1YREA

Hypothetical protein pa3270 from pseudomonas aeruginosa in complex with coa
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
183
structure length
183
Chain Sequence
b'LPITLQRGALRLEPLVEADIPELVSLAEANREALQYMDGPTRPDWYRQSLAEQREGRALPLAVRLGVQLVGTTRFAEFLPALPACEIGWTWLDQAQHGSGLNRMIKYLMLKHAFDNLRMVRVQLSTAASNLRAQGAIDKLGAQREGVLRNHRRLAGGRLDDTFVYSITDHEWPQVKAALEASF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein PA3270
publication title The crystal structure of hypothetical protein PA3270 from Pseudomonas aeruginosa in complex with CoA
rcsb
source organism Pseudomonas aeruginosa
molecule tags Structural genomics, unknown function
total genus 60
structure length 183
sequence length 183
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1yreA00
4XPLA 2KCWA 3GYAA 4F0YA 1Y7RA 1I21A 2ARHA 5I0CA 4B5PA 2B4BA 4HNYB 3IGRA 3FIXA 3R1KA 2REFA 1S5KA 1S60A 2ZW5A 1I1DA 3B8GA 5KTAA 3E0KA 3TTHA 2OH1A 1M44A 5KTDA 4XPDB 3EY5A 1I12A 2AE6A 4JXQA 1QSTA 2B5GB 2Q44A 1S7FA 2Q7BA 2GANA 1IICA 1OZPA 1M1DA 2J8NA 3RYOA 2B4DA 1N71A 3DNSA 2P0WA 2BEIA 1S7NA 2R98A 2FXFA 4EVYA 3T90A 3BLNA 3BJ7A 2D4PA 3TO9A 4ONUA 2VQYA 4U9ZA 1MJAA 3DR6A 4L8AA 3N7ZA 1ON0A 1M4GA 1YVKA 4KOXA 1Q2CA 1FY7A 5IV0A 2P6FA 2K5TA 2QECA 1YK3A 2Z10A 4BMHA 2ZW7A 4HNWB 1QSRA 1M4IA 4AVBA 1UFHA 2PDOA 2I79A 4CAXA 3EFAA 4Y49C 4ORFA 1K4JA 1IIDA 3R96A 2HV2A 1Z9UA 4GS4A 5EBVA 2A4NA 2JLMA 2CNSA 3SXNA 3VWDA 4R57A 4B5PB 4R3LA 4KOTA 2Q4YA 2OZGA 4B5OA 4JD6A 3UY5A 2B58A 3D3SA 4CS0B 3MGDA 1XE4A 1J4JA 2HQYA 4NCZA 4KOUA 4QC6A 1KUVA 1Q2YA 2PQ8A 4XPKA 4E2AA 1TIQA 2O28A 4AG7A 2FSRA 4UWIA 3CXQA 2REEA 1S3ZA 1XEBA 4QB9A 1MJ9A 4OADA 2FIAA 5IB0A 1NSLA 2R7HA 2NMTA 2B4DB 1L0CA 1NMTA 4XNHC 2C27A 4MI4A 1S7KA 1SQHA 1MJBA 2GE3A 3NE7A 3V8IA 4I49A 4MJ8A 1WWZA 4E0AA 1S7LA 4E8OA 3TOAA 3OWCA 5J8CA 2PRBA 2B3UA 4IF5A 3TE4A 2H5MA 2VEZA 4OAEA 4KUAA 3FB3A 1Q2DA 4KOVA 4KZTA 3CXSA 2Y0MA 3D2PA 3SXOA 2Q04A 2VXKA 5GCNA 5C82A 2P6GA 3FRMA 3DR8A 4XPDC 3EC4A 4NSQA 3F5BA 2B3VA 4YFJA 3P2HA 2RC4A 2FE7A 4H6ZA 1YR0A 1PU9A 3WR7A 4IUSA 4RS2A 2QMLA 2I00A 4NXYA 4AB7A 4YGOA 2AJ6A 4X5KA 1CJWA 4M3SA 4AVAA 3QB8A 1NE9A 4QBJA 2BUEA 2VI7A 4AG9A 2FS5A 4R9MA 1U6MA 2D4OA 1Y9WA 3S6KA 4CRZB 1XF8A 5HMNA 4KVOE 3I9SA 3W6SA 5F47A 2ZW6A 4JXRA 3R95A 4Y49B 3ZJ0A 4MY0A 4OLLA 3TOBA 1MK4A 2BL1A 4KOSA 1P4NA 4QVTA 2P6EA 2IL4A 2ZW4A 3DSBA 5ISVA 1RO5A 4KUBA 3PGPA 2Z11A 1VKCA 4MBUA 2G0BA 2BSWA 2OB0A 3P2FA 1IB1E 4JJXA 5CNPA 4UA3A 2ZPAA 2WPWA 3PP9A 2X7BA 3SHPA 4ZBGA 1B6BA 3C26A 4H89A 2VZYA 3KKWA 4II9A 2CNMA 3PZJA 5F49A 3TO7A 5DWNA 4M85A 3JVNA 2JDDA 2PC1A 4KORA 3TCVA 2JEVA 4K30A 1Y9KA 4XNHB 1XIXA 2ATRA 2PSWA 1KZFA 5EC4A 5FVJA 3FBUA 2GIVA 3LODA 4FD4A 4HNXB 3IWGA 3K9UA 2OZUA 3QAHA 1M4DA 1VHSA 4PV6A 5KTCA 3F8KA 2EUIA 3H4QA 2JDCA 1YLEA 3BJ8A 2VBQA 1QSNA 4RI1A 2G3AA 3FYNA 1R57A 4J3GA 4CRYB 3LD2A 4YRHA 3R9GA 2FT0A 5DWMA 3FXTA 1Z4EA 1QSOA 3TO6A 3FNCA 1YVOA 5C88A 2QIRA 3VWEA 2ZXVA 2J8MA 4UWJA 4PSXA 4KOYA 1RXTA 1QSMA 3G8WA 3ZZIA 1XMTA 4PK3A 2VZZA 4DNCA 4FD6A 3R9FA 3T9YA 1IYKA 4MHDA 4CAWA 4NEXA 5F48A 5JQ4A 4MY3A 4PK2A 3S6FA 1KUYA 3EO4A 4PSWA 3S6HA 3W91A 4LUAA 4U5YA 5E96A 4KLVA 2FL4A 3D8PA 3W6XA 2FCKA 1BO4A 2Z0ZA 4H6UA 4AVCA 4UBRA 4CAVA 1YX0A 3I3GA 5F46A 2B5GA 3F0AA 4R3KA 4FD5A 3JUWA 3CXPA 2CNTA 1BOBA 1Z4RA 2OZHA 3S6GA 1KUXA 4L89A 1P0HA 3EXNA 4KVME 1YGHA 4JLYA 5H84A 4HKFA 2R1IA 2DXQA 1YREA 2EVNA 5H86A 3TT2A 4NF1A 2Q0YA 2CY2A 1WK4A 4FD7A 3R9EA 3TFYA 1CM0A 2PR8A 3DDDA 4JWPA 5HH1A 5JPHA 1IYLA 3GY9A 4KVXA 2R8VA 1LRZA 4F6AA 2Q4VA 3G3SA 2FIWA 4R87A 2WPXA 4LX9A 2J8RA 3D2MA 5IX3A 2PR1A 4QUSA 1V0CA 5J8FA 2G3TA 4KLWA 2HUZA 2OU2A 4U9YA 1B87A 2F5IA 1PUAA 3GKRA 4KOWA 1GHEA
chains in the Genus database with same CATH superfamily
3GLJA 1IGBA 1TKFA 3ISXA 4P4JA 2KCWA 3GYAA 4XPLA 4CAEA 4F0YA 4A37A 1Y7RA 4MXUA 1I21A 2ARHA 5I0CA 2V8HA 4B5PA 4MHNA 2PE3A 4OIDA 2PVVA 2B4BA 4HNYB 1ZG7A 1AMPA 2PJ8A 2WSAA 3IGRA 3FIXA 3R1KA 3CPXA 3DGVA 2REFA 1S5KA 2CTCA 2Q43A 1S60A 2ZW5A 1I1DA 1XFOA 4WJBA 3IWWA 5I4MA 4LQ6A 3B8GA 3PEIA 5KTAA 2Z3PA 2ZELA 2PJCA 3E0KA 1XBUA 2J9AA 2ZEEA 3L2NA 3TTHA 1VHOA 2NYQA 2OH1A 1M44A 3FVLA 6CPAA 5KTDA 4XPDB 3EY5A 1I12A 2AE6A 4NGPA 2AFWA 4JXQA 8CPAA 1QSTA 2B5GB 1OBRA 2Q44A 1S7FA 1Z2LA 2Q7BA 2ZEOA 5G22A 2ZOGA 4C2XA 4ZI6A 2GANA 1IICA 2JBJA 1OZPA 4C2YA 3TC8A 1M1DA 2J8NA 3RYOA 2B4DA 1N71A 3DNSA 2C6GA 1CP6A 3GIUA 4O23A 2Q51A 2P0WA 2BEIA 1S7NA 2R98A 3FH4A 2FXFA 2V8VA 4EVYA 1HDQA 3CDXA 5IB9A 5AG4A 1LCPA 3T90A 3BLNA 3BJ7A 2D4PA 2XEFA 2YNCC 4MFKA 4KSIA 3FX6A 5AG6A 3TO9A 4ONUA 2VQYA 4U9ZA 1MJAA 3SJFA 2PJ2A 3DR6A 3IWEA 5G20A 2CIJA 3QNVA 4L8AA 3N7ZA 1AUGA 1ON0A 1M4GA 3KI9A 4MCPA 4W9YA 1YVKA 4KOXA 1ZLIA 4F8ZA 1Q2CA 1FY7A 5CPAA 5IV0A 1CP7A 3QAYA 2P6FA 4OC1A 2K5TA 2QECA 1YK3A 2Z10A 5A27A 4PXDA 4TWEA 2IQ6A 4BMHA 3TX8A 4MHYA 1ARLA 3H8GA 4R6TA 2ZW7A 4AXVA 4CGLA 5K8PA 4HNWB 1QSRA 4UCMA 1KWMA 1M4IA 3IO1A 4UEFA 1UFHA 4AVBA 2PDOA 3KHXA 4ZY1A 2I79A 4CAXA 3EFAA 4Y49C 2AFXA 4ORFA 1K4JA 1DTDA 1IIDA 2EBJA 2V77A 2HV2A 3R96A 2PJ5A 1Z9UA 1CBXA 4GS4A 5EBVA 2A4NA 3S9MA 2JEWA 2JLMA 2CNSA 3VATA 1UWYA 3SXNA 3DLJA 4MMOA 3K9TA 5JGFA 2C6PA 3VWDA 4R57A 2DF5A 4B5PB 4R3LA 4MCSA 4B12A 5K8OA 2EO8A 1QMUA 5HVGA 4KOTA 2Q4YA 2OZGA 4B5OA 4ZX9A 1BLLE 4MCQA 4JD6A 2YNCA 4GXHA 2WZNA 3UY5A 2DEAA 2B58A 3D3SA 4CS0B 2HC9A 2YNEA 3MGDA 1FNOA 5J1QA 4A32A 1XE4A 4MFLA 1J4JA 3SI2A 5LYFA 2HQYA 4NCZA 2IMOA 4KOUA 4QC6A 2PJ6A 1KUVA 1Q2YA 3JRUA 4A39A 2Q7SA 2PQ8A 4XPKA 4E2AA 1TIQA 2O28A 4AG7A 2PIYA 2FSRA 4UWIA 3CXQA 2REEA 2F8HA 4PQAA 4YWYA 2PJ0A 3T8WA 1S3ZA 1XEBA 4QB9A 1MJ9A 2AFSA 4OADA 2FIAA 2Q4ZA 5IB0A 1NSLA 2OOTA 3B2YA 2R7HA 3S9LA 4CPAA 2NMTA 2CXAA 2B4DB 2PJAA 4RN7A 3LWUA 5HVHA 1L0CA 1HEEA 1NMTA 2BCOA 2ZEMA 1LOKA 1IOIA 1LANA 4XNHC 4B10A 5F09A 2ZEDA 4UEEA 2C27A 4MI4A 1S7KA 2CF4A 1F57A 2PVWA 4F0XA 1SQHA 1LAPA 1MJBA 2GE3A 4P10A 4X3RA 4UFVA 2XEGA 4OMEA 5ELYA 3NE7A 3V8IA 4I49A 1CPXA 3LMSA 2PRQA 2DPTA 4A33A 4MHZA 4YU9A 4MJ8A 2I3CA 1WWZA 1ZG8A 1S7LA 3RBUA 4E0AA 4E8OA 4G1PA 4OP4A 3TOAA 2PIZA 5HXDA 3RAMA 3OWCA 5J8CA 2PCUA 2B3UA 2PRBA 4IF5A 3TE4A 4MRIA 5AG5A 2H5MA 2VEZA 4OAEA 4KUAA 3FB3A 1Q2DA 4KOVA 4KZTA 3CXSA 3JTKA 3VH9A 2Y0MA 3D2PA 3N5FA 1VGYA 1R3NA 5JM6A 1ZLHA 2RB7A 4FUUA 3VARA 4ONWA 3SXOA 1TF9A 2Q04A 2VXKA 5GCNA 3KL9A 5C82A 2P6GA 4OC2A 1YSJA 3FRMA 3CT9A 3DR8A 4B6ZA 4XPDC 5D29A 2ZEHA 3EC4A 4NSQA 1Y7EA 3F5BA 2B3VA 3KQXA 4P45A 1XJOA 1BPMA 4YFJA 3P2HA 1XRYA 4RUHA 3GB0A 4FWUA 2RC4A 2FE7A 2XEIA 3PB6X 1YR0A 4H6ZA 1PU9A 2O4HA 1IY7A 2WUUA 4P4EA 3WR7A 1PCAA 4IUSA 2C6CA 4RS2A 1YMEA 2QMLA 4CAFA 1YLOA 4MFPA 4UF4A 1TF8A 2I00A 4NXYA 4AB7A 3D4UA 4YGOA 2AJ6A 4X5KA 1CJWA 3FMCA 2GLJA 4M3SA 4CGMA 4AVAA 3QB8A 3KR4A 4PXEA 1NE9A 2XEJA 4QBJA 4OKOA 2BUEA 2VI7A 4AG9A 3IFEA 2PJ1A 3NH4A 1Z5RA 2F7VA 2FS5A 1LAMA 1U6MA 4IK2A 4R9MA 4PXCA 4TNUA 3KASA 4OC5A 2D4OA 1TXRA 1Y9WA 5LYIA 3S6KA 4CRZB 3V7ZA 1XF8A 1IOFA 4M6IA 5HMNA 3NH8A 2RFHA 4K3NA 4KVOE 4KSFA 3RNZA 3I9SA 1F2OA 1BPNA 3W6SA 2AFUA 5F47A 3PB7X 1Z8LA 2ZW6A 4UFWA 4JXRA 4R7MA 4WWVA 4Y49B 3R95A 3ZJ0A 3B3TA 2C1CA 2BO9A 4MY0A 4OLLA 3TOBA 1MK4A 3PFOA 2BL1A 2G9DA 4KOSA 2GU2A 1QQ9A 2PJ4A 1Q7LA 5EMIA 1P4NA 1ARMA 4QVTA 4ZX8A 4NJQA 2P6EA 4P4IA 2IL4A 2ZW4A 3SJEA 3DSBA 4A94A 3PBEA 5ISVA 4HPSA 4ZY0A 1RO5A 4KUBA 4A31A 3PGPA 1X10A 2Z11A 1CX8A 3NA6A 1VKCA 4MBUA 1Z8TA 2QYVA 3PB9X 4CYNA 2G0BA 2GFQA 3FEDA 3H5ZA 4MFZA 4UCNA 1Z8WA 2BSWA 4B11A 3B3WA 4FAIA 4A2ZA 2OB0A 3P2FA 1IB1E 3ISZA 3NFZA 4JJXA 1CPSA 3MRUA 5CNPA 4M6HA 4UA3A 5K8MA 1BAVA 2OR4A 2ZPAA 2WPWA 3PP9A 2X7BA 4LQGA 3SHPA 3D68A 3HUVA 4OC4A 4ZBGA 1B6BA 1GYTA 3C26A 1YW6A 4H89A 2VZYA 4KSAA 3KKWA 4II9A 5CBMA 2CNMA 2EK8A 3PZJA 2VL1A 2YGWA 3KZWA 3PB4X 4NGTA 5DWNA 5F49A 4M85A 3TO7A 3JVNA 1IU8A 2JDDA 3RZAA 2Z3KA 4NGQA 4EMEA 1A2ZA 3SJGA 2PC1A 4KORA 3TCVA 2JEVA 4K30A 3CPAA 4A38A 3KHZA 1Y9KA 3NE8A 3BI1A 3NH5A 4XNHB 2DPSA 1XIXA 2ATRA 2PSWA 1KZFA 4A95A 3B3CA 3FECA 5EC4A 4MFJA 4F9UA 4DJLA 4NJRA 3FBUA 2GIVA 3LODA 4FD4A 4HNXB 5FVJA 3IWGA 3K9UA 2AFMA 1AYEA 2OZUA 4BD9A 3QAHA 1M4DA 1VHSA 4NGRA 4PV6A 4Z65A 5KTCA 3BXMA 3KQZA 3F8KA 1X12A 2Z3NA 3IC1A 3PRTA 2EUIA 2O53A 3H4QA 2IJZA 3D7GA 1Y0YA 3WT4A 1CG2A 2JDCA 1YLEA 3BJ8A 2VBQA 4Q36A 1QSNA 4RI1A 2G3AA 3FYNA 1R57A 4J3GA 3D7DA 4CRYB 4B13A 4BINA 2AFOA 3LD2A 4H2KA 5BWAB 3D67A 3FF3A 4YRHA 4X8IA 3WC6A 2YNDA 3R9GA 1F2PA 2FT0A 2ZEPA 4MHPA 3FXTA 3IJ3A 3FJUA 5DWMA 1Z4EA 4ZY2A 5LRJA 1QSOA 3SI1A 1YQEA 3FNCA 3TO6A 1M4LA 2PJBA 3WC5A 2ABZA 1YVOA 1VIXA 5C88A 2AFZA 2QIRA 1R43A 2PJ9A 2V8GA 2ZXVA 4R76A 3VWEA 4B14A 4C2ZA 2J8MA 2NSMA 3FEEA 4PSXA 3I1UA 4UWJA 4KOYA 4CYPA 5LYLA 1QSMA 1RXTA 3B3SA 2WYRA 4EFDA 2V8DA 4IHMA 4CGPA 2CTBA 3D66A 1Z8XA 3G8WA 3S9NA 3ZZIA 1XMTA 3H8FA 4PK3A 2VZZA 4DUKA 2PJ7A 2ZEGA 4DNCA 5THWA 4NGSA 2POKA 3IEHA 4UFXA 4FD6A 4A30A 3R9FA 2Z3LA 4IAVA 5DS0A 2ZOFA 3PFEA 3T9YA 1IYKA 4MHDA 5D8NA 4C7IA 4UIBA 4CYQA 5G21A 5LYDA 4CAWA 2BOAA 3B3VA 4NEXA 5F48A 2Z3MA 5JQ4A 4MY3A 3KR5A 4PK2A 2Z3OA 5AG7A 3S6FA 1KUYA 5K8NA 2QJ8A 3B35A 1JQGA 1FT7A 1ZO0A 3EO4A 2FVGA 4PSWA 3V38A 5A28A 2GLFA 1H8LA 3KGQA 3S6HA 3BHXA 3W91A 1DE4C 1JWQA 4LUAA 4U5YA 5E96A 2PJ3A 4KLVA 2FL4A 3D8PA 3K2KA 2FCKA 3W6XA 4OIWA 5HVFA 1BO4A 1ELMP 3D7HA 2EWBA 2Z0ZA 3MN8A 4H6UA 4AVCA 2ANPA 1XMBA 4C7HA 4UEZA 3WC7A 4X2TA 4UBRA 1ELLP 4CAVA 1YX0A 2EK9A 3I3GA 3SI0A 2GREA 4NGMA 5F46A 2B5GA 3F0AA 2QVPA 2ZENA 1LFWA 4ZGYB 4R3KA 4FD5A 3JUWA 4P6YA 4FBEA 3CXPA 4UCPA 4M6GA 2CNTA 1BOBA 4F9VA 1Z4RA 1NSAA 4KS9A 3D7FA 4P44A 3PB8X 2OZHA 5G1ZA 3IU2A 2HB6A 3S6GA 1KUXA 4L89A 3IU1A 4GM5A 4PXBA 5LRKA 1P0HA 3EXNA 4KVME 4UIAA 1XOVA 1YGHA 2ODFA 4HKFA 4JLYA 5H84A 4OC0A 1TKHA 4ZYQA 4CGNA 2R1IA 2DXQA 1YREA 2EVNA 4NGNA 5H86A 7CPAA 4Q38A 3TT2A 4NF1A 3B7IA 2Q0YA 1PYTB 4Q7AA 3RO0A 3SJXA 3WABA 4R8FA 2ZEFA 2CY2A 3GUXA 1WK4A 4P4FA 4FD7A 3CZXA 3LACA 3R9EA 3TFYA 4CGOA 5LRGA 4DYOA 1RTQA 1CM0A 2PR8A 3DDDA 4JWPA 5HH1A 4OC3A 4C68A 3HLPA 5JPHA 1IYLA 4JZ0A 3GY9A 4KVXA 4MFQA 4EWTA 2R8VA 1LRZA 4F6AA 2Q4VA 3G3SA 1TKJA 4PPZA 4P4DA 5AGEA 1VHEA 4CYOA 1EE3P 1Y0RA 2FIWA 4R87A 1ZG9A 1YW4A 1HDUA 2JBKA 2WPXA 4LX9A 4JYWA 2J8RA 3D2MA 3IIBA 5IX3A 2PR1A 4QUSA 5JH9A 1V0CA 4MCRA 4NFRA 5J8FA 2G3TA 4KLWA 4BBHA 2HUZA 3A9LA 2OU2A 3BI0A 3PBBA 4U9YA 1B87A 2F5IA 4P4BA 1PUAA 3GKRA 4KOWA 3H8EA 1GHEA
chains in the Genus database with same CATH topology
4XPLA 2KCWA 3GYAA 4CAEA 4F0YA 1Y7RA 1I21A 2ARHA 5I0CA 4B5PA 2B4BA 4HNYB 2WSAA 3IGRA 3FIXA 3R1KA 2REFA 1S5KA 1S60A 2ZW5A 1I1DA 3B8GA 5KTAA 2Z3PA 3E0KA 3TTHA 2OH1A 1M44A 5KTDA 4XPDB 3EY5A 1I12A 2AE6A 4JXQA 1QSTA 2B5GB 2Q44A 1S7FA 2Q7BA 4C2XA 5G22A 2GANA 1IICA 4C2YA 1OZPA 1M1DA 2J8NA 3RYOA 2B4DA 1N71A 3DNSA 2P0WA 2BEIA 1S7NA 2R98A 2FXFA 4EVYA 5AG4A 3T90A 3BLNA 3BJ7A 2D4PA 2YNCC 4MFKA 5AG6A 3TO9A 4ONUA 2VQYA 4U9ZA 1MJAA 3DR6A 3IWEA 5G20A 4L8AA 3N7ZA 1ON0A 1M4GA 1YVKA 4KOXA 1Q2CA 1FY7A 5IV0A 2P6FA 2K5TA 2QECA 1YK3A 2Z10A 5A27A 4BMHA 2ZW7A 4CGLA 4HNWB 1QSRA 4UCMA 1M4IA 4AVBA 1UFHA 2PDOA 2I79A 4CAXA 3EFAA 4Y49C 4ORFA 1K4JA 1IIDA 3R96A 2HV2A 1Z9UA 4GS4A 5EBVA 2A4NA 2JLMA 2CNSA 3SXNA 3VWDA 4R57A 4B5PB 4R3LA 4B12A 4KOTA 2Q4YA 2OZGA 4B5OA 4JD6A 2YNCA 3UY5A 2B58A 3D3SA 4CS0B 2YNEA 3MGDA 4A32A 1XE4A 4MFLA 1J4JA 2HQYA 4NCZA 4KOUA 4QC6A 1KUVA 1Q2YA 2PQ8A 4XPKA 4E2AA 1TIQA 2O28A 4AG7A 2FSRA 4UWIA 3CXQA 2REEA 1S3ZA 1XEBA 4QB9A 1MJ9A 4OADA 2FIAA 5IB0A 1NSLA 2R7HA 2NMTA 2CXAA 2B4DB 1L0CA 1NMTA 4XNHC 4B10A 2C27A 4MI4A 1S7KA 4F0XA 1SQHA 1MJBA 2GE3A 4UFVA 3NE7A 3V8IA 4I49A 2DPTA 4A33A 4MJ8A 1WWZA 4E0AA 1S7LA 4E8OA 3TOAA 3OWCA 5J8CA 2PRBA 2B3UA 4IF5A 3TE4A 5AG5A 2H5MA 2VEZA 4OAEA 4KUAA 3FB3A 1Q2DA 4KOVA 4KZTA 3CXSA 3JTKA 2Y0MA 3D2PA 3SXOA 2Q04A 2VXKA 5GCNA 5C82A 2P6GA 3FRMA 3DR8A 4XPDC 3EC4A 4NSQA 3F5BA 2B3VA 4YFJA 3P2HA 2RC4A 2FE7A 4H6ZA 1YR0A 1PU9A 2WUUA 3WR7A 4IUSA 4RS2A 2QMLA 4CAFA 4MFPA 2I00A 4NXYA 4AB7A 4YGOA 2AJ6A 4X5KA 1CJWA 4M3SA 4CGMA 4AVAA 3QB8A 1NE9A 4QBJA 2BUEA 2VI7A 4AG9A 2FS5A 4R9MA 1U6MA 2D4OA 1Y9WA 3S6KA 4CRZB 1XF8A 5HMNA 4KVOE 4KSFA 3I9SA 3W6SA 5F47A 2ZW6A 4UFWA 4JXRA 3R95A 4Y49B 3ZJ0A 4MY0A 4OLLA 3TOBA 1MK4A 2BL1A 4KOSA 1P4NA 4QVTA 2P6EA 2IL4A 2ZW4A 3DSBA 5ISVA 1RO5A 4KUBA 4A31A 3PGPA 2Z11A 1VKCA 4MBUA 4CYNA 2G0BA 3H5ZA 4MFZA 4UCNA 2BSWA 4B11A 4A2ZA 2OB0A 3P2FA 1IB1E 4JJXA 5CNPA 4UA3A 2ZPAA 2WPWA 3PP9A 2X7BA 3SHPA 4ZBGA 1B6BA 3C26A 4H89A 2VZYA 4KSAA 3KKWA 4II9A 2CNMA 3PZJA 5F49A 2YGWA 3TO7A 5DWNA 4M85A 3JVNA 2JDDA 2Z3KA 2PC1A 4KORA 3TCVA 2JEVA 4K30A 1Y9KA 4XNHB 2DPSA 1XIXA 2ATRA 2PSWA 1KZFA 4A95A 5EC4A 4MFJA 5FVJA 3FBUA 2GIVA 3LODA 4FD4A 4HNXB 3IWGA 3K9UA 2OZUA 3QAHA 1M4DA 1VHSA 4PV6A 5KTCA 3F8KA 2Z3NA 2EUIA 3H4QA 2JDCA 1YLEA 3BJ8A 2VBQA 4Q36A 1QSNA 4RI1A 2G3AA 3FYNA 1R57A 4J3GA 4CRYB 4B13A 3LD2A 5BWAB 4YRHA 2YNDA 3R9GA 2FT0A 5DWMA 3FXTA 1Z4EA 1QSOA 3TO6A 3FNCA 1YVOA 5C88A 2QIRA 3VWEA 2ZXVA 4B14A 4C2ZA 2J8MA 4UWJA 4PSXA 4KOYA 4CYPA 1RXTA 1QSMA 4CGPA 3G8WA 3ZZIA 1XMTA 4PK3A 2VZZA 4DNCA 4UFXA 4FD6A 4A30A 3R9FA 2Z3LA 3T9YA 1IYKA 4MHDA 4C7IA 4CYQA 5G21A 4CAWA 4NEXA 5F48A 2Z3MA 5JQ4A 4MY3A 4PK2A 2Z3OA 5AG7A 3S6FA 1KUYA 1ZO0A 3EO4A 5A28A 4PSWA 3S6HA 3W91A 4LUAA 4U5YA 5E96A 4KLVA 2FL4A 3D8PA 3W6XA 2FCKA 1BO4A 2Z0ZA 4H6UA 4AVCA 4C7HA 4UBRA 4CAVA 1YX0A 3I3GA 5F46A 2B5GA 3F0AA 4ZGYB 4R3KA 4FD5A 3JUWA 3CXPA 4UCPA 2CNTA 1BOBA 1Z4RA 4KS9A 2OZHA 5G1ZA 3IU2A 3S6GA 1KUXA 4L89A 3IU1A 1P0HA 3EXNA 4KVME 1YGHA 4JLYA 5H84A 4HKFA 4CGNA 2R1IA 2DXQA 1YREA 2EVNA 5H86A 4Q38A 3TT2A 4NF1A 2Q0YA 2CY2A 1WK4A 4FD7A 3R9EA 3TFYA 4CGOA 1CM0A 4JWPA 2PR8A 3DDDA 5HH1A 4C68A 5JPHA 1IYLA 4MFQA 3GY9A 4KVXA 2R8VA 1LRZA 4F6AA 2Q4VA 3G3SA 5AGEA 4CYOA 2FIWA 4R87A 2WPXA 4LX9A 2J8RA 3D2MA 5IX3A 2PR1A 4QUSA 1V0CA 5J8FA 2G3TA 4KLWA 4BBHA 2HUZA 3A9LA 2OU2A 4U9YA 1B87A 2F5IA 1PUAA 3GKRA 4KOWA 1GHEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XPL A;  2KCW A;  3GYA A;  4F0Y A;  1Y7R A;  1I21 A;  2ARH A;  5I0C A;  4B5P A;  2B4B A;  4HNY B;  3IGR A;  3FIX A;  3R1K A;  2REF A;  1S5K A;  1S60 A;  2ZW5 A;  1I1D A;  3B8G A;  5KTA A;  3E0K A;  3TTH A;  2OH1 A;  1M44 A;  5KTD A;  4XPD B;  3EY5 A;  1I12 A;  2AE6 A;  4JXQ A;  1QST A;  2B5G B;  2Q44 A;  1S7F A;  2Q7B A;  2GAN A;  1IIC A;  1OZP A;  1M1D A;  2J8N A;  3RYO A;  2B4D A;  1N71 A;  3DNS A;  2P0W A;  2BEI A;  1S7N A;  2R98 A;  2FXF A;  4EVY A;  3T90 A;  3BLN A;  3BJ7 A;  2D4P A;  3TO9 A;  4ONU A;  2VQY A;  4U9Z A;  1MJA A;  3DR6 A;  4L8A A;  3N7Z A;  1ON0 A;  1M4G A;  1YVK A;  4KOX A;  1Q2C A;  1FY7 A;  5IV0 A;  2P6F A;  2K5T A;  2QEC A;  1YK3 A;  2Z10 A;  4BMH A;  2ZW7 A;  4HNW B;  1QSR A;  1M4I A;  4AVB A;  1UFH A;  2PDO A;  2I79 A;  4CAX A;  3EFA A;  4Y49 C;  4ORF A;  1K4J A;  1IID A;  3R96 A;  2HV2 A;  1Z9U A;  4GS4 A;  5EBV A;  2A4N A;  2JLM A;  2CNS A;  3SXN A;  3VWD A;  4R57 A;  4B5P B;  4R3L A;  4KOT A;  2Q4Y A;  2OZG A;  4B5O A;  4JD6 A;  3UY5 A;  2B58 A;  3D3S A;  4CS0 B;  3MGD A;  1XE4 A;  1J4J A;  2HQY A;  4NCZ A;  4KOU A;  4QC6 A;  1KUV A;  1Q2Y A;  2PQ8 A;  4XPK A;  4E2A A;  1TIQ A;  2O28 A;  4AG7 A;  2FSR A;  4UWI A;  3CXQ A;  2REE A;  1S3Z A;  1XEB A;  4QB9 A;  1MJ9 A;  4OAD A;  2FIA A;  5IB0 A;  1NSL A;  2R7H A;  2NMT A;  2B4D B;  1L0C A;  1NMT A;  4XNH C;  2C27 A;  4MI4 A;  1S7K A;  1SQH A;  1MJB A;  2GE3 A;  3NE7 A;  3V8I A;  4I49 A;  4MJ8 A;  1WWZ A;  4E0A A;  1S7L A;  4E8O A;  3TOA A;  3OWC A;  5J8C A;  2PRB A;  2B3U A;  4IF5 A;  3TE4 A;  2H5M A;  2VEZ A;  4OAE A;  4KUA A;  3FB3 A;  1Q2D A;  4KOV A;  4KZT A;  3CXS A;  2Y0M A;  3D2P A;  3SXO A;  2Q04 A;  2VXK A;  5GCN A;  5C82 A;  2P6G A;  3FRM A;  3DR8 A;  4XPD C;  3EC4 A;  4NSQ A;  3F5B A;  2B3V A;  4YFJ A;  3P2H A;  2RC4 A;  2FE7 A;  4H6Z A;  1YR0 A;  1PU9 A;  3WR7 A;  4IUS A;  4RS2 A;  2QML A;  2I00 A;  4NXY A;  4AB7 A;  4YGO A;  2AJ6 A;  4X5K A;  1CJW A;  4M3S A;  4AVA A;  3QB8 A;  1NE9 A;  4QBJ A;  2BUE A;  2VI7 A;  4AG9 A;  2FS5 A;  4R9M A;  1U6M A;  2D4O A;  1Y9W A;  3S6K A;  4CRZ B;  1XF8 A;  5HMN A;  4KVO E;  3I9S A;  3W6S A;  5F47 A;  2ZW6 A;  4JXR A;  3R95 A;  4Y49 B;  3ZJ0 A;  4MY0 A;  4OLL A;  3TOB A;  1MK4 A;  2BL1 A;  4KOS A;  1P4N A;  4QVT A;  2P6E A;  2IL4 A;  2ZW4 A;  3DSB A;  5ISV A;  1RO5 A;  4KUB A;  3PGP A;  2Z11 A;  1VKC A;  4MBU A;  2G0B A;  2BSW A;  2OB0 A;  3P2F A;  1IB1 E;  4JJX A;  5CNP A;  4UA3 A;  2ZPA A;  2WPW A;  3PP9 A;  2X7B A;  3SHP A;  4ZBG A;  1B6B A;  3C26 A;  4H89 A;  2VZY A;  3KKW A;  4II9 A;  2CNM A;  3PZJ A;  5F49 A;  3TO7 A;  5DWN A;  4M85 A;  3JVN A;  2JDD A;  2PC1 A;  4KOR A;  3TCV A;  2JEV A;  4K30 A;  1Y9K A;  4XNH B;  1XIX A;  2ATR A;  2PSW A;  1KZF A;  5EC4 A;  5FVJ A;  3FBU A;  2GIV A;  3LOD A;  4FD4 A;  4HNX B;  3IWG A;  3K9U A;  2OZU A;  3QAH A;  1M4D A;  1VHS A;  4PV6 A;  5KTC A;  3F8K A;  2EUI A;  3H4Q A;  2JDC A;  1YLE A;  3BJ8 A;  2VBQ A;  1QSN A;  4RI1 A;  2G3A A;  3FYN A;  1R57 A;  4J3G A;  4CRY B;  3LD2 A;  4YRH A;  3R9G A;  2FT0 A;  5DWM A;  3FXT A;  1Z4E A;  1QSO A;  3TO6 A;  3FNC A;  1YVO A;  5C88 A;  2QIR A;  3VWE A;  2ZXV A;  2J8M A;  4UWJ A;  4PSX A;  4KOY A;  1RXT A;  1QSM A;  3G8W A;  3ZZI A;  1XMT A;  4PK3 A;  2VZZ A;  4DNC A;  4FD6 A;  3R9F A;  3T9Y A;  1IYK A;  4MHD A;  4CAW A;  4NEX A;  5F48 A;  5JQ4 A;  4MY3 A;  4PK2 A;  3S6F A;  1KUY A;  3EO4 A;  4PSW A;  3S6H A;  3W91 A;  4LUA A;  4U5Y A;  5E96 A;  4KLV A;  2FL4 A;  3D8P A;  3W6X A;  2FCK A;  1BO4 A;  2Z0Z A;  4H6U A;  4AVC A;  4UBR A;  4CAV A;  1YX0 A;  3I3G A;  5F46 A;  2B5G A;  3F0A A;  4R3K A;  4FD5 A;  3JUW A;  3CXP A;  2CNT A;  1BOB A;  1Z4R A;  2OZH A;  3S6G A;  1KUX A;  4L89 A;  1P0H A;  3EXN A;  4KVM E;  1YGH A;  4JLY A;  5H84 A;  4HKF A;  2R1I A;  2DXQ A;  1YRE A;  2EVN A;  5H86 A;  3TT2 A;  4NF1 A;  2Q0Y A;  2CY2 A;  1WK4 A;  4FD7 A;  3R9E A;  3TFY A;  1CM0 A;  2PR8 A;  3DDD A;  4JWP A;  5HH1 A;  5JPH A;  1IYL A;  3GY9 A;  4KVX A;  2R8V A;  1LRZ A;  4F6A A;  2Q4V A;  3G3S A;  2FIW A;  4R87 A;  2WPX A;  4LX9 A;  2J8R A;  3D2M A;  5IX3 A;  2PR1 A;  4QUS A;  1V0C A;  5J8F A;  2G3T A;  4KLW A;  2HUZ A;  2OU2 A;  4U9Y A;  1B87 A;  2F5I A;  1PUA A;  3GKR A;  4KOW A;  1GHE A; 
#chains in the Genus database with same CATH topology
 3GLJ A;  1IGB A;  1TKF A;  3ISX A;  4P4J A;  2KCW A;  3GYA A;  4XPL A;  4CAE A;  4F0Y A;  4A37 A;  1Y7R A;  4MXU A;  1I21 A;  2ARH A;  5I0C A;  2V8H A;  4B5P A;  4MHN A;  2PE3 A;  4OID A;  2PVV A;  2B4B A;  4HNY B;  1ZG7 A;  1AMP A;  2PJ8 A;  2WSA A;  3IGR A;  3FIX A;  3R1K A;  3CPX A;  3DGV A;  2REF A;  1S5K A;  2CTC A;  2Q43 A;  1S60 A;  2ZW5 A;  1I1D A;  1XFO A;  4WJB A;  3IWW A;  5I4M A;  4LQ6 A;  3B8G A;  3PEI A;  5KTA A;  2Z3P A;  2ZEL A;  2PJC A;  3E0K A;  1XBU A;  2J9A A;  2ZEE A;  3L2N A;  3TTH A;  1VHO A;  2NYQ A;  2OH1 A;  1M44 A;  3FVL A;  6CPA A;  5KTD A;  4XPD B;  3EY5 A;  1I12 A;  2AE6 A;  4NGP A;  2AFW A;  4JXQ A;  8CPA A;  1QST A;  2B5G B;  1OBR A;  2Q44 A;  1S7F A;  1Z2L A;  2Q7B A;  2ZEO A;  5G22 A;  2ZOG A;  4C2X A;  4ZI6 A;  2GAN A;  1IIC A;  2JBJ A;  1OZP A;  4C2Y A;  3TC8 A;  1M1D A;  2J8N A;  3RYO A;  2B4D A;  1N71 A;  3DNS A;  2C6G A;  1CP6 A;  3GIU A;  4O23 A;  2Q51 A;  2P0W A;  2BEI A;  1S7N A;  2R98 A;  3FH4 A;  2FXF A;  2V8V A;  4EVY A;  1HDQ A;  3CDX A;  5IB9 A;  5AG4 A;  1LCP A;  3T90 A;  3BLN A;  3BJ7 A;  2D4P A;  2XEF A;  2YNC C;  4MFK A;  4KSI A;  3FX6 A;  5AG6 A;  3TO9 A;  4ONU A;  2VQY A;  4U9Z A;  1MJA A;  3SJF A;  2PJ2 A;  3DR6 A;  3IWE A;  5G20 A;  2CIJ A;  3QNV A;  4L8A A;  3N7Z A;  1AUG A;  1ON0 A;  1M4G A;  3KI9 A;  4MCP A;  4W9Y A;  1YVK A;  4KOX A;  1ZLI A;  4F8Z A;  1Q2C A;  1FY7 A;  5CPA A;  5IV0 A;  1CP7 A;  3QAY A;  2P6F A;  4OC1 A;  2K5T A;  2QEC A;  1YK3 A;  2Z10 A;  5A27 A;  4PXD A;  4TWE A;  2IQ6 A;  4BMH A;  3TX8 A;  4MHY A;  1ARL A;  3H8G A;  4R6T A;  2ZW7 A;  4AXV A;  4CGL A;  5K8P A;  4HNW B;  1QSR A;  4UCM A;  1KWM A;  1M4I A;  3IO1 A;  4UEF A;  1UFH A;  4AVB A;  2PDO A;  3KHX A;  4ZY1 A;  2I79 A;  4CAX A;  3EFA A;  4Y49 C;  2AFX A;  4ORF A;  1K4J A;  1DTD A;  1IID A;  2EBJ A;  2V77 A;  2HV2 A;  3R96 A;  2PJ5 A;  1Z9U A;  1CBX A;  4GS4 A;  5EBV A;  2A4N A;  3S9M A;  2JEW A;  2JLM A;  2CNS A;  3VAT A;  1UWY A;  3SXN A;  3DLJ A;  4MMO A;  3K9T A;  5JGF A;  2C6P A;  3VWD A;  4R57 A;  2DF5 A;  4B5P B;  4R3L A;  4MCS A;  4B12 A;  5K8O A;  2EO8 A;  1QMU A;  5HVG A;  4KOT A;  2Q4Y A;  2OZG A;  4B5O A;  4ZX9 A;  1BLL E;  4MCQ A;  4JD6 A;  2YNC A;  4GXH A;  2WZN A;  3UY5 A;  2DEA A;  2B58 A;  3D3S A;  4CS0 B;  2HC9 A;  2YNE A;  3MGD A;  1FNO A;  5J1Q A;  4A32 A;  1XE4 A;  4MFL A;  1J4J A;  3SI2 A;  5LYF A;  2HQY A;  4NCZ A;  2IMO A;  4KOU A;  4QC6 A;  2PJ6 A;  1KUV A;  1Q2Y A;  3JRU A;  4A39 A;  2Q7S A;  2PQ8 A;  4XPK A;  4E2A A;  1TIQ A;  2O28 A;  4AG7 A;  2PIY A;  2FSR A;  4UWI A;  3CXQ A;  2REE A;  2F8H A;  4PQA A;  4YWY A;  2PJ0 A;  3T8W A;  1S3Z A;  1XEB A;  4QB9 A;  1MJ9 A;  2AFS A;  4OAD A;  2FIA A;  2Q4Z A;  5IB0 A;  1NSL A;  2OOT A;  3B2Y A;  2R7H A;  3S9L A;  4CPA A;  2NMT A;  2CXA A;  2B4D B;  2PJA A;  4RN7 A;  3LWU A;  5HVH A;  1L0C A;  1HEE A;  1NMT A;  2BCO A;  2ZEM A;  1LOK A;  1IOI A;  1LAN A;  4XNH C;  4B10 A;  5F09 A;  2ZED A;  4UEE A;  2C27 A;  4MI4 A;  1S7K A;  2CF4 A;  1F57 A;  2PVW A;  4F0X A;  1SQH A;  1LAP A;  1MJB A;  2GE3 A;  4P10 A;  4X3R A;  4UFV A;  2XEG A;  4OME A;  5ELY A;  3NE7 A;  3V8I A;  4I49 A;  1CPX A;  3LMS A;  2PRQ A;  2DPT A;  4A33 A;  4MHZ A;  4YU9 A;  4MJ8 A;  2I3C A;  1WWZ A;  1ZG8 A;  1S7L A;  3RBU A;  4E0A A;  4E8O A;  4G1P A;  4OP4 A;  3TOA A;  2PIZ A;  5HXD A;  3RAM A;  3OWC A;  5J8C A;  2PCU A;  2B3U A;  2PRB A;  4IF5 A;  3TE4 A;  4MRI A;  5AG5 A;  2H5M A;  2VEZ A;  4OAE A;  4KUA A;  3FB3 A;  1Q2D A;  4KOV A;  4KZT A;  3CXS A;  3JTK A;  3VH9 A;  2Y0M A;  3D2P A;  3N5F A;  1VGY A;  1R3N A;  5JM6 A;  1ZLH A;  2RB7 A;  4FUU A;  3VAR A;  4ONW A;  3SXO A;  1TF9 A;  2Q04 A;  2VXK A;  5GCN A;  3KL9 A;  5C82 A;  2P6G A;  4OC2 A;  1YSJ A;  3FRM A;  3CT9 A;  3DR8 A;  4B6Z A;  4XPD C;  5D29 A;  2ZEH A;  3EC4 A;  4NSQ A;  1Y7E A;  3F5B A;  2B3V A;  3KQX A;  4P45 A;  1XJO A;  1BPM A;  4YFJ A;  3P2H A;  1XRY A;  4RUH A;  3GB0 A;  4FWU A;  2RC4 A;  2FE7 A;  2XEI A;  3PB6 X;  1YR0 A;  4H6Z A;  1PU9 A;  2O4H A;  1IY7 A;  2WUU A;  4P4E A;  3WR7 A;  1PCA A;  4IUS A;  2C6C A;  4RS2 A;  1YME A;  2QML A;  4CAF A;  1YLO A;  4MFP A;  4UF4 A;  1TF8 A;  2I00 A;  4NXY A;  4AB7 A;  3D4U A;  4YGO A;  2AJ6 A;  4X5K A;  1CJW A;  3FMC A;  2GLJ A;  4M3S A;  4CGM A;  4AVA A;  3QB8 A;  3KR4 A;  4PXE A;  1NE9 A;  2XEJ A;  4QBJ A;  4OKO A;  2BUE A;  2VI7 A;  4AG9 A;  3IFE A;  2PJ1 A;  3NH4 A;  1Z5R A;  2F7V A;  2FS5 A;  1LAM A;  1U6M A;  4IK2 A;  4R9M A;  4PXC A;  4TNU A;  3KAS A;  4OC5 A;  2D4O A;  1TXR A;  1Y9W A;  5LYI A;  3S6K A;  4CRZ B;  3V7Z A;  1XF8 A;  1IOF A;  4M6I A;  5HMN A;  3NH8 A;  2RFH A;  4K3N A;  4KVO E;  4KSF A;  3RNZ A;  3I9S A;  1F2O A;  1BPN A;  3W6S A;  2AFU A;  5F47 A;  3PB7 X;  1Z8L A;  2ZW6 A;  4UFW A;  4JXR A;  4R7M A;  4WWV A;  4Y49 B;  3R95 A;  3ZJ0 A;  3B3T A;  2C1C A;  2BO9 A;  4MY0 A;  4OLL A;  3TOB A;  1MK4 A;  3PFO A;  2BL1 A;  2G9D A;  4KOS A;  2GU2 A;  1QQ9 A;  2PJ4 A;  1Q7L A;  5EMI A;  1P4N A;  1ARM A;  4QVT A;  4ZX8 A;  4NJQ A;  2P6E A;  4P4I A;  2IL4 A;  2ZW4 A;  3SJE A;  3DSB A;  4A94 A;  3PBE A;  5ISV A;  4HPS A;  4ZY0 A;  1RO5 A;  4KUB A;  4A31 A;  3PGP A;  1X10 A;  2Z11 A;  1CX8 A;  3NA6 A;  1VKC A;  4MBU A;  1Z8T A;  2QYV A;  3PB9 X;  4CYN A;  2G0B A;  2GFQ A;  3FED A;  3H5Z A;  4MFZ A;  4UCN A;  1Z8W A;  2BSW A;  4B11 A;  3B3W A;  4FAI A;  4A2Z A;  2OB0 A;  3P2F A;  1IB1 E;  3ISZ A;  3NFZ A;  4JJX A;  1CPS A;  3MRU A;  5CNP A;  4M6H A;  4UA3 A;  5K8M A;  1BAV A;  2OR4 A;  2ZPA A;  2WPW A;  3PP9 A;  2X7B A;  4LQG A;  3SHP A;  3D68 A;  3HUV A;  4OC4 A;  4ZBG A;  1B6B A;  1GYT A;  3C26 A;  1YW6 A;  4H89 A;  2VZY A;  4KSA A;  3KKW A;  4II9 A;  5CBM A;  2CNM A;  2EK8 A;  3PZJ A;  2VL1 A;  2YGW A;  3KZW A;  3PB4 X;  4NGT A;  5DWN A;  5F49 A;  4M85 A;  3TO7 A;  3JVN A;  1IU8 A;  2JDD A;  3RZA A;  2Z3K A;  4NGQ A;  4EME A;  1A2Z A;  3SJG A;  2PC1 A;  4KOR A;  3TCV A;  2JEV A;  4K30 A;  3CPA A;  4A38 A;  3KHZ A;  1Y9K A;  3NE8 A;  3BI1 A;  3NH5 A;  4XNH B;  2DPS A;  1XIX A;  2ATR A;  2PSW A;  1KZF A;  4A95 A;  3B3C A;  3FEC A;  5EC4 A;  4MFJ A;  4F9U A;  4DJL A;  4NJR A;  3FBU A;  2GIV A;  3LOD A;  4FD4 A;  4HNX B;  5FVJ A;  3IWG A;  3K9U A;  2AFM A;  1AYE A;  2OZU A;  4BD9 A;  3QAH A;  1M4D A;  1VHS A;  4NGR A;  4PV6 A;  4Z65 A;  5KTC A;  3BXM A;  3KQZ A;  3F8K A;  1X12 A;  2Z3N A;  3IC1 A;  3PRT A;  2EUI A;  2O53 A;  3H4Q A;  2IJZ A;  3D7G A;  1Y0Y A;  3WT4 A;  1CG2 A;  2JDC A;  1YLE A;  3BJ8 A;  2VBQ A;  4Q36 A;  1QSN A;  4RI1 A;  2G3A A;  3FYN A;  1R57 A;  4J3G A;  3D7D A;  4CRY B;  4B13 A;  4BIN A;  2AFO A;  3LD2 A;  4H2K A;  5BWA B;  3D67 A;  3FF3 A;  4YRH A;  4X8I A;  3WC6 A;  2YND A;  3R9G A;  1F2P A;  2FT0 A;  2ZEP A;  4MHP A;  3FXT A;  3IJ3 A;  3FJU A;  5DWM A;  1Z4E A;  4ZY2 A;  5LRJ A;  1QSO A;  3SI1 A;  1YQE A;  3FNC A;  3TO6 A;  1M4L A;  2PJB A;  3WC5 A;  2ABZ A;  1YVO A;  1VIX A;  5C88 A;  2AFZ A;  2QIR A;  1R43 A;  2PJ9 A;  2V8G A;  2ZXV A;  4R76 A;  3VWE A;  4B14 A;  4C2Z A;  2J8M A;  2NSM A;  3FEE A;  4PSX A;  3I1U A;  4UWJ A;  4KOY A;  4CYP A;  5LYL A;  1QSM A;  1RXT A;  3B3S A;  2WYR A;  4EFD A;  2V8D A;  4IHM A;  4CGP A;  2CTB A;  3D66 A;  1Z8X A;  3G8W A;  3S9N A;  3ZZI A;  1XMT A;  3H8F A;  4PK3 A;  2VZZ A;  4DUK A;  2PJ7 A;  2ZEG A;  4DNC A;  5THW A;  4NGS A;  2POK A;  3IEH A;  4UFX A;  4FD6 A;  4A30 A;  3R9F A;  2Z3L A;  4IAV A;  5DS0 A;  2ZOF A;  3PFE A;  3T9Y A;  1IYK A;  4MHD A;  5D8N A;  4C7I A;  4UIB A;  4CYQ A;  5G21 A;  5LYD A;  4CAW A;  2BOA A;  3B3V A;  4NEX A;  5F48 A;  2Z3M A;  5JQ4 A;  4MY3 A;  3KR5 A;  4PK2 A;  2Z3O A;  5AG7 A;  3S6F A;  1KUY A;  5K8N A;  2QJ8 A;  3B35 A;  1JQG A;  1FT7 A;  1ZO0 A;  3EO4 A;  2FVG A;  4PSW A;  3V38 A;  5A28 A;  2GLF A;  1H8L A;  3KGQ A;  3S6H A;  3BHX A;  3W91 A;  1DE4 C;  1JWQ A;  4LUA A;  4U5Y A;  5E96 A;  2PJ3 A;  4KLV A;  2FL4 A;  3D8P A;  3K2K A;  2FCK A;  3W6X A;  4OIW A;  5HVF A;  1BO4 A;  1ELM P;  3D7H A;  2EWB A;  2Z0Z A;  3MN8 A;  4H6U A;  4AVC A;  2ANP A;  1XMB A;  4C7H A;  4UEZ A;  3WC7 A;  4X2T A;  4UBR A;  1ELL P;  4CAV A;  1YX0 A;  2EK9 A;  3I3G A;  3SI0 A;  2GRE A;  4NGM A;  5F46 A;  2B5G A;  3F0A A;  2QVP A;  2ZEN A;  1LFW A;  4ZGY B;  4R3K A;  4FD5 A;  3JUW A;  4P6Y A;  4FBE A;  3CXP A;  4UCP A;  4M6G A;  2CNT A;  1BOB A;  4F9V A;  1Z4R A;  1NSA A;  4KS9 A;  3D7F A;  4P44 A;  3PB8 X;  2OZH A;  5G1Z A;  3IU2 A;  2HB6 A;  3S6G A;  1KUX A;  4L89 A;  3IU1 A;  4GM5 A;  4PXB A;  5LRK A;  1P0H A;  3EXN A;  4KVM E;  4UIA A;  1XOV A;  1YGH A;  2ODF A;  4HKF A;  4JLY A;  5H84 A;  4OC0 A;  1TKH A;  4ZYQ A;  4CGN A;  2R1I A;  2DXQ A;  1YRE A;  2EVN A;  4NGN A;  5H86 A;  7CPA A;  4Q38 A;  3TT2 A;  4NF1 A;  3B7I A;  2Q0Y A;  1PYT B;  4Q7A A;  3RO0 A;  3SJX A;  3WAB A;  4R8F A;  2ZEF A;  2CY2 A;  3GUX A;  1WK4 A;  4P4F A;  4FD7 A;  3CZX A;  3LAC A;  3R9E A;  3TFY A;  4CGO A;  5LRG A;  4DYO A;  1RTQ A;  1CM0 A;  2PR8 A;  3DDD A;  4JWP A;  5HH1 A;  4OC3 A;  4C68 A;  3HLP A;  5JPH A;  1IYL A;  4JZ0 A;  3GY9 A;  4KVX A;  4MFQ A;  4EWT A;  2R8V A;  1LRZ A;  4F6A A;  2Q4V A;  3G3S A;  1TKJ A;  4PPZ A;  4P4D A;  5AGE A;  1VHE A;  4CYO A;  1EE3 P;  1Y0R A;  2FIW A;  4R87 A;  1ZG9 A;  1YW4 A;  1HDU A;  2JBK A;  2WPX A;  4LX9 A;  4JYW A;  2J8R A;  3D2M A;  3IIB A;  5IX3 A;  2PR1 A;  4QUS A;  5JH9 A;  1V0C A;  4MCR A;  4NFR A;  5J8F A;  2G3T A;  4KLW A;  4BBH A;  2HUZ A;  3A9L A;  2OU2 A;  3BI0 A;  3PBB A;  4U9Y A;  1B87 A;  2F5I A;  4P4B A;  1PUA A;  3GKR A;  4KOW A;  3H8E A;  1GHE A; 
#chains in the Genus database with same CATH homology
 4XPL A;  2KCW A;  3GYA A;  4CAE A;  4F0Y A;  1Y7R A;  1I21 A;  2ARH A;  5I0C A;  4B5P A;  2B4B A;  4HNY B;  2WSA A;  3IGR A;  3FIX A;  3R1K A;  2REF A;  1S5K A;  1S60 A;  2ZW5 A;  1I1D A;  3B8G A;  5KTA A;  2Z3P A;  3E0K A;  3TTH A;  2OH1 A;  1M44 A;  5KTD A;  4XPD B;  3EY5 A;  1I12 A;  2AE6 A;  4JXQ A;  1QST A;  2B5G B;  2Q44 A;  1S7F A;  2Q7B A;  4C2X A;  5G22 A;  2GAN A;  1IIC A;  4C2Y A;  1OZP A;  1M1D A;  2J8N A;  3RYO A;  2B4D A;  1N71 A;  3DNS A;  2P0W A;  2BEI A;  1S7N A;  2R98 A;  2FXF A;  4EVY A;  5AG4 A;  3T90 A;  3BLN A;  3BJ7 A;  2D4P A;  2YNC C;  4MFK A;  5AG6 A;  3TO9 A;  4ONU A;  2VQY A;  4U9Z A;  1MJA A;  3DR6 A;  3IWE A;  5G20 A;  4L8A A;  3N7Z A;  1ON0 A;  1M4G A;  1YVK A;  4KOX A;  1Q2C A;  1FY7 A;  5IV0 A;  2P6F A;  2K5T A;  2QEC A;  1YK3 A;  2Z10 A;  5A27 A;  4BMH A;  2ZW7 A;  4CGL A;  4HNW B;  1QSR A;  4UCM A;  1M4I A;  4AVB A;  1UFH A;  2PDO A;  2I79 A;  4CAX A;  3EFA A;  4Y49 C;  4ORF A;  1K4J A;  1IID A;  3R96 A;  2HV2 A;  1Z9U A;  4GS4 A;  5EBV A;  2A4N A;  2JLM A;  2CNS A;  3SXN A;  3VWD A;  4R57 A;  4B5P B;  4R3L A;  4B12 A;  4KOT A;  2Q4Y A;  2OZG A;  4B5O A;  4JD6 A;  2YNC A;  3UY5 A;  2B58 A;  3D3S A;  4CS0 B;  2YNE A;  3MGD A;  4A32 A;  1XE4 A;  4MFL A;  1J4J A;  2HQY A;  4NCZ A;  4KOU A;  4QC6 A;  1KUV A;  1Q2Y A;  2PQ8 A;  4XPK A;  4E2A A;  1TIQ A;  2O28 A;  4AG7 A;  2FSR A;  4UWI A;  3CXQ A;  2REE A;  1S3Z A;  1XEB A;  4QB9 A;  1MJ9 A;  4OAD A;  2FIA A;  5IB0 A;  1NSL A;  2R7H A;  2NMT A;  2CXA A;  2B4D B;  1L0C A;  1NMT A;  4XNH C;  4B10 A;  2C27 A;  4MI4 A;  1S7K A;  4F0X A;  1SQH A;  1MJB A;  2GE3 A;  4UFV A;  3NE7 A;  3V8I A;  4I49 A;  2DPT A;  4A33 A;  4MJ8 A;  1WWZ A;  4E0A A;  1S7L A;  4E8O A;  3TOA A;  3OWC A;  5J8C A;  2PRB A;  2B3U A;  4IF5 A;  3TE4 A;  5AG5 A;  2H5M A;  2VEZ A;  4OAE A;  4KUA A;  3FB3 A;  1Q2D A;  4KOV A;  4KZT A;  3CXS A;  3JTK A;  2Y0M A;  3D2P A;  3SXO A;  2Q04 A;  2VXK A;  5GCN A;  5C82 A;  2P6G A;  3FRM A;  3DR8 A;  4XPD C;  3EC4 A;  4NSQ A;  3F5B A;  2B3V A;  4YFJ A;  3P2H A;  2RC4 A;  2FE7 A;  4H6Z A;  1YR0 A;  1PU9 A;  2WUU A;  3WR7 A;  4IUS A;  4RS2 A;  2QML A;  4CAF A;  4MFP A;  2I00 A;  4NXY A;  4AB7 A;  4YGO A;  2AJ6 A;  4X5K A;  1CJW A;  4M3S A;  4CGM A;  4AVA A;  3QB8 A;  1NE9 A;  4QBJ A;  2BUE A;  2VI7 A;  4AG9 A;  2FS5 A;  4R9M A;  1U6M A;  2D4O A;  1Y9W A;  3S6K A;  4CRZ B;  1XF8 A;  5HMN A;  4KVO E;  4KSF A;  3I9S A;  3W6S A;  5F47 A;  2ZW6 A;  4UFW A;  4JXR A;  3R95 A;  4Y49 B;  3ZJ0 A;  4MY0 A;  4OLL A;  3TOB A;  1MK4 A;  2BL1 A;  4KOS A;  1P4N A;  4QVT A;  2P6E A;  2IL4 A;  2ZW4 A;  3DSB A;  5ISV A;  1RO5 A;  4KUB A;  4A31 A;  3PGP A;  2Z11 A;  1VKC A;  4MBU A;  4CYN A;  2G0B A;  3H5Z A;  4MFZ A;  4UCN A;  2BSW A;  4B11 A;  4A2Z A;  2OB0 A;  3P2F A;  1IB1 E;  4JJX A;  5CNP A;  4UA3 A;  2ZPA A;  2WPW A;  3PP9 A;  2X7B A;  3SHP A;  4ZBG A;  1B6B A;  3C26 A;  4H89 A;  2VZY A;  4KSA A;  3KKW A;  4II9 A;  2CNM A;  3PZJ A;  5F49 A;  2YGW A;  3TO7 A;  5DWN A;  4M85 A;  3JVN A;  2JDD A;  2Z3K A;  2PC1 A;  4KOR A;  3TCV A;  2JEV A;  4K30 A;  1Y9K A;  4XNH B;  2DPS A;  1XIX A;  2ATR A;  2PSW A;  1KZF A;  4A95 A;  5EC4 A;  4MFJ A;  5FVJ A;  3FBU A;  2GIV A;  3LOD A;  4FD4 A;  4HNX B;  3IWG A;  3K9U A;  2OZU A;  3QAH A;  1M4D A;  1VHS A;  4PV6 A;  5KTC A;  3F8K A;  2Z3N A;  2EUI A;  3H4Q A;  2JDC A;  1YLE A;  3BJ8 A;  2VBQ A;  4Q36 A;  1QSN A;  4RI1 A;  2G3A A;  3FYN A;  1R57 A;  4J3G A;  4CRY B;  4B13 A;  3LD2 A;  5BWA B;  4YRH A;  2YND A;  3R9G A;  2FT0 A;  5DWM A;  3FXT A;  1Z4E A;  1QSO A;  3TO6 A;  3FNC A;  1YVO A;  5C88 A;  2QIR A;  3VWE A;  2ZXV A;  4B14 A;  4C2Z A;  2J8M A;  4UWJ A;  4PSX A;  4KOY A;  4CYP A;  1RXT A;  1QSM A;  4CGP A;  3G8W A;  3ZZI A;  1XMT A;  4PK3 A;  2VZZ A;  4DNC A;  4UFX A;  4FD6 A;  4A30 A;  3R9F A;  2Z3L A;  3T9Y A;  1IYK A;  4MHD A;  4C7I A;  4CYQ A;  5G21 A;  4CAW A;  4NEX A;  5F48 A;  2Z3M A;  5JQ4 A;  4MY3 A;  4PK2 A;  2Z3O A;  5AG7 A;  3S6F A;  1KUY A;  1ZO0 A;  3EO4 A;  5A28 A;  4PSW A;  3S6H A;  3W91 A;  4LUA A;  4U5Y A;  5E96 A;  4KLV A;  2FL4 A;  3D8P A;  3W6X A;  2FCK A;  1BO4 A;  2Z0Z A;  4H6U A;  4AVC A;  4C7H A;  4UBR A;  4CAV A;  1YX0 A;  3I3G A;  5F46 A;  2B5G A;  3F0A A;  4ZGY B;  4R3K A;  4FD5 A;  3JUW A;  3CXP A;  4UCP A;  2CNT A;  1BOB A;  1Z4R A;  4KS9 A;  2OZH A;  5G1Z A;  3IU2 A;  3S6G A;  1KUX A;  4L89 A;  3IU1 A;  1P0H A;  3EXN A;  4KVM E;  1YGH A;  4JLY A;  5H84 A;  4HKF A;  4CGN A;  2R1I A;  2DXQ A;  1YRE A;  2EVN A;  5H86 A;  4Q38 A;  3TT2 A;  4NF1 A;  2Q0Y A;  2CY2 A;  1WK4 A;  4FD7 A;  3R9E A;  3TFY A;  4CGO A;  1CM0 A;  4JWP A;  2PR8 A;  3DDD A;  5HH1 A;  4C68 A;  5JPH A;  1IYL A;  4MFQ A;  3GY9 A;  4KVX A;  2R8V A;  1LRZ A;  4F6A A;  2Q4V A;  3G3S A;  5AGE A;  4CYO A;  2FIW A;  4R87 A;  2WPX A;  4LX9 A;  2J8R A;  3D2M A;  5IX3 A;  2PR1 A;  4QUS A;  1V0C A;  5J8F A;  2G3T A;  4KLW A;  4BBH A;  2HUZ A;  3A9L A;  2OU2 A;  4U9Y A;  1B87 A;  2F5I A;  1PUA A;  3GKR A;  4KOW A;  1GHE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...