 5SX5H 4ONOA 5EFIB 2HTKD 3U0TA 4J23A 1AGCB 4WEBH 1EO7A 1AGEA 3U36B 5EOTA 3CJJA 2B1HH 3LEXB 1DQML 5C8JB 4OUUB 5IB2A 2ZWLT 3G5XB 4NRYB 1L7TH 4J2XA 4D0CA 4NJ9H 2ATKB 3PDDA 4BUHA 2IG2L 2AEPL 2NY4B 4U05A 2H6PB 3P9LB 2VL4A 1RZKL 1ZT7A 4FQJH 4MXVF 3C6SA 4E9LA 3QPXL 2Y5TB 5FGBC 1GSMA 3HE7D 3ILQD 1OD7A 4ZG1A 3LKQB 3SO3B 2RFXB 4HJ0C 1AHWB 4EDXB 3QHTC 5DVMA 1FQ9C 5EUOF 1F6AB 3BWAB 3WJJC 1WZ1H 2DN7A 4F33A 1UQSB 3O2DL 4YHIB 1FN4B 1YDPB 1CFQA 1MCWM 1J0ZA 2ZJSH 1IGJA 3VXSA 3P30L 4BELD 4FP8L 4ISVA 4BFGA 1S78D 1FSKB 4CVZB 1EFXD 3FQUA 4GMSH 5F7NC 2RB8A 3SGEH 1AR1D 4QHKI 2Z31B 2EICA 5JW4Q 3WUZA 2P5WE 1K2DA 1IMHC 1JPGA 4AL8H 4A2LA 5H35B 5IIEA 2AKRB 3BPOB 4LLYA 3TT1L 1DL7L 4WDIB 1MI5D 4IHOA 1I1FA 4Y1AE 4PY8I 5EO9B 2F53E 1M1SA 4LSTH 1CFBA 4HUWA 4JFFB 2Z91B 3SGJA 5DJDA 1PKQE 3TNNA 1EO5A 5CILH 1RURL 1DANU 5AD0B 4S1RH 1BZ7B 3OPZL 3RWEA 2AI0L 4U0RC 4QXGH 4P0DA 4FFVD 1HHHA 2XN9A 3U4EA 4PJ5B 4OFVA 1GGTA 2IALB 3L3HA 5E99L 5HYQB 3RQ3A 3UAJD 5A2IH 2BVQA 2ERJB 4QRRB 4NN5C 4XBEH 1AI1H 5MHSE 4ZXBA 3P4OA 1JGEB 3V4VL 3FQWA 4XP4H 1RU9L 2BJML 2DQGH 2XPGB 1FNSL 4JAMB 2O5YL 2X4SA 1S5HB 4Z5RA 3IXAA 2X89D 4Y5YC 5C7XH 4LCIH 3U4BL 2XOTA 3HUJE 3PWPE 1BWMA 3KYKH 1INDL 2ICCA 3FHQA 4RQQA 5GZOD 3ARDC 4C57C 4EN3C 3VXMD 4M43H 5KTEL 3JXAA 2NY6C 1U8NA 2K9UA 4I0KA 1P4IL 5ICXB 2AK1L 1W8OA 3B5GA 3CFJA 3EDFA 4V1DA 1F4WL 2HJLB 3WKML 1DE4B 3CK0L 5DD5H 1KJ2H 3FO1B 3IT8D 3HNTL 2HLAB 3HPLB 3I6KA 3TZVA 5B3NA 3QUXB 5FYLD 3RWCB 4L9DA 5FOJA 2YUXA 1OSZB 4N8VA 3GSUB 1NAMH 2VLMD 1I8LC 1ZA6A 3OF6D 4JG0L 3LH2H 1B4RA 1FVEA 1A1OA 5D7LE 4X5LA 4LLQA 4LQ1A 3STLA 1EH9A 1XH3A 4WJ5B 3T2QA 5GS0L 1N5AA 5T1DL 2FHCA 3E2HB 5E9DE 3U1SL 4LLAA 3VWKB 1NMBH 1OPGH 4HJ0D 2EIZA 2OSLA 1P4LB 2JJTC 2OTPA 4DVRH 4JFQA 1H5BA 3MCKA 4HUUB 3RKDD 3P9MB 5DJ6B 1INQB 2Q3AA 1MCIA 5CEYA 4YHML 1YZZA 1CE1H 3OAYH 4OD2A 3UTTB 1MQKL 3OJDA 3V5KB 1JZ4A 1ZVSA 3SY0A 2NY5L 3AB0C 3T0EA 2VLKE 3GJFA 3L5WA 4CMHC 3TA3A 4OJFH 4N0RA 4GUPB 4NZUL 3D5OF 1GC1C 4FRWA 2ICWI 3VXTA 4M7LT 5EUOA 4X7TA 1CLZH 1CDUA 1IM9D 3IDUA 5D1XA 4OTXH 3SE8H 4I9WD 2I9TA 2E6JA 3C8DA 3L3OA 3JTTB 5E5UB 2R4RL 4RAVB 1ZHLB 4F9LA 1FGVL 5DRNA 2FATL 1M7XA 4J3TA 5I1GL 3EDJA 4NSKA 3G9AB 4MJ5B 1KN2H 1JTTA 1FBIH 1MCLA 1H0DA 2VDRL 2DQEH 3ISWA 5A2KH 4EXKA 4Q6IB 5C0AE 3TT3H 3IJYB 5KS9F 3E6FB 5CHNA 2XFXB 3OKLB 1LO2L 2VDNH 5EZJA 4NFDA 1B3JA 2FJFA 1RK0B 2MMXA 5HHOB 1A6UH 4Z7WE 2GUOB 3SQBA 3TO2A 2VZUA 5GS1A 4PGJA 5TF1H 2Y1VA 1Y6NR 4XH2A 1WV7T 5FECA 4RAUA 4GAGL 4ZNEE 4PJCE 4B0MM 2I60L 5E8NA 3MLZL 1U3HC 5DQDH 1I9RH 5D7KE 3ARDD 4PS4H 1TPXB 4WFEE 4O00A 2GCYA 2LE9A 4TUOA 2RGSA 3MR9A 1GGBH 3QDHA 5FDYA 1CD8A 3VFOB 4L4TA 1QEWB 3SCMC 1NCBH 3JV6B 5TFSL 1MEXL 4NPYA 1KCUH 3ROOA 3INUL 3KJ4B 1F5WA 2W0PA 3S37X 4XPAH 1FZKB 1KCLA 3BZEB 1T0NB 1IC7H 3IDIA 1EHAA 2RQ8A 2VLJE 4WUUB 4RAHA 3DROA 1QYGL 4YIQB 4PJFF 1QSFA 3ZTJG 1A1NA 2QJDA 1U2CA 4AJ0A 2CRYA 3CSGA 1PSKH 5DSCA 3VJ6B 3MACH 4MNQA 2FYYA 3EZJB 4WU5A 2FGZA 2NX5D 3QIWA 3BVNB 1VGEL 5CSZB 1I7ZB 5JXAH 2OP4H 1DBAL 2SEBB 1IGTB 2WAHA 1GGIH 1YN6B 3NZHH 1PG7X 4PRNB 3G5ZB 4XZUA 4WWKB 2HT4C 4K9EC 1JVKA 2FO1A 3Q2CA 3DYPA 1CXKA 1A5FH 2LVCA 4JR9L 5CJOH 4UTAL 4YHZH 2XACC 3RY5A 3T0BA 3C6LB 3GMOA 4HKZB 6CGTA 4XX1G 2DDQH 3MRPB 4R90H 4Y4KB 3HR6A 5KVGL 3ZMRA 5FUOH 5IVNA 3T4AB 3CDFA 1NUDA 1OAUL 1RIUH 3RUGF 4KZDH 4DN4L 4NC0B 3QDAA 5IMLA 1CQYA 2CKNA 2F54D 2LU4A 3HLAA 3TYFB 5FA4A 1XGYL 3D18A 5IFHH 2UYLA 5SV3A 1A6PA 3HZKB 3RNQA 1D9KC 2NW2A 3NIGF 4JO1H 5SWSA 3C8KB 4EVNB 4YDLB 2DLFL 5EC2B 5ESVB 4NFCA 3W11D 1YY8B 3P77A 3GJEA 4HKJB 5DA0B 4MJID 2OR7A 5MEOA 1JWSB 5E00A 2EYSB 2VKWA 3W0WB 4LHUG 3RGVA 3TN0B 2AXJA 3QUKB 3ME0A 2VQ1B 3PWLB 4P5TA 5DD6A 3ARBB 5FYJD 4NOBA 5EO0A 4P59L 2FCBA 3ZHKA 5BZWB 3WIIH 5IB5B 4IM8A 5F96L 4HS3A 5BW7C 3ARFC 4LARL 5GSRB 5T3ZL 4F37F 4PJGB 3NCFB 1T3FB 4P2RD 4JKMA 3DV6B 4B41A 2V2TA 1RUAL 1MHEA 4XAKD 3VXRD 2A6IA 1XGTA 4HEPG 3WHE0 1WIUA 2AK4B 3WS6C 3H9SB 5C6TL 4PGEB 1MWAB 3T1FB 1WCBB 2HLFC 2QSCL 3WDIA 5C0JB 1NGXB 4PBXA 5ANMB 4IMKC 2N7BA 2VLME 1MJUH 1CD9B 2Z4QA 5L6YL 1WT5C 1ADQH 1FO0H 4M93B 4TOYL 4Z18A 1T5XB 5DI8B 4G8GD 5DWUH 3BE1H 2BNQB 5DTFB 2QQLL 3EJYC 4FZ8H 2HFGH 4FQLL 3T0DA 2O5ZL 1M71B 5KS9A 5DJAA 3JWDC 1FVDA 1VENA 4HCRA 1I7RA 3L7FA 4NT6A 5ESAB 5LBSH 5JOFB 3SKOA 3SCMD 5KANG 2V17H 5KVMC 4MS8C 5FCSH 2W0LA 5HYIA 3EHBC 5LGJB 3V6ZB 1EFXA 2P4AB 1PYWA 2FX8L 3FT2A 4TVPL 3ARVA 3DX8A 4KUZL 1N7MH 3KPOA 2C4FT 5HGDA 2D7PA 5L0QC 5M95B 2OM5A 2YD5A 3O3EB 3T65B 5B8CA 2MSPA 1QSED 5EA0H 3I02A 3U7WL 5D7IF 1JUFA 2ICWJ 1JGLL 4UDTA 3CSYA 4U1HA 3EO0B 1KJ3H 3CXHK 4N1CA 5K33A 2HT4D 1EPFA 4HXBH 4J8RA 3CDYA 4KKLC 5J6GA 1SEQL 2HVJB 3KYNB 3C5ZA 3DWTA 3L7EB 2MWCA 1BD2E 1X5KA 1G7JA 4PJFA 2FHBA 5I75C 3NFPA 1QD0A 1A7QH 4GG6E 4YXHL 2R8SL 2NY1D 4QRPE 4FQ1L 3FN0L 1MIML 4GSDH 4UT9H 5C0CD 1KIUA 4LF3A 4P2CG 4XVTH 2YUZA 1E4JA 3T8XB 1I3GH 1CFTB 3DLQR 4FA8A 3U2SB 2D0GA 1MCKA 4YBLC 5TDNA 4Z78B 3MLVH 2FSEB 1A2YB 3O6ML 1QBML 3VFUB 1D9KD 2B0SH 1WISA 3H7BB 4WCYL 4FQ2L 3U9UA 3QI9A 3HB3C 3BD5A 2Y06H 1YC8A 1QLRA 4G6JH 3VFMB 4JM4L 1IAOA 1TJHL 4ELMB 5BS0E 1JHTA 3NA9L 3A6CH 5JUEL 1OB1B 3BUYB 2DJ4A 4TULH 3OG4B 3RUGA 5IFAH 1YC7A 4P3DA 3VXMA 2YA1A 3IXTB 2ZUUA 3B5HA 4XC1L 1LHZA 4GAYA 1SEBB 1U6AL 2YD3A 2DLIA 3ARFD 3EOAA 1UCTA 5FO7A 5K59E 1J0JA 3LB6C 3SJVE 2G75B 1AGDB 3T77A 5IESH 3LKNB 4JFPA 5DUPH 3DO7A 5MENB 1P6FA 4PTTA 1H3UA 2ZG3A 1JPTL 4F9PA 2W0FA 4HD9A 4ZO6A 2HLFD 1BX2A 2JJUA 5B38G 1MFEH 3MV7E 1AD9A 2PYEA 4WHDA 2ZUTA 3VWJC 2AJYH 1CFNA 4PTUA 2P8MB 2P47B 3OKNB 5DEFB 4DGVL 3ZDXE 3U0WH 3SDXE 3P4NB 4I0PA 5DHYA 3EJYD 3SGKC 4WUKL 3W2DH 2CK0H 3U6RB 1SQ2N 1IBGH 2YEZA 1OAYH 5L7XH 1KTDB 4IRSD 3R06B 4I2XA 3UTSE 5TPWL 1A0QH 2BHZA 2AJXH 4WW2B 4ZTOL 4J3OC 4MS8D 4PJ8C 1K8IB 1HHGA 3EHBD 1CGSH 5EZLB 2AQ2A 1YN7A 4LKCB 4MSWB 3BISA 3U4AA 4IMLA 4LOUC 1J18A 3Q6FA 3NPZB 5K9JH 1R3HA 1F45A 3LN9A 4FQHA 3U82B 5B39B 1JK8A 4FMFA 4YNYA 1W2KT 3K2UH 4GW4A 3CC5B 1IM9A 3LMJL 1XR9A 2BNUA 4XTRD 3IJSA 5C86A 3O3DB 1NEZG 4JPVL 5DQJB 2GQHA 3IDJA 5ACLA 1I75A 4JE4B 4KKLD 1FNHA 5FK9B 1QRND 4U6HB 1NBYA 2XKSA 4MJIE 1XGUB 3BEVA 3HC3H 3AU1B 5FB8A 4N68A 1AE6L 5LWYL 4GRWE 5FYJU 1U8IA 4M8VA 1YJDL 2GTWB 4IRJD 1Z0NA 3G6AB 4ZSOA 5FYJE 2V5YA 5CZVH 5D7IA 1N3NB 5GRZA 3QCVL 2PTTA 4F15C 1FC2D 3OWEA 3WLBB 2ZSVB 4BSVA 5C07A 4QHUA 4YGAB 3OXRA 1YPZF 2PR4L 1F11B 1IGCH 4L4VE 4WV1B 2JJSC 1S9VA 2V9QA 2RBLA 3QFJD 4YX2L 2OTWB 4P99A 3WFHA 1BVKB 4Z76B 5ISZD 1JGUH 3PWVB 1LQSR 4HDIB 2KBGA 3CGTA 3QIBA 4ALAL 1EBPA 4JHAL 3RZCA 2YPLE 3MLTA 2W9EH 2YKLL 3G04A 3BIAX 2B4CH 2VJXA 3TWCL 4J1UA 5I1IH 2L0DA 4GRMA 3QHZH 5C9JA 2VZVA 3CFBB 2J6EA 2FLBT 3LB6D 3GSQB 4G6KL 4X6CF 4Z7UE 4GXVL 3MOAL 1EGJH 1I8MB 1KC5L 1KXVC 3C09B 3V4PL 1FDLH 1TZIB 2HRPH 3E8UL 1FAIL 1RHFA 1J7VR 3KDMA 4U1KA 4WFFD 3VWJD 1B90A 3I50H 5LCVH 5FAAA 3ZL4L 4HV8B 4I1NB 1MWAH 1OAXH 3O9WA 3ETBF 3EFDL 5AWNH 3U7AA 5J4MA 5C0BD 4MXWL 4PLKC 5TQ0L 2APWA 2HN7B 1UXWB 1HIMH 3EO9H 4L8CA 5E5MA 4HUXA 4XXCC 1E4KC 5D71H 1JHKH 2GTZA 2OJZL 4K2UL 2XXCB 4R9HA 5GRXG 5L2KD 4F8QA 1X4YA 1VFAA 3HNSL 5CP3H 2C3XA 2YD1A 5IVXF 3FB6B 4PJ8D 2HYMA 4O2CA 1AQDB 5KVDH 1MJ8H 3H3PH 3ARQA 1KXQE 2VDOL 1PDKA 3O6FC 3ZE1E 1LK3L 2C4FU 5DVOA 5INCA 4PJ7F 3WE6B 4KRNA 3V4UH 4FABH 1Q0XL 1LEKB 3MO1A 2F54A 2IBBA 3IU3A 3R8QA 4XC3H 2KKQA 2KQNA 1X5XA 1R24B 5FKAA 5I1AA 3KLDA 2VDPL 2PCPA 3IS0X 1LP9F 4WNQB 1GZQA 1K8DA 1CWVA 2CO7B 4OZIE 2UWEA 2V7HB 4KJYB 2C7UB 4L5FL 2YD6A 4QGTA 1DZBA 2JB5H 1GOFA 2A83B 4JRYB 3DYOA 4HIXL 2FEEI 4PJBF 4JQIH 2GY7B 5TJWK 4OIAA 5AG9A 3S3SA 4B5EA 4UU9B 3BD3A 1IM3B 3MV8B 4ZPVB 1FL5A 3VXRA 4H20H 3LZFH 3L3IB 1B6UA 1OY3B 5F7DA 5F9DC 5GS2H 3NCBB 3HI5H 1J0KA 3QEHA 2E9IA 3GZKA 1EHLL 3BKJL 5FGSA 4JRXA 1A22B 3RWFA 2DKMA 2VXQH 1H15B 2J8UB 2HFTA 4KTDH 4CU6A 2Q8AL 3WFDH 3RX5A 5FM4A 4Y4FC 1KPVB 3VMNA 4G8GA 1M05A 4R4BA 3BKYL 5DRXB 1MF2L 4Z95L 4K7PL 1U91B 5HGAA 2NXYB 3D69B 4POYA 4OKVB 3DHMA 1T1XB 3ARGC 2FB4H 4NHUA 1LD9B 3QUMA 4M7KH 4AIOA 1U41A 4CMMA 4JM2F 3MV9E 5C71A 4LASL 5HDOA 5ESQA 1YPZA 2FIRT 4Y5VC 1U8HB 4F57H 3MXVH 3SDAD 1MCWW 5D72L 8CGTA 1NAKL 2HRLA 1BM3L 3SE3C 4G8IA 3JVGC 4NN7C 4X6DB 1OW0C 1EEQA 1LILA 5BRZA 3IDMA 3HC4L 4HGKC 2BK8A 4C59B 1CVRA 3BP6A 5KSUB 5TDOA 4XHJC 4E0RB 1Q94B 5BV7H 3HE6A 1VA9A 2FD6H 4W6WB 4NQDE 1UWXH 4GKSB 1QSEA 3I9GL 1NCDL 4K3JH 5D4QA 5TGBA 5JPMB 1D5IH 5I73B 2H8PA 2IJ0C 4PB9H 1TQBC 4X6CA 2OK0L 2Q86A 3TM6A 5EUKA 4LCUA 3ZTNH 3E1F1 3A67H 1WBXA 1VERA 2X4UA 3PHQB 4CUCA 3P4LA 4E42B 5IG7A 2JCCE 2EXWC 4DZ8B 3BMVA 2FL5A 4Z0XB 3IJHB 5JIKA 4KV5F 4NYLA 4HIIB 2E27L 4JLRA 4F7TB 4NM4H 1FRGL 3LQAL 4LFHD 1CN4A 3ZT7A 1VACB 3MREA 4LHUA 3C9NA 4Y16A 4HF5H 4AM0B 2W60A 4L29A 5EU6B 1PD6A 1T80A 3OQ3B 3SE4A 3NN8A 5D2NB 2ZUWA 4OV5A 3B9KA 1CDYA 4M6ML 1Q9WA 1I4FA 4W4NA 5IVZA 4CU8A 4OCRH 1AXTH 3OHXB 4TNWF 1FPTH 1MELA 4U1SB 3X3FL 4FFZH 1CD0A 1PLGH 2AJUH 1SJEA 4DGIL 5T5FL 5IVXA 3O4LA 1OP3K 3HCVA 3OKDA 3DYMA 4O51B 4LCYA 4C56B 2EKJA 1KCRH 3QFJE 4XB8A 4PJ7A 3P0YL 4F3FA 1CR9L 3FTGA 2DWEB 3GIZH 3PGDA 1Y18A 4NQVB 1ZLUH 1GCFA 1GAFH 2CUIA 3P0VL 5H37H 4J3XA 2QQNL 1T83C 2HFFB 1DVFA 5LAXA 1LP9A 3IRPX 2P1YA 1YEIH 3K0WA 4L3CA 2YD9A 1MFCH 4DQOH 1TJIH 5I18L 2BDNL 2AXFA 3KPRD 1UA6L 2DLTA 2IH1A 2NY7L 4UI2A 1KCSL 2VE6B 1TXKA 2YR3A 4UT7L 4MAUL 5H2BB 1MVUB 4AQOA 2WBKA 3WJLA 4WGVB 4Y4FD 4CW1B 1X5ZA 4XNXH 3GSOB 3W39A 4PJBA 1J10A 1JN6B 4LCCC 1G9MH 2PNDA 2A73B 4NBYB 4G8EB 5HHQA 4D9RE 1ZWIB 3V6FA 1NBZB 1YEEL 4GOSA 3U0PB 3BN3B 3L9RA 4D3CH 1AIFA 4LBEA 4X6BB 5E7BA 4IRSA 4YO0A 3LDBC 2FJHA 1QBBA 5SWZE 4PJHE 1E4WL 1QLFA 2YXFA 1DQQB 4FXGB 3DUSA 4PV8B 4X98B 5AAMA 3ZZ1A 3BDXA 2XWJA 4G43A 5HYJA 5CSGA 5HGGS 1G6RL 2YMXH 2XA8L 2BOCB 3WSQL 5CGMA 1T1WB 1LE9B 3DXAD 3PP3K 1HXYB 3DETD 4JM2A 3GHBL 1WTLA 4FXKA 1FNEA 3X3GL 3GBMH 2R0LH 4X4XA 3QDJD 1XAUA 4NWUL 1FP5A 1VKXA 2BSTA 1YMHA 2A6KA 4OCNC 2AGJL 4X7FC 3IVKA 4OCXL 2EXWD 1CI5A 1QP1A 1JYWA 4JZOB 4QXUH 5AZEH 2EDHA 1GRWA 1PX3A 2H2PD 2IMMA 2Y5EA 3UZQA 4JO4L 4EBQH 2DIAA 2EDJA 1ND0B 4XRCB 3U83A 4IRJA 3B6SB 2BNRB 1TETL 1HEZB 1U8JA 3FO9A 2E7LC 2P5ED 1H8SA 3K2MC 5E4EC 3UDWA 2B1AH 1R5IA 2BHUA 4YAQB 4XCYB 2H3NB 3AAZB 1RUPL 1KJMA 1HZHH 1TENA 1VDGA 3B2UD 4ZFGH 4GFTB 4TNVK 4XNYH 1U8QA 3EKCA 1FH5L 4UILL 4QCIA 3TGXA 3PHOA 3QJHA 2FR4A 4XCNB 2R29H 1UWGL 5J1AB 4N0FB 5B38A 3V5DA 3B9EA 2EIDA 4GBXA 5F1KC 4OLVH 2HKFL 4OM1L 5DVKA 2DBLH 4XNUH 1QO3A 5F1OB 4HX1A 3WEXB 1DBKL 1WWBX 3CLEL 3KPNA 4QGYA 3MRNA 3W5MA 2DJUA 5TDPA 5J9PA 2DIJA 5GGUB 1L7IH 1ACYH 1U8KB 1MHHB 3MSPA 5CMAB 2EC8A 1J87A 1YEHH 5HHNB 5FCUL 3VXQA 2NY4C 3TO4B 1YQ2A 1C8PA 1XZ0B 4BH8B 1LEGB 4KRMB 3BQUA 3D3VE 3QO0B 5IROC 2H32B 3S37H 5JHDB 2DLHA 5ICYB 1N6VA 5FYLL 1TTUA 2MOVA 3QJFB 3X14A 5L9DH 3C2SA 4PJEF 1MREL 1I85A 1NGWA 1I1YB 3X11A 5K9KB 3V79C 3R4DA 4MNGB 3R1GH 5C0BA 2X9XA 1UGNA 3D1MC 4GAFB 5CIPB 3G6JF 3F7YA 3MUZ1 1U8MB 1J05A 3EIFA 3Q6GH 3EFFA 1S7TB 4JN2A 5DJ0A 3X12A 3GI9H 2QKIB 3OAUH 3QWQB 3I75B 5DHVA 1GYAA 2DD8H 1NEZA 2HKHL 2OZ4A 5EIIB 1IGYB 2NY2C 1AGEB 2Z31C 3UZVB 5L2KA 1PG7H 1X5HA 3MRDB 3EOTL 5EOTB 3WIHH 2R0ZH 4DTGL 4I3GA 2UZYB 2YOCA 5AYUL 4HIEB 4JPIA 4PGDA 2DJSA 4ETYA 1JE6A 3BPOC 3PDOB 4D0CB 5C3LD 3FOMA 3BUTA 5D1QD 4G7VH 4LKXA 1EMTH 3VCLB 3VFSB 2XQBL 4LDEB 1KB9J 3KXFE 2EEDA 4M1GL 3C6SB 4Q7DA 1R3KA 1UFUA 5CLTA 2WWMD 4PIRF 3AREA 3HZMA 3PUCA 3OXSA 4JZJA 2DKSA 2FBJH 5HPMA 2V2XB 4KMTL 3T3PF 3VXSB 5C0FA 1SYVA 2XQYG 1CIDA 4U4BA 4RGMB 4UBDC 2B8OT 3FZUC 4QT5A 5JO5A 2NTFA 1FIGL 3FQUB 4U3CA 1RJLA 4H25B 3CVHL 2AJZA 5K9OB 1JL8A 3DV4A 3N9GH 1B0RA 4ZUSB 1DQJB 2EDYA 5I66A 1EO8H 1E27A 3IFOA 1EJOL 4P2QA 5IIEB 4WO4B 2UZIL 2VDQL 4IHOB 4ODHH 5FKPA 1S7WA 1ERNA 1R6VA 1NCAH 1I9IH 1T5WA 4K3EL 4KY1L 4PJIB 1T89C 5DJDB 3O3AB 2XA3A 4L4JA 1Z3GH 3JV5A 5E8DL 1FG9C 2XZQL 2NY0B 3GSNA 4OZ4B 3RWEB 4XP6H 4YFLI 1HHHB 5HD8D 3U4EB 1ZOXA 4XAWL 4PP1D 2I9LA 5GPRA 3TPUB 3CU1A 5D5MB 5GXBB 5BMFL 5C6PB 3SKMB 3P4OB 5IGXH 2OYPA 5DK0A 4LRNH 4LSUH 4HFUH 4HULB 2L4OA 3SDAA 3V6OC 4EI6A 4Z5RB 3S36L 2NY4D 3CFIC 2YC1A 3G9VA 4Z0BL 4YXLL 5SV4A 4U7SA 1NH6A 4HPOL 1CDHA 3DRTB 4NC1C 1FL3A 1U8NB 1A7RH 4URTB 4XVUD 1OAKL 3U30B 2EH7L 4XPGL 3AY4C 3K80A 3CFJB 2PO6B 4V1DB 5JQ6H 2Y23A 2P7TA 3HI6L 3UO1H 1G0DA 1F4XL 4WRLA 4UB0H 3AM8A 2BC4A 5AEAA 5TQ2H 2Z31D 5TE7H 3HPJA 5F6HI 5J11C 1ZK9A 4NZTH 5C09E 2VYRE 5MEPA 3F58L 3DUUA 2APVA 3CMGA 5F89B 1IZJA 1FVEB 3KHQA 4PJEA 1A1OB 5CBAA 1G7MB 2DLGA 4KKBC 2ILLA 3ZSSA 5H94A 4JY6A 4HWZA 3MC0A 4OCYH 4Y1AA 4N0YH 4N1HB 1XH3B 3G6JA 1AXSA 2F53A 1CLOL 3RU8H 5I30H 2V5RA 3N06B 1UJ3B 4U1MA 3MUGB 4JFFD 5IMOA 3DTXB 2WIIA 1UKSA 4EZMA 1PKQA 2CJUL 1JZ7A 2OSLB 2Q3ZA 1GC1L 5GJTH 5DK2A 3HG1E 3OV6A 4WENB 4LIQH 5CZKA 5GGVY 2UUDK 4JFQB 3MCKB 3PNWB 4PJ5D 3ARUA 4PJCF 4UTBH 3V8OA 4YHKL 3L5JA 4UBDD 3OJDB 3FZUD 3SY0B 4L8DA 4XP1H 2AV1A 4Q6IC 3T0EB 3QUYA 4QRRD 4WFHD 3VDBA 1A14L 3TA3B 1GH7A 4ZAKC 4GS7B 1AFVH 4XPTH 4C55A 1FYTB 3VXTB 3MLSL 2WWKO 4RFEB 3IDNA 3OGOE 4F58H 5EUOB 5FYJL 3FB7A 3WO4B 5D1XB 3OSKA 4DUXA 4M1CC 1WK0A 3SN6N 3MGAA 2I9TB 2C1OB 3L3OB 5DC0A 3HUJA 3RY6A 1CF8H 4XBGA 1TPXC 4JRWA 5FV1L 1AD0A 3WN5A 4D2NA 5L88L 1UB6A 1B4JH 1ZVHA 1F90H 1HQRA 4UQ2A 1XT5A 1ZT1A 4OLWL 2IAMC 3CMOH 1CFSA 4LNVA 2IANE 5CJQL 3X13A 4H0HB 3TCXA 1H0DB 2E6PA 4QYOB 4UIMA 4MQSB 3MRMB 4P5KA 3PXJA 5I1HL 4K8RL 4MB5A 3PP4L 1RK1B 3QUXD 2OMBA 4NN6B 4LLUA 1DUZA 2FLRT 3H8NA 3VXUB 3IFPA 5EZJB 4E41E 2VDKH 3QXAB 4NP4H 2FJFB 1MLCA 3LIZH 3QQ9D 3GMLB 5I0ZA 3TO2B 5GS1B 3MRQA 1I3UA 5T1LB 3JUYA 1NBVH 4XH2B 5FECB 4RAUB 2DQTH 3I2CL 3LHPH 4DKEH 1RPQA 2NY3B 5E9DA 3VWKD 2ZOKA 2GCYB 1YNTA 3DXAA 3EOBA 5SX5K 2MPAH 4YZFE 1E4XI 4RZCB 2CRMA 1ZANL 1OT1A 2VDMH 3VXNB 3OR7B 1MIEH 2W65A 4NPYB 3UJJL 2OL3L 3UTTD 1SM3H 4RNRA 3BZFA 3CU7A 1TZGH 4L3EE 5CS7A 3SDCA 2IQ9L 3GKZA 4DAGL 4XHQA 4K9EL 3DROB 1PGRB 5CKGA 3ALPA 1HHKA 2LU7A 3WYRA 1QSFB 5T3XH 1A1NB 4K3GA 4KRPB 3SBWC 4OIIL 4MNQB 2EYTB 3BAEH 3VGAB 2FYYB 4ZPTA 1MRDH 4KKBD 4W81A 2P5EA 4F2MA 1A7OH 3KYOA 4RGOH 3LEVL 1A21A 4G9DA 5ALBL 2P8LA 5B22A 1I9JH 2IPTH 1X6LA 4XZUB 3UC0L 3MLUL 2R1WA 5D70H 3JZ7A 3RX8A 2E7MA 4M48H 4JO2H 1S7SA 3MXWH 5DD1H 5EN2A 3R8BB 1NGQL 2B4CC 3GMOB 3RL2A 4PPTA 5F7EH 4JO3H 3FQTA 2ZCHL 3HZVA 3WNKA 1MFAL 4MD4B 2QR0B 2VDLL 1DQDH 1H9VA 1EIBA 5C0AA 3BFOA 4JPWL 1FV1B 4X0KB 1A7PH 3MRJB 5EBWA 1N6QH 1LO4H 5IMLB 1HI6B 1KNOA 1ZEAL 3OKKB 5FA4B 4X4MA 1JI1A 3F12B 5HHOD 4CJ1A 4HK3J 1INEL 4Q0XL 4P46A 4PYHA 4KK8C 2NW2B 5SWSB 2VH5L 2V2WA 3GIVB 1KB5B 1X5LA 4YC2B 4PP2A 3FKUS 1CBVH 4PJCA 4GW1A 1A6AA 3LN4B 3GJEB 4I5BA 3UMTA 3CX5J 4S0TD 5FOBA 3NCJL 5DD6B 2KQMA 1F02I 1RJCA 1RZ7L 1QG3A 5I8EA 2R9HC 4JY4B 1NANH 4HS3B 2O5XL 2Y36H 1JGDA 1PJ9A 4B7IA 1H3VA 1TQCB 5AZ2L 5E6YA 1WIPA 1XGTB 4WUUD 3KR3L 5DO2D 5IOPA 3D85A 2CDEB 1RZJH 3MUY1 1G84A 1I8KA 3VFRA 3JWDL 4XPBH 3V5HA 2R2EA 2DMKA 1T0MA 1W0VA 2EDXA 2Q7YA 4GG6F 4JANA 1WAAF 1PBYA 3F5WB 4IOSD 5D1QA 3KJ6L 1E6JH 3FB5A 2J88H 1JNHB 4WWKD 4I4WA 1TJGL 1KEGH 2L7JA 1P4BL 2XTJE 3D39E 4JCMA 5LXGL 3QZWG 3C6LD 3IFNH 4Z77A 1CXEA 1I7RB 4YXKL 3WS3A 3MMEA 5E8EA 5GGQL 1FFQA 4KK9C 4WY7L 2H26A 4Y4KD 2EDBA 4WFGD 2BMKA 4O5LH 1ONQB 4PG9A 5GISH 1IGML 1S9WA 2EDEA 4KQ3L 3KG5A 4OCLC 1PYWB 3DX8B 3AMKA 3PQYB 1EAPA 2OQJB 4JFOB 1FYHB 5HGDB 5HYFA 3SE9H 4Y2DC 2XTLA 5B8CB 4R7NA 1KCVL 3VRLE 1IQWH 1JUFB 4YBHA 3C60C 3CSYB 3OGCB 1W0YT 3MODH 2FO4A 4DGYL 4L9LA 1CXHA 5IFJA 2W1NA 1IAKA 4J6RL 5A2JH 4OLXL 3OKEB 3QWRD 4J8RB 3OAYK 3S35L 2X2YA 4UV4H 3W0WD 3Q1SL 3TN0D 1CGXA 4X7EC 1J86A 3I6LD 5KG9A 3C5ZB 1QSVA 3ARBD 3HS0A 5DD3H 2D4DA 4Z7VE 4PJFB 5DRWA 1A9BB 1HKLL 1C08B 4TN9A 2A9ML 3NFPB 1RZFH 4G5ZH 3ZDXF 3SDXF 2GITA 3QEQE 4NHCL 1J1PH 3NH7L 3QA3A 5EFIA 2D7NA 1L6ZA 5ALCH 1AGCA 2AK4D 4HAGA 5BV7C 4JFEB 4Q74A 4TQEH 1IAIH 3H9SD 1RJYA 3PABB 1MLBA 3DVIA 3GJFH 5KVFL 4NKDB 1IC4L 5TDNB 5C8JA 2J8HA 4KK8D 3G5XA 1PZUB 4NRYA 1T2QH 1U8OB 2ATKA 2MKLC 4P2OA 3QI9B 3G08B 1QLRB 3QWOA 1K3ZA 2H6PA 1MAML 1JHTB 1F3JA 2BNQD 4DKFL 1I7TA 1T20A 2AEWA 4JCLA 2EH8H 4P3DB 3TP4A 5CBEB 3EGSB 5ID0A 3KPSE 3ZKND 1AHWA 1J8HE 4BFEA 3BWAA 2R9HD 1DDHB 2X1WL 1FN4A 1YDPA 3CXHJ 5D96B 4WW2C 4X8JB 3MJ9A 2YZ1A 3EOAB 2EDWA 3DX6A 4PLNC 2EZ0D 2EC9U 1SMOA 2R1XB 4OF7A 4PRPE 4HLJA 4JFPB 4KJPC 4PTTB 5DZNA 1KBGL 1ZTXL 2W0FB 1XF1A 2QADC 4YQXL 4Z7QE 5L8LB 1BX2B 3VFTB 1AD9B 2PYEB 4R96A 2C3GA 4J4PA 2VC2H 1XF2A 1XEDA 4FQCH 4AEHH 4HAFA 5H35A 2AKRA 5TE6H 5EU5B 5HGHB 4XPFH 4WDIA 4YLQT 4I0PB 4NGHL 4UAOC 4OCWL 4JFFA 5JW3H 3VGEA 3WD5L 1AC6A 1WWWX 4ZUUA 1BD2A 5AD0A 3V0AC 5CKAA 1A3RL 1BZ7A 1MCJA 4KK9D 4ZS6C 1IE5A 4LLMA 4U6XA 2W59A 1BGXH 1B2WH 4G3YH 4GG6A 2VXUH 5FHAL 1WAAA 4PJ5A 4QRPA 2EE9A 5CD5D 15C8H 3EDDA 3Q5OA 4MQ7B 1CL7L 3P73B 1KIQA 5GS2D 5F7HA 4KHTH 2LVEA 4NM8L 5DJYA 4HBCH 4DVBB 4OB5L 3SQOL 4IMLB 2CH8A 4XMKL 3M8OL 2QSQA 5JOEA 3MLPA 4GT7A 5F6IB 5HVWA 4FQHB 2F58H 3MUJA 2XPGA 1JHLL 2H1PL 1SBSL 2H45A 5GHWH 4GW4B 2K7PA 1XR9B 1G9MC 4MZ2A 4WV1C 3IJSB 3TH3T 1NGPL 4FFWD 2CKBA 3IDJB 2P43B 5BS0A 1RQ5A 5JW4N 1JI2A 3GRWA 1NBYB 4G9FB 3EYUL 2IPKB 4MA8L 4Y19E 4OLUH 3BEVB 3HFMH 4TSCL 3NBNA 5FB8B 5LGHL 3IKCB 5JXEC 2EDRA 2EIBA 1KPUB 1W72L 1N0XL 4ZSOB 3MLRL 4P23B 5D7IB 2HJLA 2APTA 3OX8A 2C26A 4FQQB 4LAQL 2PTTB 5DD0L 3FO1A 2AEQL 3C09C 3PV6A 4KDVA 3HPLA 4WW1B 5I1LB 5MEND 3QUXA 4NQUA 3O2VH 4BSVB 5C07B 3LD8B 1OSZA 1A6VL 3IDXH 4JFDE 3GSUA 3GMRB 4DEPB 5DFWH 1G7QB 4WUUE 5DJ8A 4H1LG 1VFOA 2JE8A 4FNLL 4MZ3A 4LCWE 4O02H 4HPYH 4KTEL 2A6JB 1S9VB