1YQVH

The crystal structure of the antibody fab hyhel5 complex with lysozyme at 1.7a resolution
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
215
structure length
215
Chain Sequence
EVQLQQSGAELMKPGASVKISCKASGYTFSDYWIEWVKQRPGHGLEWIGEILPGSGSTNYHERFKGKATFTADTSSSTAYMQLNSLTSEDSGVYYCLHGNYDFDGWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKILD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Water molecules in the antibody-antigen interface of the structure of the Fab HyHEL-5-lysozyme complex at 1.7 A resolution: comparison with results from isothermal titration calorimetry.
pubmed doi rcsb
molecule tags Immune system
molecule keywords HyHEL-5 Antibody Light Chain
total genus 37
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2005-02-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yqvH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yqvH02
4L4TD 5CJQL 4R4BB 2Y7QA 3LKNA 1S8DA 2Y25A 4PUBH 5K9OA 3NACL 4FTVD 4Y16D 2MQCA 2PN5A 4KAQH 1GJIA 1I9EA 2AKRB 1AC0A 2HVJB 5JLZA 4HLJA 3ELAT 4PGEB 4F2MB 5E00B 4PREA 5LG1A 5SWZB 3HFML 3HNSH 1OY3B 1A7NH 1C1EL 3HZKA 4M5YL 4R4FL 2AXJA 4M4RA 3RVWD 4APQC 1S9VA 2XRAL 3VGDA 2A77L 4HEME 4PJCA 3RWCA 1RIHH 2FGZA 3HS0A 5GS0H 1ODAA 2F54B 5I9QC 3HG1D 3V5HA 4QRRE 3QPQC 3U30C 4XCNB 5D93B 5DQJA 3DETC 4LEOA 5DUPL 4R96B 3S8WA 3KXFD 1IEBB 5T5NG 5GRJL 3KWWB 4QNPF 4YZFF 5C0BD 5BCAA 1QR4A 1CFTA 3B8YA 1DLFH 2C3GA 3BPCB 4HFUL 5F1IB 3QCVH 3RDTD 4V1DA 3CDGA 2EIEA 3HI1A 2R4SL 4YBQC 3IDNB 2NY0C 3OKLA 1BVKB 3BKMH 4P49A 4XBGB 5SWSA 4YHLL 1LE9B 5C7XL 1N2RB 4OLUH 5HHMD 4E0RB 5BS0D 3TZVD 4J3TA 2EDXA 4TUOA 3THMH 2Z93A 2AK4E 4H26B 2VR9A 3RA7H 4NQCD 4XH2A 4HX1A 4U4BA 5E9DA 4ORGA 3SKNB 4X6DE 2CGRH 1IAIL 1JPSL 2CKBL 3MFGB 4ALAH 5C71A 3S34H 3FQNA 5A40E 4PGBB 1ES0A 2P5WB 3MA9H 3BDBA 1GOFA 1MHCA 1F4AA 2LTQB 1KIUA 1MPAH 1CBVH 2GYSA 3DLQR 2AXFA 3ES6B 1MF2H 4NO0B 3MV9E 4K7FA 4PJ5A 1DDHA 5IKCB 2XG4A 3RI5F 4K7PY 3FFCA 5F7FA 2FX7L 1NSNL 4DK3A 5TF0A 3U36A 5D5MA 3MLRH 4ETYA 3BI9X 3V5DB 1IC4L 4O00A 4M7LL 3L1OH 5EU6D 4O9HL 5IVXF 3VFWB 1KEGH 4HMCA 5DEGB 3BISA 4K71B 3INUH 4KTEL 5GGRY 4OI7A 5F3BA 1MNUH 2A6IB 4Y4HC 2R15A 1H3VA 2CK2A 4PJHF 2YD7A 3QHZL 4AH2A 5HGHA 3STBA 1IKFH 4PJHE 1JPGA 5JW5A 4DGIL 3DHJA 3L5IA 5EB9A 5A2JH 4F9LA 3HG1E 3CLEH 4H1LA 3QJFB 3DX8B 3RVWC 1I1YB 2Y06L 3HE7A 5DFVD 4I0PB 4I9WD 5C0DA 4CADA 1VFBA 2PO6D 4AENA 4UQ2B 2I5YH 2VJXA 2DD8L 5C0BE 5EO9A 3VXUB 4OCYH 2WW8A 3HHRB 5C86A 2YHGA 2H8PA 3GMRB 3SDXF 4Q2ZB 2VXQL 4NOBA 3MRGA 1CGVA 2JCCA 4PRBA 3O3DA 4P4RB 3PDOA 5F7EL 3JWDL 3MV9B 2W0FB 1L7IH 2V6HA 1A14H 1ZVHA 4ODVL 3CC5B 3OKYA 3NCJH 4TPRH 5JDSB 1X4YA 1OSZA 1JV5B 3IYLW 4OCWL 2DQJL 3VJ6A 1J9CT 1G7MA 3HUJE 4YR6B 4JKKA 4YE4H 5DJAB 1XGPB 3NH7H 1J88A 3NVQA 1C12B 1KJ2L 1FRGH 1CDHA 4LU5L 3TO4C 1EJ6A 3JV5A 3KPOB 5C0GB 2HVKA 2J5LB 3L3IB 1P6FA 3IXAB 4UB0H 4XC3H 4HBCH 2BXYA 3K8MA 4YFEA 3QFJA 3BP7B 3GMMA 1WV7T 4HW6A 4M6AA 1CF8L 4Q0XL 1KPUB 3GRWA 1IVLA 2E6PA 1ZANH 1AGFB 1FCCA 4LRNL 3GMOB 1PKQB 1Q9WB 1P1ZB 1CLYH 3GI9L 3F6IA 3I2CL 4KJPD 3BP5A 5B8CC 1HSAB 2WWKT 3F7VA 5FUZH 3O3BB 2EDFA 3BPNC 1IZJA 2A9MH 1AE6L 4PJCB 5DJ8A 1RHHB 4KI1A 3O2DH 4CVXB 1FJ1A 4F7EA 3UX9B 3KJ4C 2VLME 4JO1L 2NR6D 2HYMA 4GAYA 3KPNB 3FFDB 4Z7WB 1JNJA 3O8XD 3VGGA 2DTMH 3D1MC 4DZBB 2DLEA 3Q5YA 5B8CB 4J6RL 3RHWK 2D2OA 5F7DB 2QADB 3QCTL 4JZOB 4R8WH 4HIIA 4JM2F 5I15H 3VWJC 4KRMB 3HB3C 3ARGA 1AP2B 3TO2B 5F9AC 4HAFA 3REWB 1CD0A 4EIZC 1IKNA 1L7TH 4FFVC 1KXVC 3PF2A 3PDDA 3RVUC 4KKLD 4P9MH 5DHVA 1GOHA 3LSOA 4XXDA 4PD4K 3GMQB 5I1JL 2AJZA 2IJ0C 2V5RA 1BIIA 2MNUA 4FFYL 4NC2B 1MQKH 3GKWL 2J4WH 4E9LA 1U8IB 2WAHA 2Y4SA 1P1ZA 4Z7VA 2XV6B 3WN5A 3WFDH 1LD9B 5J11B 3X3GH 4KV5F 4KK6D 2FJFB 5CJOH 4CU6A 5D7LA 4WWID 3O9WD 1WICA 5DSCA 3BUYA 1CICD 1FG2A 5EIIA 1M7IB 4G42B 2W0LA 4J8RB 4JKPL 5F44A 1MI5E 2APXA 2XRAH 5TFSH 3STZA 1YQ2A 2A77H 3JZ7A 4TVPH 5A2IH 2X4PA 2ZOLB 3SDCD 3G6AB 4UMGA 5LGJB 5LGJA 3Q6GL 3O9WC 2CUMA 5C9KA 3DETD 3SQOL 2A73A 4Q6IC 3WEXA 1MJJB 5JA9A 2ZUYA 1JUFB 3RZWA 1SYSA 5DT1H 2VQUA 3TNNA 4RFOH 4HGKC 4ZFZB 5DFTA 3D48R 5JOPE 4R6UA 1NFDF 4DCQB 1K9TA 4PR5B 4D0BB 2YD1A 3M07A 3CFEB 5JDJA 5D7LB 2XN9E 1N3NA 1RFDL 2CRIA 5HI3C 1K6QL 3E3QE 1FSKC 3QXUA 1H5BA 4XNZB 3RPKA 3NCYS 2A6KA 3O9WB 3BGFB 2AI0L 1B0WA 1U95A 2W9DH 4L29A 1F2XK 5FFLA 2H32B 4QHMA 5FF6B 1S7WA 5GRUL 2IBGA 3OF6D 4LLMA 1BVLA 2XACC 5IT2H 4UIMA 4Y16C 2R1WA 3N1QC 3GMNB 1YEDA 2R23A 3P4NA 5D7IF 1J05A 2GIYA 4O58H 3RWFA 1GIGL 3RGVD 3ARGB 4OLXL 5E2TL 4GQPH 5K9KA 1G6RH 1QBML 4JPIA 1X7QB 3ZDZE 2GJ6E 4XVJL 4JFQA 5CEXB 3IU3A 4H5SA 1DVFA 4LSQH 3MGOB 3MA9L 5ICZA 5D70L 5KSBF 5EUKA 1CN4A 2LTQC 1MPAL 2ICWJ 4LPUA 2F5BL 1A0QH 1NGXA 5AZ2L 1MFEL 5F9DC 2RBLA 5KVMC 1PGRB 1HZHL 1U8QA 3EJZC 3K2UL 4OT1H 3WUWG 5I8EA 1CD1A 1ZGLM 4H0GA 2WUBH 4NUGH 2WWKO 4FP8H 4F15C 5FO9A 4WIQA 3QWOA 3OKEB 3P73B 4KQ3H 2ADGB 1A6PA 5B21A 1DQDL 4U1MA 1WLHA 5I1DB 4WGWB 1WQVT 4OLYH 4WHCA 4HIHA 4RZCA 1ZLSH 4IJ3B 5JMRA 3KXFE 4K94C 1A9EA 4PTUB 1BIHA 2VLLA 3LD8C 3QFJB 4HZLB 2X7LB 4PBVC 1VGKA 3BEVA 1S5IH 1KCUH 1KOAA 1EGJH 4ZPVB 1B0GB 1P5UA 1XGRB 3U0TB 5JIPA 2OS7A 3D39D 4RAUB 3S36X 2L7JA 4PGBA 4YBLB 5FUOL 1CICA 1P2CB 3ROOB 2DS4A 1MWAA 3EDEA 1KJ2H 5TF1H 4NQVA 3OJVC 5FOBA 3CVHH 3NZHL 5BS0E 3MNWB 1RZFL 1AHWA 4NRYB 3UAJD 4YQXH 5CD5C 3MACL 1T04A 2Z91A 1MELA 4RX4A 2PYFA 4P2YA 1CDGA 3GHBL 4DW2L 4QOKA 5F7EH 4I3GA 4Q2ZA 2DIAA 3GGWA 4E0RA 1IEBA 1UACH 2V5MA 3C9NB 2DLGA 4F80A 3IKCA 1KXQE 5A3ID 5HD8D 3CSGA 3SCMA 5IVOA 3T0XA 3SDDC 2HKFL 5C07E 4X4ME 4K23H 3HNTL 4JAMA 4K94L 4RMUA 2AJYL 4JHWL 4PJ7A 4LCCC 4YIQA 4B41A 1P4LA 1KNOB 1S7UA 2ESVD 2IWGA 4PREB 2WBKA 5CJ8A 4L4TB 3DO3A 1H3WM 3HMXH 3V7AE 2ADFH 2IG2H 3PNWA 3SDCB 2K7QA 3VFWA 1S9VB 5E8OA 4C57C 1T5XB 1R5VB 3RWIA 2APWA 5DJXB 1EJOH 4LRIA 2V5TA 1VFBB 4AENB 5MENE 1NBZA 1NBQA 2FECL 5J3HC 4ZFFA 5IQ7H 4P2OD 3PHOB 1AQDB 1EV2E 1FLRL 1XGQA 1EUTA 4XNXL 4BUHA 4DZBA 1OAZH 4R0LA 1MUJB 4UAOC 3KYMA 8CGTA 2A83B 3PV7A 3TF7C 4GW4A 3MLVL 2WBJD 4I9WE 4AH2B 1RZIB 2IALB 2IADB 1H0DB 3MNVA 3VGFA 1MCBA 1NCDH 3MLZH 3ISWA 1NFDE 1PSKH 1DBBH 3X13B 3HC4L 4N1EA 3FO2A 5FOJA 3NA9H 4LVHB 4ZYKB 1B4JL 3E1F1 3ILPA 1KPVA 2AJXL 4IIQB 5I1GL 4Z7NE 4JO2L 1BVZA 4QOKB 2HJKA 1FGVL 2VDLL 3BP7A 3V4UH 1CE6B 4PJIF 3CIQA 3H3PL 3LKRA 3P4OB 5DRXB 3U4BL 5GGRB 5IKCA 2YPVL 3MNZA 3KYNB 4G6MH 3V6FA 2F74A 5F7WC 1IGCH 2EDNA 3CDFA 4JZJA 2XN9B 5D7JC 5TDPB 1DQLL 1WBYB 5LAXA 1YNLH 1BFOB 2ARWA 1ES0B 1W72H 5I73C 4PRAB 1MWAB 4MXVF 5C09B 5ESVB 3IXTB 3ULVF 4LLDB 1RU9L 2WZPD 3VWKA 3GIZL 3RVTD 1TVBA 2Y6SC 1A7RL 2X4UA 3VDAA 5EZOL 5SX4I 1JGVH 5HGBB 3MRNB 3BH8B 3V5HB 1JUFA 1DVFC 3BD3A 1KIRA 4HMEA 1FVDA 1NAMH 2HRPH 1S7QA 5I73B 1HCFX 2CKBA 3VXTA 5FB8A 5IFJA 5TJWK 4F3FA 4AM0A 1U8NB 3G04B 5BV7H 3C60A 4JGUA 4KJPC 3UJJH 4G8FB 2LU7A 2R0LL 4KY1H 4U1MB 4CMHC 3DYMA 4M5YH 4POZC 1UWEH 1A8JH 4IRJA 3FQWA 5DMYA 1OPGH 5KVGH 3T2OA 1K6QH 4Z5RB 3O8XA 1A21A 4PRDB 2AJSL 3DRTA 2HJKB 2VKXA 5ELIA 2PTTB 3OTTA 3QEHB 4JFOA 4ELKA 4WHYG 4JRXB 5H8DA 1I7TA 3MV9D 2ITDA 4GW5A 4UUJA 3N06B 2P8PA 5DQ9B 5C8JB 4ERSH 1MFCL 4MAYC 4KI5C 1F8TL 4HPOH 3T77A 1OSPH 4KPHH 3GSVA 4RGNB 4YO0A 5LQBH 4YWGL 5IMLB 1PEZA 1UCBL 1MRCH 4K8RH 3PHQB 3FOMA 1AP2A 5J8OA 2EDDA 1KELL 4KXZI 4FXGB 1EHNA 3H9SA 3MRLB 4NFDA 1Z9SA 4PRDA 3W11D 3FB8A 1HH9B 2P49B 3V5KA 1RUKH 5TQ2H 3WXVH 4OGYL 5CBAA 1TPXB 3EO1A 4C56E 4LSUL 2OL3L 4G8FA 1AR2A 1IKNC 1S3KL 1SMOA 4G43A 1G7JA 3C6LB 1U95B 1CDUA 3VXQA 2JELH 1S7VA 1IEHA 4M7JL 1C7TA 1Q9LA 1FL3B 3INUL 1SYVB 3F58H 5F1NB 5FYJU 1T03H 5FECA 3ETBF 3PWUB 1D5ZB 3L7FB 3EAKA 3JTSB 4K3HA 1B2WH 4LLUA 3SDXA 4XNUH 2DDQH 5JOPD 3HAEG 3W9EB 3QIWA 4S1SL 1BAFL 1CGWA 3G6AA 5EA0L 4P46D 1FFPA 4RA3A 2R0KH 2V5SA 4S1RL 4M7KH 2HWZH 3T1FB 1GZPA 3HFMH 3ARBA 3DURA 5E2WL 2EICA 3QUYC 4I18C 1JPFB 2J1KA 4WWKB 4LEXL 2F9BT 2V7NA 4ZUUA 2HAZA 1QYGL 1ZE3C 4EVNB 3O3AB 4XCCL 3T0EE 4MQSB 1G9MH 1RVFL 4Q9QH 3GBNH 2IGFL 2E27L 5JHDB 4M1DL 1C16A 1BWMA 4N0CC 5DUPH 3DVFA 2O61A 3CLEL 4MD5A 1H15B 3M1BB 5GSVA 2NXYD 3DXAD 3WIHA 4PJFB 5CHNA 2D31B 3TO4B 1CXIA 4OF7A 1E4XH 1N7MH 5DC0A 4LAJH 2Q8BH 2DI8A 3VMNA 4APQA 4FTVA 4P2RE 3LD8B 5GRYA 2DMKA 4LCUA 4LCUB 5CGTA 1V3LA 1QFWI 2CDFB 2DMBA 1LEIB 3TZVC 4PTUA 3QEQA 5KVDH 4HUKB 4PJEB 3ZT5A 3RZCA 3P0VH 1KUMA 4ELMA 4XC1L 2QQQA 5KSVA 5HDLA 5KOVC 4TN9A 4WHDA 4YBQD 2VZ3A 2ADFL 3WDHA 4KH2A 3SDCC 4IRSD 3AB0C 4YE4L 4RGMB 1JPSH 4X6EB 2UYLB 3R06A 1MCHA 5IJVA 1XF3A 5E8NA 1BZ9B 1YQVH 4XZUA 5DMJB 4DGVL 1D7FA 5JXAH 4PJCF 1FZKB 1OAUH 5ADPH 3HPJA 1NLBL 3JV6B 4W81A 1EO8L 4OFDA 1XT5A 2AJ3A 2DYPD 2QKIA 2YD3A 4PB9H 4JO4L 3DROA 2QADC 3HKFA 4YHMH 1AI1H 3O0RH 2PR4H 3HZYB 1I4FA 4BQ8A 4JFYB 3LH2L 4W4NA 1PZUB 3ARSA 4EN3A 5C0RL 2VXVL 4WUKL 4QGYA 4LKXA 3GJEB 4OZGE 3IDJA 4RMSA 1E4KC 2XA3A 1MNUL 3LQAC 2LABA 3IU4H 1SY6L 4TVPD 4P2RB 5E9DB 1IGFH 3H2WA 4OFYA 1R5WB 3JV4A 4ZUSB 2CR6A 4QHMB 3ORJA 4ONOA 5BJTA 3PV6B 5C70A 3ZTNH 5C0CB 1ZT4B 4LARL 3T4YA 1QO3B 2NR6C 4IMKC 5GSRB 3TYFB 4WWKA 3EO0B 2VE6A 3D6GA 1UZ8B 1AKJB 3RP1A 3CLFL 3GUTB 4PJBB 4Z7QF 5AYQA 3FQTB 4GLRI 5KSAA 1FE8H 2XN9D 1DQJA 3EOBB 5CCKL 1J8HE 3DXAE 1OD9A 3KPQA 2QR0B 2QSCH 4NPYA 4PJ5D 4FXGA 2NZ9C 2YKLL 1A4KB 4PP2A 4ONGH 4JE4B 1G7QA 5EOQH 2KH2B 1JK8A 3R8QA 1MFCH 3PGFH 2NYYC 4IHOA 5HYJE 3HUJA 3VXUE 2E7LC 4KPHL 5I75B 4LFHD 1CGSH 5HGDA 4LSPH 3VXRA 3ZYOA 3CUPB 1NDGB 1U8OB 4KY1L 5HJ3B 3Q5TA 3MJ9H 4S10A 1DSFH 5ESAB 2Q76B 3LEVL 4U1JA 2J6EA 1WIUA 3GSXA 5E5MB 3TN0D 1WISA 4LSSL 5ISZE 4UBDD 2P45B 4XNYH 5B38B 5JZ7D 1RI8A 1U9KA 1L0XA 1A6VL 1EA9C 1RIVL 1KTDB 3E8UL 2Q86A 2YS4A 1HSBA 1D9KC 3BXNA 5JOEA 2P4AB 3IDGA 3TBTB 1QTYT 4FQCH 3C6LD 4HEPG 1CTNA 5D6DA 5D1QA 4E42A 3MCG1 4K3JH 3F58L 1OL0A 3O4OC 4NZDA 4JDZA 4UQ3B 3HPLB 3U0WL 1G7HB 3BP4B 4Z7WF 4RCAA 4NHUA 1RJZA 3SDYH 1TNMA 2CUHA 3DV4B 4BQ6A 1T1XB 1FL5A 3T65A 2GITA 4L3EE 2BFVL 1QFWM 3BGFC 4ODXB 4WEUD 4YHNB 3C8KB 1T1WA 5I8CA 2B39A 4OGYH 3QG6A 2R39A 4LF3A 1LK3L 3OXRB 2AVGA 3DRQB 2VLKA 4NHCL 3QCTH 3MV7E 3VFRA 4I48A 4CU7A 1S3KH 4DCQA 5K33A 5KTEL 4QXGH 1IT9H 4FQQA 2F19H 1GZPB 1B0RA 3PG2A 4NCC2 1AFVH 3LV3B 1QEWA 4KROB 4Y8DC 1IGML 4ZO6A 3F5WB 5IMMA 3BIKA 4R97B 3SEPA 3BQUB 2NY4D 3LS4L 3RWJA 4OB5H 5DRZA 1FFNB 4OCRH 1H3TA 2PYFB 3L3JB 4N0FA 4FFYH 1MRFH 4GH7B 3RWDB 5D1QC 1N4XH 1ZA6B 3FQXA 5DSCB 1A1NA 2A74A 4KROC 3BIBX 3WNLA 1EEQA 4HK3N 4MGXA 1T4KA 2BSTB 3GM0A 1G0DA 2EZ0D 5CUSH 2BNQE 4P4KA 3K7UA 1PD6A 2G5BA 3ULUF 4XPFL 3HLAB 1GGCL 3BRDA 3TYGH 2DKSA 5GRVL 1M05B 2FBOJ 3D39B 2PYEB 2JCCB 4MHHI 4PRBB 5HVHC 5KVDL 2YSSB 2Y36H 3LKSA 3LKOA 4FQLL 1IZKA 1ZGLP 1EAPB 2J8OA 1BBJB 1OCWH 1BGXH 5EU5B 3LQMA 2EEDA 3KYAA 2Y72A 3FB5A 5EU5A 4XNQA 1K3IA 5MHSE 1GRWA 1SEQL 1HHIB 3HNSL 4MA8L 5HDQH 2OJZH 1W0VA 2BCKB 4IMLA 2X6MA 3NZHH 5HVHB 3AUVA 5JO5A 4MJ5B 4ZNEE 3MRQA 5JORB 4LDEB 1J8KA 2XWTB 3FO1A 3BZFA 1PYWA 1JPGB 5JW5B 1IC7L 1QRNA 3NN8B 1YEIL 3T08A 1LEGA 5IMLA 4X9HA 3MQIA 2E6JA 3UO1H 3L3KB 5JW4Q 3KYMB 4YEEA 3W2DL 2EDWA 5SWZE 1RIUL 4KDVA 1ZS8B 2R29L 1U8MB 5DQ9A 2EH7H 2XXMB 5GHWL 5FGBC 4OZ4A 4CRPA 1A47A 2XTJB 1LEKA 4HDIB 1NC2D 3TH2T 4AM0B 4NDMB 3SKOB 2A9NL 5FKAB 43CAB 7CGTA 3BQUA 1TJIL 4U6HA 3U6RA 5KAQG 3KPQB 3LQAH 4QRSB 4XNXH 2JJSA 3SE3A 1FZMB 1DBKH 3BHBB 3K80A 3ES6A 1MFAH 1P6AB 2YUXA 4QRRB 3UPRA 3TN0A 2RB8A 2P7TB 2UY6A 5T3XE 2VR4A 2OR8A 2VLRB 3QXAB 2OTUB 4WI7A 2UUDH 1L0QA 5I74C 1H5BB 4U1HB 1AI1L 2GTWA 3TBVA 1NBYB 4NBYB 5LAXB 1T2QH 1FVEA 3VJ6B 4WNQB 3QDJE 1EJOL 2VXVH 4D2NA 3MRDA 2Z31B 1BMGA 3MCLL 4LSDA 2AJXH 3MOBL 5DVNA 5LWYL 4WDIA 2MHAB 3ARFC 1JZ8A 3BEVB 5ACZA 1ZA3A 3CFJA 4LSTL 5C6TH 2BNQD 2QJDA 4JCMA 4FABL 3RZCC 5CILH 1KJMA 1JVKA 1KF9B 5GGTH 1JTPA 5I0ZA 3PP4H 3T8XB 2UY7A 1NGWA 1JGUL 4BH7B 3QWOB 3WV0A 3PL6D 4P5MB 4O9HH 2VO5A 4RQQA 3GNMH 3KLHD 1MHHB 2DQUL 4R26H 5L8KB 4U1JB 3UEZA 4G8EA 4ODWA 4OUOA 4GAJH 3L3HA 2P5WE 3MACH 3VXSE 5D1XC 1LWRA 4DGIH 2SEBA 3RL1B 3ARPA 4R7DA 1S7XA 4R2GB 5ANMB 5F7KC 3AS3A 2R9HC 2LU3A 4LSRL 1X4XA 1IC5L 2JCCF 2IQAB 4ZUVA 3V2AR 4AEIL 3QUZA 3WHXB 3CZFB 4KK5C 4M1CC 3UJJL 4P2CG 3WFBL 5IR1A 1KN4L 4X80H 3ULVC 5KSUA 1GGIH 4GKSA 4WI9A 3DX7B 3TT3L 4JFPA 4LMQI 1C5DB 3IRZA 2IBBA 3BT2L 1NBZB 3VXPA 2HLAA 3C5SB 1A6VH 1S8DB 1XGTA 1CI5A 2DKUA 1BQLL 2BVQB 5CEZE 3MO1A 1RURH 3RWHB 2CJUL 3LHPL 5C0AA 3ZDXF 4Y4FC 4U49A 4XH2B 5LKNA 4WI3A 1F02I 1IAOB 4BSWA 1T0PB 1TCMA 2DBJA 5FK9B 4KVCL 4PP2B 5I9QB 1JRHH 3DMMA 5AG8A 2Z0BA 2UVFA 4XC3L 3RY5A 1BD2B 2R69L 2QR0A 4NPYB 4XT1C 4BFEA 3QFDB 4XRCA 3VI3E 4Y4FB 1ZANL 4M6MH 4RMQA 1QFHA 4HUXA 5T1LD 3SO3B 1GXEA 1GHFH 4JREB 2NXZD 2QSQA 5ANME 4JN2A 4KRPD 5I1KL 4EOWH 1U3ZA 2NLJA 1MLCB 2RQ8A 2ZUTA 3VRJB 4AEFA 1BPVA 4HKZA 1IL1B 1Q94B 2VXSL 2LQRA 4PR5A 4FQXD 5DJZA 3WUZA 5HYQB 1QOKA 2FGWH 3I50H 1YJDC 3W9DA 1INEH 4L4JA 4F9PC 1FIGL 1K4DA 2AV1B 4XPTL 1MLBA 3LSOB 4XXDB 5JXEC 4H20H 4KV5E 3IF1A 4KKNA 1T20A 4WI5A 3GSRB 3MRGB 2BVQA 1TZHB 5I17A 5HYSB 5IFHL 4Z8FH 4KHXH 5D1QB 5IHUH 2P5WD 4P9HH 5D7LD 2CD0A 3SE9H 5IHZB 3QUZB 2EDLA 5IG7B 3WIIL 1PVHA 4UQ2A 1IGCL 4HD9A 3MBEB 3A67H 4WFEE 3OB0K 4PJXA 5H37G 1G7PA 3OKEA 5ISZD 2OYPA 4KKBC 3BUYB 3BMVA 1MJUL 5T5FL 2NY3D 3NGBC 4NQTA 2FSEA 2I07A 2ORBH 4J3OC 3GBML 4W6YB 1UWGL 3GI8L 4U1SB 2PXYC 3LB6D 2J8UB 5EBWB 2IQAA 1JI1A 3S97C 3TA3D 2YEZA 2N4IA 1MIML 2YA2A 4GBXC 5HI4D 3T3MF 3CMOL 1H9VA 1PEWA 5EA0H 1ND0B 1Z0NA 3MUGB 3TV3H 3VFVB 1XIWC 3U7YL 3BPLB 2NY6C 2W38A 3DJ9A 4DGYH 3REWA 2JB6A 3FB5B 5HY9A 4FQHA 4ZS7L 5A16A 3B3IA 5D7JA 1TJIH 3P9LA 3NBNA 4ENEC 5F96H 1BFTA 1MFBL 5HDBE 2R1WB 3KDMB 1CE1H 1TQBB 3PQYD 5DI8B 1OWWA 3V0VB 5C0GA 2N7BA 1AO7A 1OVZA 4UT7L 3KPNA 2XYCA 4M1DH 3T8XA 4Y5XA 4KZDH 1FVEB 5DRNA 4LOUC 1H3PL 1R24A 5C0AD 2IPUK 4WTWA 1FIEA 3OWEA 1IEAB 4JEGB 1RMFL 2BHZA 3S37X 3LEYL 4ZXBB 1CGUA 5D8JL 1I9JL 1JGEB 4U6XA 3H6JA 1T2XA 1BECA 1INQB 2IPTH 4YWGH 2NTSP 4KK9C 3K0WA 5ID1B 1G7LA 1VB9A 4MWFB 4HUMB 5T1DL 4PJXF 3P3YA 1KELH 1PZ5A 1CWVA 2D7OA 2E6QA 3EDDA 1DUZA 5DVLA 1KFAH 4H1LH 4HJJH 5ERWB 3MLSH 2HRLA 4J1UB 5D1ZA 3ESUF 4X7SL 2ILLA 5EZLA 3VFOB 4GBXA 4TSCH 4AEHL 1JIBA 3QUMA 4X5WA 2XZQH 5K93A 5E99H 3QT2A 2A0LC 3ZTJG 1KJ2B 3MUZ1 4YXLH 1LNUA 1OW0C 3CX5J 4NQDA 5D1XA 3GJFA 4AIXA 2NY2B 1I3GH 4IDJL 4JPWL 4OJFL 2ZOKB 4ZNEA 1XH3B 4C83A 3U7WH 2YD2A 4UZGA 4DN4L 2O5YL 2ADIB 5DGQA 1U8IA 4Z7VB 2KQNA 2C1OA 3MRMB 2AQ3A 3DI3B 1KSRA 1FL5B 5IM7A 3T04D 4FNLH 3GSWB 3WUWB 3TWCH 2CDEA 4ZPTA 5EBMB 4PG9B 3ULUC 2XA8L 4WUUD 4E42B 1Q0YL 4X83A 3DWTA 1RZIA 1D6VH 4NO3B 3C5SA 4MA7L 4LAQL 4Q7DA 3QPXH 1VFAA 4DZ8A 1T22A 1EUUA 2CRYA 1SMAA 1P9MC 2R2BA 3KJ4B 5SWZD 2B4CC 1QYGH 2YBRA 4U7MA 1LVEA 4GAJL 1SY6H 4TSBH 2W91A 3NCCB 4BYHA 2VDPL 1RVFH 5CZXC 4XPGH 3G5XA 5IF0A 2EDRA 3EFDL 2E7BA 3D0LA 4YLQT 5HGHB 1AXIB 3H3BC 2G9HA 4YDVA 1DFBH 2NY7L 2ZUXA 2AXGB 4JVPA 4HSQA 4K3EH 4KKAD 4WENB 2J8UF 2VERN 2XFXA 2SEBB 4Q9RH 5T1KB 5JW4N 3EZ8A 1MWAL 3NABL 1VFMA 5CGYD 1RQ5A 3NA4A 2D7TL 3HC3L 5IP4A 5DRZB 4HF5L 1KG0B 4PS4L 1XIWD 2DJ4A 2MSPA 3RU8L 2VC2L 4MDJA 4X4YA 2BRQA 4HG4J 2OX5A 5I1CL 2DWEB 5IFAL 1ZKAA 4Z7VE 1IGJA 2BJMH 3F7PC 1YNTB 4HKJB 1Q9KA 1N8ZB 4LPCA 4PJHA 5IHBA 3FQXB 43C9B 2AK4D 3AMLA 4WI8A 2X09A 4KFZC 4N0FB 2IF7A 4DEPB 3WO4B 1ORQA 4K3JL 1O5DT 4F3FB 2QQNL 3N85L 1X5XA 1J1PL 3KLAB 2RFXB 3IDXL 3S96B 4HBQA 3K8KA 1C5BL 2C7UA 1JZ3A 3DMMB 1K8DB 2R2EA 2G75A 1A6WL 4K9EL 2MWCA 2HFFB 1WVZA 3B5GA 2ZSWB 5EOCH 1CQKA 2XWBA 2FYYA 4F7CA 1N0XH 4PTTB 4MDIA 1LK2B 1A7QH 4YDKL 3RDTA 1MJ8L 2B0SH 4XPAL 4M6ML 4ETQB 4OBRA 5HYSG 3ULUL 2DQFA 2Z8VC 1JF5A 4JREC 1DBJL 1I1RA 2P1YA 3H3KA 5M7QA 5HYIA 4YBHA 4MJIB 5MI0C 4NQDE 4FQXC 3FCTA 3I02A 1EDQA 5ITFA 1W72B 4H8WC 4JG1L 5FEBA 3MJ9A 1OT1A 3EYVB 3FB8B 1T22B 1YMHA 1UWGH 2VLLB 1V7MH 2J5LC 3FN3A 4L3CB 3I6GA 4ODUB 3S3SA 5J1AB 1WIPA 3LDBC 4LPWA 4OGXH 3CSPA 4BQBA 5GZNC 2LE9A 4Z8FL 1KV3A 3O4LE 4J23A 1NDMB 3X13A 3W39A 3QJFA 4L4TE 1AD9B 5IMOB 4QHLB 3FZUC 4HIXH 5EU7C 2I25N 2APTA 2ITDB 5KSBE 1QFOA 2YXFA 2IALA 1HIML 1SEBB 1FZOA 1JZ6A 4MS8C 3GBLA 4YNYB 2VITA 5ILTH 1F3DJ 5IJKA 3IFLL 3CFDB 1EH9A 2BC4B 2NY5H 2QLVB 3HZVB 2VZSA 5ICZB 3BJLA 4X7TA 1UXWB 2DLHA 1UWXK 5CEZD 4NP4H 5C0FB 4UDUB 5K9JL 1ZK9A 3RGVA 4ONGL 1CTOA 4P46C 1J1XH 4BUGA 4H88L 1H3PH 2VLJB 4Z7OE 1A6ZB 2X4RB 2CGRL 4RGND 2PCPB 5FDYA 4BKLB 5C6PB 1EAPA 1IAIH 2H41A 3JVGC 3QDGA 5D2NC 2VZUA 5D7IB 5HYFA 4MA8H 1FNGA 5HDQL 3IDYB 4GG8A 1YMHB 1ZHBA 4V1DE 3ULSB 1BP3B 2MHAA 4KI5E 2AV1A 5FO8A 3FQTA 1M05A 4IS6A 5JHDA 1INQA 4QXTB 1KNOA 1VEPA 1X5KA 3Q0HA 3EGSB 1ZXQA 3FQRA 3NPSC 3BD4A 4JO3H 4NN6C 2O26U 4BSVB 5IOPB 1R24B 1ORQB 4FQLH 3UTTE 3I9GH 2VSCA 3ULVD 1N5AA 3TIDB 4Z7QE 2A6DA 1PBYA 3B5HA 3U9UA 4G6JH 1OP5K 2J3SA 2A6JA 3B9EA 4Y4FA 4OCSH 5I1IL 3CDYA 2CLZB 3QEUA 4XCYB 3QHFH 4L8DA 4HH9B 2HTLC 3LEYH 3VFMA 4AMKL 2BVPB 4O2EA 3ZYZA 4G3YL 2JB5L 5KZCD 3NIFE 4U1LA 4U7KA 3O2WL 4NQCE 4QHUA 1MJ7L 3QHZH 4OIAA 1SHMA 1Y0LA 4M9OA 4LSVL 3VCLB 2ATPB 1WC7A 4MQTB 4Y5YC 1VEMA 4W68A 2JK5B 1EGJA 1JWMB 4A6YA 3W2DH 3QULB 4NM4H 4L8SA 5ACLA 1H5BC 1EXUB 4QHKJ 3S37H 3LPGA 4NQVB 1JHKL 5EFIB 2FECI 2NY6B 1QPPA 3O2VL 3EYFB 4IRZL 1ZLVH 3TIEB 3AY4C 5FM5M 2IFFL 5MEND 4P2QA 3MRJA 1G7JB 2QBWA 4QXGL 4PGJA 1I8IA 4LAQH 3G6DH 5ALCL 4PRNB 4D3CL 4ZQKB 4XNZC 2YN3A 1IGMH 1A4JA 3QEGH 4XBEL 5FHAH 1HH9A 5TE4L 2E9BA 2CMRL 3LS4H 1WZ1H 3HNVL 1MCPH 4TTDC 2GY5A 1QFUH 1AO7E 3BN9D 4TPRL 4BZYA 5EU6E 3HI5H 4OM1H 5GIRB 3G6JE 3MXWH 3KNBA 2EYSA 3FN0H 1I75A 5HHXL 3K81A 1CL7I 4G7VL 1MVUB 3DV6A 1WCBA 4KJQC 4JFFB 1RJLB 2JELL 2AS5M 1NKOA 4OFPA 5CUSL 3QH3B 1NEZA 2BNQA 2GJ6A 2JKXA 5E08H 2IH3A 4OFYD 2WWMC 1GAFH 1U6AL 5FCSH 1CL7H 1T5WA 4ZO9A 5GS2D 4UILL 4B53A 1DEEB 2O5XL 3H9HB 3O45A 3FFCD 5C92A 3GSNH 4QYOB 3P9MA 4JFDB 1J0YA 4KMLB 4XPGL 4EN3C 1A1MA 1ZT1B 2M26A 1K5NB 4AEIH 3MRRA 4PLOB 4S1RH 2WQRA 4OD3L 3UTTD 2NY2C 3S5LB 2CKBB 2OJZL 3S5LA 5IFJB 4H25B 4ZUUB 1TVDA 3QDHA 2P42B 1DUYB 4MWFA 4QHNB 1JZ4A 4KDTA 2I60L 4HXBH 3BQUD 2FIRT 4ZS6D 1QRKA 3EKCA 4Y16A 1CDJA 3JWDC 1EK3A 2BOBA 2E5EA 3QWRA 2OR9L 4KUCD 5J13C 1F6LL 1U8HA 5F8QC 5GSRA 3TYFA 3ROOA 1FN4B 4GRMA 3VXRD 1FAIL 3RBSA 2EE3A 4UINH 2MPAH 1T1YB 1WT5A 3QH3A 1FYHB 3MYJB 5HPOA 4F7PB 4JG1H 4P2OC 4QY8A 2CLRB 5MEOA 1A02N 2V2WB 3OV6A 3PWPE 1JRHL 5FO7A 3QIWD 5L2JA 3QG7H 3TFKD 3C09C 1BWWA 3MRLA 3KYKH 3LN5B 4GKZB 2D9QB 4WUUE 3V0WL 1T3FA 1H3GA 3TVMB 3VG9C 1JGLH 2X40A 4QXUH 4G80A 2D9CA 1BQLH 4WTXA 3UTPE 4LVEA 1BEYH 5AYUH 1PLGH 4U1GC 3H0TB 1G9EA 4Z0BH 3CD4A 3P9LB 4U1IB 1N5YH 3FO9B 4N8VB 3STLB 3FO9A 4N8VA 5CSGA 3STLA 1K85A 1QSFB 4CVZA 1SEBA 2XKUA 2FLBT 4X6BA 1NGXB 3MCLH 5AZEL 3NIDE 3CUPA 4MJ5A 2VLKD 3IDUA 4PJ7E 3QDME 3F7YA 3O81A 3AU1B 5CGYC 4FABH 5L9DH 3BP5B 1W0YT 4DVRL 3EJYC 1JHTA 3C60B 3EHBC 1IGIH 3VG0H 1QSZA 4YHYC 1R5VA 1FH5H 4ZAKB 5TPWL 1QA9B 4CDHA 1EZVY 4FG6D 3U36B 3H42H 4UT9H 4X8JA 4GUPB 3BPOC 1JF6A 5MP6H 4HH9A 2ATKB 3TPUB 2UZXB 1YEGH 4WO4C 4WGVB 2OQJB 3IFLH 5DQDL 1TVBB 4ZOAA 3LRSB 4YDLC 3RIFF 1INEL 5EUOE 1U3JA 4IRSA 4OZFB 3RVXD 3KLSA 3Q6GH 4QTHB 2GTWB 1TNNA 1TVHB 3T0WA 1AKJD 1WUNT 1H15A 5DMKA 2YUZA 2O5ZL 1J10A 1DLFL 3RL2A 4WEBH 2MFNA 4LQ1A 1CR9L 3HA0A 3C6LC 4M62H 4PRPE 3BZEB 1BJ1J 3KYNA 1E4KA 2NY4B 1SYSB 1PX3A 4HS8H 3BO8B 4HWBH 1RZGA 3MV8B 1U8LA 2MJWA 4I8DA 5SWSE 2AQ1A 4WY7L 2DWDB 1YMMD 3VGAC 1F90L 3QI9C 5CCKH 4HIEA 1UB6B 1MFEH 3BZ4A 4W6XB 3TJEH 3QWRD 1SBSH 4LNVA 3RA7L 4F58L 5FCUH 2WQ8A 5IB2B 3EJJX 2VXUH 2A0LD 4PJ9A 4NKIH 3NIGE 4YXHH 1XF4A 1YN7B 1KIQA 3CVIH 4PB0L 6FABL 4NYLB 3L5WB 4Z7UF 1RURL 5D7JB 3OSKA 3CFBA 4H8WH 3ZDYF 3L5HA 2V2TA 3DARA 5FGCB 3GK8L 1NEZB 3BWAA 1EHLH 1ZLSL 1MUJA 3LEVH 2A6IA 4Y19D 1WAAF 3B5TA 4LIQL 5F96L 3IS0X 5I1HH 2X4OB 3GRWH 1BM3L 1G7HA 1D5XA 1EX0A 1LO2L 1ZV5A 1YEFH 1KCUL 1A7PH 1BQSA 1DE4A 3MNVB 4D8PB 4TNWF 4XNQB 3C6SA 3C6SB 3IDGB 3T0DA 2VLKE 2GJ6D 1CVRA 3GM8A 3UPAA 3ARDD 2EIZA 3S37L 3LKOB 1I1YA 5I6XC 1HSBB 1KCLA 4I1NB 4TUKH 1JWSA 1UB5B 4I3RL 2EO9A 3WD5H 3QP3A 1HINL 2IPTL 2MQ0A 1RJCA 2V2TB 4F7TA 5FGRA 5HI3D 1JTOA 3EIFA 3SPVB 4E41E 4ZXBC 3TCLA 4PJ8A 5TE4H 1HDMA 3V0AC 3DX9B 4XPTH 5T3XH 1S7RA 2JLLA 2J8HA 4JKWA 4U3XA 3VI4E 4O2CA 1GC1H 4G7YL 5J0BA 4OM1L 1UGNA 3T2PA 2X89A 3VI4F 4JPIB 3SJVE 2Z8WC 5DC4B 5DJ2A 4W6WB 1HHHA 3J7HA 3MLRL 4JHZA 4RGMC 4G8GD 3MV7B 2X70B 2B1HL 4QHUB 2QADD 1IL1A 2Y9RT 4XB7A 2Y07L 2DWDA 4EDWL 5CBEB 5DMGC 3QIUD 2HT3C 4ODSL 2X42A 1F58L 3BKYL 3OKLB 1RV6X 4NO0A 2ZKHH 1FPTH 5IHLB 3OR7A 3RGHA 4KQ4L 1MSPA 5JR1L 2H32A 1N5AB 3TIDA 4MLIA 2WV3A 1TVHA 5CJBA 4OCMC 4OKVA 3QZWG 3NH7L 1HHGB 3VXOA 4TSAL 1N64H 1D6VL 2ZCKL 4X98A 3S7GA 1HI6B 1HI6A 5JQ6H 4NQSA 1NMCB 1HXMA 1UA6L 3QPXL 3M17A 2VQ1B 3U6RB 3P0GB 5TQ0H 2VC2H 3BYTA 1UVQB 1KJ3H 3K2MC 2ZOLA 4TSBL 1XGTB 5L0QB 4LBEA 1Z0MA 2DYPB 1QFWL 3MODH 1BJMA 1UH4A 2ADGA 3IFPB 3RWGB 3GI9H 43C9A 1PSKL 4LVNC 4K3EL 3WIHL 4Z0BL 4YEFA 5CBEA 1JFQH 3VWKD 3HTLX 4NZTL 1NCCL 3SQBA 1KG0A 2AW2A 2YD4A 4NQDD 1HNFA 2HKHH 2YRLA 3NTCH 3C09B 3BUTA 2H6PA 2F54D 1EFQA 1FLRH 4U2YA 3T0EB 3MUY1 3W82A 3T3ME 4I77L 4MX7A 1JPTL 4G80B 4IJ3C 5E4EC 1RIUH 4E41D 5CEZH 1BX2B 1DBJH 1YPZF 4X6FB 1Q1JL 3HZKB 1AQKH 1JWUB 4L8SC 5EZJB 2EDJA 3P4NB 4WV1A 1EFXD 3UZVB 3N85H 5E00A 1QACA 3DPBA 5I66B 1BBDL 3U4EB 5GGVL 1UB5A 4LIQE 4FQ1L 4OLZH 1V7ML 5K59F 3LY6A 1E4JA 1A7RH 4K3DH 4Q6YA 4PJ8D 3ARVA 4Y2DC 5E94A 5GS2H 2AK4A 3OB8A 3MGTA 4MD4B 3T09A 1DEDA 5JPMB 1EMTL 4JDTL 4Y19A 1NGZB 1N0XL 1QQDA 3FT4A 5F70A 4JM4L 4XAKE 1KB9K 4HH8A 1MJ8H 2EH8H 1VACA 3BGMA 3FOLA 4GO6B 4YH6A 3BAEL 5DFWH 1UT9A 5IW6A 1GVIA 3MFFB 1NJ9B 1NMAL 1KB5A 4O02H 2VQTA 1RULH 4QHNA 4TVPL 4PJ9D 2EE9A 1JYWA 2AJSH 5BW7C 2FR4B 4Y4HA 2DRUA 4KUCF 1F6AB 2H3NA 5CINH 1Q0XH 4X99B 1R5IA 5D6CA 3T0ED 1A64A 3RTQC 1T66D 3HZYA 5CLTA 4H88H 1YEKL 4J12A 3OKOA 3PE9A 4HV8B 1U8KB 1MJJA 5ERWA 3V52H 2NQCA 4M7ZC 3PHSA 4JRYD 5C3TA 1YPZA 1OSPL 2RJMA 3U46A 2J88H 3OGCB 5EG6C 4S0TD 1UCBH 3I85A 4PV9A 4JB9L 4AIZA 3GNML 2QQLL 3JTSA 5I19L 3ARFD 2VDRL 2AJZB 3S4SG 1IAKA 2EDBA 1WWWX 5FYJE 3HS0B 3SGEH 5AEAA 1S9XB 3LS5L 4I2XA 2FZ3A 3RU8H 5JIIA 3MO1B 4OV6F 5FYKL 4ZSOB 1P7HL 3F7RA 4M61B 3VMPA 5GGSB 2HMIC 3M8OH 4JHAL 3L7EB 1QRNB 3NN8A 5DRNB 2OL3B 1FHGA 1CFQA 4WI6A 2C5DC 1IILE 3UJTL 4LHUA 3D85A 4F2MA 4PGEA 2QSTA 5C0BB 5C0BA 2BCKA 4JFPB 3U4EA 4JDZB 4UQ3A 3ZHDA 4HCRH 5J57B 4LGPB 3JUYA 3RY6A 3TT3H 1RUQL 3LKNB 4LIQH 5CGMA 2JTDA 5I1HL 1ZEAH 3OAYK 2ZJSL 2GUOB 4LVHC 5SWQA 4J2XA 1WZMA 4JZOA 3X12A 2YSSA 1ND0A 1RUKL 3HUJB 4S1QL 3Q6FB 3TBWB 2HT2D 4GRWF 5GJTH 2HWZL 3DSFH 3TC9A 1K4CB 35C8H 3V6BR 5EPMA 3MLTB 1CIDA 2VDNH 3KR3H 5DJZB 5D1ZC 1AR1D 2GSIA 4UTBL 2FRGP 4OCSL 1S7SA 3SDDA 4D3CH 2Y07H 4U1IA 2D03L 3UTQB 2D4DA 4M6NH 2I9TA 2NY0D 3QI9B 3BP6A 1WFUA 3W5MA 1YEJL 4G3YH 1FCGA 1CT8A 3F7QA 2FO4B 3ZKXC 5DK3A 5E56A 1ZHKA 1JWMA 4O5LL 1M7DA 3QUMB 1S9WA 3C5ZC 5A2LH 1MHPL 5DJ0B 2X4SB 2Q1EA 4TSAH 5HVFB 3ARUA 3GMPB 1G1YA 5FM5O 2R8SH 1F4YL 1URLA 2XZZA 2EDYA 1Z5LB 1G7IB 2ADJA 2HJFA 5H37H 1UA6H 5SV3A 3U48A 1U6AH 4HJGA 4LEXH 1OQXA 3QEGL 3MJ8B 4C54A 1NGYB 3UXFA 5DO2C 1I7ZB 2R56L 2NX5A 3TA3A 1F4XH 2HFGL 3C6LA 3HI6L 3QAZB 1A1OB 3ZMRA 1T0NB 1T7XA 3B9KA 3SE4C 4CADB 4HUXB 5KSBB 1FORH 5FA4A 3SE9L 1MEXH 4XMPH 2ZUQC 2HKFH 2VR5A 5HHVH 5F7YC 1ERNA 1JF1B 4IRJC 3NFNA 4NZJA 2PTUA 5F89A 2H9GA 5ALBH 2ZG2A 5HBBA 3NFSH 2I60H 2X4PB 1M71A 4BSWB 3VXSD 3GBMH 1I7RB 1S9WB 4I2XE 1XGYL 3P4MA 5E5UB 3RPIB 3DUHA 1VDGA 3VDBA 3MCKA 4OZIB 3GHBH 1INDL 2X10A 2FATL 3UTTA 1YECL 4UINL 4JVUA 4Y0GA 3AROA 4GLRH 4QHLA 5IBLD 5D72H 3QNXA 2XI9A 2AEWA 4K23L 3X11A 4MYWB 1HKFA 5DDHA 3MJGX 4PUBL 1I8KA 1KCSH 1QSEB 1EMTH 1W8OA 1D5MA 2XKSA 2JCCE 4L3ED 3IJHB 4ELMB 1W2KT 1IFHH 3EZJB 3UYRH 4KKCC 5IIEA 4M00A 3HE6C 4YHML 1X4ZA 1MI5D 1X5ZA 1NFIB 3QJHA 2O61B 4F15B 3QQ3A 4FXKB 4NFBA 4NN7C 4LLMB 3NA9L 4O4YL 4ZG1A 5C0RH 1HXYB 1AXSB 5HYQA 2M1KA 5D8JH 2X4QB 3ARBD 1X9QA 3FO0L 5E4IA 2CRMA 2IH1A 2C7UB 1F4HA 4BSVA 1K8IA 3P2TA 4K8RD 4PJ8C 4Y2DD 3C5ZA 1A1NB 3V8OA 4OQTH 4ELMF 1XF4B 5D2LE 3OKNA 4LRIC 4WJ5A 3K3QA 3QA3B 2BSSA 1TJHH 4CBPA 3MUHL 1R3IL 3MXWL 1DQQA 2I26N 4NNPL 2X1PA 2Q8AH 3FRUB 5MEPA 4JY4A 1YNLL 3S96A 5DJ0A 3BAEH 1CDIA 3IDIB 1N59B 3CFKA 1UM6L 4YXLL 5D4QA 4GRLB 4TRPH 1NCBL 4GMSH 2VDRH 2HVKB 4P23B 5F88B 2CK0H 4X7TB 1DLHA 4DK6A 1GSMA 1T7WA 1XF2A 1IGJB 3DVGB 3QNYA 4QF1A 4L8CB 1HYRC 2XTLA 1I7UB 4Y4HB 1FGVH 3AS2A 4U1HA 4OLVH 1DN0A 2DMCA 4JKMA 1V3JA 3U79A 2GI7A 4Y5VA 5EPMB 3LQZA 4WV1C 3S34L 3W39B 1E4XI 4UV4L 5E8EA 1AQDA 5LGHL 4LLVB 5DHVB 1UM4L 2ERJB 6CGTA 3VGAB 2Q7NA 4WI2A 1OLZA 4HIHB 4RZCB 5GIRA 1L6XA 1QPXA 1EBPA 2B1AH 4IOIA 1A6ZA 5FA3A 4UNVA 1R3JA 4Y19E 1G9NC 3TNMA 4HK0B 4PJEA 3RZCB 2MTPA 4GAFB 2YBRB 4NJAH 5DO2D 5C0FA 1CDBA 2X44D 2Q6WB 5HGAB 1X5HA 2YPLB 3ILQC 3GJFH 5FYLL 1IARB 1UCTA 4YK4C 1KTKE 5DK2B 4NWUL 4O2FA 2L4OA 3AXLB 4UUJB 5DLML 5BMFL 1A5FH 2I9LB 3IFOB 4IIQC 3RAJH 3ARXA 4FQJH 1LE5A 4X6FA 5GZOC 1UWEL 4CVWA 3P4LA 4JAMB 4YO0B 4ZTOL 2UWEA 1XF2B 5F3BB 5B39B 3NFPB 4U7SA 4YHIA 1IKFL 3TBSB 4PJ9B 4M9PA 4GG6F 5BZWB 2F8VA 3DTXA 4TNVK 4GBXB 3MRPB 4U1KB 2DKMA 4F33B 3ALXA 5KANG 4XNMA 1NH6A 1FO0B 4TUJB 1I85C 3CNKA 4I3RH 3WKNA 1QEWB 3WD5L 1BF2A 5MEOB 3RHWF 2EC9T 3B2UD 2JJTA 5HGBA 5ITFB 1OB1A 3R4DA 1GYAA 4XHJD 1CGXA 1MHCB 1UZ8A 2G5BB 3CXDL 3CFIC 4PJAF 3IXTA 3VXTB 5FB8B 3D18B 2J7LA 1DUZB 3HI6H 1YEFL 3WNMA 4Y88A 1TQCB 5BV7B 2DI7A 4OI9A 2A74B 3HB3D 3L5XH 4GKNB 5HDBF 4YXKL 5DXWA 2P5EE 3RUGE 4N9GB 1FRGL 4LU5H 5ALBL 5C9JA 3TJHD 5EWIH 3VWJB 1T03L 3F5WA 4HS3A 3QDMB 4XPFH 4ODTH 3TYGL 1U3HA 4BFIB 2DBLL 3LKRB 3P4OA 1Y6MR 4EBQH 1KC5L 1RZ8A 2XKNA 2NY1C 3S36L 3QIBC 1OAQL 3MBXL 1U8QB 3LOWA 1N64L 1FZJB 2IH3B 1MEXL 3QIUA 5IWLC 1EEUA 2IEPA 3MLTA 4HS8L 1U8OA 4YHZL 5GS1C 3DV4A 3GSUB 3QNZB 5IESL 5T1KA 3LQAL 3RIFK 3RPIA 4ODSH 1IBGH 4R4NC 5FV1L 2DM3A 1HDMB 3ARBC 3UBXG 4P5TD 5J56B 2ADIA 4ELME 4JG0H 2Z4QB 4OTXL 4JPVH 3DO7A 4JN1L 4PY8J 4NOFA 2R1YA 4YXHL 5BZDA 5KVEH 3SDCA 1RZKH 3DGGB 3ZKND 1KJ2A 1D6EA 3IFPA 3O4LB 2EDHA 2HG5B 2ZSVA 4K7PH 2XQBH 3ZKNC 3UMTA 2PW2B 5D72L 5E6IC 3MRFA 3NAAL 4ZAKD 1GGYA 1Q38A 1EHLL 1E4XL 4R4BA 3WMSA 5T3ZL 3VFTA 3OX8B 3EOYG 3PNWB 2CDEB 3QR2A 5IBLC 4JN2B 1QLEL 1MFAL 3W5NA 3JBG7 1XR8B 4P3DA 1TPXC 3IKCB 1S78C 1QFWH 1GGUA 1VGEH 4TTGA 4H25A 2EYTB 4NNXB 12E8L 4D0DB 3V4PL 5I1IH 4O2EB 4JY4B 2IMMA 1MLCA 5FIEA 2H26A 4L8BA 4TRPL 2VXTH 1KIPA 5IW3A 3KPSA 3KPSB 4OV5A 4XP9H 4DVBB 4WJ5B 4CN1A 2AEPH 1RUAH 2BVUA 1GCFA 2AJVL 1MIEL 5GS0D 4PB9L 3K4DA 4YFDB 3MREB 4Z7UE 2FL5A 3GSQA 4JFHD 3OZ9H 1OD7A 3DOSA 5DD3L 2OSLB 4NNPH 2Q8AL 3KPPB 2GJ6B 5D7LE 4IRZH 3FT2B 3Q1SH 3R06B 4NHUB 2R4RH 4E41B 1AD0B 4MNQA 2VDMH 1CS6A 4YC2B 4XVTH 3QCUH 4MQ7B 3M45A 4Y19B 4X6CE 1A2YA 5KSVB 4IRSB 3OAUH 4OZFA 4RRPG 3AY4A 5L6YL 2ZKHL 3W0WD 3CX2A 1HEZA 3IB4A 1PJ9A 4P3CH 3U0PB 5J89A 1J1OL 1A3RH 3QQ3B 3SE4A 3KG5A 1G9MC 2JJVA 5LBSL 3ZTNL 1J18A 2ATKA 3TPUA 3DGGA 5BMFH 3AM8C 4P4KD 5KSUB 2RHEA 4WV1B 1QA9A 5J9PA 3IJYA 2AGJH 5FYKU 3EDFA 4FXLA 3ZZ1A 3SOBH 5EUOF 3HCVB 4YGAB 2V9TA 1I8KB 2W92A 2WUCH 5DJCA 2VAAB 5GISL 1GAFL 2NXZB 2R69H 3MGOA 1K4DB 3G6JB 4S0SD 4G9DA 3OKKA 4GQ9L 3SGDH 4OZHB 1W8NA 4PPTA 2OK0H 5CSZA 1OARL 4FP8L 4OF3A 1SJVA 4V1DD 2FH6A 2AQ2A 1T89C 3ZO0A 3VA2C 3LHPH 1J0JA 3KVQA 3VFMB 4M1GL 5C0AE 4NKMA 1FNLA 1JFQL 4YHPA 4LCWA 4WWKD 4XWGH 3S88L 1C08B 2O93L 3ILQD 1DSFL 3X14B 1JNHB 5CJXA 1Q72L 3K4AA 4J1UA 2R0ZL 1F6AA 1G6VK 4KC3B 4HIEB 3DVIA 3LS5H 2JJTC 2NX5E 2FX7H 3ARFB 2YN5A 1P5VA 4EQ3A 1ZA3B 3TZVA 4NCDA 3UDWC 4EI5A 3Q2CA 3PWVA 4L3AA 5DR5L 3MRNA 3IVKA 1GHFL 5KTEH 4M7LH 1C1EH 3A67L 1PG7X 3HUJF 5BS0B 4JHBA 1R6VA 4OZFG 4PRIA 1N3NB 1NGPL 2DQGH 3UC0L 3BN9C 3S3PA 5EZIH 3L6FB 4ZPVA 3V0VA 1ZHKB 5DURB 2Y5EA 1TENA 3TH3T 1VPOL 3E6HA 5BZDB 5IHUL 1AIFA 5KZCB 2FHCA 2NW3A 4NDMA 5FK9A 4Z95L 2X70A 3V95A 4MJ6A 3SKMA 1YY9C 2DD8H 3BRFA 4LLUB 2GK0A 2GT9B 1CG9B 4HWZA 4OM0H 5IESH 5E8PB 3ZKMD 3QIBD 4U1NA 1ZHNA 2AJYH 1GH7A 3SCMC 2UWEB 1FYTE 1KLGA 2OP4H 2YEZB 2GUOA 3I3DA 1HILB 4JG0L 1NGZA 2ESVB 1YNKH 1LGVA 4O2FB 4AK1A 1MHPH 3WE6B 1T7VA 3QO0A 1M4KA 2ZUQB 1WCBB 2BRRH 5I75C 4CMHB 2QHRH 2ENSA 4PJXB 2J88L 3VGHA 4LHUB 3WJJC 2R4SH 4DN3L 2N56A 3PJSA 1QFPA 2HA1A 5E24E 4X4MA 4QT5A 1HQRB 5SV4A 5JTWA 3KPMB 2X4NB 4OCLC 5IEKA 1UQSB 2JF1A 1S5HA 4X7CC 5DA4A 3SDXE 4PTTA 5EUOB 2E7MA 2KQMA 3MRHA 5H35B 2Q7YB 3EYQD 4ORGB 3SKNA 5JOFB 2R1XB 4NFCA 3FJTA 1C16B 1OGTB 4HXAH 4X98B 4XHJC 4ZUWB 3AFLA 4OZIF 4N8CL 2G75B 1DBBL 4PRPB 2BY3A 4RGNC 2V7NB 2IPKA 4EQ2A 4I3SL 4MJIE 4HCRL 3ARDB 1RHFA 4XBGA 5SWSB 3U1SL 2ZCLL 3D3VA 3HE6A 4HLZH 3DURB 4RIRB 4CN6A 4HK3J 3WNNA 4IRJB 3EJYD 2DYPA 2ATPA 1UKTA 2VDQH 5CS7A 3HMWL 2H3NB 1MIEH 5FCUL 3OXRA 4FQXA 3U46B 3QIWB 4W70A 5D96C 3RGVC 3S4SB 4F33A 2D7NA 4TSCL 1LEKB 4L9LA 4HV8A 2JIXA 3UTZA 3PWPD 4NQSB 1IC4H 5C1MB 3QDAA 5DRWB 2MQ3A 5HHOB 2BDNL 4OCYL 1J5OH 1JGEA 2F54A 4IDJH 4P2QD 4X0KA 4HKXA 3B9AA 1IJ9A 4JZNA 3HRPA 4JQIH 2IPUG 3H9HA 4K2UL 1SJHB 2HT4C 3CSYB 3MGTB 5HI5D 3QXAA 5KSAD 1MCLA 1DBKL 1D5BA 4GAGH 4MXWL 4FNLL 3WFDL 4RMVA 5F3HB 2IBZY 5CJOL 4NBZB 3FOLB 4P99A 2ICEB 5DZOA 4BZ2L 3HPLA 3UZQA 5LVEA 3O4LD 2D7TH 3SKOA 1XR9B 4YGVB 1HILA 4I0PA 3T3PF 2V7HA 4UTAL 1ZHNB 2Q86B 3RFZC 4J3WA 1JNLL 3HZVA 25C8H 5ICYA 1A14L 5J12C 1UH2A 3WKML 4NGHH 4QRPB 2H2PC 5D2NA 1JWUA 4RSVA 4JRXA 4U6YA 2DQJH 4I13B 4RWYH 2NY7H 4OD1H 4M1GH 4JFFD 4RGNE 1YY8B 2GQHA 3VXRB 5JO5B 4P3WA 4WFHD 5GPRA 3NABH 2K7PA 3N9GL 5B3NA 4E5XA 1Q9OA 2W9EH 3CK0L 1PY4A 3EUUA 3VH8G 3EYQC 2AXFB 4G6KL 2GCYB 1OWRM 1G7QB 4RA0C 5HHPA 2HH0H 3QSKB 4FFVD 5EOCJ 4XHQA 4LP4A 3VXME 5F7MC 4FQIL 1ZT4A 1U92A 2YR3A 1MREL 1B3JA 3KHOA 3CGTA 4MZ2A 4J3SA 3DBXA 2F58L 1A5FL 3BZEA 2DQHL 3IVKB 2A6DB 3BPOB 1FQ9C 2YWYA 5IBTH 1CGYA 1NBYA 4NBXB 4LSQL 3PWLA 2DQGL 4XWGL 3UC0H 4JFDD 1ONQA 3BOVA 3OR6A 2BP3A 3SGKA 2P7TA 2OQJA 3OR7B 3MJ7B 1G9NH 1CLOH 1FAKT 1NFIA 1YUHA 3KPLA 3QFDA 3BPCA 5F1IA 1F97A 4LPYA 2XTJE 4L5FH 1H3XA 3DYPA 3ULUH 3P11H 5AUMB 1FNAA 5CIPH 5A16B 5EO9B 3VXUA 3TBTA 4U0RC 1X5GA 1LE9A 4HIJA 4OM0L 2CIIA 2B5IC 3CCHA 4GFTB 4PRHB 2UV3A 3W0WE 4J8RA 4YHIB 3MR9B 4ZTOH 4PY8I 2FO4A 1T66C 1ZS8A 1S7RB 32C2B 5ISZA 3JV6A 3S3JA 2IBZX 3SBWC 5E1AB 1H0DA 1CFBA 1U8JA 2P8MB 4GMTH 3G08B 4JQVA 1LEGB 3SPVA 4UDTB 4A6YL 4ODXA 1PG7H 3BH9B 3L3GA 4PJ9C 1NUGA 1B0GA 1QKZH 2EXWD 2WNGA 3O4LA 5DD0L 2GY7B 4MLSA 2OI9B 2QHRL 4IMLB 3NPZB 3UPCA 2YD6A 3B8SA 4KMTH 1NANH 1UEYA 1JTTA 5F8RC 2W9DL 2XNAA 5C08B 2IAMB 4J4PC 3TO4A 5ILTL 2X2YA 3IJYB 1OAYL 4MA1C 4QT5B 5IUSA 3PP3H 3I50L 4WVRA 2R23B 1A7BA 4YDIL 4UNUA 5I17B 4I0KA 3REVA 3CAFA 5F7LB 4ZUTB 5JPNB 1I1FA 1OP5H 5DFVC 4PYGA 5J1SC 3FFCE 2HFTA 3WE6A 1YNKL 1OGAE 3T4AA 1IM9A 1MFNA 3VFPA 3PQYA 1S7TB 1XIWA 4JM4H 3OKMB 2EH8L 2FJHB 1AKJA 3L5XL 3FHQA 2ESVA 2VUOA 3MRJB 4YX2H 4WU7A 2A6KB 4LOUD 5F1KC 4Y7MA 1ZOXA 1NMAH 3DUUB 3EYUH 3O3EA 4WEMB 4JPKL 2BY2A 1JPFA 4NUJA 4U6VL 4D0BA 3D5OF 1A0QL 5AZ2H 3GSWA 4JDVB 1OAUL 4ZFOA 5ADPL 3C5ZD 3P4MB 3BRGC 2MKLC 3HRZB 5L2KD 4Q58C 4HC1H 1QHPA 1WTGT 3WEXB 3MOAL 2FL5B 3GSQB 4X4XA 4Y5XC 1AGFA 3RWFB 3RWJB 3DYOA 3IDIA 5KN5A 3I9GL 2BERA 1JF1A 3W9EA 1JHKH 2CLZA 4XCYA 1DQQB 1BJ8A 1IAOA 1HHKB 5D1ZD 3A6CL 3GUTA 2R2CA 1G6RL 1S9YB 2G2RB 2P46B 2H26B 4L8BB 3ZL4H 4XBEH 2XY2A 3G5VA 3VFGL 2YOCA 2ZCLH 3TFKC 3U2SA 4YDLB 4RDQF 2Y23A 3QQ4A 4DJMA 2YPLE 2H2SD 3FB7B 5DHYA 1J86A 4ZSOE 3RKPA 5AD0B 3QJHB 1YMMB 2YMXH 4LDLB 3DX7A 3UTPD 1CXKA 3CVHL 5C0IB 1OTSC 4CMMB 3A6BL 4OSUH 1OTSD 1TMCB 1ORSB 3G5ZB 4HDIA 4Z7OF 2IAMA 3DXAB 1P4BH 3NAAH 3PJSB 4CGTA 5CMAA 4DQOH 5CBAB 1C08A 4HT1H 2O5XH 5T1DH 1HH6A 3FB6B 2VDLH 1KTDA 3V4UL 2ICWB 5I16B 3H3PH 3H9SB 1G0YR 3O45B 1YY8A 3HI5L 2HT3D 1JNNH 1WWAX 4WCYL 1CFQB 1LE5B 4UDTA 5HY9B 3NIDF 4OLEA 2XZQL 2XKNB 5T1KD 4OQ1A 1I3VA 2EEAA 2MKWA 3WFEL 4WHTB 3MJ9L 4CL7A 3CK0H 4KGJA 4KTYA 5HHQB 1I3GL 5F72S 1MVUA 3UCRA 2AERT 4ODHL 1KLUB 4DN4H 1N6QL 5CEYA 5I1AA 3DXAA 2BHYA 2OR9H 2KKQA 4HULB 4APQD 2Z92A 1BOGA 1C5CH 3UBXB 4ZXBD 4DW2H 1CXEA 4J7RA 4KJQD 4HUVA 3RNQB 1PKOA 2ICWA 4I0CC 3RUGB 1JN6B 2V2WA 1W72A 3MBXH 3LQZB 2Y06H 4A2MA 5IBTL 1BLNA 1X6NA 4TQEL 3O9WA 4MQ7A 5LJYH 1T21A 1E4WH 1I7UA 2CDGA 3PWLB 4PJDB 2VDML 2VUYA 1GOGA 4KVNH 5KANI 5BRZD 2FEEI 4P57A 1I9IH 1D5IH 1WEJL 4P23A 4DKEL 1DBML 4XPBH 1F4XL 2HFGH 3RUGF 3RWDA 2BSRB 3NCJL 5ICXB 1N59A 1DFBL 1AC6A 5KN5B 2X41A 1LO4L 2VISB 4HPOL 1YPZB 4Q9RL 4LFHG 3BSZL 5T1LA 5BVJA 3QEUB 3S88H 1MCDA 2ARJA 4XCEB 4FFWD 5FYJD 5AG9A 1UJ3B 3B6SB 3FT3A 5SX5H 2LAAA 1YNTA 4HKJA 2FIKB 4PS4H 3D69A 4KUZL 4FRWA 3PGDB 1CFTB 2HTLD 3HPJB 1CIUA 1MCKA 1L6ZA 1QBAA 3KLHC 5BOZG 3AB0B 2BJML 3V0WH 4OD2B 1N4XL 4WU5A 4OZIE 2DM4A 3QI9D 4JCLA 1NL0H 1HXYA 1I9RH 1HHHB 1KB5B 1CLYL 4UT9L 2GKIA 1UJ3C 3OJMB 1AJ7H 3MUGA 4WHTA 3DHMA 3RWCB 4M48H 3IDXH 4FA8A 1VSCA 2B4CH 1H3UA 4IOIB 5FA3B 2XTJC 3O2DL 3SGEI 5GGUB 3VXMA 2AK4B 1U58A 4XNUL 5I18L 4D9RD 1S7TA 3PQYB 4H0IA 2FHBA 1UWXH 2FSEB 3MV8D 3FFCB 4LMQE 2DTML 1FYTD 3FB6A 2XZAH 4NT6A 4RISH 4WW2C 5DZLA 5E6ZA 5IMKB 5FGBA 1R3LA 1PG7L 4M02A 3U0PA 5K9QI 3UYRL 2W9LA 3EYOA 2YD9A 4G6ML 3DO7B 2Y5TB 2OBGA 1T83A 2LU4A 1JMXA 1CZ8H 4I4WA 2EE6A 2NTFB 2GTZB 3EYFA 3JWOL 4WY7H 5E5RB 4Z78B 5DHVH 5IK3B 3IGAB 3SDAD 5IB3B 3VRLE 1HYSD 4HUWA 2X4OA 3T0EA 3SCMB 3GKZA 3BH8A 3O11A 4F58H 3UO1L 2ITCB 1ZVYA 3BYYA 1J1XL 5DT1L 1RY7B 4XAWH 4MCZB 2RFXA 5CD3B 1HKLH 1A6AB 3EOTL 5D6DC 1ZVSA 4PD4J 3AREA 4JZJB 1D9KB 3CFCH 5IVXB 5TH2B 4Z95H 4M5ZH 4N5UA 1HHKA 3WN5C 3G6JF 5B22A 1QP1A 3MNWA 3GSNA 1LO2H 3RY6C 1YEEH 1OHQA 1F11B 4RNRB 3RKDC 1NGYA 5I8CB 4X4XB 4OZGF 5H2BB 1T04B 2Z91B 2XWBB 4O58L 3MRBA 5D2LB 4O51B 5CIPA 4G6JL 1VADA 4PB0H 6FABH 5FECB 4BM7A 4G6AC 3ALWA 1FO0H 1IEAA 1K8DA 2R2EB 2XICA 1HQ4B 4X5XA 1NLDL 4KKBD 2X4SA 3ZHLA 2YC1B 5DWUH 1G0XA 5KJRL 1HINH 1BF8A 4U1GB 3D2UD 4PRID 4HT1L 2C1PB 4OZGB 3BXNB 2AP2A 3N1MC 3HMWH 1J7VR 1NMBL 3X11B 1ZLUH 4JRWA 1TTGA 5IT2L 2AKRA 4NZUL 3RKDD 3SGJC 5IIEB 5JLZB 1CGTA 3REVB 2EZ0C 3WXWH 2HN7A 4AJ0A 4EKXA 3ARZA 3OF6A 5I30H 4Y89A 3ZT6A 4R96A 4Y1AD 3WHXA 4AG4H 5E8DH 2M8XA 4OZ4B 3D87B 5E2WH 4AY0A 1M6OA 2HTKC 3SE8H 3P73A 5IVXE 2X4TB 2EEBA 1CD9B 4YHYB 1UXWA 4PLKD 4XVJH 3ROLB 3FRPA 1MCCA 4TOYH 4XCCH 5CWSB 2GK0B 5A2FA 2F5BH 1U91B 1J8HB 4JJ5B 4D94A 4XMLH 1FFQA 1PYWB 2ID5A 2UZIH 3B43A 4PJFF 1HZHH 4LSRH 1LNUB 4NQDB 1JNNL 4NT6B 5IMKA 1W0VB 2B20A 3VI3F 3WFBH 1YDPB 4GG6A 2JJUA 2Z35B 4X5WB 2Q3AA 1KN4H 4X80L 5ESQB 4DAGL 2E8YA 3D3VD 3HE6D 3F65A 3MC0A 2VE6B 3K4ZA 3NGBB 1GZQA 2Z8SA 2Y7QB 5FDWB 4MB3A 1Y6KR 4R2GD 4NN6B 3CSYA 4EDWH 3O6FD 1CL7L 1MHEA 4ODHH 1PZ5B 3HZMB 4MXQC 2VH5L 1WSST 1KJ3L 2YWZA 1I9IL 1RZGB 3M17B 1S9XA 3MV8A 4K2UH 4PLJD 4ZPTB 3SJVD 4LASH 4NRXB 1FPTL 4TTDD 1VERA 2EECA 3FT2A 3WO3B 3B9KB 3SO5A 4LKCA 1ZGLB 1AY1H 3RBGA 3HAEB 2QHLA 5E03A 4XI5C 5E0QA 4HWBA 4IM8A 2XN9A 4FOMA 3STZB 4KVCH 4OV5B 4QOKD 5E7FA 1FZMA 4YQXL 4X99A 4AZ8A 3R1GL 5B4MC 4KUZH 5TQ0L 1DUYA 1VCAA 4HZLA 1CE6A 1LILA 4Y1AB 4S2SB 3NPSB 5DJYA 5DYOA 1BFVH 1U93B 3KWWA 4D9QD 4D9LL 3OG6B 2CSPA 3VH8A 4AL8L 4BK5A 4EUPH 2P5EB 4NGHL 1KC5H 1RK1B 3SCMD 1Q1JH 1FAIH 5I1DA 3MRPA 2X1XR 1K4CA 2CUIA 4N8CH 3MFFA 1JBJA 1LO4H 5IJVB 3ARDA 2XFXB 1WJ3A 2WBJB 3PWPA 4EUPG 2HJLA 4LLQA 3CZJA 4X4ZA 4KRPB 2VNCA 1YYML 3DUUA 3WS6A 2WIMA 1SQ2N 1QNZH 1UQSA 2J8UE 3IU4L 1KCVL 4K55A 3GMLB 5IQ9B 1X5YA 3WDJA 4U1SA 4KK9D 4KAQL 3U0TA 4UT6H 2HH0L 3WS3B 2XWTA 4JDTH 4Z7NF 3GEWB 3QEQB 2FWOB 3V5KB 4QXUL 1RJLA 1F3DH 2Q6WA 1J12A 3CVHB 4HUVB 1BEYL 1NL0L 3RX8A 2PR4L 3SDAA 5TGBA 3S35L 1AFVL 3CZFA 4NZRH 1BX2A 4G6AD 4IEFB 1BFSA 2CQVA 4NQXB 1NC2A 1Y18A 1BQHA 3GSVB 1W0WA 5EU4A 4CVUA 1DQML 4FTVE 2R2BB 2FLRT 4OB5L 5HHNA 2F15A 4JANB 5F3HA 1QSVA 1MRFL 1ITBB 1X5JA 3RJDA 1QLRA 4P2OA 4GAYB 4Y5VB 3QXDB 4XAWL 3HR5A 3LEXB 1R3KB 4G6FB 1IGIL 3G08A 5BVPH 2APBA 1RD6A 1GPOL 1BHGA 2VZVA 3QQ9C 5D1XB 2WBJA 1OGAD 2P44B 1REIA 4YPGB 4XB8A 3FQWB 1CG9A 3JWNC 3MRCB 4YHLH 5BRZE 2GEEA 2PXYD 2QQLH 3LB6C 4ZFOL 4QRRD 4NQCA 5F9JA 4LSSH 3LN9A 1CE1L 1ORSA 3G5ZA 3S98A 2AEQH 3C08L 4XAKD 3LN5A 4GKZA 5HXMA 2Y36L 5C9JB 2JE8A 3N0PB 5IMMB 1RUAL 4DOHE 3GSRA 3KPTA 3CSBA 1U8KA 1TTUA 4QOKE 5AD0A 1CFNA 5J6HB 4P3DB 4WEBL 4DVRH 3VGBA 4WNQA 4YJZL 5TDOB 1EFXA 1HHGA 2R0LH 3VXOB 4D9QE 4JY5H 4RRPA 3H42L 4Y8AA 2H8PB 3GMRA 4XP4L 2MCG1 3MZGB 3VRLF 3VRJA 3N9GH 4WU7B 2AXHA 5KAQF 4Z0XB 4Z77A 2ZCHL 3MJ8A 4YHNA 2HMID 5ENWB 3IJSB 1RJYA 4G6KH 5CJ5A 4NIKB 1YEIH 2AEIT 1IQWL 3QFJD 1NPUA 1AO7B 5E2VL 3BHBA 5EZOH 4JRYE 3MRHB 3RVVD 5H35A 2X7LA 3DV6B 4NKIL 5FYKH 4HZAA 1QSEE 1J1OH 1FFOA 1QQDB 3PGCA 2CPCA 5DVKA 3EFFB 2H1PL 2ZG3A 1RSFA 4M62L 1IT9L 5E4EB 5EN2A 3WBDA 5C0DB 1TETH 2OXGA 4N0CD 4E5XB 1EHAA 2GFBA 5M95B 3QNZA 2X4TA 4QYOA 3QNXB 3TLRA 2VAJA 4XBPB 2DQIL 2H6PB 2WANA 2I9TB 3P40A 5FGSA 3C60C 5E2UH 1JGDA 3BX7C 4YNYA 2D0FA 4PJAB 3LKPB 4N68A 2CO7B 3LKPA 4H1LG 5IQ9A 3MV01 4XP5H 3OAZK 5D5MB 3FO1B 5J6GB 1I1AB 3MLYL 1QSFD 4DKFL 3G5YA 3QRGL 1ULVA 3LPFA 4FFWC 4C56D 1HSAA 4H5SB 3ARGD 5GJTL 5HGAA 4BELD 4GKSB 1MCRA 3KR3L 5B4MD 2EIZB 5GS1B 4KKAC 4HS6A 2A2QT 5A43C 4OZFH 4QRTA 1KJMB 5C2UB 1UVQA 3WO4C 3W0WA 4C4KO 3SKJL 1DE4B 5I1EL 1RPQA 2X1QA 2KPNA 4MNQB 3KS0J 5A2KH 2CRZA 4UIMB 4Z18A 1DDHB 5KSAB 1A7PL 1BZ7B 2ICCA 1SJEB 3TEUA 3NIFF 4F7MA 3U9UB 4OFIA 5JNYB 3MZTA 2PXYB 4PG2A 1I8IB 3WFHA 4HUUA 4OZHE 1T4KB 4ZAKC 2A38A 3L95A 4YR6A 1JCKA 3PWPB 3MBED 3WHE0 4HJGB 1DLHB 2EXWC 1MLBB 5EDXA 3GHEL 4UB0L 4BSJA 3R1GH 4NRXA 1CFNB 1RK1A 4FN0A 5EIQA 1KJVA 3T1WA 1UB6A 3QUZC 3MLWH 2DDQL 3SBWA 5D5ME 2LV4A 1VPOH 3I75A 3MV7A 3C5JA 15C8L 1BGXL 1OCWL 1OGAA 2FJGA 3OJDB 4C55A 3Q48A 3BFOA 4ZYKA 1RUMH 2C4FT 2E3VA 3HE7B 5C08E 5IVXA 3QISA 1F4WH 2C3XA 2XOTA 1B4RA 3L95B 3UBXI 4MDJB 1K8IB 4U6VH 1JI2A 4KVNL 5IV2A 2FB4H 4Z7WE 3O3UN 1KBGH 4U33A 2A83A 3WNKA 4V2BA 4PIRF 2FHFA 3MRQB 3VXPB 5JORA 5GRVK 2IGFH 5JR1H 5BV7C 4POZD 4R3SB 1JWSB 4MNHB 4AL8H 3F62A 2W65A 5F1NA 2CJUH 2AXGA 4RFNC 4NQXA 4KJWD 1XCQA 1WFOA 1CFSA 4ZAKA 3IDMB 1TQBC 1HQRA 4HAGA 3FO0H 4ZUVB 2VABA 2A9ML 2VLMD 3JVGA 4TNWK 3GZKA 4KDTC 4N0UE 1UXSB 1JZ2A 5I2IB 3JV0A 4K7FB 4PJ5B 5CILL 2GW5A 2XY1A 3ARRA 4RFNB 1QVOB 1V7NH 5B38A 3L3KA 2C9AA 5ID0A 1P4LB 3QIUC 5IWLA 3E2HC 5CEZL 3ZKXB 1AHWC 4D9RE 4F57H 4J6RH 2PO6A 3BW9B 1GPOH 3CH1A 4HWEL 4JY6B 4HXAL 2B7DT 1QR1A 4GS7B 3L5WA 5ICYB 1EEZB 1P4IH 4MNQD 2VLJE 1AGCA 4Q97A 1UM6H 1NDMA 2FEDC 5EOTA 3S35H 4O4YH 2EKSA 2OMNA 4NZRL 1JL8A 4W4OC 2FEDD 5CJQH 2KL6A 4R26L 1I8MB 1I8LC 5FKPA 5J1AA 3LMJL 1ZLWK 4YAQB 5F9WB 4OD2A 3PDGA 1TTFA 3GSNB 4Y1AA 2C3VA 4RISL 5ACZB 2DJSA 3DX6B 5EC1B 3VFNB 3D39A 4K07A 4NJ9H 4BH7A 2W0PA 1P7QB 5BQ7A 3IAQA 3O0RL 3QA3A 3PIQA 1B90A 1IAII 2VWEC 2DB8A 1KN2H 1AQKL 5ENWA 4U0QB 1AJ7L 4JJHA 5GZOD 4M93C 5T5FH 5DJDB 1ONQB 1H8NA 4MAUL 3T0VA 2DL9A 4LHUG 5GGVH 1TCRA 2WM0A 2V17L 3TT1H 2DQUH 3BO8A 2B1AL 5CINL 3JV4B 4UIKL 1J8HD 5BXFA 4ZD3L 2ZSWA 3MV9A 4PJ5E 2COQA 1VACB 3BGMB 4GAGL 4LK4A 5FAAA 2VN4A 2WK2A 1HKLL 1OF2B 4OLVL 3S4SA 2G9HB 4KROD 4NWTH 3A6OA 4FMKA 5F97E 1ZSDA 5CZKA 5C0CE 3S9DB 4OLXH 5E2TH 4JZJC 1MOEA 2ZUSA 4Z6AT 1TETL 2UZYB 1YDPA 4GG6B 3CLFH 2Q20A 4XP4H 4M4PA 1NMCC 5TH2A 1UM4H 1MFBH 4RAHA 3ULUD 1DANT 1FE8L 2AJ3B 2IPKB 1RIHL 4OGZA 5GS0L 2OZ4H 5J6GA 1NGQH 4X4YB 1IQWH 1RIVH 1CFVH 4CN4A 4XNMB 2ZPKL 1Z3GH 1QSFA 3C2SA 1WZKA 4CVZB 1Q0XL 3ET9F 3CU7A 1KPVB 1JGDB 1LO0H 4OGAC 1ROWA 4ZUWA 1DBMH 4XPBL 2K1MA 4ISVB 3VFSB 5IB1A 4RX4D 2P8LA 4JM2C 3I6LE 4B7IA 4IBLT 2YA0A 2H1PH 1KCRH 3LAFA 4ALAL 4WHYH 3QCVL 3ZSSA 2IAND 4Y4FD 3SY0A 1UH3A 3CMGA 1NC2B 1Y18B 3G6DL 3OHXA 5ALCH 5F7NC 3P0YH 4M5ZL 2DL2A 1XR9A 1JMZA 3B2VH 3FQUB 2VTFA 3QEHA 4MNQE 2H9GB 1ZEAL 4Q9BA 3RVXC 1ZHLA 3DRTB 4XNYL 4HG4K 1JZ5A 4MXQD 3THML 3UJIL 1XMWA 4G8GE 4ZMAT 4FQIH 3MBEA 4HKBA 2BNRB 2NY3B 1T7YA 2AAVA 5E99L 5EZLB 3VFOA 1I9RL 3RWIB 4Z0XA 4Z77B 1ED3B 4LCYA 4QRQB 4MJID 2F19L 1QO3A 1TITA 1NDGA 4JZNB 4CU8A 2LAGB 3F7VB 5E8EB 1HOCB 2R9HD 4OLYL 1BREA 1KTRL 2GAZB 1OP3H 1CQYA 3TN0C 5DRWA 4F7PA 1RUQH 5IVZB 3FB7A 3GO1L 4U6XB 2FH8A 4H20L 4IOFD 1TLKA 4NRZB 4BQ9A 4EBQL 3ZE2F 4FQXB 5EU6A 3PXJA 5IFHH 5AAWA 1A6TB 3O6FB 3CXHK 2ED9A 3OKOB 4ZDHA 1LDPL 2IANB 2RCSH 1K5NA 3PL6C 1A7NL 4G42A 3PABB 4OFKA 3HNTH 1LP9F 3WHE1 1F13A 5T1LB 2D03H 5C0CD 2NZIA 3LKQA 3T0AA 1FL6B 4OCNC 3IDYC 1YEJH 5CP7B 1QLFB 2IH1B 1DR9A 1WBXB 3GI8H 4URTB 3F8UB 1WGOA 3VD4A 3K74B 3K1DA 2BNUB 2R2HB 1SY6A 2P5ED 1BIIB 5BZWA 3B9KC 3CJJA 3VFVA 3Q6FA 2IG2L 2F53A 3OKNB 1I1FB 3LN4A 1AY1L 4MVBD 4TYUA 3QUXA 4XMPL 3TV3L 4M7LT 1Q9LB 1TJGH 5E6YA 3U7YH 1RUML 4L9LC 1I9JH 3F12B 2XQBL 5DEZA 2F54E 3VXNA 2C4XA 1F4WL 4F7TB 3I6LD 3HC3H 2BNQB 3AXLA 1RK0A 4AT6B 3KXFA 4GRWB 4RDQG 3BP4A 1QSFE 4ZUTA 5JPNA 3E6FB 1V7NL 1V3MA 1VFAB 2BC4A 1A9EB 3I3EA 3IJHA 2Z92B 4ODVH 4PJIA 3RNKA 4PRHD 4ZFGL 2ZG1A 3D2UB 4N0YL 5E8OB 4OZHA 1RZKL 4KTDL 1MFDL 3WS6C 3BD5A 5HGDB 5FYKD 3LN4B 3AVEA 3PWJA 1O0VA 4NC0B 1NLDH 4GW1A 1CYGA 1A4JB 4MQXC 4XMKL 4KRPC 5EU3B 2CO6B 1KCVH 5AZEH 4QWWD 3FONA 1KTLA 3UDWA 4NC1C 4ELKB 2LVCA 4JFOB 4L3CA 3MREA 1FYTB 1ETZA 3TWCL 4KJYA 4P5KA 32C2A 5AAMA 1YC8A 2YPVH 3E6FA 3SDAC 2KZ1B 2G5RA 4P9HC 2R29H 4X9GA 1NGWB 3B4NA 3PWNB 1DQLH 2CIIB 1T2QL 1OGAB 3ZDZF 3C9NA 3TH4T 4MB5A 5D1ZB 2GK2A 1F3JA 1L7TL 1LP9E 4NO5B 4CMMA 1XEDA 2EDKA 3AS1A 3QDJD 5T33H 2V17H 4XVTL 1AD0A 1G7LB 2XQYK 4UIKH 1IAMA 2BK8A 4R7NB 4P5TA 2WBJC 4LQFL 3BN3B 2ZP0T 3HRZA 4OQTL 3MRBB 5D2LA 2BNUA 2R2HA 2X4UB 3EFDH 3QUKA 3QUML 4JFXA 2I24N 3C5ZB 1RUPH 1R0AH 1CU4H 2OMBA 4H26A 3TBVB 1CR9H 3GJEA 1NAMA 3K8LA 5FGCE 1HHJB 5GJSL 1H8OA 4KRLB 3MV11 4GG6E 1BLNB 1BVKA 1L9MA 2UUDK 4EN3B 3KPRD 1W72L 5KBNC 4FFZH 4N0UA 4S1DC 5I6XB 4V1DB 1Q9KB 4PJHB 3JWOC 3MOBH 5LWYH 1PQZA 4GXUN 2VH5H 4NKQB 2BX5A 1Z6JT 3HN3A 4ZD3H 4EXKA 4MAYB 5D9SB 3JWDH 3UTSE 2J4WL 2DLFL 1OARH 1A3RL 5D96B 3RGVB 5IMOA 1NAML 1XR8A 2HRPL 2EKSB 1WT5C 3TBWA 5C0NC 3P9WB 1DQTA 2V9QA 5F6HI 5C2BL 4QKXB 1FL3A 4U3CA 4XI5D 4G8EB 5ECJE 4RGOL 1N26A 1FBIL 2R0ZH 5E2VH 3RRQA 4OLWL 1A3LL 2BNRA 4JANA 4HHAA 3WL9B 1CFVL 3RTQD 1A22B 1WWCA 4AQOA 4BFIA 4HJ0D 3ZE2E 3I02B 5K9KB 5E6ID 5CD5D 1KB5H 1U8NA 2OI9C 2E7LA 3UAJC 3I2CH 1CFSB 5L8JB 4R2GC 2YC1A 4JY5L 3OPZL 1NANI 5FUZL 3UYOD 2FZ3B 4J3XA 5L2JB