1YQVH

The crystal structure of the antibody fab hyhel5 complex with lysozyme at 1.7a resolution
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
215
structure length
215
Chain Sequence
EVQLQQSGAELMKPGASVKISCKASGYTFSDYWIEWVKQRPGHGLEWIGEILPGSGSTNYHERFKGKATFTADTSSSTAYMQLNSLTSEDSGVYYCLHGNYDFDGWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKILD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Water molecules in the antibody-antigen interface of the structure of the Fab HyHEL-5-lysozyme complex at 1.7 A resolution: comparison with results from isothermal titration calorimetry.
pubmed doi rcsb
molecule tags Immune system
molecule keywords HyHEL-5 Antibody Light Chain
total genus 37
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2005-02-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yqvH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yqvH02
2VDOL 3BKYH 3FCTA 1S3KH 5JPNB 5D2NE 4WWKA 2Q87A 4B5EA 1RUPL 5J1AB 2XWTB 5JNYB 2XPGA 4M48H 4HKBB 3OHXB 3FTGB 1C1EL 4NJ9H 2E6PA 2DKSA 4WRLA 1TMCB 4ZG1A 1KBGL 3FMGL 5E6ID 5CD3B 5TJWK 5IFAH 1SYSB 1OPGH 3FT3B 1C7TA 1NLDH 4PJHA 3WFDH 5TE7L 4QLRA 1EERB 2PTTB 5J56B 3VGAB 5K9JH 1NBVL 1A6UH 1DANT 4MLSA 1EHAA 4HC1H 2DTMH 4L4VD 1WLHA 3SY0A 4WJ5A 2EXYD 2QSVA 1JN6B 1AE6H 4XPTL 5T1KA 3ZDXF 4UIKH 4ZS7H 4NRXB 2CKNA 1OSZA 3MLYL 1JHTB 4O58L 4YHPA 1EBPA 1AD0B 5K9QG 4YGVA 2OYPA 2P5EB 1FNFA 4P3DB 5I8EA 2R56H 2V9TA 3TO2A 4KJYB 2IH1B 4I8DA 5C2UB 3QFJE 2EE6A 4Y2OA 2ATKA 1U6AL 1W0VB 5AZEH 1IQDA 5C9KA 4Q58C 2HFGH 2MOVA 3HZYB 1JGDB 5JHDA 4NHUA 2BC4B 3D87B 4LLDB 4EI5C 1X5FA 3UYRL 4K23L 2X05A 3UBXA 2R1WA 1B9ZA 4YBHA 2Q8BL 3WSQL 4OCXH 1Y18A 4WUUA 5IOPA 4QXGH 4Y4HC 5IIEA 3LKNA 1P2CB 2C1PA 4TNVK 4EI5D 4XMPL 4X7CC 4OZGF 5TDOB 1VESA 2OP4H 5JW5B 3VFSB 3ULUF 4ZAKD 3U4EA 2HFEA 2HT2C 1FFOA 1I1RA 3SDCC 1NCAH 4U6HB 1CL7I 4CW1B 5I1KH 3D3VD 2J1KA 4R96A 1OGAD 1HYSD 4KC3B 3IF1A 3FT2A 2DJ4A 5IROC 1IQWH 4HEPG 5FYLE 5GRXG 3QHFL 1GGTA 1M7DA 1NCDL 3GJFK 1INEL 5I73C 4NQED 3U4EB 1T03H 1K4CB 4YDJA 4LLAA 2YRPA 4OSUL 4Z7UE 3UJIH 1MI5B 4P2OA 1WVZA 3FQWB 4OIAA 5IB5A 2WV3A 5C70A 5CGYC 1AXTL 5IVZB 3SDAA 3QEHA 4L8SB 3SPVA 3S34H 5CGYD 3GK8L 4ZO9A 4FQQB 2B0SH 3EHBC 1KJ3H 2AKRA 2NY4C 2GW5A 2ERJC 1B4JH 2YSSB 1CICC 3WLWC 5KVDL 3T0EB 4M3KB 3P4OB 4AIZA 1U8IB 2QKIA 1NC4A 4KJPC 4U3CA 3EO9H 4PV9A 2JIXA 1LDSA 3RX7A 4NQVB 1S9XA 4FOMA 1ZEAL 2D03L 3VXUD 1QFOA 2CDFB 2I5YL 3UTSB 1KF9B 1DQQB 1TVBA 1AHWA 1FP5A 4YNYB 3MUHL 3RBSA 5A2KH 5EOTA 3KPLB 4GXVL 5HHNB 1RFDH 2YXMA 1UXSA 4NO5B 2OK0H 3FQUB 3NTCL 1MCFA 3U9UA 2AK1H 3UZQA 2BOCA 2MMXA 4WFHD 4ZFGH 4UV7L 5ACZB 3SY0B 3MZGB 1M4KA 4YQXH 1MRDH 2WUBH 2OZ4H 4J23A 2IBBA 2E7MA 1EEUA 2M26A 3DX9B 2NLJB 3U7WH 2EKJA 1K3IA 4UIMB 4LHUG 5IBTL 3O4OB 4FFVC 3RWFB 3T3PF 2BNQE 1AGCB 2APFA 5DWUH 4F7MB 3BPOB 4PY8I 1I7RA 5I1HL 2YSSA 4M1GL 5DZLA 3HB3D 3CXDH 1KNOB 3WIFB 4Z7WB 2XA8H 3B9VA 1DQTA 4O5LH 2J88H 2P46B 3RWEB 1G7QB 3MACL 1RIVL 5T3ZH 3L95B 1DDHB 4G3YL 5T1KD 1FL6B 5HYQA 3WN5A 4L4VA 4EEEA 3HE6D 1DUZA 3ZKMD 4OJFH 3BKJL 4V1DE 3QCUH 1BQSA 1MFEL 2MHAB 3FONA 1KJMA 5EC2A 5DJYB 2FEEL 3C6LD 3BD5A 4CW1A 5E7BA 2W0KA 3FOMA 3MRRB 4FXGB 4MAUL 2Q8BH 3PE9A 4DVRH 3EW3B 3L5XH 4HJJH 5B39A 2D31B 3LZFL 4Y16D 4PJGF 5GGTA 1FC2D 4X4MA 3PL6D 4XNQB 5D7JA 1X6LA 3DGGB 4DAGH 2OP4L 4MD4A 4NRZB 1JPFB 4K8RL 4GUPB 4FG6C 3QI9A 1UM4H 4NCC2 3M17B 1FZOB 4NO0D 1LMKA 4O00A 1OWWA 5KTEL 3LKPA 1HEZB 2HFGL 3D9AH 3MRQA 1NANH 1UA6H 4WV1A 3RWIA 3GB7A 3G6AB 1CICD 3WLWD 1IAMA 1U8QB 3UTPD 1P7QD 3MV7B 5GRUH 2DIJA 5D2LB 2G9HB 5HYJD 1T21A 3D5OF 1X3DA 1ORQB 2Z9TA 4JLRB 3BQUB 4LLYB 3GMOA 1A1NA 4YHPB 2GAZB 3OKEA 2OXGA 2VL5B 3KYMA 3RJQB 3IFPA 4PRPA 5KW9L 3WJJC 3ZE0F 3L95A 4KTDL 2E27L 3ULVD 4AIOA 1YDPA 3BPCB 4HZLA 2FO4A 5I1KL 1J1PL 3C09C 3RWDB 2NY0D 1AKJB 2LFGA 4NQCA 4QXUH 5HGDA 4QHLB 1RUQL 3QDJD 1QHPA 1KFAL 2H2SD 5EU3A 4YHYC 4MCZA 2A6JA 2W91A 4WDIB 2ZCLH 3VFGL 4OZGB 5DK2B 4IIQA 4OI9A 3X17A 2CKBB 1RJZB 1NL0L 3KVQA 3KYNB 3QFDB 4O4YH 4KK8C 1HOCB 2OSLA 2DWDB 1KTLA 4YFDB 4WWKB 4JFFD 1AKJA 4LBEB 1JFQH 1AP2A 1FYTB 2R15A 3DVIA 5DA4A 4JEGB 2ZNXA 3HI6H 2KKQA 1YDPB 1S7WA 5EBWB 1BJMA 1PVHA 1EIBA 2RR3A 4PRPB 4KQ3L 3U9UB 2NXZB 1TJIL 3BIBX 4XXCA 3WUZA 3HI5L 3T65A 4GG8B 2UUDK 4LSUL 3GSNA 1S7VB 2CDFA 3HZVA 1JWUB 5IFHH 4JFXA 3G6AA 2PKDA 2CKBL 2NY5H 3T1FA 1J8HB 3QG7L 4WV1B 5TH2A 4MAYB 1NFIA 2P42B 1CGXA 1NH6A 2UVFA 3FHQA 4HXAL 3NAAH 2CXGA 2BSRA 3O3AB 4KRLB 4NP4L 1YMHB 4Z7UA 5I8OH 1IBGL 1LO4L 1QO3A 4N1EA 4JFEB 1AO7A 4K3DH 5F7DA 1UKTA 2B4CC 1FE8H 3BIAX 4I77H 4DZ8B 1CE6A 4ZPTB 2G2RB 4Y5YC 1TPXB 3N85L 2NPLX 3VRLE 4EDWL 1CQYA 1KYOK 2P5WA 4Y19D 2GYSA 43CAA 4XNQA 3WEXA 1MFEH 3RWGA 5GZNC 1A6ZB 1I8IA 2DQCL 2QQKL 3VXSD 4B41A 2JB6B 4X6FB 3LQAH 2AEQH 1M7DB 4JFPB 2VZ1A 3MLTA 4LCYA 5H94A 3MRRA 1VB9A 5KZCD 4YHOH 3VMNA 1KCUL 1NSNL 3K7UA 3O2VH 4MWFB 1BQHA 4OFVA 5DJYA 2G75A 2Q8AL 4OGXH 3GJFB 5AUMA 1S9KC 1B6DA 5J12B 5INCA 2IGFL 2VZSA 1RZGA 1OB1B 2KQMA 3PHQA 4YBQC 1YMME 4U6TA 2HFEB 5KAQF 4WFGD 3T0BA 5IT2L 4QRSA 4C55A 2F5AH 6FABL 3GSOB 3LKNB 2P8LA 1I9EA 1R5IB 3LRSA 5L0QC 3CFKB 4I9WD 3HUJE 5IMLB 3Q5TA 4GKNA 3KNBB 4JPWH 1JP5A 4PJDA 3V9FA 2GTWB 1XR8A 1UCBH 1DFBL 5JHDB 3WSQH 4C56D 2A0LC 5F71A 5IEKB 2VDML 2ZUVA 3MUGB 1RZKC 3P30L 4GSDH 4JQXA 2Z8RA 5HHMD 1UB6A 5AYQA 1INEH 4N68A 2FRGP 4GO6B 3RP1A 1WWWX 5IVXF 2J2ZA 3SDDB 1OVZA 1YYLL 3DXAB 3GO1H 3HMXH 1DUYA 3K8MA 1OQXA 1AR2A 3VDAA 3TYGH 5MP6L 4V1DA 1N8ZA 1H9VA 2IC2A 5GIRB 1E4JA 1WFOA 3HS0B 4MJ5B 2ZCLL 2DTSA 4P46D 1ADQA 2VQTA 4FFYH 3UJTL 3VFUB 5JXAL 3DX8B 1Y0LB 5EU7C 2QQNH 3L9RA 4PRDB 1IGJA 5MHSD 2CO6B 4IRZH 1DVFD 5ANME 2VLRE 2HYMA 4NYLA 5DRNA 4L8CB 2GSIB 3BPNC 3NZ8A 5DC0A 1FAIL 3BEVA 2YS4A 4HKBA 3BX7C 4PR5B 3IDYB 4FP8H 3UZVB 3ZT6A 1OOAA 1S7RA 5JR1L 1SM3L 1QEWA 5ALBH 5BVJB 1J11A 5CILH 2H3NA 1T1WB 3DUHA 3SDDC 3RKPA 2X4SA 5JQ6H 3TESA 1DTUA 3EGSA 4OLVH 3TM6A 2C3HA 1OAYH 4P0DA 3EJZD 2GJ6D 3JV4A 5BV7B 5DVMA 5IBUB 3MRDA 5JTWA 5ACLA 3I85A 1LNUB 3WFCL 5EUOF 5D7KE 4JCMA 4NQXA 3BSZH 4HGMA 4QOKE 4RCAA 1F3JA 4GS7C 2RBLA 1JPSL 4RAVA 4UV7H 1KIQA 1R3HA 3GIZL 4N90E 5J6HB 4M1GH 5K9OA 5MENE 5D7KD 4AMKL 1JK8B 2R2CA 1LHZA 4YDLC 3UBXG 5F7WC 4M1CC 2DM2A 1DN2A 3LD8C 3WNMA 1TJIH 3U7WL 3HE7D 4NKDB 3LPWA 2V7NB 4ZQKA 2NZIA 5C0EA 3STLA 5BJTB 3S37L 4CMHB 4I48A 3EYSH 1U8OB 4CL7A 3V0WL 4FTVA 5EA0H 1NSNH 1A7OH 3MXWL 4UDTA 1JGDA 3PWUB 3QDGB 1FIEA 4FQCH 4Z7QF 3VXQA 4XVUD 5ALCL 4MB4A 1QFUL 1QSFB 5TGBB 2DQEL 3NA9H 1QSFA 5TGBA 1WISA 3WE6A 2NTFA 3Q48A 3MUJA 1S7UB 3U6RB 2Y9RT 4Z18A 1R5WA 3EOTL 4M9PA 4F8TA 2DLIA 1G7IA 1LK2B 5ADOL 2BXYA 2E6JA 2F5AL 2N7AA 4FTVB 4JPVH 3PWJA 1DBKL 2Z31C 4KV5F 2UZXB 5C0NC 4HPYH 1U9KA 1I8LA 4TSAL 4YHNB 4U0QB 2WLZA 3ALPA 3WNKA 4E9LA 4JFZL 5I6XB 2AJUL 5CS7A 3MLUL 3C6SB 4ZDHB 4K7FA 4MA3A 5JQHC 4ZOEA 3L5XL 1PGRB 3HE6A 1BJ1H 4KGLA 3OJDA 4EBQH 3SGDH 4K8RD 1BFVH 4P2QD 1YUHB 5KG9A 4U1HB 5IBUG 1R0AL 5TE6L 5GGUA 4KRPD 3MLXH 4KDVA 5K9JL 4LSDA 4MD0A 2NXZC 4P4KA 2FGZA 3GSWB 3LKOA 4A6YH 5IGXL 3ZKMC 2EDFA 2P5WE 5SWQA 1RMFH 2HTLD 4YPJA 2V2WB 1UA6L 3OG4B 4C58B 4WU5B 4IBLT 5MEPA 1G7PB 3WUWA 4H8WL 4PGCB 5DK0B 5F1OB 5I2IB 2FR4A 2UWEA 4HF5H 4J6RH 3I6KA 3D39B 5I17B 1QRKA 1YMMD 4LCIL 1FYTD 5GRJH 5IEHA 1H8OA 2BRQA 1AGBB 1JCKA 1JYVA 4JPKH 5E1HB 4YHYB 3L9RB 2FHFA 3HPJA 2JJUA 5CEZL 2G5BA 2I25N 3HFMH 2YD3A 3QA3A 2NY1D 1JF1A 1T7WA 3QUKA 1CWVA 2AEPH 1ZGLM 2IQ9L 4QGYA 4PS4H 5DT1L 3N1GC 4FNLL 3KPRE 4U1JB 4ODWA 1II4E 1JTOA 5E4EC 4BZ2H 4D9RE 3MRJA 1W8NA 3B2UC 5IM7A 1T1XA 1IZJA 3QR2A 1YJDL 2VJXA 3D2UB 4RAHA 2W9DH 3QCTL 1MWAL 5D2LE 3Q6GL 5C0CE 3BJ91 4HFWA 2UV3A 3EYQD 4BJLA 3FB7A 2A73B 5C0GB 4ZYKA 4WGWB 3HAEH 3SKMB 3QIUC 3CXHK 5I8CB 2WBJC 4NP4H 1EMTH 1SHMA 2DM3A 4BSVA 1NC2B 3VJ6B 1Q0XH 4RRPG 1QPXA 5IMLA 4LFHD 3O81A 5GJTL 3DETD 1VCAA 3OKOA 2X2YA 4WNQB 4FABL 4J3UA 3HI1A 3LMJL 3OJ2C 4ZUUB 5GSVB 2AEQL 4M6OH 4WTZA 1A4KB 4LEOA 3IJYA 5I74C 1EH9A 1T66C 4CN6A 2CJUH 2DQGH 5J8OA 4RWHA 1T4KA 4FQIL 4KMQA 1NDMB 4WI9A 2NY3C 4KMTL 1QKZH 3DV4B 3LS4H 5JUEL 2DB8A 1SVCP 4Y4KB 1YY9D 4HXBH 2VC2L 5A2FA 4X6FA 2RGSA 1RHHA 2XWBA 3DJ9A 1I3GL 5D7LB 1C5CL 1A64A 1OW0C 2H6PB 4IS6A 3WEXB 2ZKHH 5C07B 2R56L 4XNZB 2BY2A 1ZHNB 2UYLA 3WIHA 3C5ZB 3T0EE 3MRHA 5T5NG 3UYPA 1M05B 1Q9KA 4YUEH 2EYTB 5D7LD 3V5HB 3ZO0A 4U7KA 3ULVE 1LE5B 3VMPA 3MYJB 4L3CB 2K3TA 3LKQB 1JGUL 1XR8B 3PGCB 1IEAA 3IJYB 3KPSA 5F1NA 4HIJA 1QG3A 5B8CA 3O3EB 1RZ7L 4H1LH 1F8TH 2VO5A 4PLJD 2VSCA 3MYZA 4MAYA 3BAEH 4G9FA 1SEQL 1FLTX 2ENSA 3G5VA 1A7NL 5HVGB 3UEZA 2IQAA 1CLCA 4PB0L 4XNUL 4MNHB 3O0RL 4L5FL 4X7TB 4NM8L 3P0VH 5IB1B 4BH8A 4RX4D 4DWHA 4Z0BL 5F7NC 1QQDB 1ZS8A 5CIPH 2HA1A 5SWSE 1EAPB 5CHNB 1R5VA 4LBEA 1P6FA 1JRHI 2X7LA 1OAKH 3D3VE 5TE6H 1VERA 5BV7C 3HNTH 3KPTA 4IIQB 5KSBF 1WFTA 1IVLA 4GRLD 1T0NB 5K33A 2OR9L 3FL7A 3SN6N 3GDBA 5DMIL 4H88H 2MTPA 2APBA 3BZFA 3IFLH 4XWGH 1HXYA 1GYAA 1F6LL 1T83A 12E8H 4DUWA 4IDJL 5I1JL 3ZKXC 3BPCA 4HZLB 3QIBB 2XRAL 4PRDA 4K8RH 3ARRA 1VACB 4NGHL 4J4PC 3U0PA 5E1AB 3BQUA 4LLYA 1SY6L 4NBYB 1OT1A 1GC1C 3AC0A 3EYUL 3QUYD 4L8DB 4Q9QH 1B4RA 2VE6A 3L3DA 1BWMA 2PUQT 1QNZL 3DXAA 3MC0A 2VLKB 3SE8H 2VIRB 1A3LL 2F53B 5MEOA 2ZCKH 5T3XD 3REVB 4YR6B 3QIWC 4X6DA 5HHVH 5L8JB 3SDDA 5M95B 3SOBH 2MCPH 5CZVH 5GS1B 4YZFF 1OP5K 3ECBB 5E94A 4FFZL 4UQ2B 5AAMA 1P4BL 3MLVH 4TOYH 2YD7A 3QNZB 1OAZL 3RVUD 3NBNA 3D85B 5DRZA 2HRPH 4WDIA 4W6YB 3QFJA 1YUHA 1F4XL 4G8GD 4EI5B 1OARL 2MCG1 4WHDA 1JRHL 1RULH 2IAMC 1KJVB 2YD9A 1A4KA 3R0MA 4YBLB 3CXDL 4P9ML 3DVGA 5IV2B 1DBAL 1UH3A 3HCVA 4M1DL 5DC9B 5DK3A 4Q6IC 4ONHA 5E70A 2ZG1A 3QT2A 5DJ0B 5D70H 4CMHC 1H3WM 2AI0H 2GAZA 3T08A 3QDMD 4OLZL 3G6DL 3WKML 1MH5B 3IYLW 3WUWG 5ICZA 1MVUB 3WN5B 2JJVA 3LD8B 1BWWA 1K5NB 1MCOL 4OGAC 1N2RB 1OF2B 5J89A 3HI6L 4LU5L 2ICWI 3SE4A 5DEGB 5J12C 3KJ6L 1FNAA 1KENH 2CDEA 4KU1A 5DDHA 3RI5F 4F8QA 2P5WD 2IMMA 1IC1A 4JFPA 5LWYL 3MCLL 2VZ3A 3NN8A 5E2VH 4ZS6C 3QZWG 1CLYL 1CBVL 5CIPA 1RUPH 5JOFB 4JHAL 3SDXF 4XAWL 4Z76B 4LL9A 1A5FH 4EOWH 1BJ1J 3QPXL 4HJ0D 1FZJB 5DFVC 2YK1L 2XZCH 4QY8B 5BMFH 3E6HA 3CPLB 5ITBH 4FTVE 4MA8L 5CSZA 3TO4C 3RZCC 4R4BA 4YWGL 3BDXA 4GXUN 1CXHA 3MOAL 5CWSB 1W8OA 1DL7H 4X7SH 3IDYC 3P0YH 1NFIB 3DURA 5D2NC 3O6FB 3V5DB 4HHAA 5ANMB 2OS7A 1LE9A 4GW4A 3SGEI 2Q7NA 3DECA 3OKKA 5ILTH 1UWXH 4JJ5A 4I0KA 4OLYH 3FN3A 1TVBB 4U6XA 3I6KB 4N0FB 2PYEB 4NQDB 1JYWA 4AENA 2R9HC 1DP0A 3SKNB 3OKMB 4XI5D 2E7BA 4L4TA 4HUUA 4OFYD 3MNVB 1NQBA 2QR0B 1JZ5A 3PQYA 3FAXA 2IANE 4OCYH 1RZFL 5D71H 5D7IA 1ZT1A 3OKDB 3WHE1 4Y5XA 1S9WA 1G6RL 2ED7A 1S7XA 1AGCA 3GM8A 3QH3B 4NQCD 3MZTA 3DO7B 2GITB 5E2WH 3ZMRA 3EZ8A 2FECI 2VAAB 5FHBL 1RFDL 1MI5A 1A47A 1NL0H 4N9OB 2AJVH 5DMIH 5TQ0L 5DFVD 4R0LA 1Q72H 3C8KB 2BOCB 3STZB 4BZ1H 5LVEA 4N90D 4DKAA 1J10A 3FO1A 4MXQD 5AG8A 4PUBH 5HXMA 5CP7B 2VXVL 4G42A 4GAYB 3O3DB 4I3RH 3PWJB 2C26A 3A6BH 1VADB 3TV3H 4QEGA 3RTQD 1BD2B 1XAUA 4YXHL 4XVTL 3WNPA 1RI8A 3F58L 1D3CA 3CFCL 4NCC1 4OLUH 2CLVB 1GL4B 5CBAB 5CINH 2EDDA 1YEKH 1QSEA 5SX5K 4AIZB 4HMDA 3ZE1F 4ESKA 5I75B 4PJFB 3UBXB 2WMPA 5FYKH 5D9SB 1IBGH 1LO4H 2RJMA 1I7UB 5E5MB 4XVJL 1ZLWK 3T0WA 3SDAB 1S8DB 4YO0A 2ADGB 3BE1H 4NQTA 3KG5A 4IHOB 5DJAB 4KJYA 1LP9A 2YPLB 4U0RB 4WGVB 4FQJL 5KSAD 2OJZL 4K3GA 3DBXB 4LCIH 3RDTB 3Q1SH 1U3HA 5EOCH 1IC5H 3CSPA 4UMGA 3H3BC 1ZLUH 1H3GA 4P5KB 1QRNB 1PKQB 2DQGL 3VXNB 3BKYL 5FIEA 5J6HA 1JJUA 3KXFB 5DJZB 3TJEH 2F74A 1D5BB 3HRPA 5HDQL 4UDUB 4WJ5B 1GZQB 1U8LB 4G7YH 1B6UA 4NJ9L 1PLGH 1U92A 2H32B 5FK9B 2QHRH 1FL6A 1MEXL 3MROA 1L7TH 1P9MC 5FKAB 2X4SB 3BSZL 3WXVL 5IKCB 3UXFA 4ODUA 3ULVF 2RCSL 4X9FA 1QEWB 4PGZA 4WFFD 3MSPA 1OL0A 3I50H 2VXUL 5E56A 1QLFB 4JDVB 1CXKA 1C5BH 1KIUA 2IF7A 3FT4B 1OM3H 5C3LD 1DFBH 4O58H 1E4XL 5GRUL 3RWFA 4IRJA 1F3RB 1DEEA 4O5LL 1AI1L 4S1DD 5C92A 3MPCA 4OLYL 4MMXC 5TH2B 3O4LB 1Y0LA 3Q2CA 2PYEA 3S35X 1BBJB 1MPAL 4YDVA 3W0WA 4G6KL 5EO0A 2VWEE 1M7IB 1Y6KR 4LNRB 2D4FA 3DGCR 3VXRE 3ARED 2Y25A 1EUUA 3JTTB 5LKNA 1JHKH 1JHTA 5GS0L 5GRYA 3BKCL 2NY6C 1H3TA 2R0KH 4OZIF 3CZFA 1FNSH 2DQEH 1Q9WA 3UC0H 1CIDA 4NCDA 1CD1B 1CXFA 1JZ4A 4OZ4B 4P59H 2EDNA 3VFGH 3Q6FA 4PRHA 1Y6MR 2F5BL 2W9EH 4GG6E 2EEDA 1MHPL 2AK4A 2I07B 1MHCB 4BQBA 3ROOB 1J88A 5DK2A 4YFLI 1XF2B 1UWGL 3PWNB 4RAUB 1WWAX 3BUYB 1X5AA 5I1CH 4P5MB 3MV9D 2J4WH 4QHLA 4TNWF 3T0EC 4NRYB 5I66B 4G43B 4LLQA 1I1CA 3BZEA 4P2OD 4FG6D 2NY4B 1AGFB 4ODUB 4CADB 4KK6D 4QXUL 2HJKB 1R3KB 4P2QA 5I71C 4LSTH 3OGCB 4TVPH 3T1WA 3HC0A 1FN4A 1H15B 2YRLA 1U8KB 3KYMB 1K5NA 2VL5A 2GSGB 2IG2H 3RDTC 4ONGL 2SEBA 3S4SB 5J1TC 1OGAA 1FLRL 2FEEI 4UDUA 1EHNA 4WW1B 4DUVA 3B9KC 2CUHA 4I13B 1R3IH 3IDNA 4UINL 3CLFH 1KLUB 3RA7L 4F9PA 3VXNA 4PGBA 4Z7OE 3PDGA 3KPQB 3DVGB 1IM9A 2PW1B 1EAJA 3RU8H 1FFOB 1Z3GL 3MTRA 5DJ2B 4WUUD 3BO8A 4G6JL 2BVTA 1NFDF 4M1DH 4Y4HA 2EYRA 3DYMA 1XF2A 1P2CA 5F9WC 1JTPA 3ULUH 2LABA 2AQ3A 4LRIC 3DVFA 4MD4B 4NRZA 1U3YA 1LWRA 2NX5D 35C8H 3BYTA 2HMID 3QDAA 3SDCA 4APQB 3W9DB 2HTKD 1CGWA 3OAYH 4LLDA 1QBML 4D8PA 3KGRA 4NHUB 3G6JA 5CGTA 1IQDB 2WBWB 2OTWB 4YE4L 4Q2ZA 4FXGA 4K94L 1YN7B 4YZFE 1Z5LA 1FL3B 3DETC 3DMMB 2Y6SD 3VH8G 4MX7A 1HILA 5FUCC 2K7PA 1VSCA 1VFBB 5I19H 4LASL 4MQXC 1FIGH 4M8QA 4Y1AB 2PO6A 2VR9A 2XQYG 1Q1JH 5TFSH 3IT8D 4P9HL 3ROLA 4KKNA 3UDWC 1CDIA 4P4KC 3HC0B 1XGTA 3KJ6H 1A21A 1IC5L 2YKLH 1YPZE 2Y4SA 5C07D 1YY9C 2EDOA 5EULV 3KPRD 4JB9L 2D2OA 4LSPH 3QFDA 1NGQH 1OP5H 3SJVE 1MJJB 1LEIB 1FQ9C 2PTVA 1MPAH 3ZTJH 1EFXB 3EFDL 4PGDB 2ICWJ 2YD1A 5C6TL 1MCQA 3PNWB 3P9LB 1MHEA 4YXKH 3ULVC 2VQ1A 1A7RL 1PG7W 4KI5D 3HMXL 3CUPA 2W0PA 2HMIC 2MKLC 1ZWIB 3QXVA 4GMTH 2YWYA 4H25B 1LO3H 4JRYD 3QUZA 1RMFL 5HVFB 3MRPB 3SE9L 2WAHA 5FB8A 5KBNC 3QUMB 2OR8A 5AG9A 1XCQB 2FWOA 4UV4H 4J6RL 4P5KA 2R4SH 4OIBA 4S1SL 4NN5B 4OZFB 1XGPB 4PRIB 3RUGF 4UU9A 4BM7A 1BPVA 4YHKL 5FDWA 4K9EL 4YO0B 1DEEB 1RIUL 5I1GH 3GJEB 4JVUA 2ESVD 5IMMA 2IPUG 2ZSVB 4Z6AT 1FZOA 3KDMA 4PBXA 3THMH 5K59F 1VEPA 4JO1L 3QEQD 3W5NA 5TQ2L 5D5MB 5JPMA 1ACYH 2R1XA 1NEZA 4Y4HB 3R1GL 3F12B 3P9MB 5D5MF 5L7XL 3DI2B 5TF1H 1TVHB 2FB4L 1TFHA 1BQLL 4LCWE 2NW3A 1NGWB 2Z93B 1RJLB 4NQSA 1GZQA 1UM4L 4DFIA 2OQJA 4LKXA 2PYEE 4F2MB 4FS0A 1T4KB 1YEKL 2F74B 1KB9K 3GJFH 3VWJC 3JWOL 4MB3A 5E0QA 2ADJA 1ONQA 2IAMB 1DLFH 4X5LA 5BO1L 4QRRD 3O2DH 3K81A 5FO9A 1PY9A 4ZXBA 4Y4FA 1IAKB 3KXFD 2Y07H 2ZUSA 1HYRC 4MA1B 5IW6B 4JG0H 1IM3B 5ALCH 4DN4H 1ZLUK 5EOCL 2GY5A 1GC1H 4HD9A 1G9MC 1NFDE 5GISH 3RAJH 3B9EA 3IDUA 4FZ8H 4Y19A 4ELME 3RNQB 3PWNA 4RAUA 1MIMH 4OM1L 4XAKE 5E6YA 3HI5H 4XBGA 3GMQB 2C3VA 3MXVL 4Y7MA 3X11B 3TO2B 4WW2F 2Y06L 4R2GD 5IB2B 5F97E 2Y5TB 4N0UB 3MV9B 4U3XA 3E6FA 2P5EA 3QG7H 5LCVH 2EH8L 4ZFFA 4E41B 1N5AA 1MEXH 4FQXC 3GNML 4G6FB 4KKLC 1XGRA 4PPTA 1WF5A 5IG7B 4GAYA 1I3VA 1U91B 2CUMA 1YY8B 1MLCB 3QIBC 1PG7L 2BCKA 2DBLH 1F4HA 1KJ2L 4WUKL 5IHUH 3CNKA 2YMXL 2YUXA 1CFTB 1OGAE 4YE4H 2W65B 1RSFA 5L2KE 2CK0L 2J8UF 3SE3A 4E42A 4YNYA 3MLPA 5EU6D 3QUXD 1C8PA 3ZHKA 1Z9MA 4GQPH 1KIRB 3PGDA 3STBA 4NFDA 4QHKJ 2R29L 5DQDL 1QBLL 1OCWL 1MJUH 3X14A 5C7XL 5MHSE 4PJBF 5KN5A 4X5XB 3RJDA 4HH9B 4WFFE 3T4AA 3IU4H 1H0DB 3S6CA 3SEPA 2DI8A 5DEGA 2B1AL 5GGSA 3FQWA 4B50A 1E27A 3TBVA 3MJ8A 4XH2A 2OL3L 4U6XB 5CHNA 5E8EB 2ICEA 4PJAB 2VDQL 5GS0H 3GSQA 3W9EA 3PP3K 1NGXA 5E6IB 5F3HA 4PJ5E 1FNSL 2EXWD 4PRPD 5L9DH 5IHZB 1WBYB 4RGNE 1QVOB 1E6JL 3MV8A 4JO3H 1QRNA 4H0IA 1AE6L 4XPTH 1AQKH 1JUFA 1K9TA 3A67L 4UTBH 1BD2E 2PTUA 3IXAB 5JW5A 4DZBA 5I1JH 4LIQH 3FB5A 3P30H 3BMWA 4AG4L 4E5XA 1KELH 1XIWC 5HHOB 1I1AD 2YPLA 3RHWF 3QIWD 2BSSB 1UM6H 3HR5B 1GGCL 1MNUL 5B22A 5B8CB 1OT2A 5BRZA 4DQOL 1F4WL 3TN0D 1IFHH 5E4IA 1KCSH 4R97C 1WZ1L 2YD4A 2NXYD 3IKCA 5K9QI 4QGTA 3Q3GB 4J4PD 4CKVX 5DVOA 2VIRA 2WINB 3ZL4H 4XB7A 4DCQB 1VEMA 1OAUL 3VFNB 4P46C 3O2DL 3LH2L 2C7UB 5L6YH 5J9PB 4HUVB 3RKDC 4I0PD 2QQQA 2IFFH 1ACYL 5CP7A 3PWPA 4UQ3B 3IU3B 4HKXB 3A6CL 4R7DB 3OXRA 1ZLSH 3SKUD 5GGQL 2YUZA 5JXEA 3FQTB 4DKDC 4HT1H 4LEOB 1BD2D 3FFCE 3C2AH 5LBSH 2IANA 2VN7A 2CLZB 4S0SD 3AS1A 5DUPL 4L3ED 4JM2F 3UC0L 3DSFL 1QBAA 3BZFB 5KANG 1I1YA 4PJ5D 4XCCH 3VD3A 4NZRH 1BECA 4NQCE 3WO3B 1FNLA 2W0LA 4WTWA 1CL7L 2MJWA 4Y5XB 2RAMA 3FO9B 4EN3A 1JPSH 5D7IB 1RUML 2DMCA 2YHGA 3ECBA 4GT7A 1GGIL 5GGSB 3DROA 1XGUB 4MDIA 3P3YA 1C7SA 5C09E 1LO2L 4G80B 4Z0XB 4MDIB 1RURL 1OTTC 3O3UN 4NDMB 4LASH 1HINL 2X70B 4GRWB 4QRPE 3TBYA 3WHXB 2C1OB 4K55A 4I5BA 3LN5A 4F9LC 3EO9L 4OQTH 4NHCH 1XF4B 3KWWB 3O9WA 3UCRA 1ZT7A 1YQ2A 4XAWH 2DI7A 4WFED 1QSVA 1FL5B 4E0RA 4D9QE 2X4RB 3C6LC 3Q5YA 1HH9A 3VE0A 2D7QA 4NM8H 3IU4L 1ZANH 3J8F7 1PG7H 3IFNH 5FYJU 4WVRA 2VDRH 2W65A 3D69B 1ROWA 5I30H 1MFDH 2IADA 1CF8H 1XMWA 1TJGH 2JKXA 1SBBA 3I84A 1P7KA 3TP4A 3K74B 1FNGA 4HDIA 2DYPA 1S5IH 4K7PH 4HS6A 5E8NB 2X7LB 5GHWH 1T5XB 2R29H 2R4SL 5DQDH 3Q1SL 3EO1A 1OCWH 1T7VA 4Y1AE 1F3DJ 4ZO7A 1A3QA 4HS8L 5E8OB 1AY1L 2ITDA 2X4UA 5F21B 3O4LD 4LLMA 4PJ9A 3OKNA 5J13B 3JV5A 4XBGB 3OF6A 3F7YA 4HUXA 4LPCA 4PYHA 5LGHH 4PJFF 3VRIA 3T3PE 1WZKA 3W2DL 3W11C 5FFLA 4KRPB 2EE2A 4GLRI 3TYFB 4LIQL 5KOMC 5F6IB 3FRUA 3D48R 3MREB 4G8GB 1JGVH 4IM8A 2P24B 5E00B 4E41D 4TQEL 2BVQA 5IK3B 4NO0B 3M45A 4W6XB 5I19L 4WW2B 1JF5A 4D0DA 3KXFE 1OP9A 1NAKH 5DJDA 1NUGA 3JVGA 1N0LA 4JZJB 3BVNA 4XP9L 5AZEL 3KPPB 3VFMB 3HMWH 1MAML 5JXEC 3LQMA 2ZCKL 5A1AA 1N7ML 2BVEA 5ISZA 5KVFL 1UACL 5KS9E 3LEYH 2RFXB 1T80A 4XRCA 3MV01 1WBYA 4EI5A 3B9KB 5B3JF 1A6VL 3SKMA 4A2LA 2KBGA 1OAXL 3GSQB 5ID1B 4PJDE 2UYLB 3B43A 4HS3B 4AT6A 4D94A 4LCWD 4GAFB 5HI4C 1CFBA 2HRPL 3VFVB 3IGAA 5JHDD 1CTOA 4C56B 3CH1B 4UAOB 2G5RA 1S9VB 4KUCD 4CN1A 1F11B 4DGIH 3MLXL 2R2BB 1A0QH 3D39D 1DBJL 4IOSD 3TC9A 4LQ1A 2OTUA 4XX1E 3NAAL 2B1HH 1BVZA 4GAGH 1HQ4B 4XP6L 1WK0A 4P57A 3GJEA 2WIIA 3D9AL 5CJBA 4MNQA 4OLZH 3ZTJG 2KH2B 4XWOD 3PP4H 2R8SH 4XPAL 4J3XA 5BZDA 1JWUA 3SGDI 1ZT7B 4UOJA 2GK0A 1G7HB 5KVGL 4OZIA 4UB0H 3ALWA 5LJYH 5ABDE 1YPZF 1QOKA 1X5KA 2EDEA 5BS0D 1BVKB 2YN3A 4U1LB 3T3ME 3N06B 3TPUA 3IFOA 4Q9CA 1NGXB 5E6IA 5C0GA 1CZ8L 4G80A 4FQ1L 3LQZB 2BVOB 4HKJA 5AYUL 5BW7A 1K8IA 3TIEB 1KIPA 1A6PA 1A6AB 2Z92B 3CDGB 6CGTA 3HZKA 1NDGB 4QYOB 1IAII 2Y5TA 4N0UA 5LXGH 1UJTA 4ONGH 5CZVL 3EYOA 4LARL 3UYOD 2Q1EA 3EGSB 5SWSD 1JWMA 2NXYB 4FQXA 4JFED 4WO4D 4X4ZA 3L7EA 1S7QB 4U1NB 5IVXA 3TPUB 15C8L 1EO7A 4KY1H 1T89C 3V6BR 3U9PL 1LO2H 2J8OA 3HE6B 3GKWH 5LWYH 3C5ZD 4I2XB 1NKRA 3F7VB 1YQVL 4XP4L 2JK5A 2EH7L 2CRMA 5DWUL 4JG1L 1FVDA 3IDXH 2ENYA 4MNQB 1O5DT 3IXTA 4Z7OF 4PJ7A 4X6CF 3MRIB 2H26A 4JRXE 4KI1A 4W4OA 3MRCB 1ULVA 3SGJC 1WQVT 2IH3B 3GBNH 3ARDD 4NN7C 1ZHNA 3QDGA 4X99B 4NKIH 4NZUH 1J5OL 5T3XL 5DHYB 1F6FB 1J1OL 3ZKQD 1CGTA 3OAUL 2CIIB 1KLFA 5L0QB 2NX5E 3DIFA 3GMQA 4WI6A 5DF0A 3QIBD 3EZJB 5T1DH 2BMKB 1FHGA 3NCJH 4TTDD 1L6XA 2G60H 3HHRB 1FAIH 4HG4J 2RFXA 2ZSVA 3GKZA 3L3GA 4XRCB 5B39B 2OCFD 5TPWH 1RQ5A 4O02L 1T6WA 5FOBB 2BDNH 2A6KB 2ZUWA 1KCUH 3NTCH 3LRSB 1JHLH 2BK8A 4UT9H 1J12A 9CGTA 1WEJL 4G5ZL 4JZNB 3IVKB 1WAAF 4YQXL 4XVTH 2AJ3A 2QSCH 3FONB 1F8TL 5FYKE 3DPBA 3DV6A 1A0QL 4DUXA 4D2NA 5HHOE 3OV6A 3H9ZA 3AU1A 5FYKL 3U6RA 5MI0C 2DMBA 1ZLSL 5INDA 4NQSB 4XC1L 3GHEL 1FH5L 3VXQB 2ITDB 4R2GB 3MV9E 3V7AE 2ZUUA 3L3HA 3CFBA 2F54D 5I1IL 43CAB 3P9LA 1JYNA 1V7MH 5FV1L 1DE4A 2AXJA 3AM8C 3INUL 3CFJA 3STLB 2OL3H 4Q97A 1MJJA 1VGKA 2V7NA 5HGHB 3DX9A 1OAKL 1B0RB 1UEMA 3TVMA 4EZMA 1A7OL 3HNVL 3Q6FB 3EO0A 3NMEA 1DBJH 3GM0A 3WIIL 3U48A 1EXUB 2FGWL 4NJAL 4Y0GA 3QDGE 1J8HA 2FJGB 1GGUA 2VAJA 4NQXB 4KKAC 4ISVB 2DBJA 5FAAA 4Z7VF 1M7IA 3S3PA 4NT6A 2CKBH 4HPYL 2BVYA 3QUMA 2OJZH 4X83A 4ZNCD 2XFXA 1CLZL 1GGCH 1ZTXL 2YPVH 5FV2A 2JIXB 5I76B 4Q9BA 2DD8L 2FJHB 1XZ0B 1OP3H 1T83C 1A7PH 2PNDA 4LCCC 4ORGA 4Y5VC 3NFSL 4EN3B 3FQRB 3V7AG 4ONFL 5FO8A 1ETZA 1IGCH 32C2B 3JTSA 1GZPB 5J06A 4OZGA 3TA3A 1D9KD 4FQPA 2HT3C 2C4FU 3EOYG 4PGDA 5DRNB 3FZUC 4L8CA 4XNXL 1I1YB 2Q7YB 4Y2DD 3MROB 1E28B 1KN4L 1D9KB 5HPMB 2FDBP 2Y5EA 4OV5A 4Z7UF 5JORB 1AO7E 3VGEA 3HA0A 4MA3B 3IJHA 4OKDA 3SGJA 4R90H 1J1XL 4P2RA 3VWJA 3C2AL 4WHCA 3IU3A 5LBSL 4LAQH 4MA1C 5IW1B 4YH6A 1N5YL 5DEFB 3HZMB 4HIIB 1FC1A 1HYSC 3LIZH 1MLBB 3RGVB 1A9EA 1HI6A 2AQ2A 4RGMC 3LKRA 1R3LB 3RWIB 1E4WH 3D25A 1I7TB 4RGNC 5EO9A 1TXKA 2VLJE 2JB5H 3DMMA 4J2XA 3MRQB 1GXEA 2F54B 3MJ9H 2H2PC 4KTEH 2D4DA 4O4YL 3IKCB 3RVWD 1CE6B 2H32H 1ED3B 4JANB 3EJZC 3KDMB 1JGVL 2P48B 4D8PB 4AK1A 3CFKA 4LVEA 3T3MF 4MJ4A 4KROD 4V2BA 3ARDA 1J5OH 2DICA 2C9AA 2BSSA 3H9YA 4Y89A 1EZVY 1U0QA 3EBAA 1XCTB 3VXPB 3CU7A 1HI6B 1KCVH 1YJDC 2P8PB 4DOHB 2I9LA 1YNTA 1BIIA 1MJ7H 2BY1A 5INCB 1KLUA 1FH5H 4OV6F 1T20B 4Y1AD 2DQTL 2WBJB 3VWKA 3O6ML 5FO7A 2BNRE 2VDLH 2NZ9C 3P0YL 1BM3H 1RUKH 4WEBH 3ARFA 3QG6B 4CRPA 5E2WL 2VISB 1ZWIA 2QQNL 1HOCA 1U42A 2DQUL 3QAZC 1A6ZA 3UJTH 3RNKA 2VDQH 1NANI 2P5WB 4P2QB 4K7PL 1VPOL 2F19H 2Q76B 2IBZY 5ITFB 5CEZE 5EIIA 4UBDD 3RQ3A 2J5LB 2GFBA 5H2BB 2YWZA 3GBML 1WFUA 3FQRA 5DD1H 1CD8A 5TE4H 1RD6A 1GC1L 4PJDF 5LQBL 4TUKL 1QO3B 2J4WL 4WI8A 1XFPA 4MA7L 3DRQB 5KS9B 2J7LA 4PJCB 1BP3B 2APVA 3B4NA 5F1IB 3VFRB 5LG1A 1B0GA 1C5DB 2CPCA 4JY5H 5EUKB 1UJ3C 2IEPA 2JCCA 3VGDA 2PXYC 3MBXL 4LOUC 3C5JB 3N1FC 1EJ6A 4JGUA 1N8ZB 3TN0C 2PXYD 2ICCA 2XQBH 1A7PL 1WBXA 4ZUSA 4YLQT 2NCMA 4ZS7L 1EV2E 1YY8A 3QWOA 4ORZC 3F6LA 4XXDB 3HC4L 5BW7C 2XN9D 5DD6A 1U3HB 1PZ5B 4MJID 4ELKA 4Z7WE 1B0RA 5IB2A 2R69L 4BK5A 2ORBL 5FYLH 3KYNA 4PUBL 1I9JL 1NKOA 4GOSA 5TE7H 2NW2A 4YGAB 4O9HH 3P77A 2F8XC 1L7IH 2DDQL 4EUPH 3K2UL 1CGSH 5A16B 4PLOB 1ES0A 4RMVA 3MOBH 3JV6B 1CVSC 1C16B 2NYYC 2B4CH 3L3HB 5E8PA 3GFUA 4YHZL 5IFJA 3P0GB 5DGQA 4LCWA 4L8SA 3AY4A 2FO4B 2C4XA 4FXKA 5FECA 4CVXB 3OKLA 3H9SD 3NA9L 1P5VA 4DKFH 1PQZB 5JOEA 4YFLF 2XICA 3H42L 1FCGA 3FB8B 1MLBA 4LMQI 5EU4B 3RGVA 5FOJA 3U4BH 2JB5L 1RZGB 2G9HA 3QPQC 3VDCA 4FQJH 5DMKB 5BZWA 1JVKA 4OZHE 4PJIB 5EUOA 1MRFH 2I60H 4HKZB 2HN7A 2COQA 3NCJL 4PIRF 4FN0A 1U8HA 4UT7L 3NCYP 1CVRA 4Z7WF 1BEYL 5JZ7C 3CDCA 4OD1H 3WIHH 1AGFA 2X5PA 7FABL 3GRWL 4RNRB 2DKMA 4LLQB 3RX8A 4ZMAT 2BNUA 3QUXC 3KS0H 3GMNB 4KMTH 1CDYA 1NEZB 4YFEA 3HC3L 1MSPA 3DO7A 1RJYA 1KCLA 3QQNA 5I71B 2AGJL 4K3HA 4RGND 3KLHD 2R0KL 5D9SA 4RGOL 3WXVH 5DS8B 3ARUA 5HD8D 2YZ8A 3S88H 1W2KT 1I3RB 5I30L 4YPGB 1ZHBA 3IETA 4OGYL 4TVPE 1W0YT 4ZD3L 2UY7A 2XKUA 1KXTB 1Z6JT 3QSKB 4KJPD 1VADA 1A1OB 3VGAC 4XPGL 3H3PL 4GG8A 3ULSB 1ZEAH 3DYOA 3L5HA 5F1IA 3VFRA 3L5JA 3HPLB 3V5DA 1BQLH 1AC6A 3F7VA 3X3FH 5F7HA 2VTFA 3V0WH 4QHNB 5IJKC 5CWSA 4MCYB 1KACB 3RKDD 4WIQA 3LRGA 1JL8A 4R9HA 3KPMB 3FT4A 4RMQA 3O11A 4OZFH 2YA1A 1Z9OA 3E6HB 3H3KA 5IQ9B 4M4RA 2VAAA 2V7HA 3QQ4B 5IVXB 43C9A 1EPFA 1RUKL 4WEBL 1X5LA 5CD3A 2AABH 5T3XH 4MJ6A 3PXJA 3VXRA 3EYOB 1NBQA 5JW3H 1BQUA 1QBBA 5T1LD 4EN3D 3PHSA 1QYGH 2QR0A 1JBJA 5J6GB 5IF0A 2IALA 3TEUA 3A6OA 4UUJB 5TE4L 2DD8H 4GJTB 1RIVH 1YN6A 3ZLQC 3U0TA 3NFSH 1VGEH 4F3FA 3K2UH 5D2LA 1YECL 4OF5A 5JOPE 3GUTA 1MFCL 3FB8A 1NCNA 2ZG3A 4S1RH 4FABH 4EOWL 2BNRA 4G9FB 1T3FB 3BDYH 2YPLE 2VH5H 4UZGA 3ULUC 3ARDB 4YHMH 1C12B 1UXWB 4LAJH 5IFJB 4A6YL 5IGXH 2UUDH 1QRNE 1JPTH 4ZSOE 4LCCA 2XA3A 2YPKB 3EIFA 1H8SA 1G9NC 3MYJA 1SJVA 5TDPA 2CIKB 3LKSB 4IRSD 4L29A 2XNAA 3DIFB 3RGVC 1T6VN 1I7TA 3IKKA 4OTXL 3CVHL 2ATPA 2VNCA 2WWKO 2W60B 3L7FA 3QHZH 3WO4B 1IM9B 2I5YH 2PW1A 2X6MA 4JHWL 4RZCA 2XKNB 2F53A 5MEOB 1J86A 3IDNB 5I75C 1ZVYA 3O2VL 2WZPD 3HAEA 5I1EL 5JUEH 1UH2A 3DNKA 1HKLL 1SJXA 4XC3H 4FNLH 1LO5A 1NUDA 2BX5A 2GSGA 4PJHE 2AGJH 5DJDB 3WS3A 1HDMA 4P2OC 3VMOA 3QDJB 1OSPL 5DYOA 4ALAH 5HDLA 5ECJE 3BZEB 4X80L 3VFTA 1NBZB 1D6VL 4Z7WA 5L9DL 3D2UD 1KJVA 3V6OA 1D5IH 3DHMA 1IARB 5J1AA 3S98A 1TCMA 3JV6A 4BZ1L 3LEYL 4PRID 4FFWC 4JM2D 3UX9B 1AQKL 3H3PH 4HUUB 1TCRB 3GSRB 4TPRH 1QPPA 2C4FT 3MR9B 3SKNA 3LSOA 5GS2H 3MODH 1FVEA 1G7MB 5AZ2L 1YEDA 4F33A 3CFDB 1YEIH 3J7HA 3AXLB 1J0KA 4FQHA 5CINL 3BKML 3CGTA 4GW4B 1S78C 4HIEA 3MX0A 5BOZG 4KI5E 3O6FA 2VLJB 3LMJH 3O45B 5D6CA 1MCNA 3TYGL 2B2XH 1YNTB 1AHWB 1JF1B 3QUKB 2JCCB 3L5IA 3SKOB 2P45B 1ZLVH 1BBJA 5BZDB 3MLYH 2GK2A 5EOQH 4UOW0 4YX2H 3QWRD 4XTRD 4XPHH 5FYJE 3F65A 3RL1B 1GGIH 3D0LA 4P23A 4OCRL 2CD0A 1B3JA 3B9KD 3OHXA 2AXHA 3OL2A 1QLFA 5AD0A 5DK0A 1W72B 3BN3B 2BNQA 1LE5A 1R24A 4HX1A 2EDBA 1PKQE 3DVNB 4KTEL 3RZCB 3TCLB 4N0YH 2F54A 3C5SA 5IVZA 5EIIB 3SQBA 3TBWA 2E6QA 4LVHC 4KV5E 2E9BA 2QSCL 3C60C 2Y6SC 4P2OB 1HSAA 4URTB 2EICA 4ZTOL 3MBXH 4ZO6A 1S7TB 2PETA 4Y4KA 3EDKA 3IDMA 5GGUB 3MFGB 1SBSL 2ZP0T 1L7TL 4KAQH 3DV4A 4OKVB 4PJCE 4R8WL 4RWYL 5FYLD 4Z7QE 1RULL 3FT2B 5FGCE 5KVEL 3L6FB 3KXFA 1AGEA 5ICYB 3BT2L 3LCYA 4OGXL 1D5ZB 1EEZB 1RZJH 1FSKC 4RBPK 4H1LG 3DBXA 1BBDL 1G9MH 4U33A 2VDLL 1CXIA 3CVHH 1RUQH 2XY1A 3KPOB 2BMKA 4LFHG 2FBJH 1Y18B 4WUUB 3R06B 3TA3B 3N1QC 4HIXL 2HTLC 1G0YR 1INQB 2KZ1B 5ENWB 3HNTL 5I8CA 1Q8MA 3BKCH 2YMXH 3RRQA 3V6OC 5I1AA 3VFPB 4X6DB 4HGKC 4I0PC 2IH3A 4K3DL 1X5JA 1IC4H 4HJGB 3UJJH 7FABH 1NGYB 2EIZB 2PR4L 1EZVX 2Q3AA 4M6NH 5JDJA 5ESAB 3OR7A 3BGFB 4ZO8A 4GQ9L 5T1LB 5JW4N 4LPUA 4G8FA 1TPXC 3C8DA 5DEFA 4JPVL 1U8OA 5CEZD 1FNGB 2KQNA 4KUCF 3DHJA 4HCRL 5EBLB 2FJGA 3U1SL 1NCBH 4J12A 4OQ1A 4MQSB 3P2TA 3IJHB 4KK5D 1L9MA 5C9JA 1A6TA 3G5ZB 4G8EA 1A8JH 3KPSE 2Q3ZA 4N9GA 4YWGH 5B39G 2X4OB 3QUML 4HIHA 3K2MC 3QISA 1N3NB 5HGAA 1E28A 1E6OL 4ZFGL 3H0TA 3OKOB 4KRNA 4XMLH 2A74A 2PN5A 4ZSOA 3B5TA 2R0LH 2LTQC 4PTUA 1V3LA 3VXMB 3QZWB 2HJFA 2YEZB 1ZT1B 2UWEB 2EXWC 5T5FH 1T04A 4OF0A 4LGRB 5IB4B 3T77B 4P5TA 4OCMC 1YPZA 5H8DA 3KYKL 4ZYKB 4OGYH 1D5IL 3SCMC 3MLWL 1S7RB 5D1QC 3PDDA 3TJHC 1UM5H 3ZDXE 3UTSD 4KDTC 2VDMH 1EX0A 3VXMA 3RVTD 1CFVH 2J3SA 1MRCL 4Z8FL 1T2XA 2DN7A 4P23B 3FO2A 2WBKA 4U1GB 3K0WA 3VRJB 5C2BL 3S3JA 4FP8L 4NBZB 3P11L 4OF3A 5J7CC 1AH1A 4QXWA 6FABH 3GHBH 3GIZH 3E1F1 1EEYB 3KHQA 1DQDH 4JDZB 3RTQC 5GIRA 3NIFE 4K94H 4Z9KB 1CT8B 4F7EB 5FUOL 1Z9SA 1JTTA 3LS5L 2R0ZH 4HLZG 4JFDE 1E4XI 2FEDD 1GHFL 1A6VH 1Z0NA 2EDQA 1P4LA 2QLVB 3O8XA 4Z76A 1TETH 2FYYA 1KGCD 1GPOL 2AXFA 1ZOXA 5J9PA 5DHYA 2WWMD 4GLRH 4WWID 1WIOA 4RA0C 4AT6B 3MR9A 1YEFL 5DHVB 2VXSL 2DM7A 1UWGH 2M1KA 1P7QB 3MV7D 2ZCHL 4KKLD 4DQOH 4M62H 1GH7A 2XV6B 3NABL 1OLZA 1F4YH 5CP3H 3FO0L 3KAAA 2X1OA 4BKLA 4ZAKB 1UWEL 3HN3A 3ZKSD 5GSVA 3MO1B 3R06A 1I9IL 4OLVL 5EWIH 2NNAB 5D1QD 4KWUA 2PW2A 5KG9B 3RPIB 5ISZD 1HDMB 4JZNA 4TSAH 2FATH 2ILLA 1DJSA 1T7XA 5GXBB 1RZJC 3ILPA 4PREA 1BX2A 5K9KA 5DD1L 1K85A 4TVSa 4Y16B 3MREA 3AVEA 3U0WH 5HY9A 4LHJB 1P4IH 3ARBB 4YC2C 3D85A 3GIVA 5DRZB 4M9OA 4MXQC 1NFDA 5ALBL 3G6JE 3QNZA 5E2TL 2WLYA 2YR3A 1IEBA 4U6YA 1NCUA 5FF6B 1HKLH 5LAXA 5EO1B 5CEYA 1NCBL 3O6LH 2OM5A 8CGTA 3O8XB 3JXAA 4JM2B 5FHBH 3I6GA 3DX7A 2WWMC 2ZNWA 4RFOL 1V3MA 1L9NA 3CX2A 4WU7A 2ED9A 4PJ7B 1X5GA 3BEVB 3BWUC 2ZJSL 4XCFL 4KJWC 4GKZB 1WWCA 2M8XA 3ZYOA 5T3ZE 1QTYT 3D0LB 2DLFH 1MWAB 1VENA 2GI7A 4X4XB 1MVFA 1M6OA 1T3FA 3QWQB 4MD5B 3RIFK 1NCTA 4D0CA 4RDQG 2PXYA 3IDIA 4P9HC 3L1OL 1H5BC 5KSVB 2LVEA 4PB0H 1YZZA 5F8RC 5F9AC 4X6DF 4YHML 5TPWL 1LVEA 1ZANL 2CR3A 2J5LC 1XH3A 3FQXB 4Y5XC 4MQ7A 1CDJA 3WMSA 1PAMA 1F00I 2YD5A 3QAZB 4Q0XH 3UTQB 4N8CH 2EO9A 3X11A 4PTUB 3OAUH 2A9NH 1KXQE 5D1ZB 5BVJA 3GIVB 4BH8B 1EFXA 4EXKA 1UACH 3QDJE 1HHIB 1T0PB 3WIHL 5F70A 4R7NA 1CI5A 4L9LC 3NZ8B 4PJBB 4S0TD 5D1XD 1XF3A 1X4YA 5D7SH 4KJWD 4LLWB 1X5HA 2ADFH 2CRYA 1KG0A 2H45A 1Q94A 3QNYB 1T22A 5TDNA 4XCYA 3QUYB 2H8PA 5HJ3B 3ELAT 3MJ7A 4MJ5A 4JO2H 1LK2A 4M7ZB 1KT2A 2W92A 2C7UA 5IVNA 3BW9A 3LKQA 4BKLB 5D72L 2G75B 4HSQA 3VFNA 4NNPL 5ESQB 2Q86B 4R97B 4WUKH 3ZYIA 1GOHA 4XTRC 1FV1A 2R2EB 1GGYA 1NGWA 3ARWA 3QDME 3RWJB 5DMGC 4G6JH 2HT4D 4HUWB 5ETUA 3ARYA 4JR9H 1JPGA 1H3PL 1DVFB 1R3JB 4BQ9A 1Z3GH 5J0BA 1UB6B 3MRGA 3QEUB 2VUYA 4F15C 1KN4H 4HS6B 5E8NA 5FYLL 1BFOA 2DWEB 5F8QC 1GSMA 1F4AA 2OMNA 1OAZH 1S78D 4ZUTB 2PCPB 5TF1L 4QTHB 2DQJL 4JPKL 4LVNC 4ZTPH 2YPKA 1J1XH 3BEWB 2GTWA 5E7FA 5HGBB 5IMMB 1G9EA 1N0XH 5D7IE 3RVVD 5T33H 3X13B 1MIEH 2JLLA 4LHUB 4TUOB 4RAVB 4W6WB 4P2RD 3VWJD 3QCVH 2BVQB 2NY1B 2XT1B 3KWWA 3G5YA 4H1LB 3QIUD 4NWTH 1NGZA 2ZUYA 5IW3A 1Q9OB 1EHXA 5EU4A 1H3VA 3TBVB 2GJZB 4WCYL 4K07A 1KPRA 4HWUA 5IHBA 5EBWA 1RK1A 4MNGA 5GGSY 4F7TA 1FG9C 4R4FL 1QP1A 2XYCA 4GKOA 4XHJC 1JNJA 5F88A 5HHMB 3V4VH 3PL6C 4KKAD 3P40A 4X6BB 3NIFF 5C0BD 1SEQH 1T1XB 4PG2C 1A14H 1F02I 1YECH 5IFAL 2A74B 3AS3A 2FX8H 1J0YA 2AK4B 1JWSA 5CLTA 3WLBB 2AV1B 1IGYB 2W07A 5C0DA 1MELA 3RGHA 2XZCL 4JE4B 4OCNC 4EKXA 5KSBA 5MEQA 4GRLC 3KPMA 4JFHD 2JCCE 2OTPA 5CKAA 5JW4R 2P7TB 4WEUD 3CJJA 5ACZA 4UOW1 1T1YB 4QRPA 3MOAH 3AS0A 1QFWL 4JVPA 1RV6X 4HQQL 4BFEA 2WUBL 1CR9L 3GKWL 3QXAA 1UM5L 3O9WB 3C5JA 4I18C 3MCKA 1QKZL 1QBLH 5B38G 5IMOB 2FSEB 3IFLL 3TBYB 1NGYA 3LSOB 2BSED 1I75A 5ERWA 4WU5A 1ACZA 1FORH 4KMLB 3MUGA 1MCCA 2APWA 5F72S 3S35L 4K23H 4JDVA 4MD0B 2ADFL 1SMOA 3C60D 1IGTB 2E9WA 2QTEA 3KNBA 2Y7QA 4HBCH 2WQRA 2CUIA 2X1QA 4JM2C 4FFWD 1HK6A 2D0GA 2R0ZL 4GUPA 2V5MA 5D7JB 1SEBA 3VFWB 4ZXBB 1Q1JL 4NQCB 3EYQC 3PXHA 4F58L 4KK8D 5D7LE 1JUFB 5JW3L 4QT5B 3BXNB 4X0KA 4QRRB 5IHLB 4NN6C 5E03A 1J0HA 1KV3A 4XWGL 4ZDHA 1SQ2N 5DVNA 3V0VA 1RURH 5DQJB 3K8KA 4HKZA 4PFEA 1IMHC 3VXMD 3QXDA 4N8VA 5CZXD 5TQ2H 1ZLWH 4R96B 4LSRL 4DGVH 3GSUA 3RL2A 2XKNA 1JNLL 1MQKH 3QYCA 4BZYA 4GRWE 5EBGA 1S7TA 3T0DA 5FGRA 1F5WA 4NQDE 4RFEA 4PGJA 1G7LA 5EWIL 5C0AE 3BI9X 5KSBE 5F96H 2GJJA 3PG2A 4IHOA 5HDBF 3KLAA 5CJ5A 2MQ3A 3BDYL 5FEBA 4CJ0A 4P3CL 3T4AB 2CLRB 3KR3L 2EE3A 5IBLC 3E3QE 3ZDYE 2FIRT 5KTEH 4KGJA 4P5MA 4RMSA 3T8XA 4JANA 3E8UH 1MIML 3QEQA 1DCLA 1TZHA 1I7RB 1QSEB 2ATKB 2DQCH 2QQKH 4G7VL 5DGRA 4XGZA 4RFEB 1NC2D 3QI9C 2X1XR 2FCBA 4EIZC 3L3OB 5IR1B 1CGSL 4UT7H 4QF1B 2BXZA 3GSNL 4YAQA 1DN0A 1RUAL 1ZA3B 3ETBF 4XBEH 5D1XB 3CVIL 4X5WA 5FB8B 2XZQH 5F6IC 3FO1B 1M71A 4LPWA 4NC1E 3OWEA 4LF3A 4QTIH 5I1GL 1T2JA 2UZIH 2EIDA 2V9QA 1IGCL 4WV1C 4EUPA 5B38B 5I1EH 3BXNA 2CO7B 3JWDL 4ZFFB 4QT5A 4R26L 3K8LA 2AJSH 4XHJD 5DD3L 3HG1A 4KRMB 1JZ8A 2QQLL 4P23C 3IDGA 4PJFE 1UH4A 3BH9A 4GRLA 4UNTA 3RY5A 3UTSE 1V7NH 2ZJSH 4GAJL 1ZVSB 5D1QB 4IOFC 4JKWA 1O7SA 3PQYB 1PX3A 4MCYA 2AJYH 4GSDL 5I76A 1F45A 1HCFX 2F53E 1OAXH 3U7YL 3IFPB 1UWEH 1EJOH 4NQDA 4O51A 3C6LB 5ID0A 3HG1B 4EUPG 5DO2C 4KXZI 4RRPA 4G6KH 4PRBB 3V6FB 1CG9B 2IBZX 5ITBL 4P49A 2JELH 4OCYL 4GMSL 4NO5A 4G9FD 3M1BA 4PJXE 2OR7A 3S88L 3U79A 1U91A 2EDXA 1I3RA 2ZG2A 2DQDH 3D1MC 2Z93A 5F93C 5HI4D 4APQC 5C1MB 5EOCJ 2ZZUT 4JZOB 1DR9A 5E2VL 1QLEH 1CR9H 5F9WB 4PRPE 5FGBA 1JNNH 3QI9B 2ADGA 4AZ8A 2XN9E 1ZGLB 5IIEB 3MRNB 4PV9B 4Z78B 4MDJB 5HD8C 3MLSH 3P4OA 1YC8A 4JO4H 4YHLH 4W4NA 4WHYH 1E6JH 4Y19B 1AC0A 2NX5A 1K4DB 3GMNA 3EUUA 3GMMB 1QA9B 3I6LD 3WBDA 4D9QD 2FHBA 5D6DA 3QWRA 4XNYH 1W0VA 2CH8A 2VERN 1UXWA 1KJ2H 3FHAA 5IB5B 1D5MA 4YDKH 4GBXD 3H9HA 1G7LB 3MA9L 3QDHA 4YDJB 1MNUH 1OAYL 2ZPKL 5BRZE 2IPUK 4PD4J 2VLLA 1NBVH 4KQ4H 1I9RL 5JO5B 3ZT7A 5A2JH 1IL1B 1WV7T 3K1KC 2JTDA 1KLGA 1OSZB 1FN4B 2V5TA 1NAMB 4DEPC 2EE9A 1UZ6F 2HJKA 4CAGA 2IALB 3O0RH 4L5FH 1SY6A 3CFEB 1AFVH 3VXME 1TVDA 3B5HA 3NVQA 4NZRL 1VDGA 3GMLA 4JQXC 5I1DA 3QH3A 4KVCL 3ROOA 3MLRL 4YXHH 1ETZB 3ILQC 5FHAL 35C8L 1XIWB 1V05A 1DQDL 1H3XA 2BSRB 1GOGA 5ESVB 1RJCA 3O41A 3MJ9A 2A1WL 4NKMA 2AJXH 2IH1A 1JI1A 1UWXK 3MRCA 3OKMA 1MFAH 2GJ6E 4JFDA 4TNVF 5I8EB 1NEZG 4NT6B 3MFFB 4NPYB 1DBKH 1KPUA 5JHLH 1J1OH 5IWLA 1CL7H 3V6FA 4J3TA 1X5IA 5JZ7D 4I3RL 4LK4A 1FGNH 3A6BL 4NOFA 1EGJL 2YXFA 2FX8L 4JQVA 1F58L 1S7WB 4M5YH 3QHTC 1CFSA 3W0WD 1MF2L 1TJHL 1VKXB 1Q9LA 3PABA 5I0DA 5DS8A 4IRSA 4L9DA 1ZVSA 1QNZH 5D1QA 2VDKH 3ZZ1A 5HHQA 2XACC 4LSVH 5AYUH 4U1NA 1I4FA 2Z8VC 1P6AB 5FGBC 4EDWH 1WBZA 2OBGA 3HZKB 1EAPA 4NUGH 4PJBE 4CU6A 3FCTB 1QQDA 4G6AC 3U0WL 2WNGA 2CDEB 2I27N 2C3GA 4PRIE 3VI3F 3MBEB 4MZ3A 5HI5D 5D1XA 1GRWA 1NGZB 3OJVC 3ZE1E 3BD4A 2IG2L 4M8QB 4Y1AA 4PV8A 5I73B 3JWDC 2FJFB 5E5UB 1VFBA 3QCVL 3TNNB 1LP9B 2OK0L 2MPAL 2XWJB 4LOUD 1YA5A 5E08H 3LDBB 3T2OA 4MB5A 3IAQA 3FRPA 1CK0L 1X7QA 3CXHJ 3G6JB 3VXTA 1UCBL 4L1DA 3CMOH 1QA9A 1KB5H 2OZ4L 4OLXH 1NBYA 2PF6A 2AXGA 4NQDD 3SDCB 1C5BL 1XIWD 25C8L 2R2BA 3DSNA 1G0DA 5F7KC 5CBAA 3RUGB 2M2DA 2BRRH 2EYRB 1TETL 2VOTA 1DQLH 3OMZA 3MNWA 4JHAH 4PLNC 4ELKB 1YJDH 5J4MA 3CK0H 5HTSA 2AJZB 3KS0J 3KPQA 1AD0A 4GFTB 5I16B 4P99A 3LEVH 3QWOB 2AP2A 3G6JF 3ZSTA 5CMAA 3CD4A 3UTTB 4ZNEE 4G3YH 4YBLC 4RFNB 4PRBA 2X9WA 4PRAB 1KEML 3C2SA 3BVNB 4M7ZC 4QXTB 2HP4A 5DRXA 3U0PB 5HPOA 3SGEH 1K2DB 3M07A 4NO3A 2BFVH 1I8LC 2R8SL 2Q7YA 5A3ID 3B6SA 5IK3A 3ZT5A 1CFNA 5HYSG 1G7QA 4PJBA 4FQ2H 4ZFOA 2Z91B 4HAFA 4TTGA 2F58L 4RMWA 4NO2A 3AROA 4ZUWB 4PP1C 5I8KH 4FFVD 1I3UA 1NC2A 4IMLA 2B0SL 3TYFA 4LSQH 5FYJL 3FOLB 3VRIB 3GHEH 1QACA 5D5ME 1S7QA 4POUB 3D85D 4IRJC 5D1ZA 3L3KA 2O5ZL 5EZJA 2O61B 1JYXA 1BZQK 4RBPH 3TT3L 4N0FA 3ULUL 2DLEA 3GSNH 1T5XA 1MCSA 1XH3B 3GBLA 4XBEL 4JJ5B 5F89B 4HIXH 4HKJB 5ELIA 4KUZH 5CEZH 1ITBB 1P1ZA 3QUMH 2LU4A 3FB6A 1BVLB 2DBLL 2VDKL 1BJ8A 4U2YA 1N7MH 3WFBL 4QF1A 2VL4A 1B88A 3N1PC 4NZTL 5C0BE 3B8YA 1KCKA 3JSSA 3QQ9D 1OTSD 3X12B 4ODXB 2HRLA 3TVMD 2DQJH 3G5XA 1BLNB 3T8XB 4JRXD 4MJ2A 1F6AB 5F96L 3CVHB 4PJAE 4X6CE 4AH2A 3WHXA 4OZHB 4WI5A 1QFHA 3ARGA 3P4LA 3SJVB 3V5HA 4PJ5B 3LHPL 4Z7NF 1S5HB 3U4AA 2CMRL 1E4KA 5E8DH 4C56A 1IC4L 2IPKB 4XVJH 2EZ0C 4HWBL 5MENA 5FK9A 3T04D 3EFFA 3DTXA 2DI9A 4XNXH 4YDIH 1XGQB 1FFRA 1RIUH 2R4RH 4LNVA 3WFDL 5IW1A 2G60L 4JRXA 4M02A 4FA8A 1MCIA 3B9KA 3EJYD 5T1DL 4P2RB 3VWJB 3QUXB 3G08B 4P23D 1CD9B 3THML 4RMTA 4IDJH 3RIAK 4X0KB 3ULUE 1IQWL 4U6HA 4Y16C 4K7FB 2YA0A 3BEWA 1HN1A 4HW6A 5BO1H 3R1GH 4IJ3C 3PQYE 1J0ZA 2VLRB 5EC1B 2C1PB 2W59A 3RPIA 3H6JA 1J8HD 1WEJH 4G5ZH 4M7LT 3NIGF 3WD5H 4F15B 3F5WB 3RVWC 1U95B 2AV7B 4P5TD 1I3GH 2QHRL 2YA2A 5F7YC 1KPVA 2W9LA 4UQ2A 1W72H 1J05A 1R5WB 5E94B 1GGBL 1GOFA 2GIYA 3EYUH 4Q9QL 1WITA 4HJGA 1IAIL 4NNPH 3LDBC 1FFPB 3HG1D 4HK0A 4Q7DA 2CLVA 4HFWB 1JGLH 3RWCA 2FSEA 1U58A 3FFCB 1F2QA 1INQA 2EDWA 3MJ7B 5EZOH 2LQRA 3X3GH 5L8KB 2UZYB 4G42B 1MFBL 3F5WA 1V7ML 4ZPVB 1KCRH 4QCIA 3ZKXB 5EC1A 1JNHA 1BQHG 2LAGB 3NACH 3IXAA 4LHUD 4GH7B 5IHUL 4M62L 1TTFA 1FBIH 2WWKT 3BP6B 3IAGC 3QIUB 2OL3B 3RTQB 5CSZB 1AGEB 3DOSA 2GQHA 1HQRB 1F3JB 3W39A 3L7EB 1NCDH 1AR1D 2PO6C 4S10A 5CJQL 3ZE2F 3QUZD 3VW3H 1PG7X 1MCJA 3MRDB 3PWLA 4NC2B 4G9DA 3UAJC 1QLEL 1HH6A 2Y07L 3JV4B 2VZUA 3DX6A 5KS9F 1NDGA 4QYOA 5E4EB 1A6AA 1HHJB 5DA0B 4BQ6A 2VWEC 3AFLA 1T1WA 4OB5L 1FJ1B 5CUSH 4XCFH 1KN2H 4X5XA 4P4KB 2NY6B 4MNHA 4AM0A 4N0UE 3G5YB 1FNEA 4B7IA 4E41E 2GK0B 4F57H 1NMAH 4TVPL 1DLFL 4PJEF 2FLBT 3QJFA 5CJXC 3DURB 4LHUA 4TUOA 1TITA 1HIML 2OL3A 2DLTA 3QPQD 4GKZA 5I1LB 2YRZA 3UJJL 3MGTA 4UINH 1HQ4A 3VH8A 3T0XA 2R0WH 1TJGL 4J1UA 3C60A 5CP3A 3KPSD 2DLFL 1AQDA 4Y4KC 5DFTA 4AY0A 2R23A 1G7JB 3FJTA 4OAWB 5EPMA 5JOFA 4HUVA 5D8JL 5D7LA 1GIGH 5DHXB 1P7HL 5EZJB 5FUZL 1EFXD 1RPQA 5ID1A 2A6DB 5LGJA 1BZ7B 1I7ZA 5DDHB 2IMNA 4BUHA 1T2QL 1JGUH 2DQFB 4YHZH 4F80A 5D7JD 3RDTD 4LGSB 3WIIH 4FHBD 5BRZB 4WFEE 3B3IA 4ZUUA 2IGFH 4PREB 1U95A 3VFMA 3OGOE 1QLRA 4XCYB 3B8SA 3P4NB 4G6MH 5BJTA 3BISA 2A83B 4J3VA 5DJ0A 2FX7H 2JK5B 2A83A 1A7NH 4E5XB 4U0RC 2NY2B 4F7PA 3HCVB 1FGNL 1TQBC 4BFGA 1G0XA 3CH8A 4MGXA 4PJHF 3SDAC 5M7QA 1D5ZA 1EEZA 1FO0L 4HCRH 3MV8B 1OTUD 3G04B 1HXYB 5F7FA 3TBSB 3U46B 2DQFA 2FL5A 5DUBB 1KGCE 3IS1X 5GS0D 4YBQD 5LGJB 3W9EB 1BM3L 1FG2A 3V6OE 3OZ9L 5H94B 1K8DA 4KKCC 1G1CA 4TN9A 5KANI 5EZOL 4JFDD 5E8OA 4F7CB 4TSCL 1TVHA 3D2UA 1BF2A 2BVPA 4X8JA 4S1RL 3WKNA 5GGQH 4MQ7B 5GGVY 3CFCH 4GW1B 4CMMA 3I75A 3S34L 1S5HA 2X4PA 3C60B 4X6DE 4YEFA 4UBDC 5JA8B 3I02A 4G9FE 4DZ8A 4FQ2L 2AK4D 5KN5B 5LQBH 2IADB 4ELMA 4LCCB 4XP6H 3VXTB 3VXOA 3O3AA 2V2TB 5KSVA 2W0FA 3OB0K 3P73A 4XPBL 3UTTE 3HPJB 3QJFB 4ERSL 5HYEA 3TT1H 4XPGH 3LPGA 1YNLH 4X4ME 1EO8L 5FM8A 3VFUA 2F53D 5IEHB 3UMTA 3AREA 4B53A 1IGML 2WIIB 3LN5B 3KPSB 3QXTA 3GI8H 3SO3C 3VXUA 5GQBA 3FB6B 4LPYA 5HDQH 4F37F 4H5SA 3ZYJA 1WGOA 1L4IA 4ZUVB 1T0NA 3PGFL 1FDLH 4E41A 4GBXA 1R0AH 2Y23A 3WFBH 2GY7B 1N4XH 4KPHL 3K3QA 3IGAB 1RHHB 4HPOH 1CQKA 3U83A 1T5WB 3F6IA 1LK3L 3IAPA 4OCWL 3I50L 3MRBB 1HQRA 3KHOA 2RCSH 3ILQD 3QRGL 1I1FB 4LSSL 3VG9C 4HIHB 5A2IH 2CLZA 1G84A 4HT1L 1Q9LB 1CIUA 1CFNB 4PB9H 1MQ8A 1E4XH 4F7PB 4XP5H 5IQ7L 3AUVA 3ARVA 4AEFA 4G8IA 4L4JA 4QRSB 2IAND 3WKMH 3BD3A 4NC0B 3QO0B 3H42H 5C86A 3QCUL 3TV3L 5FYKD 1RHFA 2R39A 1KPUB 2V17H 4ZAKA 3K4AA 4TULH 1BQHB 3UPCA 5DT1H 2HLFD 4JGJA 4P59L 1PFCA 1FFPA 1FYHB 4Q2ZB 3OSKA 3OKNB 3ZYZA 3NFNB 3I2CH 4OD1L 2NW3B 4EQ3A 5E99H 1D6EA 5ENWA 1XIWA 4OM1H 2O5ZH 3RUGA 4KZDH 4OTXH 1OTUC 5CSBA 2G2RA 1JPFA 4DN3H 3LKSA 5ICXA 4OCRH 2PYFA 2EH8H 2X9XA 1MF2H 2ZWLT 1X7QB 3LN4B 1EEYA 2D7NA 4TSBL 3BYYA 1CDBA 1V3KA 1SJEA 3OKYA 2EECA 2MKWA 1SYVB 2X4QA 2G5BB 3ABZA 1U8HB 2AK1L 1AXIB 2V2XB 2X44D 1KJMB 1QRND 4L3EA 3ARFC 4OKVA 1EA9C 5F3BA 4Q74A 4PP1D 1CS6A 5HYJE 1JZ6A 3H8NA 3UTPE 1LD9A 3D6GA 3PUCA 5C08A 1DQJA 3VD7A 5JOPD 4UUJA 2V5SA 4J8RA 4LQFH 3PWPD 4CADA 1FO0H 5L8LB 2EDHA 3HE6C 5EG6C 2P1YA 4JN2B 2H1PH 5I66A 3UTZB 3JUYA 1K4DA 2NX5B 3LHPH 4HH8A 3G5XB 1MHEB 4UTAL 1RJZA 3D0VB 3WCYA 4F7MA 2I9TB 2XKSA 4LARH 3T2QA 4ODXA 2HVKA 2NXYC 3O9WC 4J4PA 1P9MA 1UJ3A 3MODL 1QZ1A 5HHQB 1N3NA 5D2NB 5HGAB 4A6YA 3O11B 3TN0A 3BP6A 2FZ3B 1DANU 1ADQL 3HS0A 1VKXA 3KR3H 3QA3B 4P48A 4KQ3H 4R3SA 2E3VA 4L8BA 5J11C 2HG5B 1JNHB 1WICA 3H9SA 4JR9L 4JO3L 3SO3B 1FIGL 5ACMA 4OBRA 3OKEB 4GBXC 1LP9E 2Z4QB 4S1QL 4XCNB 4LSUH 3CFDA 3V8OA 2Z8SA 1ZHKA 5K59E 5CAYB 1FVEB 3MV7A 4JHBA 5SX4I 3I3EA 1NMAL 3GB7B 3O4LA 1CDUA 2ESVE 3RWCB 5EZLB 1F58H 1ZTXH 2YPVL 1KN2L 5I1AB 2ICWB 3TZVC 3REWA 4HK3N 4UDTB 2AKRB 5JIPA 3U7YH 3S5LG 2OZ4A 3EOTH 4JY4B 4Y5YA 4DK6A 3E8UL 2BJML 2DQHH 1JGLL 3UPAA 1AJ7L 1TQCB 2Q76A 3GSOA 1MHHA 1QHOA 4K3JL 4M7KH 5GZOC 4P2RE 5C0EB 1JMZA 4P3WA 2LAAA 2RQ8A 3S96A 3ULVH 5CJXA 1MJ8L 4TULL 1FFNB 3CFEA 3WNNA 1AXSB 4FMKA 4ZFZB 3V0AC 3A6CH 3S37X 3FOMB 2V5YA 1ONQB 1V3JA 2OI9C 1V7NL 4GAJH 3VWKB 1D5BA 1BREA 5EC2B 1N0XL 4MWFA 4LP4A 2VUOA 5F3HB 5BZWB 3RU8L 2OQJB 4LKXB 4F2MA 1B2WL 4RZCB 1DN0B 3C5ZC 1TQBB 3EYFA 4C4KO 5DJ8B 3RDTA 5FA4A 5HVHC 1WCBA 1I8IB 4HUKB 5F9JA 5FUZH 4JG1H 4JFYB 3NIDF 3ZHDA 4HUNB 2L4OA 2XNAB 3QNXB 3RIAF 4HGWB 4CVXA 2F8VA 4ETYA 3MOQA 3QQ3A 2DQIH 3TO4A 2WUCH 4HX1B 2CIKA 3RZCA 4HH9A 2R1WB 3QEQB 2AXGB 3V4PH 2DOCA 1FVCB 4BSWA 5CLWA 3HZYA 1YMHA 4Z7UB 2GSIA 1HINH 4Z78A 5EBMB 2FX7L 2YBRB 1XGPA 4PRIA 4GQ9H 1YQVH 4XP4H 1EO5A 1JNNL 2WK2A 4XMPH 2MSPA 4H8WC 3GUTB 1YEIL 2OX5A 4O2EB 4YGVB 1HHHA 3OR6B 1XGYH 1JHKL 2V6HA 4L9LB 1M1SA 4U1IB 2Z4QA 4V1DB 3SGKA 2VH5L 4P2QE 3H9SB 3CZFB 1FRGL 4WWKC 3QUZB 1BGXL 1LNUA 5J6GA 5D1ZC 4LSPL 1AXSA 3PIQB 4ZFZA 3INUH 4J7RA 4YDVB 5EOQL 4YX2L 2OSLB 1S9XB 1U3JA 4JRYA 1UJ3B 1N6QH 3Q6GH 2HVKB 3MNZB 4OUUB 1I4FB 43C9B 2JCCF 2OXHA 1OD7A 1LEIA 4GMTL 1T89A 2B7DT 2BSTB 5GGTH 3TWCH 5DEZA 3VG0L 4JJHA 1FGVL 1OHQA 3AAZB 5FCSH 3RX5A 2VDNH 4WTXA 3RWDA 2HAZA 1RZ8A 3CAFA 5JQ6L 2BDNL 5IKCA 1EEQA 4UNUA 5KVDH 3ZTNH 4PLJC 4NO3B 1INDL 1BOGA 4BA8A 3QXWA 2ARWA 3PV7A 4PRAA 2L7UA 4M4PA 5F9OH 5T1MA 4H0GA 1OB1A 2NR6C 4TNWK 3TFKD 2AAVA 1TNNA 1U8QA 5C0CD 3UAJD 3K4DA 1HHKA 4JFDB 4RWYH 4F58H 4GG6A 3IETB 3QUZC 5DHVH 1T20A 3TZVA 2CJUL 1CICB 2PO6D 1ZKAA 1UFUA 4PBVC 3TA3D 1HHHB 3OR6A 3SE8L 1SJHA 5C08E 3NGBB 4GRWH 1MFAL 4ZTOH 2AEWA 4K3JH 4M7KL 4PJXF 4A6YB 5TDOA 5JDSB 2HKFL 4HXBL 3RWGB 1U2HA 2PYFB 4RISH 1MY5A 1X5YA 4QY8A 1JWSB 2RHEA 1N59A 4ZFOL 1KTDA 5D5MA 1MJUL 4TSCH 1EK3A 1U6AH 3ARBC 3MLRH 2BNUB 4GXUM 2V17L 4WO4A 4U1SA 4LAQL 3VXRD 1BFSA 1FYTE 5EO9B 5L88H 1RIHL 5T3ZL 5I6XC 1P84J 2CMRH 5EUOB 5ISZE 1E4WL 1CLOH 4N1CA 4N0CC 1PY4A 5DJ8A 1MH5A 2A38A 1I8KB 3GEWB 3NGBC 2AJUH 4ZAKC 4K71B 3VA6A 2AK4E 4GRMB 2EIBA 3MV7E 3NCYS 4R90L 4LCWB 1MUJA 2EEBA 2OI9B 5E99L 3HNSH 3L3GB 5DD5H 1C1EH 4MXWL 4KK9C 5BS0B 4S11A 2QSTA 3VCLB 4DN3L 2D7TL 3MRNA 3ARGD 3P77B 5LXGL 2XZZA 1IKFL 1PX4A 2XPGB 1D6EB 2ID5A 4UILL 2JELL 3ZE2E 1UC6A 3WL9B 3SGKC 5JLZB 5DXWA 1XZ0A 2WUCL 4ZUVA 3RVXD 5J57B 1N26A 3GI9H 5ESQA 4NKOA 3E3QC 1CDHA 4K3EL 5B4MC 4AMKH 1OAUH 3HPLA 1WT5C 3ZSSA 4QHMB 3GMOB 5GRJL 5HI5C 4PG9B 2C3WA 4M00A 5JW4Q 4PG9A 5IBLD 3AM8A 5EO0B 3HKFA 3T4YB 2NQCA 3QNYA 5I8KL 4UNVA 1JGEA 4LLWA 4ZTPL 5EU6E 5IMKB 1FO0A 3DRQA 4XP1L 5HYJB 1RZ8B 2V2TA 3T0EA 1FYTA 1YMMA 2R2HB 4HEME 4IMKA 4R4BB 1JI2A 2VXQH 3CPLA 1U8PB 2AV1A 3QDGD 5GRVK 3CFJB 1G6RH 3B2VH 5FUOH 4XPFH 1BAFL 1LP9F 1T5WA 2DQUH 2GTZA 4CBPA 4Q9RL 5F9DC 5F7LB 3SKJL 1K4CA 5SX4H 3K1DA 3NFPA 4F7CA 5L7XH 2Z92A 5C08D 5GSRA 2GT9A 4PGBB 4F7TB 1NGPH 4K2UL 3ESVF 3MLUH 2ZCHH 2F54E 5FA3B 3LS5H 2GJZA 2FLRT 1D5XB 5CSGA 4OM0H 2EC8A 3PHOB 4XNYL 5JO5A 3H7BB 1ZA3A 2UWEF 3S4SA 3FQNA 1GPOH 1A22B 2I9LB 1T66D 1DBBL 2A77H 4J3SA 5HYQB 4GW5A 4I3SH 3TT3H 3UO1L 3MOBL 1UM6L 1VFUA 4IJ3B 1AJ7H 1T03L 1IGFH 1XCTA 2B4CL 3C9NB 4JCLA 3KLSA 3LEXB 2X4QB 4PJXB 5I8OL 1HEZA 1L6ZA 1I9RH 3CMGA 5IJVA 1BEYH 5DC4B 2X9YA 4U1SB 4HWEH 4RMRA 1Q38A 2F8OA 3TPKA 1F2XK 5E6ZA 1C16A 4QOKB 5IVXE 2WM0A 3M17A 2VR5A 4Z7NE 5FYKU 4PJFA 4RGNB 5D96B 1NUFA 4HK3J 4LLUB 4XVSL 4MHHG 3QNXA 1ZGLA 5KJRH 1YNLL 3DGGA 4JFFE 5C07A 3HUJB 1CFVL 3OG6B 5F1SA 3BIKB 3TCXA 4JZOA 3VFVA 4P3DA 3OJMB 4PRHB 4HS3A 2DAVA 3HZMA 3F8UB 4R6UA 5FM5M 4BYHA 5DQJA 3VH8B 3TBSA 3U46A 4MHHI 4JFQA 5HHXH 1T1ZB 5E2TH 1FAKT 3AB0B 3JWOC 4MNQD 5EOTB 5DZNA 1WT5A 3F7RA 4L4VB 5KSUA 1DDHA 1FNHA 1Q94B 4PJCA 1T0MB 4V2CB 3U4BL 5DQ9A 5H35B 4CU7A 2YOCA 4I9WE 3HG1E 2Z35B 3VA2C 3C08H 4EI6A 4JY4A 4XP9H 4Y5YB 5C8JB 2W9DL 3QCTH 5DUMH 2HH0H 2OLDA 1MAMH 4M5ZH 4ORGB 4D9LH 2H41A 4IRSC 4HUXB 5IESH 5KSAB 3VG9B 1MREH 3SQOH 3MNVA 3ZDZE 4JKPL 5ITFA 5EZLA 2QV2A 5IWLC 2KPNA 3PQYD 3VGFA 3ORJA 2IPTL 1NJ9B 1YNKH 2OJEA 4N8CL 1QBMH 3AREC 3ULUD 5HYIA 4YDIL 3BP4B 3GSVA 4UILH 3PP3H 1CT8A 1M71B 3GO1L 3OTTA 2E9JA 4X7TA 5BVPH 4L8BB 2J12B 3D69A 4HFUL 4W70A 3RTQA 2E7HA 4OLEA 3QIWA 3U82B 4CVZA 2HT4C 3GI9L 4XPFL 4DK3A 1TNMA 3MRFB 1TDQA 4OD3L 4XGZB 3M8OH 1HNGA 5C09B 3U36A 1HE7A 2A0LD 3WLBA 2YBRA 5MERA 3MRKB 1MWAA 1MHPH 1RVFL 4PJ9D 3D0VA 1MY7A 1VFAB 4HIJB 3VG0H 4PJ9C 2DM4A 1IAOA 5SWZA 4ELMB 5EDXA 1MCHA 5F88B 3MV11 2DS4A 1KCSL 4JN2A 4EDXA 1NGQL 3O8XD 3QO1B 4OFDA 1WZ1H 3C09B 4PJGA