1YREA

Hypothetical protein pa3270 from pseudomonas aeruginosa in complex with coa
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
183
structure length
183
Chain Sequence
LPITLQRGALRLEPLVEADIPELVSLAEANREALQYMDGPTRPDWYRQSLAEQREGRALPLAVRLGVQLVGTTRFAEFLPALPACEIGWTWLDQAQHGSGLNRMIKYLMLKHAFDNLRMVRVQLSTAASNLRAQGAIDKLGAQREGVLRNHRRLAGGRLDDTFVYSITDHEWPQVKAALEASF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein PA3270
publication title The crystal structure of hypothetical protein PA3270 from Pseudomonas aeruginosa in complex with CoA
rcsb
source organism Pseudomonas aeruginosa
molecule tags Structural genomics, unknown function
total genus 60
structure length 183
sequence length 183
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1yreA00
4IUSA 4XNHB 4MY3A 1J4JA 5HH1A 3C26A 4XPLA 5ISVA 2Q0YA 4QVTA 5CNPA 4X5KA 3S6HA 2B5GA 2B5GB 4XPKA 3PGPA 2FS5A 5H84A 2FIWA 1XIXA 5F47A 5KTCA 3R96A 4KOXA 4BMHA 2R98A 2A4NA 4EVYA 4II9A 5GCNA 2F5IA 3TOAA 3S6KA 3FRMA 3D2PA 2WPXA 4AVCA 5IX3A 4NF1A 4MHDA 2B3UA 2REFA 2FE7A 4NXYA 4FD6A 2H5MA 3VWEA 1Y7RA 3PZJA 4U9YA 3ZZIA 2EVNA 2B4DB 4YRHA 5J8CA 2FT0A 2JLMA 4NSQA 3W6SA 2AJ6A 3T9YA 1S3ZA 1QSMA 4FD7A 5KTAA 5JQ4A 4AVBA 2PR1A 5F46A 2R7HA 4FD4A 3DNSA 4KVXA 3R9EA 3WR7A 4PSXA 2VZYA 1QSRA 1M4DA 3CXQA 2ZW5A 3TOBA 3FBUA 1L0CA 3W6XA 4RI1A 1VHSA 4IF5A 3DR8A 2VEZA 1KUXA 3LD2A 2FSRA 1MJ9A 4CAXA 4KVOE 4CAVA 1YR0A 2BUEA 2Q04A 2NMTA 3MGDA 4KZTA 4XPDC 3GY9A 4KUBA 2ATRA 3EC4A 1WWZA 1Y9WA 2CNSA 3TO6A 4QUSA 2C27A 3W91A 3R1KA 3G8WA 5E96A 4E0AA 3SXOA 4H89A 2G3TA 5KTDA 3QB8A 3TO9A 3IGRA 1I12A 5JPHA 3D2MA 4QC6A 2BEIA 2PSWA 2Q4YA 4R87A 1IB1E 1SQHA 1XF8A 1S7FA 4KLWA 1V0CA 1NSLA 5C88A 4B5PB 4UWIA 2I00A 4I49A 1XEBA 4LUAA 3R9FA 1M4IA 2HQYA 1XE4A 4KOUA 1CJWA 4AG9A 5FVJA 2PDOA 3BLNA 3CXPA 1YGHA 2J8RA 4KOSA 3OWCA 2REEA 1WK4A 3D8PA 4CAWA 1YK3A 1S7KA 1NMTA 1IICA 1TIQA 2VXKA 5J8FA 1Q2YA 1Q2DA 3H4QA 5IB0A 4R9MA 2G3AA 3V8IA 5F48A 1KUYA 3SHPA 4KUAA 1I1DA 3S6GA 2P0WA 1Z4EA 4YFJA 2JEVA 2PRBA 3EO4A 4JD6A 4RS2A 4F0YA 2G0BA 2D4PA 2BSWA 2ZW7A 2B4DA 1Q2CA 4GS4A 4QBJA 5I0CA 3FIXA 1ON0A 2EUIA 3EXNA 4PK2A 4Y49B 4J3GA 3DDDA 1YX0A 4E2AA 2PR8A 4KOVA 3K9UA 1KUVA 4KORA 4H6UA 2OZGA 3FB3A 1UFHA 2ZW4A 3EY5A 2Q44A 5IV0A 1QSTA 2R8VA 2AE6A 4XNHC 2FIAA 2VZZA 3R95A 3TE4A 3LODA 3I3GA 2BL1A 4MI4A 4MY0A 2OB0A 2OH1A 2Y0MA 2PQ8A 4MBUA 4UA3A 4ONUA 1RXTA 3F5BA 2WPWA 1IIDA 2B58A 4OLLA 1Z9UA 1N71A 4JWPA 4LX9A 4CRZB 2PC1A 2GANA 4R3KA 2HUZA 3KKWA 1NE9A 2OZUA 3ZJ0A 1B87A 4KOTA 1S7NA 2RC4A 1FY7A 4JXRA 2B4BA 4JLYA 4NCZA 3F0AA 3N7ZA 4MJ8A 3UY5A 3GYAA 2FCKA 3FXTA 3I9SA 4R57A 3D3SA 2CY2A 4KLVA 3S6FA 3P2FA 4KOWA 5HMNA 3RYOA 4B5PA 4UWJA 2QMLA 4H6ZA 4M85A 3CXSA 3B8GA 3SXNA 2Z11A 2Z0ZA 3VWDA 5EC4A 2ZXVA 1IYKA 1CM0A 4M3SA 1XMTA 2KCWA 4OAEA 2GIVA 1MK4A 4ORFA 2OZHA 3F8KA 4PV6A 2ZPAA 4ZBGA 2ARHA 2I79A 4K30A 2GE3A 1BOBA 2DXQA 4XPDB 5DWNA 1U6MA 2B3VA 4DNCA 1P0HA 3GKRA 4F6AA 2ZW6A 3TCVA 1OZPA 2HV2A 4HNXB 2J8MA 1LRZA 2IL4A 1MJAA 3FNCA 1QSNA 2JDDA 3TFYA 5DWMA 4HNYB 4JXQA 1Y9KA 2CNTA 1PUAA 3G3SA 4JJXA 1S60A 1YVKA 3JVNA 4KOYA 3QAHA 1MJBA 1M44A 2VBQA 2Q7BA 3JUWA 5EBVA 4OADA 1P4NA 4HNWB 1M1DA 1VKCA 4HKFA 4UBRA 4AVAA 3R9GA 1IYLA 3PP9A 4PSWA 3P2HA 3DR6A 4AG7A 1S7LA 4PK3A 2Q4VA 3IWGA 4B5OA 4QB9A 2VQYA 3BJ8A 5C82A 1R57A 2P6EA 2FXFA 2OU2A 5H86A 4YGOA 2CNMA 4FD5A 1M4GA 2D4OA 4KVME 1GHEA 1K4JA 3NE7A 3FYNA 3T90A 1I21A 4R3LA 3TTHA 2JDCA 4AB7A 4L8AA 2K5TA 2Z10A 1YLEA 4L89A 2P6GA 1RO5A 3TO7A 1BO4A 1KZFA 3BJ7A 2O28A 5F49A 3E0KA 4CS0B 2R1IA 2QECA 4U5YA 2QIRA 3TT2A 4NEXA 2P6FA 1YVOA 1QSOA 2FL4A 4Y49C 4E8OA 2X7BA 4CRYB 4U9ZA 3EFAA 3DSBA 2J8NA 2VI7A 1S5KA 1Z4RA 1PU9A 1YREA 1B6BA
chains in the Genus database with same CATH superfamily
4IUSA 5F09A 3FF3A 1R3NA 1HEEA 4XNHB 4MY3A 3PEIA 3RNZA 1J4JA 4CYNA 2PJ9A 2WUUA 3C26A 5HH1A 4M6GA 4XPLA 1Z8XA 5ISVA 3KI9A 2Q0YA 2ANPA 2PJ8A 3WC7A 4QVTA 1F57A 5CNPA 4A39A 4RUHA 2EK9A 4P4JA 4X5KA 3S6HA 2PJ3A 3D68A 4ZY0A 2B5GA 1ZG9A 2B5GB 4XPKA 3PGPA 2FS5A 5H84A 4B13A 2FIWA 1XIXA 2XEIA 4NGPA 5F47A 5LYIA 5KTCA 3DGVA 4Q38A 3R96A 3GIUA 4KSFA 4KOXA 4BMHA 1AMPA 2R98A 1Y7EA 3PBEA 1ZG8A 2A4NA 3SJGA 5I4MA 1BPNA 2WSAA 3D4UA 4EVYA 1YQEA 2Q51A 1ELLP 5GCNA 4II9A 2DPSA 2AFWA 2F5IA 5D8NA 3TOAA 2JBKA 3S6KA 1ARMA 3FRMA 3IFEA 3D2PA 3T8WA 3CZXA 4UCMA 2WPXA 3JRUA 3B3TA 4AVCA 3D7GA 2OR4A 4OC4A 4W9YA 3D67A 4LQ6A 4NGSA 3IO1A 5D29A 4YWYA 4NGQA 5IX3A 4UEEA 3VH9A 4NF1A 3SI0A 5K8OA 3PB9X 4MHDA 4UEFA 2B3UA 2REFA 5K8NA 2FE7A 4NXYA 4FD6A 4EFDA 2ZEHA 2H5MA 1CP6A 5G1ZA 3VWEA 1QMUA 2QVPA 5DS0A 1Y7RA 3HUVA 3PZJA 4AXVA 4U9YA 3ZZIA 1Z8LA 2EVNA 2ZEPA 2Q43A 2DEAA 2B4DB 4MFZA 4LQGA 4C7HA 4YRHA 3PB7X 5EMIA 4CAEA 5J8CA 2FT0A 2JLMA 2Q4ZA 4NSQA 2AFZA 3IJ3A 3W6SA 2CF4A 2GU2A 2AJ6A 3T9YA 4OKOA 4CPAA 1S3ZA 4P6YA 1ARLA 1QSMA 4FWUA 4FD7A 5G22A 5KTAA 4CYQA 4BBHA 5JQ4A 3SJEA 4TNUA 4ONWA 1IGBA 4AVBA 1F2OA 2YNEA 3I1UA 2PR1A 4KOTA 5F46A 2R7HA 4FD4A 2CTCA 4ZY2A 4A33A 2Z3LA 4ZGYB 3DNSA 1QQ9A 2RB7A 4KVXA 3R9EA 3WR7A 2DF5A 4M6IA 4PSXA 3S9LA 1X10A 2VZYA 1QSRA 1M4DA 3CXQA 1JQGA 3N5FA 2ZW5A 1YSJA 4DYOA 1BAVA 4FAIA 1NSAA 3TOBA 3FBUA 1L0CA 3NH4A 3W6XA 3BI1A 3V7ZA 4RI1A 4C68A 1VHSA 3ISZA 4IF5A 3B2YA 1CPXA 2VEZA 3B3SA 3DR8A 2PJ6A 3IU1A 5ELYA 1KUXA 3LD2A 1F2PA 2FSRA 1MJ9A 2ZOGA 4IAVA 4CAXA 4KVOE 4KSAA 4CAVA 3KGQA 5LRGA 4ZYQA 1YR0A 2BUEA 2Q04A 4OC0A 2CTBA 5JM6A 1AYEA 2NMTA 3MGDA 2PJAA 4KZTA 3D7FA 3ISXA 4NGNA 4P4DA 4XPDC 2V77A 4R6TA 4UEZA 3GY9A 4KUBA 5LYDA 2ATRA 2AFXA 3EC4A 1WWZA 1X12A 1Y9WA 2HC9A 2NSMA 2CNSA 3TO6A 4QUSA 3H8GA 2C27A 1LANA 4NGRA 4IK2A 3W91A 2CIJA 3KL9A 3R1KA 3G8WA 5E96A 2J9AA 2POKA 4KSIA 4E0AA 3SXOA 4H89A 4P45A 1RTQA 1PCAA 2G3TA 4B10A 5K8MA 5KTDA 3QB8A 2ZEEA 3TO9A 3IGRA 1I12A 3KHXA 4X3RA 5JPHA 4MHYA 1ELMP 3D2MA 4IHMA 4CGOA 4QC6A 2BEIA 2PSWA 2Q4YA 4R87A 2O53A 2PVWA 1TF8A 1IB1E 4PXBA 1VHOA 4C2XA 1SQHA 4MCRA 1XF8A 1FNOA 3B3WA 1S7FA 3IWWA 2PE3A 4KLWA 2CXAA 1V0CA 2XEGA 3S9MA 1NSLA 4FBEA 4PPZA 2YGWA 4UFVA 1XFOA 3NH8A 5C88A 2HB6A 4B5PB 2ZEFA 4JZ0A 4UWIA 2I00A 4BD9A 1LAPA 1XEBA 4I49A 1Q7LA 3CDXA 4LUAA 4OC1A 4RN7A 3R9FA 5JH9A 1M4IA 4R7MA 4UIBA 3JTKA 3RZAA 2HQYA 1XE4A 4BINA 4CYOA 7CPAA 4KOUA 2BO9A 4PXEA 1CJWA 4AG9A 2F8HA 2PDOA 4H2KA 2FVGA 3MRUA 5FVJA 3SJXA 3BLNA 4NFRA 2YNDA 3CXPA 3IIBA 4MXUA 4NGMA 3IU2A 2PJ5A 1YGHA 2C6GA 4C2YA 2J8RA 4KOSA 3OWCA 3PB6X 4OC5A 2REEA 1WK4A 2Z3OA 3D8PA 3D7HA 4UFWA 4CAWA 1YK3A 4C7IA 1S7KA 4X2TA 1NMTA 1IICA 1Z2LA 4P4IA 1TIQA 2VXKA 5J8FA 1Q2YA 1Q2DA 2ZOFA 3H4QA 1XRYA 5IB0A 3GB0A 4R9MA 2G3AA 3D66A 1LCPA 3V8IA 4Q7AA 5F48A 1JWQA 4MHZA 1KUYA 3D7DA 4KUAA 3SHPA 1I1DA 1TKHA 3S6GA 2P0WA 1Z4EA 4YFJA 2JEVA 3KR4A 2PRBA 1H8LA 5HXDA 3EO4A 3IWEA 4HPSA 4JD6A 4RS2A 4F0YA 3SI1A 5CPAA 2G0BA 5AG7A 4R8FA 3WC6A 2D4PA 4GXHA 4NJQA 2BSWA 2ZW7A 4PQAA 2B4DA 2ZEMA 1Q2CA 5AG4A 3FX6A 4GS4A 4KS9A 3KQXA 3KASA 4QBJA 1YMEA 5I0CA 3FIXA 4MCPA 5G20A 5K8PA 1ON0A 2EUIA 3EXNA 4PK2A 4Y49B 3K2KA 2OOTA 2I3CA 3H5ZA 4DJLA 1GYTA 3DDDA 4J3GA 5LYFA 3DLJA 3PB4X 2PJBA 2AFSA 1YX0A 2PIZA 2PR8A 4KOVA 4ZX9A 4E2AA 3K9UA 1Y0RA 1KUVA 4CGLA 4WJBA 3FEDA 4KORA 4H6UA 2PIYA 2OZGA 2PJ2A 3FB3A 3MN8A 1UFHA 4DUKA 4P4EA 1LAMA 3B3CA 1Z5RA 3WABA 4B14A 3PRTA 2ZW4A 4A31A 3EY5A 2Q44A 4CGMA 1QSTA 5IV0A 2BOAA 2R8VA 4A38A 2AE6A 4XNHC 2FIAA 3PFEA 2VZZA 4F9UA 3QAYA 2NYQA 4K3NA 2C6PA 1IY7A 2V8VA 3R95A 1ZG7A 3TE4A 1YW6A 3LODA 3I3GA 4O23A 2BL1A 2Q7SA 4B11A 3RAMA 2O4HA 1DTDA 4MI4A 4MY0A 2PJ7A 3CT9A 1OBRA 2V8HA 5LRJA 8CPAA 2OB0A 2OH1A 2PJ1A 1TXRA 2PQ8A 2Y0MA 4MBUA 3B35A 3IC1A 3VATA 4FUUA 4ONUA 4UA3A 1RXTA 4M6HA 3F5BA 2ZENA 2WPWA 3CPAA 3FVLA 1IIDA 2PJCA 4F0XA 3KQZA 2B58A 2QJ8A 3KR5A 4OLLA 4MFQA 3H8FA 4ZX8A 1Z9UA 2IQ6A 5IB9A 2VL1A 4A30A 1N71A 4JWPA 5THWA 2EO8A 4LX9A 4CRZB 2PC1A 2GANA 4MHPA 3FMCA 1ZO0A 1CPSA 2HUZA 4R3KA 3KKWA 2IMOA 1NE9A 2OZUA 4UCNA 3ZJ0A 2QYVA 1B87A 3LACA 1S7NA 2RC4A 1FY7A 2ABZA 2WZNA 2AFOA 3QNVA 2B4BA 4JXRA 5HVFA 4JLYA 2Z3MA 1CX8A 3F0AA 3N7ZA 4MJ8A 4NCZA 3UY5A 4A2ZA 3GYAA 1EE3P 2ZEOA 2FCKA 3FXTA 3I9SA 4R57A 3D3SA 3NFZA 2JEWA 3PB8X 2CY2A 4KLVA 4MFKA 3BHXA 1R43A 3LWUA 3KHZA 3P2FA 4KOWA 4JYWA 3S6FA 5HMNA 3RYOA 3TX8A 4B5PA 4UWJA 2QMLA 4H6ZA 4UCPA 2ZELA 4M85A 3CXSA 3B8GA 3SXNA 2Z11A 4MMOA 2Z0ZA 4X8IA 3VWDA 4NGTA 5EC4A 4MCSA 4MHNA 1UWYA 1XJOA 3GLJA 2ZXVA 4OC2A 1IYKA 1CM0A 4Q36A 4CAFA 4M3SA 1XMTA 1M4LA 4F8ZA 1TKFA 2KCWA 2EWBA 2GIVA 2YNCA 4OAEA 4TWEA 3WC5A 1MK4A 4ORFA 2OZHA 3B3VA 3F8KA 1TF9A 4PV6A 2ZPAA 1XMBA 4EMEA 1A2ZA 4R76A 1PYTB 3FECA 3NH5A 4ZBGA 3L2NA 2ARHA 5AG5A 2I79A 4K30A 3VARA 2GE3A 1BOBA 2DXQA 4UFXA 4XPDB 4A32A 5DWNA 1U6MA 2B3VA 2PJ4A 3S9NA 2G9DA 2V8GA 4DNCA 1P0HA 4B12A 3GKRA 5BWAB 4F6AA 2ZW6A 4ZY1A 3TCVA 1OZPA 4C2ZA 1ZLHA 2HV2A 4MFJA 2PCUA 4HNXB 2J8MA 5G21A 1LRZA 2IL4A 1MJAA 3FNCA 4GM5A 4B6ZA 1QSNA 2JDDA 3TFYA 5DWMA 4HNYB 4G1PA 4JXQA 4OIDA 4P4FA 1AUGA 3TC8A 1Y9KA 2CNTA 1PUAA 1Z8WA 2EBJA 1CP7A 2PRQA 3HLPA 4OIWA 2XEFA 1BLLE 3G3SA 4A37A 4JJXA 1S60A 2ZEGA 2ZEDA 3FH4A 1YVKA 3IEHA 1CG2A 3JVNA 2RFHA 3FEEA 3QAHA 4KOYA 5AGEA 1MJBA 5JGFA 3A9LA 1M44A 2VBQA 1Z8TA 2Q7BA 3SJFA 2C1CA 3PFOA 3JUWA 2ODFA 4OC3A 5EBVA 1KWMA 4OADA 1P4NA 2GLJA 4HNWB 1M1DA 1VKCA 4EWTA 4HKFA 4UBRA 2AFMA 4AVAA 2PVVA 3R9GA 1IYLA 5LYLA 3PP9A 4PSWA 3P2HA 3DR6A 3NA6A 4P10A 4AG7A 1BPMA 1HDQA 5HVGA 4MCQA 3H8EA 1S7LA 3GUXA 3KZWA 1LFWA 4F9VA 1TKJA 4PK3A 1IU8A 2Q4VA 5A28A 3IWGA 4OMEA 4B5OA 4QB9A 2WYRA 2XEJA 4ZI6A 2VQYA 2Z3NA 3BJ8A 5C82A 1R57A 2P6EA 2FXFA 2OU2A 5H86A 5HVHA 2AFUA 5A27A 4YGOA 2CNMA 2Z3KA 4FD5A 2GLFA 1M4GA 3WT4A 4CGPA 2D4OA 1VIXA 4KVME 4MFLA 2YNCC 3NE8A 4UIAA 1GHEA 1K4JA 3NE7A 3SI2A 4CYPA 3FYNA 3B7IA 3T90A 1I21A 4R3LA 1ZLIA 3TTHA 2DPTA 2JDCA 4NJRA 4AB7A 4L8AA 2K5TA 1YLOA 3V38A 6CPAA 2GFQA 1YLEA 2Z10A 1XOVA 2P6GA 4L89A 4MRIA 1RO5A 2JBJA 1XBUA 3PBBA 1Y0YA 3LMSA 3TO7A 1BO4A 1KZFA 2Z3PA 2F7VA 1IOIA 1DE4C 1IOFA 4MFPA 3BJ7A 2GREA 1YW4A 2O28A 5F49A 3E0KA 3RO0A 4CS0B 1VGYA 1FT7A 4A94A 5LRKA 4OP4A 2C6CA 2R1IA 3CPXA 4P44A 2PJ0A 2QECA 2V8DA 4U5YA 1VHEA 3BI0A 2QIRA 5CBMA 3TT2A 3FJUA 4NEXA 2EK8A 3BXMA 2P6FA 1YVOA 1QSOA 2FL4A 4YU9A 4UF4A 4Y49C 1CBXA 5J1QA 4WWVA 4E8OA 2BCOA 3K9TA 1LOKA 2X7BA 3RBUA 1HDUA 2IJZA 4P4BA 4PXCA 4PXDA 5AG6A 4U9ZA 4CRYB 4Z65A 3DSBA 2J8NA 2VI7A 3EFAA 4CGNA 1S5KA 1Z4RA 1PU9A 1YREA 1B6BA 4A95A
chains in the Genus database with same CATH topology
4IUSA 4XNHB 4MY3A 4CYNA 1J4JA 2WUUA 3C26A 5HH1A 4XPLA 5ISVA 2Q0YA 4QVTA 5CNPA 4X5KA 3S6HA 2B5GA 2B5GB 4XPKA 3PGPA 2FS5A 5H84A 4B13A 2FIWA 1XIXA 5F47A 5KTCA 4Q38A 3R96A 4KSFA 4KOXA 4BMHA 2R98A 2A4NA 2WSAA 4EVYA 4II9A 5GCNA 2DPSA 2F5IA 3TOAA 3S6KA 3FRMA 3D2PA 4UCMA 2WPXA 4AVCA 5IX3A 4NF1A 4MHDA 2B3UA 2REFA 2FE7A 4NXYA 4FD6A 2H5MA 5G1ZA 3VWEA 1Y7RA 3PZJA 4U9YA 3ZZIA 2EVNA 2B4DB 4MFZA 4C7HA 4YRHA 4CAEA 5J8CA 2FT0A 2JLMA 4NSQA 3W6SA 2AJ6A 3T9YA 1S3ZA 1QSMA 4FD7A 5G22A 5KTAA 4CYQA 4BBHA 5JQ4A 4AVBA 2YNEA 2PR1A 5F46A 2R7HA 4FD4A 4A33A 2Z3LA 4ZGYB 3DNSA 4KVXA 3R9EA 3WR7A 4PSXA 2VZYA 1QSRA 1M4DA 3CXQA 2ZW5A 3TOBA 3FBUA 1L0CA 3W6XA 4RI1A 4C68A 1VHSA 4IF5A 3DR8A 2VEZA 3IU1A 1KUXA 3LD2A 2FSRA 1MJ9A 4CAXA 4KVOE 4KSAA 4CAVA 1YR0A 2BUEA 2Q04A 2NMTA 3MGDA 4KZTA 4XPDC 3GY9A 4KUBA 2ATRA 3EC4A 1WWZA 1Y9WA 2CNSA 3TO6A 4QUSA 2C27A 3W91A 3R1KA 3G8WA 5E96A 4E0AA 3SXOA 4H89A 2G3TA 4B10A 5KTDA 3QB8A 3TO9A 3IGRA 1I12A 5JPHA 3D2MA 4CGOA 4QC6A 2BEIA 2PSWA 2Q4YA 4R87A 1IB1E 4C2XA 1SQHA 1XF8A 1S7FA 4KLWA 2CXAA 1V0CA 1NSLA 2YGWA 4UFVA 5C88A 4B5PB 4UWIA 2I00A 4I49A 1XEBA 4LUAA 3R9FA 1M4IA 3JTKA 2HQYA 1XE4A 4CYOA 4KOUA 1CJWA 4AG9A 5FVJA 2PDOA 3BLNA 2YNDA 3CXPA 3IU2A 1YGHA 4C2YA 2J8RA 4KOSA 3OWCA 2REEA 1WK4A 2Z3OA 3D8PA 4UFWA 4CAWA 1YK3A 4C7IA 1S7KA 1NMTA 1IICA 1TIQA 2VXKA 5J8FA 1Q2YA 1Q2DA 3H4QA 5IB0A 4R9MA 2G3AA 3V8IA 5F48A 1KUYA 3SHPA 4KUAA 1I1DA 3S6GA 2P0WA 1Z4EA 4YFJA 2JEVA 2PRBA 3EO4A 3IWEA 4JD6A 4RS2A 4F0YA 2G0BA 5AG7A 2D4PA 2BSWA 2ZW7A 2B4DA 1Q2CA 5AG4A 4GS4A 4KS9A 4QBJA 5I0CA 3FIXA 5G20A 1ON0A 2EUIA 3EXNA 4PK2A 4Y49B 3H5ZA 3DDDA 4J3GA 1YX0A 4E2AA 2PR8A 4KOVA 3K9UA 1KUVA 4CGLA 4KORA 4H6UA 2OZGA 3FB3A 1UFHA 4B14A 2ZW4A 4A31A 3EY5A 2Q44A 4CGMA 1QSTA 5IV0A 2R8VA 2AE6A 4XNHC 2FIAA 2VZZA 3R95A 3TE4A 3LODA 3I3GA 2BL1A 4B11A 4MI4A 4MY0A 2OB0A 2OH1A 2Y0MA 2PQ8A 4MBUA 4UA3A 4ONUA 1RXTA 3F5BA 2WPWA 1IIDA 4F0XA 2B58A 4OLLA 4MFQA 1Z9UA 4A30A 1N71A 4JWPA 4LX9A 4CRZB 2PC1A 2GANA 1ZO0A 4R3KA 2HUZA 3KKWA 1NE9A 2OZUA 4UCNA 3ZJ0A 1B87A 4KOTA 1S7NA 2RC4A 1FY7A 4JXRA 2B4BA 4JLYA 2Z3MA 3F0AA 3N7ZA 4MJ8A 4NCZA 4A2ZA 3UY5A 3GYAA 2FCKA 3FXTA 3I9SA 4R57A 3D3SA 2CY2A 4KLVA 4MFKA 3S6FA 3P2FA 4KOWA 5HMNA 3RYOA 4B5PA 4UWJA 2QMLA 4H6ZA 4UCPA 4M85A 3CXSA 3B8GA 3SXNA 2Z11A 2Z0ZA 3VWDA 5EC4A 2ZXVA 4Q36A 1IYKA 1CM0A 4CAFA 4M3SA 1XMTA 2KCWA 2YNCA 2GIVA 4OAEA 1MK4A 4ORFA 2OZHA 3F8KA 4PV6A 2ZPAA 4ZBGA 2ARHA 5AG5A 2I79A 4K30A 2GE3A 1BOBA 2DXQA 4UFXA 4XPDB 4A32A 5DWNA 1U6MA 2B3VA 4DNCA 1P0HA 4B12A 3GKRA 5BWAB 4F6AA 2ZW6A 3TCVA 1OZPA 4C2ZA 2HV2A 4MFJA 4HNXB 5G21A 2J8MA 1LRZA 2IL4A 1MJAA 3FNCA 1QSNA 2JDDA 3TFYA 5DWMA 4HNYB 4JXQA 1Y9KA 2CNTA 1PUAA 3G3SA 4JJXA 1S60A 1YVKA 3JVNA 4KOYA 3QAHA 5AGEA 1MJBA 3A9LA 1M44A 2VBQA 2Q7BA 3JUWA 5EBVA 4OADA 1P4NA 4HNWB 1M1DA 1VKCA 4HKFA 4UBRA 4AVAA 3R9GA 1IYLA 3PP9A 4PSWA 3P2HA 3DR6A 4AG7A 1S7LA 4PK3A 2Q4VA 5A28A 3IWGA 4B5OA 4QB9A 2VQYA 2Z3NA 3BJ8A 5C82A 1R57A 2P6EA 2FXFA 2OU2A 5H86A 5A27A 4YGOA 2CNMA 2Z3KA 4FD5A 4CGPA 1M4GA 2D4OA 4KVME 4MFLA 2YNCC 1GHEA 1K4JA 3NE7A 4CYPA 3FYNA 3T90A 1I21A 4R3LA 3TTHA 2DPTA 2JDCA 4AB7A 4L8AA 2K5TA 2Z10A 1YLEA 2P6GA 4L89A 1RO5A 3TO7A 1BO4A 1KZFA 2Z3PA 4MFPA 3BJ7A 2O28A 5F49A 3E0KA 4CS0B 2R1IA 2QECA 4U5YA 2QIRA 3TT2A 4NEXA 2P6FA 1YVOA 1QSOA 2FL4A 4Y49C 4E8OA 2X7BA 5AG6A 4CRYB 4U9ZA 3EFAA 3DSBA 2J8NA 2VI7A 4CGNA 1S5KA 1Z4RA 1PU9A 1YREA 1B6BA 4A95A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IUS A;  4XNH B;  4MY3 A;  1J4J A;  5HH1 A;  3C26 A;  4XPL A;  5ISV A;  2Q0Y A;  4QVT A;  5CNP A;  4X5K A;  3S6H A;  2B5G A;  2B5G B;  4XPK A;  3PGP A;  2FS5 A;  5H84 A;  2FIW A;  1XIX A;  5F47 A;  5KTC A;  3R96 A;  4KOX A;  4BMH A;  2R98 A;  2A4N A;  4EVY A;  4II9 A;  5GCN A;  2F5I A;  3TOA A;  3S6K A;  3FRM A;  3D2P A;  2WPX A;  4AVC A;  5IX3 A;  4NF1 A;  4MHD A;  2B3U A;  2REF A;  2FE7 A;  4NXY A;  4FD6 A;  2H5M A;  3VWE A;  1Y7R A;  3PZJ A;  4U9Y A;  3ZZI A;  2EVN A;  2B4D B;  4YRH A;  5J8C A;  2FT0 A;  2JLM A;  4NSQ A;  3W6S A;  2AJ6 A;  3T9Y A;  1S3Z A;  1QSM A;  4FD7 A;  5KTA A;  5JQ4 A;  4AVB A;  2PR1 A;  5F46 A;  2R7H A;  4FD4 A;  3DNS A;  4KVX A;  3R9E A;  3WR7 A;  4PSX A;  2VZY A;  1QSR A;  1M4D A;  3CXQ A;  2ZW5 A;  3TOB A;  3FBU A;  1L0C A;  3W6X A;  4RI1 A;  1VHS A;  4IF5 A;  3DR8 A;  2VEZ A;  1KUX A;  3LD2 A;  2FSR A;  1MJ9 A;  4CAX A;  4KVO E;  4CAV A;  1YR0 A;  2BUE A;  2Q04 A;  2NMT A;  3MGD A;  4KZT A;  4XPD C;  3GY9 A;  4KUB A;  2ATR A;  3EC4 A;  1WWZ A;  1Y9W A;  2CNS A;  3TO6 A;  4QUS A;  2C27 A;  3W91 A;  3R1K A;  3G8W A;  5E96 A;  4E0A A;  3SXO A;  4H89 A;  2G3T A;  5KTD A;  3QB8 A;  3TO9 A;  3IGR A;  1I12 A;  5JPH A;  3D2M A;  4QC6 A;  2BEI A;  2PSW A;  2Q4Y A;  4R87 A;  1IB1 E;  1SQH A;  1XF8 A;  1S7F A;  4KLW A;  1V0C A;  1NSL A;  5C88 A;  4B5P B;  4UWI A;  2I00 A;  4I49 A;  1XEB A;  4LUA A;  3R9F A;  1M4I A;  2HQY A;  1XE4 A;  4KOU A;  1CJW A;  4AG9 A;  5FVJ A;  2PDO A;  3BLN A;  3CXP A;  1YGH A;  2J8R A;  4KOS A;  3OWC A;  2REE A;  1WK4 A;  3D8P A;  4CAW A;  1YK3 A;  1S7K A;  1NMT A;  1IIC A;  1TIQ A;  2VXK A;  5J8F A;  1Q2Y A;  1Q2D A;  3H4Q A;  5IB0 A;  4R9M A;  2G3A A;  3V8I A;  5F48 A;  1KUY A;  3SHP A;  4KUA A;  1I1D A;  3S6G A;  2P0W A;  1Z4E A;  4YFJ A;  2JEV A;  2PRB A;  3EO4 A;  4JD6 A;  4RS2 A;  4F0Y A;  2G0B A;  2D4P A;  2BSW A;  2ZW7 A;  2B4D A;  1Q2C A;  4GS4 A;  4QBJ A;  5I0C A;  3FIX A;  1ON0 A;  2EUI A;  3EXN A;  4PK2 A;  4Y49 B;  4J3G A;  3DDD A;  1YX0 A;  4E2A A;  2PR8 A;  4KOV A;  3K9U A;  1KUV A;  4KOR A;  4H6U A;  2OZG A;  3FB3 A;  1UFH A;  2ZW4 A;  3EY5 A;  2Q44 A;  5IV0 A;  1QST A;  2R8V A;  2AE6 A;  4XNH C;  2FIA A;  2VZZ A;  3R95 A;  3TE4 A;  3LOD A;  3I3G A;  2BL1 A;  4MI4 A;  4MY0 A;  2OB0 A;  2OH1 A;  2Y0M A;  2PQ8 A;  4MBU A;  4UA3 A;  4ONU A;  1RXT A;  3F5B A;  2WPW A;  1IID A;  2B58 A;  4OLL A;  1Z9U A;  1N71 A;  4JWP A;  4LX9 A;  4CRZ B;  2PC1 A;  2GAN A;  4R3K A;  2HUZ A;  3KKW A;  1NE9 A;  2OZU A;  3ZJ0 A;  1B87 A;  4KOT A;  1S7N A;  2RC4 A;  1FY7 A;  4JXR A;  2B4B A;  4JLY A;  4NCZ A;  3F0A A;  3N7Z A;  4MJ8 A;  3UY5 A;  3GYA A;  2FCK A;  3FXT A;  3I9S A;  4R57 A;  3D3S A;  2CY2 A;  4KLV A;  3S6F A;  3P2F A;  4KOW A;  5HMN A;  3RYO A;  4B5P A;  4UWJ A;  2QML A;  4H6Z A;  4M85 A;  3CXS A;  3B8G A;  3SXN A;  2Z11 A;  2Z0Z A;  3VWD A;  5EC4 A;  2ZXV A;  1IYK A;  1CM0 A;  4M3S A;  1XMT A;  2KCW A;  4OAE A;  2GIV A;  1MK4 A;  4ORF A;  2OZH A;  3F8K A;  4PV6 A;  2ZPA A;  4ZBG A;  2ARH A;  2I79 A;  4K30 A;  2GE3 A;  1BOB A;  2DXQ A;  4XPD B;  5DWN A;  1U6M A;  2B3V A;  4DNC A;  1P0H A;  3GKR A;  4F6A A;  2ZW6 A;  3TCV A;  1OZP A;  2HV2 A;  4HNX B;  2J8M A;  1LRZ A;  2IL4 A;  1MJA A;  3FNC A;  1QSN A;  2JDD A;  3TFY A;  5DWM A;  4HNY B;  4JXQ A;  1Y9K A;  2CNT A;  1PUA A;  3G3S A;  4JJX A;  1S60 A;  1YVK A;  3JVN A;  4KOY A;  3QAH A;  1MJB A;  1M44 A;  2VBQ A;  2Q7B A;  3JUW A;  5EBV A;  4OAD A;  1P4N A;  4HNW B;  1M1D A;  1VKC A;  4HKF A;  4UBR A;  4AVA A;  3R9G A;  1IYL A;  3PP9 A;  4PSW A;  3P2H A;  3DR6 A;  4AG7 A;  1S7L A;  4PK3 A;  2Q4V A;  3IWG A;  4B5O A;  4QB9 A;  2VQY A;  3BJ8 A;  5C82 A;  1R57 A;  2P6E A;  2FXF A;  2OU2 A;  5H86 A;  4YGO A;  2CNM A;  4FD5 A;  1M4G A;  2D4O A;  4KVM E;  1GHE A;  1K4J A;  3NE7 A;  3FYN A;  3T90 A;  1I21 A;  4R3L A;  3TTH A;  2JDC A;  4AB7 A;  4L8A A;  2K5T A;  2Z10 A;  1YLE A;  4L89 A;  2P6G A;  1RO5 A;  3TO7 A;  1BO4 A;  1KZF A;  3BJ7 A;  2O28 A;  5F49 A;  3E0K A;  4CS0 B;  2R1I A;  2QEC A;  4U5Y A;  2QIR A;  3TT2 A;  4NEX A;  2P6F A;  1YVO A;  1QSO A;  2FL4 A;  4Y49 C;  4E8O A;  2X7B A;  4CRY B;  4U9Z A;  3EFA A;  3DSB A;  2J8N A;  2VI7 A;  1S5K A;  1Z4R A;  1PU9 A;  1YRE A;  1B6B A; 
#chains in the Genus database with same CATH topology
 4IUS A;  5F09 A;  3FF3 A;  1R3N A;  1HEE A;  4XNH B;  4MY3 A;  3PEI A;  3RNZ A;  1J4J A;  4CYN A;  2PJ9 A;  2WUU A;  3C26 A;  5HH1 A;  4M6G A;  4XPL A;  1Z8X A;  5ISV A;  3KI9 A;  2Q0Y A;  2ANP A;  2PJ8 A;  3WC7 A;  4QVT A;  1F57 A;  5CNP A;  4A39 A;  4RUH A;  2EK9 A;  4P4J A;  4X5K A;  3S6H A;  2PJ3 A;  3D68 A;  4ZY0 A;  2B5G A;  1ZG9 A;  2B5G B;  4XPK A;  3PGP A;  2FS5 A;  5H84 A;  4B13 A;  2FIW A;  1XIX A;  2XEI A;  4NGP A;  5F47 A;  5LYI A;  5KTC A;  3DGV A;  4Q38 A;  3R96 A;  3GIU A;  4KSF A;  4KOX A;  4BMH A;  1AMP A;  2R98 A;  1Y7E A;  3PBE A;  1ZG8 A;  2A4N A;  3SJG A;  5I4M A;  1BPN A;  2WSA A;  3D4U A;  4EVY A;  1YQE A;  2Q51 A;  1ELL P;  5GCN A;  4II9 A;  2DPS A;  2AFW A;  2F5I A;  5D8N A;  3TOA A;  2JBK A;  3S6K A;  1ARM A;  3FRM A;  3IFE A;  3D2P A;  3T8W A;  3CZX A;  4UCM A;  2WPX A;  3JRU A;  3B3T A;  4AVC A;  3D7G A;  2OR4 A;  4OC4 A;  4W9Y A;  3D67 A;  4LQ6 A;  4NGS A;  3IO1 A;  5D29 A;  4YWY A;  4NGQ A;  5IX3 A;  4UEE A;  3VH9 A;  4NF1 A;  3SI0 A;  5K8O A;  3PB9 X;  4MHD A;  4UEF A;  2B3U A;  2REF A;  5K8N A;  2FE7 A;  4NXY A;  4FD6 A;  4EFD A;  2ZEH A;  2H5M A;  1CP6 A;  5G1Z A;  3VWE A;  1QMU A;  2QVP A;  5DS0 A;  1Y7R A;  3HUV A;  3PZJ A;  4AXV A;  4U9Y A;  3ZZI A;  1Z8L A;  2EVN A;  2ZEP A;  2Q43 A;  2DEA A;  2B4D B;  4MFZ A;  4LQG A;  4C7H A;  4YRH A;  3PB7 X;  5EMI A;  4CAE A;  5J8C A;  2FT0 A;  2JLM A;  2Q4Z A;  4NSQ A;  2AFZ A;  3IJ3 A;  3W6S A;  2CF4 A;  2GU2 A;  2AJ6 A;  3T9Y A;  4OKO A;  4CPA A;  1S3Z A;  4P6Y A;  1ARL A;  1QSM A;  4FWU A;  4FD7 A;  5G22 A;  5KTA A;  4CYQ A;  4BBH A;  5JQ4 A;  3SJE A;  4TNU A;  4ONW A;  1IGB A;  4AVB A;  1F2O A;  2YNE A;  3I1U A;  2PR1 A;  4KOT A;  5F46 A;  2R7H A;  4FD4 A;  2CTC A;  4ZY2 A;  4A33 A;  2Z3L A;  4ZGY B;  3DNS A;  1QQ9 A;  2RB7 A;  4KVX A;  3R9E A;  3WR7 A;  2DF5 A;  4M6I A;  4PSX A;  3S9L A;  1X10 A;  2VZY A;  1QSR A;  1M4D A;  3CXQ A;  1JQG A;  3N5F A;  2ZW5 A;  1YSJ A;  4DYO A;  1BAV A;  4FAI A;  1NSA A;  3TOB A;  3FBU A;  1L0C A;  3NH4 A;  3W6X A;  3BI1 A;  3V7Z A;  4RI1 A;  4C68 A;  1VHS A;  3ISZ A;  4IF5 A;  3B2Y A;  1CPX A;  2VEZ A;  3B3S A;  3DR8 A;  2PJ6 A;  3IU1 A;  5ELY A;  1KUX A;  3LD2 A;  1F2P A;  2FSR A;  1MJ9 A;  2ZOG A;  4IAV A;  4CAX A;  4KVO E;  4KSA A;  4CAV A;  3KGQ A;  5LRG A;  4ZYQ A;  1YR0 A;  2BUE A;  2Q04 A;  4OC0 A;  2CTB A;  5JM6 A;  1AYE A;  2NMT A;  3MGD A;  2PJA A;  4KZT A;  3D7F A;  3ISX A;  4NGN A;  4P4D A;  4XPD C;  2V77 A;  4R6T A;  4UEZ A;  3GY9 A;  4KUB A;  5LYD A;  2ATR A;  2AFX A;  3EC4 A;  1WWZ A;  1X12 A;  1Y9W A;  2HC9 A;  2NSM A;  2CNS A;  3TO6 A;  4QUS A;  3H8G A;  2C27 A;  1LAN A;  4NGR A;  4IK2 A;  3W91 A;  2CIJ A;  3KL9 A;  3R1K A;  3G8W A;  5E96 A;  2J9A A;  2POK A;  4KSI A;  4E0A A;  3SXO A;  4H89 A;  4P45 A;  1RTQ A;  1PCA A;  2G3T A;  4B10 A;  5K8M A;  5KTD A;  3QB8 A;  2ZEE A;  3TO9 A;  3IGR A;  1I12 A;  3KHX A;  4X3R A;  5JPH A;  4MHY A;  1ELM P;  3D2M A;  4IHM A;  4CGO A;  4QC6 A;  2BEI A;  2PSW A;  2Q4Y A;  4R87 A;  2O53 A;  2PVW A;  1TF8 A;  1IB1 E;  4PXB A;  1VHO A;  4C2X A;  1SQH A;  4MCR A;  1XF8 A;  1FNO A;  3B3W A;  1S7F A;  3IWW A;  2PE3 A;  4KLW A;  2CXA A;  1V0C A;  2XEG A;  3S9M A;  1NSL A;  4FBE A;  4PPZ A;  2YGW A;  4UFV A;  1XFO A;  3NH8 A;  5C88 A;  2HB6 A;  4B5P B;  2ZEF A;  4JZ0 A;  4UWI A;  2I00 A;  4BD9 A;  1LAP A;  1XEB A;  4I49 A;  1Q7L A;  3CDX A;  4LUA A;  4OC1 A;  4RN7 A;  3R9F A;  5JH9 A;  1M4I A;  4R7M A;  4UIB A;  3JTK A;  3RZA A;  2HQY A;  1XE4 A;  4BIN A;  4CYO A;  7CPA A;  4KOU A;  2BO9 A;  4PXE A;  1CJW A;  4AG9 A;  2F8H A;  2PDO A;  4H2K A;  2FVG A;  3MRU A;  5FVJ A;  3SJX A;  3BLN A;  4NFR A;  2YND A;  3CXP A;  3IIB A;  4MXU A;  4NGM A;  3IU2 A;  2PJ5 A;  1YGH A;  2C6G A;  4C2Y A;  2J8R A;  4KOS A;  3OWC A;  3PB6 X;  4OC5 A;  2REE A;  1WK4 A;  2Z3O A;  3D8P A;  3D7H A;  4UFW A;  4CAW A;  1YK3 A;  4C7I A;  1S7K A;  4X2T A;  1NMT A;  1IIC A;  1Z2L A;  4P4I A;  1TIQ A;  2VXK A;  5J8F A;  1Q2Y A;  1Q2D A;  2ZOF A;  3H4Q A;  1XRY A;  5IB0 A;  3GB0 A;  4R9M A;  2G3A A;  3D66 A;  1LCP A;  3V8I A;  4Q7A A;  5F48 A;  1JWQ A;  4MHZ A;  1KUY A;  3D7D A;  4KUA A;  3SHP A;  1I1D A;  1TKH A;  3S6G A;  2P0W A;  1Z4E A;  4YFJ A;  2JEV A;  3KR4 A;  2PRB A;  1H8L A;  5HXD A;  3EO4 A;  3IWE A;  4HPS A;  4JD6 A;  4RS2 A;  4F0Y A;  3SI1 A;  5CPA A;  2G0B A;  5AG7 A;  4R8F A;  3WC6 A;  2D4P A;  4GXH A;  4NJQ A;  2BSW A;  2ZW7 A;  4PQA A;  2B4D A;  2ZEM A;  1Q2C A;  5AG4 A;  3FX6 A;  4GS4 A;  4KS9 A;  3KQX A;  3KAS A;  4QBJ A;  1YME A;  5I0C A;  3FIX A;  4MCP A;  5G20 A;  5K8P A;  1ON0 A;  2EUI A;  3EXN A;  4PK2 A;  4Y49 B;  3K2K A;  2OOT A;  2I3C A;  3H5Z A;  4DJL A;  1GYT A;  3DDD A;  4J3G A;  5LYF A;  3DLJ A;  3PB4 X;  2PJB A;  2AFS A;  1YX0 A;  2PIZ A;  2PR8 A;  4KOV A;  4ZX9 A;  4E2A A;  3K9U A;  1Y0R A;  1KUV A;  4CGL A;  4WJB A;  3FED A;  4KOR A;  4H6U A;  2PIY A;  2OZG A;  2PJ2 A;  3FB3 A;  3MN8 A;  1UFH A;  4DUK A;  4P4E A;  1LAM A;  3B3C A;  1Z5R A;  3WAB A;  4B14 A;  3PRT A;  2ZW4 A;  4A31 A;  3EY5 A;  2Q44 A;  4CGM A;  1QST A;  5IV0 A;  2BOA A;  2R8V A;  4A38 A;  2AE6 A;  4XNH C;  2FIA A;  3PFE A;  2VZZ A;  4F9U A;  3QAY A;  2NYQ A;  4K3N A;  2C6P A;  1IY7 A;  2V8V A;  3R95 A;  1ZG7 A;  3TE4 A;  1YW6 A;  3LOD A;  3I3G A;  4O23 A;  2BL1 A;  2Q7S A;  4B11 A;  3RAM A;  2O4H A;  1DTD A;  4MI4 A;  4MY0 A;  2PJ7 A;  3CT9 A;  1OBR A;  2V8H A;  5LRJ A;  8CPA A;  2OB0 A;  2OH1 A;  2PJ1 A;  1TXR A;  2PQ8 A;  2Y0M A;  4MBU A;  3B35 A;  3IC1 A;  3VAT A;  4FUU A;  4ONU A;  4UA3 A;  1RXT A;  4M6H A;  3F5B A;  2ZEN A;  2WPW A;  3CPA A;  3FVL A;  1IID A;  2PJC A;  4F0X A;  3KQZ A;  2B58 A;  2QJ8 A;  3KR5 A;  4OLL A;  4MFQ A;  3H8F A;  4ZX8 A;  1Z9U A;  2IQ6 A;  5IB9 A;  2VL1 A;  4A30 A;  1N71 A;  4JWP A;  5THW A;  2EO8 A;  4LX9 A;  4CRZ B;  2PC1 A;  2GAN A;  4MHP A;  3FMC A;  1ZO0 A;  1CPS A;  2HUZ A;  4R3K A;  3KKW A;  2IMO A;  1NE9 A;  2OZU A;  4UCN A;  3ZJ0 A;  2QYV A;  1B87 A;  3LAC A;  1S7N A;  2RC4 A;  1FY7 A;  2ABZ A;  2WZN A;  2AFO A;  3QNV A;  2B4B A;  4JXR A;  5HVF A;  4JLY A;  2Z3M A;  1CX8 A;  3F0A A;  3N7Z A;  4MJ8 A;  4NCZ A;  3UY5 A;  4A2Z A;  3GYA A;  1EE3 P;  2ZEO A;  2FCK A;  3FXT A;  3I9S A;  4R57 A;  3D3S A;  3NFZ A;  2JEW A;  3PB8 X;  2CY2 A;  4KLV A;  4MFK A;  3BHX A;  1R43 A;  3LWU A;  3KHZ A;  3P2F A;  4KOW A;  4JYW A;  3S6F A;  5HMN A;  3RYO A;  3TX8 A;  4B5P A;  4UWJ A;  2QML A;  4H6Z A;  4UCP A;  2ZEL A;  4M85 A;  3CXS A;  3B8G A;  3SXN A;  2Z11 A;  4MMO A;  2Z0Z A;  4X8I A;  3VWD A;  4NGT A;  5EC4 A;  4MCS A;  4MHN A;  1UWY A;  1XJO A;  3GLJ A;  2ZXV A;  4OC2 A;  1IYK A;  1CM0 A;  4Q36 A;  4CAF A;  4M3S A;  1XMT A;  1M4L A;  4F8Z A;  1TKF A;  2KCW A;  2EWB A;  2GIV A;  2YNC A;  4OAE A;  4TWE A;  3WC5 A;  1MK4 A;  4ORF A;  2OZH A;  3B3V A;  3F8K A;  1TF9 A;  4PV6 A;  2ZPA A;  1XMB A;  4EME A;  1A2Z A;  4R76 A;  1PYT B;  3FEC A;  3NH5 A;  4ZBG A;  3L2N A;  2ARH A;  5AG5 A;  2I79 A;  4K30 A;  3VAR A;  2GE3 A;  1BOB A;  2DXQ A;  4UFX A;  4XPD B;  4A32 A;  5DWN A;  1U6M A;  2B3V A;  2PJ4 A;  3S9N A;  2G9D A;  2V8G A;  4DNC A;  1P0H A;  4B12 A;  3GKR A;  5BWA B;  4F6A A;  2ZW6 A;  4ZY1 A;  3TCV A;  1OZP A;  4C2Z A;  1ZLH A;  2HV2 A;  4MFJ A;  2PCU A;  4HNX B;  2J8M A;  5G21 A;  1LRZ A;  2IL4 A;  1MJA A;  3FNC A;  4GM5 A;  4B6Z A;  1QSN A;  2JDD A;  3TFY A;  5DWM A;  4HNY B;  4G1P A;  4JXQ A;  4OID A;  4P4F A;  1AUG A;  3TC8 A;  1Y9K A;  2CNT A;  1PUA A;  1Z8W A;  2EBJ A;  1CP7 A;  2PRQ A;  3HLP A;  4OIW A;  2XEF A;  1BLL E;  3G3S A;  4A37 A;  4JJX A;  1S60 A;  2ZEG A;  2ZED A;  3FH4 A;  1YVK A;  3IEH A;  1CG2 A;  3JVN A;  2RFH A;  3FEE A;  3QAH A;  4KOY A;  5AGE A;  1MJB A;  5JGF A;  3A9L A;  1M44 A;  2VBQ A;  1Z8T A;  2Q7B A;  3SJF A;  2C1C A;  3PFO A;  3JUW A;  2ODF A;  4OC3 A;  5EBV A;  1KWM A;  4OAD A;  1P4N A;  2GLJ A;  4HNW B;  1M1D A;  1VKC A;  4EWT A;  4HKF A;  4UBR A;  2AFM A;  4AVA A;  2PVV A;  3R9G A;  1IYL A;  5LYL A;  3PP9 A;  4PSW A;  3P2H A;  3DR6 A;  3NA6 A;  4P10 A;  4AG7 A;  1BPM A;  1HDQ A;  5HVG A;  4MCQ A;  3H8E A;  1S7L A;  3GUX A;  3KZW A;  1LFW A;  4F9V A;  1TKJ A;  4PK3 A;  1IU8 A;  2Q4V A;  5A28 A;  3IWG A;  4OME A;  4B5O A;  4QB9 A;  2WYR A;  2XEJ A;  4ZI6 A;  2VQY A;  2Z3N A;  3BJ8 A;  5C82 A;  1R57 A;  2P6E A;  2FXF A;  2OU2 A;  5H86 A;  5HVH A;  2AFU A;  5A27 A;  4YGO A;  2CNM A;  2Z3K A;  4FD5 A;  2GLF A;  1M4G A;  3WT4 A;  4CGP A;  2D4O A;  1VIX A;  4KVM E;  4MFL A;  2YNC C;  3NE8 A;  4UIA A;  1GHE A;  1K4J A;  3NE7 A;  3SI2 A;  4CYP A;  3FYN A;  3B7I A;  3T90 A;  1I21 A;  4R3L A;  1ZLI A;  3TTH A;  2DPT A;  2JDC A;  4NJR A;  4AB7 A;  4L8A A;  2K5T A;  1YLO A;  3V38 A;  6CPA A;  2GFQ A;  1YLE A;  2Z10 A;  1XOV A;  2P6G A;  4L89 A;  4MRI A;  1RO5 A;  2JBJ A;  1XBU A;  3PBB A;  1Y0Y A;  3LMS A;  3TO7 A;  1BO4 A;  1KZF A;  2Z3P A;  2F7V A;  1IOI A;  1DE4 C;  1IOF A;  4MFP A;  3BJ7 A;  2GRE A;  1YW4 A;  2O28 A;  5F49 A;  3E0K A;  3RO0 A;  4CS0 B;  1VGY A;  1FT7 A;  4A94 A;  5LRK A;  4OP4 A;  2C6C A;  2R1I A;  3CPX A;  4P44 A;  2PJ0 A;  2QEC A;  2V8D A;  4U5Y A;  1VHE A;  3BI0 A;  2QIR A;  5CBM A;  3TT2 A;  3FJU A;  4NEX A;  2EK8 A;  3BXM A;  2P6F A;  1YVO A;  1QSO A;  2FL4 A;  4YU9 A;  4UF4 A;  4Y49 C;  1CBX A;  5J1Q A;  4WWV A;  4E8O A;  2BCO A;  3K9T A;  1LOK A;  2X7B A;  3RBU A;  1HDU A;  2IJZ A;  4P4B A;  4PXC A;  4PXD A;  5AG6 A;  4U9Z A;  4CRY B;  4Z65 A;  3DSB A;  2J8N A;  2VI7 A;  3EFA A;  4CGN A;  1S5K A;  1Z4R A;  1PU9 A;  1YRE A;  1B6B A;  4A95 A; 
#chains in the Genus database with same CATH homology
 4IUS A;  4XNH B;  4MY3 A;  4CYN A;  1J4J A;  2WUU A;  3C26 A;  5HH1 A;  4XPL A;  5ISV A;  2Q0Y A;  4QVT A;  5CNP A;  4X5K A;  3S6H A;  2B5G A;  2B5G B;  4XPK A;  3PGP A;  2FS5 A;  5H84 A;  4B13 A;  2FIW A;  1XIX A;  5F47 A;  5KTC A;  4Q38 A;  3R96 A;  4KSF A;  4KOX A;  4BMH A;  2R98 A;  2A4N A;  2WSA A;  4EVY A;  4II9 A;  5GCN A;  2DPS A;  2F5I A;  3TOA A;  3S6K A;  3FRM A;  3D2P A;  4UCM A;  2WPX A;  4AVC A;  5IX3 A;  4NF1 A;  4MHD A;  2B3U A;  2REF A;  2FE7 A;  4NXY A;  4FD6 A;  2H5M A;  5G1Z A;  3VWE A;  1Y7R A;  3PZJ A;  4U9Y A;  3ZZI A;  2EVN A;  2B4D B;  4MFZ A;  4C7H A;  4YRH A;  4CAE A;  5J8C A;  2FT0 A;  2JLM A;  4NSQ A;  3W6S A;  2AJ6 A;  3T9Y A;  1S3Z A;  1QSM A;  4FD7 A;  5G22 A;  5KTA A;  4CYQ A;  4BBH A;  5JQ4 A;  4AVB A;  2YNE A;  2PR1 A;  5F46 A;  2R7H A;  4FD4 A;  4A33 A;  2Z3L A;  4ZGY B;  3DNS A;  4KVX A;  3R9E A;  3WR7 A;  4PSX A;  2VZY A;  1QSR A;  1M4D A;  3CXQ A;  2ZW5 A;  3TOB A;  3FBU A;  1L0C A;  3W6X A;  4RI1 A;  4C68 A;  1VHS A;  4IF5 A;  3DR8 A;  2VEZ A;  3IU1 A;  1KUX A;  3LD2 A;  2FSR A;  1MJ9 A;  4CAX A;  4KVO E;  4KSA A;  4CAV A;  1YR0 A;  2BUE A;  2Q04 A;  2NMT A;  3MGD A;  4KZT A;  4XPD C;  3GY9 A;  4KUB A;  2ATR A;  3EC4 A;  1WWZ A;  1Y9W A;  2CNS A;  3TO6 A;  4QUS A;  2C27 A;  3W91 A;  3R1K A;  3G8W A;  5E96 A;  4E0A A;  3SXO A;  4H89 A;  2G3T A;  4B10 A;  5KTD A;  3QB8 A;  3TO9 A;  3IGR A;  1I12 A;  5JPH A;  3D2M A;  4CGO A;  4QC6 A;  2BEI A;  2PSW A;  2Q4Y A;  4R87 A;  1IB1 E;  4C2X A;  1SQH A;  1XF8 A;  1S7F A;  4KLW A;  2CXA A;  1V0C A;  1NSL A;  2YGW A;  4UFV A;  5C88 A;  4B5P B;  4UWI A;  2I00 A;  4I49 A;  1XEB A;  4LUA A;  3R9F A;  1M4I A;  3JTK A;  2HQY A;  1XE4 A;  4CYO A;  4KOU A;  1CJW A;  4AG9 A;  5FVJ A;  2PDO A;  3BLN A;  2YND A;  3CXP A;  3IU2 A;  1YGH A;  4C2Y A;  2J8R A;  4KOS A;  3OWC A;  2REE A;  1WK4 A;  2Z3O A;  3D8P A;  4UFW A;  4CAW A;  1YK3 A;  4C7I A;  1S7K A;  1NMT A;  1IIC A;  1TIQ A;  2VXK A;  5J8F A;  1Q2Y A;  1Q2D A;  3H4Q A;  5IB0 A;  4R9M A;  2G3A A;  3V8I A;  5F48 A;  1KUY A;  3SHP A;  4KUA A;  1I1D A;  3S6G A;  2P0W A;  1Z4E A;  4YFJ A;  2JEV A;  2PRB A;  3EO4 A;  3IWE A;  4JD6 A;  4RS2 A;  4F0Y A;  2G0B A;  5AG7 A;  2D4P A;  2BSW A;  2ZW7 A;  2B4D A;  1Q2C A;  5AG4 A;  4GS4 A;  4KS9 A;  4QBJ A;  5I0C A;  3FIX A;  5G20 A;  1ON0 A;  2EUI A;  3EXN A;  4PK2 A;  4Y49 B;  3H5Z A;  3DDD A;  4J3G A;  1YX0 A;  4E2A A;  2PR8 A;  4KOV A;  3K9U A;  1KUV A;  4CGL A;  4KOR A;  4H6U A;  2OZG A;  3FB3 A;  1UFH A;  4B14 A;  2ZW4 A;  4A31 A;  3EY5 A;  2Q44 A;  4CGM A;  1QST A;  5IV0 A;  2R8V A;  2AE6 A;  4XNH C;  2FIA A;  2VZZ A;  3R95 A;  3TE4 A;  3LOD A;  3I3G A;  2BL1 A;  4B11 A;  4MI4 A;  4MY0 A;  2OB0 A;  2OH1 A;  2Y0M A;  2PQ8 A;  4MBU A;  4UA3 A;  4ONU A;  1RXT A;  3F5B A;  2WPW A;  1IID A;  4F0X A;  2B58 A;  4OLL A;  4MFQ A;  1Z9U A;  4A30 A;  1N71 A;  4JWP A;  4LX9 A;  4CRZ B;  2PC1 A;  2GAN A;  1ZO0 A;  4R3K A;  2HUZ A;  3KKW A;  1NE9 A;  2OZU A;  4UCN A;  3ZJ0 A;  1B87 A;  4KOT A;  1S7N A;  2RC4 A;  1FY7 A;  4JXR A;  2B4B A;  4JLY A;  2Z3M A;  3F0A A;  3N7Z A;  4MJ8 A;  4NCZ A;  4A2Z A;  3UY5 A;  3GYA A;  2FCK A;  3FXT A;  3I9S A;  4R57 A;  3D3S A;  2CY2 A;  4KLV A;  4MFK A;  3S6F A;  3P2F A;  4KOW A;  5HMN A;  3RYO A;  4B5P A;  4UWJ A;  2QML A;  4H6Z A;  4UCP A;  4M85 A;  3CXS A;  3B8G A;  3SXN A;  2Z11 A;  2Z0Z A;  3VWD A;  5EC4 A;  2ZXV A;  4Q36 A;  1IYK A;  1CM0 A;  4CAF A;  4M3S A;  1XMT A;  2KCW A;  2YNC A;  2GIV A;  4OAE A;  1MK4 A;  4ORF A;  2OZH A;  3F8K A;  4PV6 A;  2ZPA A;  4ZBG A;  2ARH A;  5AG5 A;  2I79 A;  4K30 A;  2GE3 A;  1BOB A;  2DXQ A;  4UFX A;  4XPD B;  4A32 A;  5DWN A;  1U6M A;  2B3V A;  4DNC A;  1P0H A;  4B12 A;  3GKR A;  5BWA B;  4F6A A;  2ZW6 A;  3TCV A;  1OZP A;  4C2Z A;  2HV2 A;  4MFJ A;  4HNX B;  5G21 A;  2J8M A;  1LRZ A;  2IL4 A;  1MJA A;  3FNC A;  1QSN A;  2JDD A;  3TFY A;  5DWM A;  4HNY B;  4JXQ A;  1Y9K A;  2CNT A;  1PUA A;  3G3S A;  4JJX A;  1S60 A;  1YVK A;  3JVN A;  4KOY A;  3QAH A;  5AGE A;  1MJB A;  3A9L A;  1M44 A;  2VBQ A;  2Q7B A;  3JUW A;  5EBV A;  4OAD A;  1P4N A;  4HNW B;  1M1D A;  1VKC A;  4HKF A;  4UBR A;  4AVA A;  3R9G A;  1IYL A;  3PP9 A;  4PSW A;  3P2H A;  3DR6 A;  4AG7 A;  1S7L A;  4PK3 A;  2Q4V A;  5A28 A;  3IWG A;  4B5O A;  4QB9 A;  2VQY A;  2Z3N A;  3BJ8 A;  5C82 A;  1R57 A;  2P6E A;  2FXF A;  2OU2 A;  5H86 A;  5A27 A;  4YGO A;  2CNM A;  2Z3K A;  4FD5 A;  4CGP A;  1M4G A;  2D4O A;  4KVM E;  4MFL A;  2YNC C;  1GHE A;  1K4J A;  3NE7 A;  4CYP A;  3FYN A;  3T90 A;  1I21 A;  4R3L A;  3TTH A;  2DPT A;  2JDC A;  4AB7 A;  4L8A A;  2K5T A;  2Z10 A;  1YLE A;  2P6G A;  4L89 A;  1RO5 A;  3TO7 A;  1BO4 A;  1KZF A;  2Z3P A;  4MFP A;  3BJ7 A;  2O28 A;  5F49 A;  3E0K A;  4CS0 B;  2R1I A;  2QEC A;  4U5Y A;  2QIR A;  3TT2 A;  4NEX A;  2P6F A;  1YVO A;  1QSO A;  2FL4 A;  4Y49 C;  4E8O A;  2X7B A;  5AG6 A;  4CRY B;  4U9Z A;  3EFA A;  3DSB A;  2J8N A;  2VI7 A;  4CGN A;  1S5K A;  1Z4R A;  1PU9 A;  1YRE A;  1B6B A;  4A95 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...