1YRWA

Crystal structure of e.coli arna transformylase domain
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
300
structure length
291
Chain Sequence
MKTVVFAYHDMGCLGIEALLAAGYEISAIFTHTDFYGSVARLAAERGIPVYAPDNVNHPLWVERIAQLSPDVIFSFYYRHLIYDEILQLAPAGAFNLHGSLLPKYRGRAPLNWVLVNGETETGVTLHRMVKRADAGAIVAQLRIAIAPDDIAITLHHKLCHAARQLLEQTLPAIKHGNILEIAQRENEATCFGRRTPDDSFLEWHKPASVLHNMVRAVADPWPGAFSYVGNQKFTVWSSRVHPKAQPGSVISVAPLLIACGDGALEIVTGQAGDGITMQGSQLAQTLGLVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and mechanism of the Escherichia coli ArnA (PmrI) transformylase domain. An enzyme for lipid A modification with 4-amino-4-deoxy-L-arabinose and polymyxin resistance.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords protein ArnA
total genus 83
structure length 291
sequence length 300
ec nomenclature ec 1.1.1.305: UDP-glucuronic acid oxidase (UDP-4-keto-hexauronic acid decarboxylating).
pdb deposition date 2005-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
A PF02911 Formyl_trans_C Formyl transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.25.10 Alpha Beta Roll Methionyl-tRNA Fmet Formyltransferase; Chain A, domain 2 Formyl transferase, C-terminal domain 1yrwA02
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 1yrwA01
2YWRA 5J63A 5J9FA 1YRWA 1MENA 3R8XA 1MEOA 3N0VA 4TS4A 3P9XA 3O1LA 4ZZ0A 1S3IA 4PZUA 4EW2A 1GRCA 1CDEA 1RBYA 1CDDA 4DS3A 4ZYXA 5CJJA 3TQQA 4YFYA 3Q0IA 1RBQA 1ZLXA 2BLNA 4EW1A 3DA8A 4ZZ2A 4EW3A 1JKXA 4TT8A 3TQRA 4ZYTA 1GARA 1FMTA 4IQFA 1RBMA 2GARA 4R8VA 1C2TA 3NRBA 4ZYYA 4ZZ3A 2BW0A 1RBZA 1NJSA 3W7BA 4TTSA 1ZLYA 4ZYVA 3LOUA 4S1NA 3OBIA 3KCQA 2FMTA 4ZYZA 1ZGHA 1RC0A 4QPCA 1C3EA 3DCJA 4Q12A 4ZYUA 4ZYWA 1MEJA 2CFIA 4ZZ1A 4NV1A 4YFVA 1RC1A 3GARA 3AV3A 4QPDA 3AUFA
chains in the Genus database with same CATH superfamily
4ZYYA 2A14A 3E53A 2WIJA 3MBOA 1FS6A 4PQEA 1QYWA 1JHOA 5AI6A 2GRAA 4BMPB 5LJLA 3EAQA 2WM3A 3VZSA 5A6VA 1Y63A 3L8FA 1BHQ1 4HBZA 3BF8A 2AUTA 5A9SA 4RS3A 1Y3CE 3PNSA 2QX4A 5CLIA 5GQSA 5FTJA 3RK1A 4P4GA 4E33A 4AIIA 4B6OA 3IV9A 1VHDA 3ZLJA 3FBTA 4DJEC 2PXXA 4DREA 4ARBA 3WAGA 2UV8A 3CX7A 1I3KA 1S9DA 1QIHA 1ZHFA 2YS7A 3C70A 3K1AB 4LZOA 4O4HA 1X1DA 1HSZA 4YRJA 3SZLA 5AKLA 3UMVA 3WNVA 4DLVA 5L3SA 2JLWA 2Y1KA 4KO2S 5J4LA 1T4CB 3IE1A 3EUFA 4J9UE 4LJLA 5GGYA 5HBRA 2HR1A 3W2IA 3LUFA 1X1EA 2QJTA 3NWBA 4FYIA 3CVXA 2PQ6A 4RV5A 3V4PB 1RD4A 4AWAA 4DV1B 3ZI4A 2GASA 2WJ4A 4Q9IA 1DOAA 4O3MA 3VR2D 4V2IA 2P7IA 4HB3A 2DU8A 1K06A 2V7WA 2WIGA 4NFSA 3LUHA 3VAZA 3VR5H 1U8FO 2BFDA 3IMFA 2QN8A 6LDHA 4TYPA 2GN6A 1BWSA 2M6LA 4AKEA 1P81A 3TRFA 4F38A 3NBXX 2F9MA 3HYTA 5AW7A 2DX7A 4UBOA 2PQ0A 3CF4G 1CY6A 2YJ3A 4JT2A 5LB4A 4AX8A 5C8YF 3AM5A 5ELLA 4WJLA 5FI5A 1F7VA 1USUA 4OI2A 4FSXA 1ZMOA 3A9SA 5AMXA 5JBNA 1YZUA 3AVXA 1KU0A 3FKSA 5LDHA 2G9QA 2VR1A 3UPTA 4ID3A 2BEWA 1PZGA 1ESDA 3G5TA 3LY8A 4NFYA 1BYUA 3H6GA 3PWKA 2HWUA 3KEFA 1GNVA 2JEZA 4RMGA 4H0FA 2C1XA 1O5OA 2R47A 4JJIA 4MCJA 2W6MA 3OIGA 4JP1A 3OQPA 4HGPA 1H23A 2IX9A 3C5WP 3WBFA 1KH3A 3IQZA 4IHJB 2I6QA 2WAMA 5ALGA 3EOAI 5AJVB 1VG1A 4PYIA 4WVFA 4C0BA 2GX6A 2WAOA 1AKVA 5F73A 2BFEB 1PI3A 1ZGGA 3ID6C 4EB3A 2F6RA 3H1FA 3LFTA 4NAUA 4C4TA 5A9RA 1NLUA 4IDHA 5KS2A 3P1JA 2IA5A 3JQAD 1KRXA 2NSYA 3FTEA 4QWWA 4AF8A 1JVBA 1U04A 4KQGA 5DNYB 3DOHA 5C1PA 5E1DA 1M76A 1GLVA 2FDXA 4QREA 2PZ8A 3F3YA 1TJNA 4XUCA 1GXSB 4J0DA 3EYWA 5EZYB 3K9HA 5DBEX 1RP7A 2I7DA 3E3MA 4LGCA 2ORED 3ZDYB 4DA4A 1N2SA 2MSDB 3GRYA 3G0CA 4KR2A 4Q1BA 1OZFA 1IK4A 4BUZA 2PWPA 5ESXA 5LJIA 4GVXA 1GZUA 2N47A 1HOXA 2O7NA 5FB3A 1QK3A 4EMTA 1SB8A 3WP0A 1L6RA 1NT4A 2PUJA 4NOKA 3BB1A 2VKQA 1C8KA 2ACEA 3R3HA 4XJSA 2PR2A 2VCEA 1TOAA 3SZOA 1T10A 2C4VA 2O2SA 3EUEA 3H3FA 1HKHA 1C41A 4IFEA 4ANFA 4CT5A 4BO6A 4OQYA 1E5TA 2CF6A 3SF8A 3UMBA 4JITA 1WPXA 1XFAA 1MEOA 1WDLA 3JVIA 3L40A 4CR7A 1HRKA 3MMPA 4CQMB 1QS0B 3LCVB 5ADWA 3RYCB 4FYYA 1J8QA 4HS4A 4LQ4A 3LP5A 5IBQA 1HM5A 3PE4A 3RNOA 5ITSA 4X65B 1FXSA 3AF2A 3C6KA 2M32A 5IHPA 3USZA 2ZFUA 1JHRA 1J7KA 4QBIA 2GCOA 2RGUA 4QULA 4AJ1A 1E32A 1JL3A 5EKXA 2YY6A 4NCNA 4MJXA 5AQEA 3MVEA 4GRDA 1AB6A 4ZQGA 4BNLA 1ZXLA 3PNOA 1G5HA 4HWSA 4J43A 1GSHA 3ZHXA 4AG5A 2ICAA 1GVHA 2CYBA 2BM0A 2O2JA 3OOYA 5CAEA 5JPIA 1DRUA 4KBYA 4XR9A 3BZBA 4MP8A 1YZGA 5FEUA 1PLJA 3S5UA 4QZVA 4CMEA 4CIWA 3BJZA 1YBHA 3EMVA 3RIEA 3VU3A 2OECA 3H5WA 2QZ9A 1C9NA 5B6PA 4JC5A 5K03A 3QXSA 4Q1AA 3O7MA 3ZWOA 4BL5A 3W5DA 3KB2A 2R48A 3DBRA 2VK1A 3MUOA 2PNFA 5IVIA 3T41A 1GGFA 1UPCA 5HJEA 4RMJA 3JQ7B 1LSOA 1DTEA 2Z6UA 1XEWY 1P0PA 1ZJ5A 5J47A 4YY3B 2V6BA 3ESXA 3KJEA 4HPWA 4LY9A 1XXHA 5CNMA 4D3XA 2H4FA 1MD9A 3H0KA 1GYPA 1Q14A 3RK0A 4KJXA 4S0XA 2CXOA 2JJYA 3PRKE 1SXQA 1JUDA 2VJMB 3JTEA 4FZRA 5FI0B 3E5MA 2LGJA 3SSMA 2B0CA 2OR3A 3KLMX 1EQ2A 1WXIA 4P22A 4DMMA 3U4QA 1C1XA 2JIZA 3FI9A 4OJMX 5HJ2A 2JARA 1UEXC 1X0XA 2VF7A 3NYIA 5DMXA 2W2KA 2GLTA 2I03A 1VOTA 4YP7A 1YWGO 4LGVA 2PKCA 3PPIA 1NVDA 4CN9A 3LK6A 1TCUA 4B17A 4ETIA 1Q21A 4WOKA 3JQFA 3DAHA 5ALDA 4PPQA 2CCJA 1Z75A 1PFWA 4J2TA 4YHBA 2O2YA 4R8RA 1EP3B 3VYWA 3KYIB 4ER6A 2O3UA 4DR7B 3HMQA 1RAIA 5D3MA 2ZQ5A 1X8XA 5KVQA 1ODJA 2PUWA 4AJNA 1ZA1A 2F9FA 4ZVSA 1E98A 2BBSA 4A73A 5FQNA 1KYYA 2X58A 3G8BA 4WACA 1P5RA 4A2PA 4DE5A 2G4VA 4B2LA 3NNSA 4P81A 4YJFB 2C7RA 2UU9B 2NVOA 1LZLA 2CBXA 5JC8A 2E1RA 4TS4A 5KEIA 1VYVA 3KUCA 2JVJA 4TTQA 4HL6A 3DMGA 1XTVA 1L4HA 4E5NA 2BN4A 3L4BA 4DIMA 1XDSA 2QZSA 2Y9PB 4Q21A 2JIMA 3J7TA 1P4GA 3T7JA 3TE6A 1MX5A 4MYCA 1G98A 2WYOA 4KQ1A 3WY9A 1DLIA 2BV3A 1VKJA 1MA3A 4P38A 3STHA 3ZDBA 2OV3A 3A3YA 1MV8A 3BWMA 4OEHA 3U3DA 4B40A 3VH3A 3DTVB 4HJRA 3MF4A 4W5WA 3WDMA 3FYSA 3NT4A 5K0SA 4RY8A 1EBFA 1KPHA 2V9CA 1JDTA 1FU8A 4JJ6A 4YYEA 4CMBA 3GO4A 4F04A 1YTUA 1MEJA 4XQ0A 3H11B 5C3MA 2NTYC 1JJ7A 3UT5A 3N59A 2G67A 3OKAA 3HKBB 4NENB 3V8PA 1T6BY 1X7XA 4H7HA 4ALJA 5EJ7A 1LLFA 5IUJC 2HEIA 2MSNA 4N3BA 3TUZC 3HRIA 5IAJA 2LKDA 4O6VA 3PSHA 2F8SA 1II8B 1CNMA 4FYXA 1BXGB 1PL6A 3OTWA 4PQFA 1OXUA 1UBEA 2CEAA 3FFWA 4IDNA 4YGYA 1D2AA 1KFCB 3ZZ1A 1ZR4A 5B7PA 1IMOA 3BKWA 5LDGA 3AY3A 1TW3A 2AOVA 4BLRA 4OB6A 5DZSA 2IYLD 5FYQA 5F1YA 3UWMA 4C1NA 5CDTA 1TPYA 3D7RA 1RJEA 2ZCVA 4L57A 2O2XA 5AWFC 1EK6A 4YCMA 1DC4A 2AG0A 1Z56C 2O9JA 2A67A 3D4LA 1YZNA 3JD1A 3JZDA 3QPBA 4OIFA 5AK4A 1A9XA 3ZS9A 1KAGA 2P2CA 1HFJA 2RHTA 1NA5A 2NYRA 3DV0A 3LGXA 3GCZA 4M3NA 3TL2A 3UMRA 1NRJB 3V6LA 3OURA 1HMYA 4LECA 1A4RA 4G0WA 2LR0A 1M5UA 2WY2D 2VRWA 1F06A 3A26A 5EL0A 5EY5B 5CCDA 5IAKA 5E6RB 1AQIA 5KNBA 3FTNA 2GETA 1K8RA 3OA2A 3DBRB 3HJRA 3G5AA 5AKXA 4M38A 4XM0A 2O7SA 3L6OO 3OC0A 3G0HA 3HTXA 4BO4A 4DF3A 4O4JB 4NCHA 3LE8A 1P60A 1WDTA 1WMAA 2X2EA 1QWOA 3AQIA 4J7AA 4JB2A 4NYIR 1L8QA 5CIWA 3OQIB 5LA6A 5LQMA 3H2SA 3IX7A 2QMUA 4D42A 4P31A 5KYNA 3ZE6A 1XU7A 3PNQA 1YA6A 1UAGA 2CDCA 2ZVQX 3F3KA 3T5MA 4EENA 1ORIA 2GF9A 3EVGA 3PXCX 5DTJA 2GK7A 3KT6A 3BQMB 3PQ7A 3WBJA 4G5QA 3ZIAA 3NM6B 1U5CA 1WP9A 2ZI9A 2VQFB 4FBGA 3X43A 4AMZA 4MQ4A 1MVNA 1THMA 3L7OA 5E4TA 1KZ1A 4N0QA 3WLQA 1Z5UA 4BN4A 4DDVA 1FTNA 2ORYA 5ENDA 2BP7A 3B7WA 1A5TA 2BKXA 2FZLA 3GGPA 4HWRA 4UPDA 4EATA 1HNNA 3G0DA 3LF2A 5FBQB 4YP9A 3QX8A 2PSHA 4GZMA 3IPAA 2WPNA 4CIAA 1Y4UA 1HBJA 3I9MA 3ROPA 1D6SA 3O03A 4Y9TA 3ERCA 4U2BA 4ZEVA 5H4GA 5BR7A 4WN9A 3NPAA 1J7JA 5AICA 2VYCA 5F21A 3WP1B 1QYRA 2YJTD 3IBYA 1FS5A 4N9WA 1UK7A 5L3QA 1Z4QA 3CRVA 1FZTA 1XDDA 4CTJA 5FF9A 3FYUC 1DCTA 3SS8A 1QO0A 3PEYA 2BH2A 3D7MA 2B8JA 1ONPA 1PVDA 1DEHA 3GDHA 1C0LA 4RH1A 4O5OA 3E22A 5KWIA 1ZKMA 3FYTA 2LNDA 1LQ2A 1Y1RA 4BFCA 4CUKA 4BNVA 4LXUA 5GVSA 4F71A 2W2NA 2GBGA 4LNUA 3TOZA 5J58A 3ZHTA 1VJ1A 3BB3A 3O4HA 1RWXA 3RI3A 2DC1A 3TINA 3SR3A 2AUMA 1A7KA 1VMIA 2AG1A 4O2RA 4XJVA 4L4RA 1F0KA 3M33A 3PC8C 5IVDA 4CRWB 1Q22A 1XNGA 2VJLA 2XY4A 3LT2A 1JHAA 4O2LA 1H5NA 2IP1A 4PIPA 4UDNA 2Q2QA 3ZE8A 5TT1A 1UOQA 1XG5A 1RAEA 2Q2OA 2QL6A 5ELXA 2C4TA 3F4BA 5A0VA 1IOZA 5FULA 1JQ5A 1WB4A 2I4RA 2WMYA 2I4OA 3GA7A 3GUVA 1E3TA 1Y8QB 3DQQA 1WEHA 4J7CA 3CUVA 3KQQA 2HTEA 2I3DA 3L43A 3NDJA 4RSGA 4HYQA 4YHHB 3AF6A 2W22A 3OI7A 1JG4A 1Q19A 1JWLA 2BFPA 1MB4A 1CR6A 2RJ3A 5DNAA 1XMPA 1T9CA 2CMKA 4GMKA 4ACBA 1ZK0A 2OQIA 2ZIXA 5DNUA 1DLJA 1CT9A 2R8EA 1V39A 3K9CA 4UFPA 4Z7NB 3BTOA 4MLPA 4YAWA 4M22A 1SBYA 2IIPA 1GPKA 3DQZA 4PYLA 4HVAA 3QXJA 4WK4B 1GAJA 2V3VA 3UXEA 2Q5JA 4RIGA 1PR6A 1DUSA 1OFIA 1W94A 3DZFA 2GFQA 3LT1A 3K09C 3OCZA 3QENA 4JMPA 1XHLA 4PG8A 3AI3A 1X8KA 3PQCA 1JYEA 2GK3A 2YN0A 4P53A 3ZLBA 1U98A 1ZM4A 3MT0A 3GGSA 3ZWKA 5IAGA 2DQZA 3CCBA 1UC8A 1QDEA 3PJGA 3NLLA 4XYBA 3U81A 3K70C 4H08A 1UZNA 4GAEA 3LHIA 3GCDA 4OGKA 4OL0A 4BNXA 1V0JA 2QQ0A 3GG2A 2ZE7A 2R2GA 1GHTA 4G2TA 1SEVA 3LW8A 2J3KA 1PS0A 1TD1A 2ZB4A 3CX3A 3NWJA 2FEPA 4A6PA 2NUAA 4ZAGA 4E13A 5CEJA 3A70A 1FFHA 3T3PB 3DOJA 1VSBA 3FOAA 1E2PA 4QSHA 4RY2A 4IEFB 4JJZA 4WNAB 1ZMTA 3H83A 4GIBA 2FX5A 4OQNA 1B0PA 3IBSA 2VWHA 3KQPA 1DMRA 2PMCA 3GVPA 3UMSA 3MSXA 4M1TA 4XM2A 4MVJA 2GNOA 3JQQA 3L4SO 1XJQA 2X5NA 1TVCA 2QNBA 1P4SA 3DLCA 4UUPA 1FP7A 1SBNE 3AIOA 3DE4X 1RI5A 3FNRA 4K9LA 4LPSA 1EGMB 3WMGA 4B0OA 3R0XA 1CB0A 4JQSA 4ZOQI 3A1EA 5KNDH 4HCJA 3T1YB 5JAZA 4JVNA 1PJRA 1RVV1 2PGDA 3LH5A 1E7WA 2AKAB 1B8VA 4P8RA 2JLBA 1O87A 4K9RA 2ZIUB 3MN1A 4DG5A 4EUNA 4YPVA 2RSLA 4MDYA 1P0FA 2VXYA 4JQYA 3WRYA 5MFZA 4FS8A 3NAZA 3RYIA 3QV2A 2PZBA 5C4GB 1P9OA 1CY1A 5G4LA 5DN6A 1G66A 1FFXB 1P44A 2XW6A 4OKIA 4YBRA 3TPCA 1S8NA 3NVKI 1OTXA 4E6EA 4ODIA 3I45A 4EY6A 5G0VA 1I5RA 2V0NA 3T3DA 2XI4A 4CMGA 4ESOA 4PNZA 1JZSA 3SJUA 3MGKA 1HQDA 2OAGA 1GNRA 3BRCA 3FPKA 1DAEA 3RC1A 4RFSB 2DQYA 4BJHB 5M5BA 2IYPA 4KXNA 4BGEA 2VK4A 2WG2A 2CNNA 4MMXB 2GVNA 4WFQA 2X1LA 3BIWA 3G6WA 4Q37A 5EQJB 5KTRA 4WEQA 2VJQA 1QIFA 3OEEA 5HWSA 1KY4A 2Z2ZA 3LUDA 4WLNA 4RYDA 2DUUA 5J1TB 4XPIB 3T94A 4F97A 3QFSA 3QW2A 2HBZA 1R27A 5K0NA 3UB3A 4KGVA 2RHDA 1IWPB 1EB9A 1A5SB 1WMDA 3L05A 5CT9A 4GBJA 5T6MA 1OMOA 2JJ1A 5IZ4A 1SRRA 2DGDA 2J4DA 3SC4A 3E4DA 1D2NA 5ARDA 1N7JA 1PX0A 3PFFA 2FW6A 1G2OA 1A2QA 1WP4A 1GU7A 1S0UA 2A3NA 2QUHA 3PI7A 5CT6A 1KIFA 4RXUA 1GZSA 4N1AA 4C4ZA 4WN3A 2FXVA 3LHKA 1QFYA 3GPIA 1QYDA 4LOLA 4MW5A 5IDVA 4R2KA 2EG9A 3UW3A 1OH7A 1XRJA 2WTUA 3IHWA 2QQEA 1LNSA 2Z9CA 3MOGA 4XVUA 2HYDA 2PWZA 4MVJF 1W35A 2C7GA 1CEXA 3NETA 4Z9BA 3H04A 3RVMA 2IHKA 2PGOA 2P9HA 3LGAA 4G67A 4RA6B 1MQ8B 4HNQA 1F5SA 4D02A 4X41A 3O3NB 2PV0A 4R6XA 2X8JA 2YQZA 3EF1A 3GJXC 4XWWA 1R0SA 4JGBA 3G2HA 3WTCA 3SMQA 2FOXA 2AFIE 2YVQA 3A2LA 4FGJA 3GLFE 2JA2A 1F7UA 3CH4B 1K4KA 1GDDA 3V42A 2AVNA 4PX2A 1RKQA 2QRMA 1ZGHA 3B1WA 3DEZA 2RGBA 1UFQA 1XRPA 3I09A 4HTFA 1D1SA 3PIDA 4GI7A 4PAMA 2ZWVA 4LFCB 3ZJ5A 2O8FA 1M0TA 4Q4AB 1PHPA 2I1WA 3WTBA 2QS9A 1Z0FA 5B64A 1FDUA 5IJ9A 1A1VA 3PSAA 1MABB 3G23A 1O89A 4IOKA 2VDPB 3W8NA 1NXVA 4Y3UA 5GMOA 1EJ6A 3D5QA 2PKWA 3C7KA 4UUNA 4W9RA 3ECCA 3VU8A 4O8ZA 1W36D 4W9NC 4A8PA 3EMDA 4GE0A 3R76A 1EJ2A 2QE7A 4WOBA 2CXXA 3FLEA 3HBJA 1HDIA 5CITA 1OC4A 5KWVA 4TMZA 4MGEA 2WQ7A 3PTZA 5DGDA 1CRWG 3CVWA 2WWGA 1KYVA 1RXCA 1A8SA 3SFZA 4EG0A 3E4CA 2PLNA 1COWD 5GJVC 1TM5E 1MVOA 3OBIA 1F8UA 2C78A 1EM6A 1RPAA 1XDWA 4BB0A 2J5QA 1H8HD 2GZ1A 1RLIA 1XELA 2P9EA 3WGOA 2PIDA 3B52X 2MU1A 2Q6KA 5IPFA 4KP7A 3HG7A 3EY9A 2DERA 2QTMA 3PIIA 4JHXA 1NP3A 1SK9A 2P78A 2GZDA 2DJ5A 4DDMA 1V3QE 5LOVB 3AP2A 5L6LB 3EVZA 2RARA 1FRZA 3GGDA 1GKKA 4KU4A 3HVKA 3NTQA 3JATA 4LQLA 1RQ2A 1RYEA 3BK1A 3OIYA 2W6CX 3BFJA 4KIJA 2Q3CA 3GFBA 4L75A 3HCCA 1TEHA 3M0EA 4Z53A 1DT5A 1EVYA 2DKOA 4MIKA 4YJ3B 1TW2A 4C87A 3VNQA 2CLCX 4EKEA 4DV3B 1JJBA 5J5CA 2W6PA 3EVEA 1UADA 3R9KA 2VYVD 4Y0AA 2HJHA 3DT8A 2CFTA 1IWOA 2C20A 1OLXB 2FE1A 4HP8A 4IEIA 4JVLA 4RV9A 1B2LA 1W96A 4QOGA 4ZCPA 3ZY2A 4Q3CA 1QR6A 1LDBA 3LU1A 2VT6A 3REGA 4EHDA 5LQUA 4F9FA 2YW9A 3DS8A 3HJGA 2IC5A 3K31A 1RHJA 3EC1A 2I0FA 1AQJA 2MINB 1CDDA 1V2HE 3K20A 4I9UA 4UTPA 1N92A 2X9LA 5CB4B 2Y2UA 1VBNA 3UJ6A 3UATA 1ODKA 2BH9A 1BXRA 4LMAA 4CEHB 3G0BA 2ZVDA 4FGZA 3TZKA 1NQOA 3ETJA 3HR8A 3U1VA 1J1UA 5JY1A 3CBGA 2B1JA 2FSVA 3IUEA 2YV4A 4HMOA 3ROKA 3F8SA 1V71A 3SY8A 1MABA 2Q3HA 3R24A 1DPFA 4EY5A 1NVXQ 1HZJA 1ZHHA 3OJOA 5EJFA 3TRDA 2PFSA 3N3BC 4MW6A 4URXR 1R0KA 1PHRA 2UZ1B 2X6RA 3F6YA 4GOJA 2Z30A 3HU2A 5DLEA 4CU2A 5KB3A 3UJDA 1WUIS 4LYDA 5GONB 3NP7A 3TFQA 2BFDB 5CFRA 1WF3A 4A1OA 3OLZA 4R2LA 4XD2A 3PLNA 3Q11A 1AKTA 3WYBA 2CWDA 3JYNA 4G5GA 3T15A 1P73A 1OX4A 5H7XA 3BC1A 4G01B 4A36A 3ROMA 3DKPA 5GGXA 1BU8A 1ISJA 3CRZA 4B81A 1BXKA 1E4OA 1HL7A 2RH5A 1OQAA 3QVGB 4JOCA 1URPA 2X5KO 2NZYA 2Z2JA 1ZSNA 3TJZA 3TIVA 4Q7KA 1WHSA 4QXOA 4K03A 4UM5A 3ZWYA 3IMEA 1XVLA 4IX1A 1WR8A 4PC6A 3LGSA 5C2JB 5K7SA 3PUZA 2QX7A 4RFVA 3K1AA 3IJRA 3DHEA 5E9QA 1RM0A 3QEMB 5BRJA 3I01M 2JLCA 1JDZA 3TRIA 2BTOA 2X7XA 3MOSA 1YQEA 4TPKA 4YLEA 3KXKA 5AK6A 1MJGA 5FQOA 3P27A 3HV0A 3GNTA 3RAFC 1XA4A 1OLXA 2RGDA 5E2IA 4BFYA 2YHSA 1NQWA 4Z86A 4XX1A 1W5SA 4JENA 4Y1FA 3S1LA 3R5HA 2OFPA 1R6XA 2GI4A 4W7IA 4K86A 4YCDA 2NP6A 1M2WA 1PWEA 2BFFB 4RD0A 1E1DA 1ORTA 1T9GR 3CO5A 1YGPA 3PU6A 3SN6A 1O94D 4NIMA 1ZWKA 1LQTA 1MTZA 3AHEA 1T25A 2RAUA 4MJ7A 4HQKA 4HVCA 3BCSA 3WYEA 1CTQA 1EWTA 3T9DA 1J07A 3U4DA 4A6XA 3LV8A 3HCRA 5EZYA 3BH0A 1W9MA 4YI3A 1C3VA 1YS9A 2HFJA 2G6TA 3HFGA 3ZHCA 1VIDA 4G26A 3AW8A 5LOVA 1AZLA 2DBVO 3NIGB 3C41J 1Q17A 4RW0A 5EI5A 3MFYA 2VJYA 3NHSA 1RWWA 1I2ZA 3VR4H 1Y8ZA 2GLUA 1C0KA 1EFTA 3QU5A 1E9DA 4MI9A 3ZCTA 1P74A 4X20A 4COKA 3HXOA 1G38A 2JFXA 3HPQA 1YR6A 2Z2XA 2O06A 3AESA 3GLGB 1L5VA 2D0OB 3G0IA 1Z2EA 1ZS9A 3RUCA 5SICE 1VPEA 1QMGA 3LX4A 3HADA 3BXOA 3HCDA 1BVUA 3SM3A 1YFJA 4YQZA 1YR1A 2JFWA 5KX5A 2O5CA 2HDHA 1XAIA 1ZGAA 2EJUA 1CS0B 3IGFA 2Y1FA 5KNCD 1A95A 3ROQA 1UL1X 4MQ6A 5KVSA 5C1DA 2QIOA 1PGNA 1WJGA 2IV2X 4CM6A 1S2DA 3QXHA 4CEIA 2PGIA 3GXBA 1T5TA 2FDRA 4MS1A 4TQ9A 5L45A 1CUDA 3ETNA 4R81A 3ESQA 2NX2A 5WRFA 2WTXA 1HORA 5CGQB 2FU5C 4TMYA 5AP9A 1X1TA 1I0IA 4HX5A 4Q1CA 5BR8B 5LD2B 4LTNA 2DBYA 2XNHA 4IIVA 4YRTA 1SCQA 3ADKA 3JQ9A 1UINA 1BDJA 3IA2A 1JLLA 1JIXA 1OFUX 2D1SA 3KCQA 1MZVA 3ESDA 1T4BA 2A1UA 5T3UA 3SQWA 3L4EA 1W1UA 1NP6A 1NY6A 3DL4A 1D03A 2ID8A 4F5DA 3PCXA 3IMGA 2E4YA 2I99A 2QTBA 4QTYA 4J0EA 1A7AA 1J1ZA 2D1TA 4MYSA 3TGLA 4HK4A 1QHFA 2D13A 3JS5A 2AG6A 2O3QA 1MG5A 2WPDD 1J06A 1RE0A 3L8ZA 1VM6A 3L7MA 2ZJFA 3MELA 1EJBA 1M33A 1U9YA 1ZBQA 3C2QA 3RFFA 2WTMA 3U4CA 1V5IA 4ZOLA 3GT7A 1RRMA 3LZCA 2BLNA 2HA0A 3RUDA 4BXOA 4R16A 5C53B 4BX3A 4ER3A 3AR7A 3MJRA 5BR1A 1XMQB 1PRYA 3TRHA 3FR8A 4JN6B 5EZ6B 1AUOA 4CJXA 3PXUA 3FPSA 3WDKA 3QFFA 4GUAA 4PU0A 4UNSA 5FPTA 1EI9A 4AN0A 1HDCA 1SD5A 5BVGA 3G9ZA 2HX1A 1FDIA 1XI2A 3DF7A 4DNPA 1XRLA 1QAOA 3VC3A 4DLBA 2B1IA 2QJOA 4U7TB 4ZODA 1N2CE 4AB1A 2ZWPA 3BRQA 2BGJA 4L4YA 5MF6A 3RTGA 5L8VA 1DC3A 1O2DA 2XDQB 1EVLA 1RWPA 3EIWA 3NH6A 1SBTA 1SPBS 2PHZA 3PNYA 3EIXA 2HCBA 3CY6A 3LY5A 3QKWA 3VYVA 4HFNA 1G7CA 4BLSA 4N5DA 2ZGVA 3GLQA 1E59A 1Y9EA 2J9GA 2JAWA 2P5UA 2QHXA 5FA8A 3EWAA 2XITA 4KO8A 3MS2A 1XCBA 2CUNA 3TGWA 1JDBC 2AN4A 6GPBA 3LXUX 4ZAZA 4F60A 3BSSA 4ARZA 3EPPA 3DHVA 1N3BA 3JWJA 4YJFA 1BG6A 1S3GA 4UTRA 3PHGA 4FBMA 2WM2A 1J97A 1BE1A 1FSZA 1ZH8A 2FWMX 5FJJA 3WRVA 1XZLA 3ABRB 1G21B 1NQAO 1ISMA 2OHOA 3C7TA 4ROSA 1JAZA 2UVPA 3QYAA 4TWBA 1E64A 1SR8A 1USIA 4V0OA 3RUAA 1ONBA 5JD3A 2ZZKA 1O6BA 3MOIA 1DG3A 4I9HA 5BSEA 1NE7A 7GPBA 1O0BA 3MCAA 3BAFA 3R77A 1OLUB 1LLDA 1FUYB 1NXSA 3A4LA 3O2SB 3OVMA 3UPDA 3ICQB 4D4LA 2AC7A 3HNOA 3UJ8A 4ZVUA 2FOLA 3SFVA 3ZOZA 4J3JA 4FYPA 5J2TA 3BRWA 3JXEA 2WJPA 3PF9A 3R6WA 2OZEA 1NE2A 2VPWA 3N7TA 3QKTA 2B4QA 2D3WA 4NYIQ 4FWIB 3UMGA 2L42A 4TV9F 4C6HA 4J1QA 2GAOA 3A4VA 3DFIA 2DJIA 2I62A 3QLUA 4QAQA 5K3CA 4Z54A 3SK0A 1N2CB 4YMUA 4AQDA 2P3LA 1WVIA 2AA3A 3EBOA 5JJLA 3GDGA 4IS3A 3VGPA 4V0QA 4XJXA 3S7ZA 1G8PA 4KLRA 2GXSA 3AC0A 4MVXA 2FMXA 2OXRA 5F2KA 4LK3A 4M1SA 3SBOA 4G56A 1AE1A 2IZ1A 3PHLA 1Q7RA 1V9CA 3BXFA 3SF8B 3LZ6A 2HCFA 2XUKA 1G4HA 3GYGA 2FWIA 2FUNB 3HYRA 3ESCA 3PDIB 4D45A 5C8DA 3V4RA 4TS3A 1P77A 3G0OA 4HDCA 4UU1A 1L1RA 4X8OA 5EXTA 4PVCA 3U6KA 2PH5A 2XXAB 2HNBA 4RBNA 5M34A 4DC0A 2F00A 1PNVA 3GZNB 1WXQA 2YOHA 3DONA 3ELBA 3LX8A 2XYVA 1ENOA 2BC9A 4MW2A 3U16A 1JLLB 3QVWA 4YAEA 1LBQA 2A33A 3U6BA 2X3UA 2RHGB 2NNWB 3U3ZA 4BE7B 3TLMA 4DMKA 1KZ4A 2F1IA 1G3MA 1NQUA 2P4UA 2XVMA 1N2JA 2NO7A 1TZMA 1U28C 3F46A 2AMLA 5H70A 1BCSA 3H4VA 1OB2A 4K6MA 1ZD4A 1JHVA 1G5FA 1S96A 2G0AA 4HN4B 4HRXA 4EL5A 3SQLA 5FAKA 2HMAA 2OO7A 1ZYUA 4RD3A 3H75A 1KMIY 4G5OA 1E1YA 3IDQA 5DLYA 2P3SA 1RMTA 4UNQA 5JS6A 1SC4A 4CG0A 3WWCA 2A92A 2OAQ1 1DRVA 1TUIA 3UCFA 3HSKA 3Q7IA 5DI3B 1VIVA 1NZJA 1NUTA 1YZVA 5K8VA 1T29A 2P40A 5CX1B 3SJCA 5K6RA 1N8TA 4BEBA 3LBHA 5IH7A 1GTJ1 2H6EA 1OASA 1AGNA 2ZITA 3ZWNA 3JQBA 4DLRA 1XRNA 4GXTA 3T5BA 4JJGA 3EPLA 4H6PA 4CKBA 3JVEA 2CVFA 2D0IA 4NPCA 4J4TA 4M86A 3U3OA 4GKAA 4P7JA 4KUEA 1L5NA 1U8UA 4MARA 3TFWA 3BE6A 2VHZA 4PYQA 4UE2A 1GG9A 1OBVA 1IZZA 2PA3A 1KAMA 2PLRA 4MWTA 5CDFA 1I4EB 4Q5IA 2DHRA 1NTRA 2P27A 1P0CA 3C3MA 3MXOA 5TC4A 3RJMA 1FXWF 4HAVA 4BN5A 5IKXA 3U7FB 3SXJA 3VSDA 3S2SA 4Q18A 4Z9AA 3RT9A 5A03A 3WNDA 4ZXPA 4PPNA 3DPUA 4KN6A 5AHRA 3M7IA 3TBFA 4BMDA 3T1OA 3TLKA 3AKCA 1QRUA 5T3YA 3EXFA 3HCFA 3HB5X 4OKSA 8OHMA 2PVSA 3COZA 4KZKA 2YQ4A 1AZSC 1D7OA 3HKBA 4NENA 1M6NA 3JYPA 3W90A 5JLJA 3GJ8A 2HJGA 3S70A 3SG0A 2O8CA 4J1SA 1V1MA 2LD4A 1CEQA 3OMXA 4NWIA 3VJKA 2HHAA 4WUTA 2B8WA 4WT7A 4F4DA 1MC8A 2OCLA 3ABSB 3G9XA 4XH9B 2Q21A 4HZUB 3GZJA 3VV3A 2AR0A 1LVGA 1EAYA 2ILTA 1XXHE 2FFRA 4XKJA 2ZIZA 2XLBA 5EIAA 3RYFB 4NRDA 2HZ7A 3ML1A 4MLCA 1ZK2A 1ES9A 1R6UA 2D59A 3ZV7A 3W5IA 4PIMA 5I7RA 3KM0A 1DARA 3MG9A 1FFEA 3ZKWA 4FGLA 1SC3A 5IEBA 2DSNA 4J1TC 1Q3TA 2EG5A 4LNUB 4Y67A 3E3AA 2BKAA 4D8YA 2CV2A 1MBZA 3ORSA 5IT4A 1QDUA 5E3IA 1IOLA 2G77B 4LBYA 4MNTA 4KB5A 5TRTA 3ZWQA 2BKVA 3IPXA 4OQFA 4JT9A 1TFRA 3AGPA 1DQNA 1VLZA 2DTEA 3W6ZA 5DCLA 4ME6A 3I2JA 4N6NA 4KQXA 3W2EA 3DWIA 2O8CB 1M1UA 3KFVA 1QWSA 3K9LA 5T7BA 3WYCA 3U3RA 5I9NA 4QGBA 2WD8A 4OHUA 2E21A 1LI4A 3EZXA 3DDHA 3IOCA 2PQMA 3NAMA 4UNPA 3RWMB 3SC2B 3ZE9A 3I0NA 2QLJA 1GGMA 5D87A 5CA0A 2F43A 5K01A 2IYTA 4CBVA 3IQFA 3I34X 4OP2A 4WCFA 5EJIA 3IEUA 1UMCB 1W85A 3OE5A 1YOVA 2JANA 5HUHA 1LPMA 2C7BA 2GPJA 1TQHA 1DC7A 4HZGA 2R0QC 1GTRA 1E2KA 3TDMA 3EZYA 1R6TA 3LCUA 3H0EA 3GB9A 2M1XA 4FVTA 4GC5A 1IN4A 3I3SR 3L1HA 1KYWA 5FUWA 5J23A 1MHTA 4CZ2A 4ZHQF 3ZZTA 4WGFA 3KJXA 2IEBA 2O8VA 4F06A 3PC8A 4IOJA 2A5FA 2ZWMA 1TYAE 4HXGA 4P4TA 2P5SA 3H5LA 5D7BA 1OVGA 3TFOA 4RD6A 4DVGA 5IXSA 5HDBB 1ZI9A 4HDOB 4ZCIA 1IBRA 3WKDA 4QEKA 2IEIA 3TLYA 5LPNA 1ST2A 3A9CA 1U8TA 4UUBA 3G02A 4J6EA 4KAXA 1MB2A 1G19A 2C7VA 2QGZA 1HETA 1GRRA 1U0TA 2PZJA 1Q95A 1AHNA 2XCIA 4WRRA 1XZDA 4X61A 3U2QA 1RQRA 1H05A 3WMWA 3EG9B 1E4EB 1QFZA 5JZSA 2GVZC 1BMTA 1OAAA 1P9RA 4WZZA 4JLNA 3V2HA 3BGSA 2YHUA 3AGQA 3UGKA 3IDAA 3K8OE 4L28A 4P3PA 5FNVA 2ZQYA 3FPLA 4RIHA 4WW0A 3V55A 4MS3B 8LDHA 1UKAA 1PNQA 4H17A 3AY6A 5CDHA 5I8WA 3H97A 3B48A 5DPMA 3L5OA 1FIUA 2EIXA 1J99A 1IM5A 1S9HA 3PHHA 4JKYA 5ITZA 3A7DA 1U2SA 3QE2A 1BWPA 3RC3A 4EEXA 3R44A 1GWNA 3WLLA 1HFKA 3W8FA 3EPHA 2ANBA 2OZVA 1DJLA 1EDZA 1NBEA 3D0OA 3PFBA 4DA0A 1PGOA 2QI9F 5EHZA 4EFDA 4NPHA 2AWNA 2VUIB 2ANCA 2Q8PA 2WVHA 2FWRA 3GEGA 1MFPA 4OPMA 3V2GA 1D4OA 2BFCB 3PFNA 3SEZA 3IL2A 2P4EA 1FMTA 1SK8A 3OMLA 3RJZA 3T6KA 2IOFK 4ILKA 2JLZA 2LCFA 3WICA 1UXOA 2GM9A 5JWOA 2OWEA 5AVYA 2VNJA 2XHZA 1RWNA 3DPSA 1VYUA 2CVQA 2OHXA 3CE6A 3NBQA 3P2IA 2VJBA 2XWJI 1JXOA 2VI5A 5EJ8A 5BT8A 1BS1A 4BPRA 4GP6A 2R5WA 1XTIA 2FXIA 2NZVG 3L6UA 1KVTA 2C04A 3K1YA 3O2NA 1QYIA 3KR9A 2IWRA 4A2CA 4RDXA 3LI2A 4P0QB 3HZRA 3FDIA 3ZY5A 3ECAA 4Q34A 3A1DA 4LF5B 1F8FA 1ZCZA 3OIWA 3C3DA 4G63A 4HNRA 2DZDA 5I8ZA 2E4XA 4GE3A 2BZGA 3MWJA 1QBGA 2Q5OA 3FPAA 2C4HA 2GSDA 3QVOA 1XAJA 1CLEA 2Q2VA 3P0IA 5KNCH 4DJAA 1EBUA 5DLQC 2HPAA 5BW6B 3ROTA 3MWLA 4KE8A 4BMOB 1VSTA 1CWUA 3LSTA 1XNQB 3NXSA 5KTTA 3BD7A 3NDPA 4RHTA 3MCTA 3IKTA 4BNMA 1FB5A 5IJWA 5IX8A 1F1JA 2POQX 1WV0A 4UEKA 3ENVA 1BJKA 1H2HA 1KI6A 1WX1A 2X8JB 4DLUA 4I08A 2DPMA 4KQKA 4PZZA 5CHYA 4HN2A 5D1HA 5K51A 3KZVA 5CA1A 5TMPA 2JDID 5K20A 3I04A 4W5TA 4MV0A 4DCPA 1QP4A 1RQXA 3N2GA 3OICA 1Z0SA 3E9YA 3MRVA 5KTMA 3NHBA 4RZ2A 3I12A 2D4HA 2QVLA 1HNXB 2EQ5A 3NHYA 1YL5A 4FOLA 1FNDA 2RIPA 2ET6A 2PIAA 1RYHA 4JL6A 2AEEA 3S2IA 3W6NA 2OM6A 2QROA 2CVPA 4NFLA 2AZMA 1WMBA 1BDMA 1NUPA 1DTWB 2BT4A 1CS4C 2C2BA 4GNRA 2P68A 4PXAA 2PE5A 5C9ZA 1E5QA 2FN4A 3O82A 3AOEA 4LK2A 3SJAA 3FNBA 3LT0A 2Y0BA 3GJ3A 3TSAA 2WU4A 3I3OA 3OPNA 3S44A 4YXFA 5AUOB 5L3RA 4IXNA 3K4QA 1FK8A 1CR0A 1T3LA 3K53A 5A6SB 4WCFC 1U0NA 3Q1LA 2FPGB 3ANNA 4L0MA 5AJTA 4Q1VA 3MWFA 2QM7A 3AY0A 5EP3A 2B9EA 1BXRB 4CEHA 4DNXA 4MI6A 3ANLA 5I7WA 1EUYA 2QP3A 4EPYA 4A8HA 2Z2KA 4H3SA 3BJMA 4MWCA 3WYAA 4MKGA 4GLJA 5AW1A 3I9FA 4ER7A 1JH9A 3E9MA 2PBRA 3I9V1 3ZKAA 1KO5A 3CRW1 1FLVA 1XV5A 2EVWX 1GN8A 4MRSA 4CNBA 1JA9A 2V7VA 4F7DA 2PX8A 2Z4RA 4DPKA 2NP7A 3FW1A 1T6NA 3LWZA 2W98A 5EKSA 3REFA 2ZXFA 4NNOA 4UKDA 1RS0A 2H3HA 2DBRA 4FR0A 1BVHA 2BFBB 4YRNA 4L5AA 1ZH0A 3LBFA 4UBIA 2Q6TA 1XD9A 4YUXA 3VKWA 1P0QA 1UPXA 4LFBB 3QKIA 1Q0QA 3R9XB 1LEHA 3ZNPA 4HFJA 3MPUA 2R8XA 2IBTA 1XRMA 1Y6FA 2X15A 5HOEA 3B51X 5A9SB 1CQZA 3FKJA 4B71A 1U3VA 5CFNA 4YTEA 1SFRA 1KZHA 3GMDA 3TMKA 3B1VA 4BO7A 4IGAA 3U4AA 1GQRA 2PT5A 3IRUA 3ZR4B 2OCDA 3OJLA 4C2BA 1OWLA 1K5HA 1SQFA 4HAWA 1P1JA 3HDTA 2BEVA 4WECA 1Z63A 2R7NA 4YT4A 1N33B 1I4OA 1WNFA 2QIPA 1U0HC 3GUUA 3W2HA 4BNDB 4L8VA 1OCEA 1NR5A 2AFHA 5ER6A 1NVWQ 2VF4X 1PCXA 3FDZA 3FNQA 2GPWA 1KI2A 1TUGA 3HWX1 5DULA 5HCIA 1JI0A 3EUWA 3AM4A 3ADDA 1FSFA 1KH1A 1HPLA 1WS6A 4GBED 1N3LA 2GZMA 1RE1A 5G02A 3ISTA 5TR9A 3IVGA 7ABPA 2I7XA 3IP9A 2HQSA 4BV3A 3EDCA 5ITZB 3LPMA 3U37A 1PR1A 1DKQA 3I28A 1C3EA 1G2QA 3JZAA 3N75A 1XK7A 3ZVNA 2UYQA 2FLVA 4LYYA 4RIEA 2CHGA 5T67A 2Z3ZA 3R7NA 4J2OA 3VDNB 3BQNB 4B48A 2XOKD 2FUCA 2Q99A 2ZRDA 1ILEA 4GX1A 4OA5A 1S8AA 2WYHA 4DIDA 2I2CA 4NXNB 5DNVA 3OF2A 2JS7A 4GS5A 4HBGA 1TO1E 3TEMA 1G8AA 3LT5A 1KZ6A 1PWYE 1F8XA 4FR2A 4AMYA 2ZRAA 2BEUA 3CEAA 2BFNA 5ALLA 1I6WA 1OIXA 4IVRA 1CXZA 2ZBVA 3H5AA 2JGFA 5DXAA 4KMMA 1JZTA 2ZRIA 2LBPA 3L2OB 5ESRA 4A92A 2H18A 2X0NA 3T9CA 3UN1A 3WHKA 2O8EB 1DDOA 1UBRS 3U4HA 3AZPA 2YHIA 1I8TA 4IHJA 3AR6A 5DNEA 3T3MB 2FH5B 2D5BA 1MIHA 4N41A 1XALA 3L6BA 1XXHB 3L0SA 1G8GA 5G1OA 4NHOA 4B0PA 4BKPA 4CCAA 1OZGA 3LL4A 3RYHB 5EKTA 5BUCA 2A9JA 3ABIA 3DCYA 3O8NA 1JSXA 3Q15C 5K3AA 3RTCA 1E1LA 4CF6A 2C9OA 4ZJYA 2P91A 1XRRA 2HY7A 3NI2A 1IDN1 1NF2A 1MEEA 4L07A 3ASVA 5GONF 3UNXA 4B7ZA 4EOGA 2ZJBA 3WLOA 5AOBA 2HXSA 4FD3A 2QUKA 3TQRA 4GVLA 1DXQA 1VGVA 3P0FA 1NNEA 4IDQA 3HVIA 2HWXA 3BYZA 4TKUA 3SDZA 2X4DA 1X3SA 1BCRB 2X13A 4GLLA 4C21A 3GUYA 3CN9A 4ZYWA 1TZ2A 1W93A 1DXOA 1EX1A 1LDNA 2E7ZA 2PZAA 3IPYA 3Q6NA 1LSUA 3WK9A 1R5JA 2IYXA 2YNMC 4FOOA 2J6CA 3P0EA 4QTXA 2I3BA 3AFMA 3CFYA 3RYHA 2NTNA 4DB2A 2GQ0A 2XMSA 1K7YA 1UIMA 3DNFA 5I7FA 4HAZA 3JTMA 4ZA2A 1E9VA 1UFOA 4OLBA 2RGYA 4CQMA 4OI4A 5D01A 4QD3A 3A8TA 4FWTA 3LCCA 3L0IB 1ODIA 1YRHA 4GRAA 4BFUA 2H7CA 1WTAA 1M34E 3EASA 2O1WA 4LXYA 4UBNA 4YI5A 4ZKEA 3W2TA 4EJ2A 5LQRA 5F7JA 2C95A 1AA6A 4QYMA 3ORFA 4DCOA 2HTFA 3T1TA 4EGCB 1EFHA 2B7CA 1TE2A 4OBWA 4V0SA 4WY8A 4Y2QA 1YOBA 1UDCA 1UBLS 4XJTA 2C2OA 3PNBA 1NKTA 3AU9A 5A4MS 3WOVA 4NHEA 4MJ3A 4Q4CA 1H8EA 2J85A 2GF2A 1Z34A 3NNNA 5JI3E 3EWIA 1VTKA 3GMSA 2BBWA 2LCIA 1Z0JA 3DWFA 4JL8A 3G1WA 5DT2A 3W78A 4N3CA 5BNWA 5LYJA 1YRBA 1ZWLA 3VHQA 3ZU2A 3JATB 3WLJA 2BDTA 1UXKA 4UVEA 5CLLA 3TE7A 4DOMA 4LJ4A 2ZUWA 4EHBA 2HC9A 1D2RA 3NZEA 4HDQB 4CQJA 1BDIA 1UMKA 3TVYA 2YCLA 1R5BA 2EL7A 3ITNA 3GEHA 5U1PA 1CQJA 4HH1A 5JCJA 2SECE 3KD2A 4WKCA 3ZW7A 4AJLA 5CVTA 1ZPDA 3SEQA 4B34A 3IAM6 3KFXA 3WADA 1T9GS 2C4UA 2AN9A 3NASA 2EV9A 4W1QA 4B74A 5JD4A 1YIDA 3DOIA 5HSGA 4JP2A 3D0KA 1JECA 4ZVKA 5CMLA 4AZVA 1NNUA 1FLAA 1JR3D 2Y93A 3JALA 3WGUA 3TJMA 2FR8C 2IHYA 1WMFA 3AUJB 5I7SA 1R66A 2WJGA 1TLTA 5DK6A 5ALUA 4RSHA 3CE9A 4CM5A 3CNBA 3E1SA 3UW1A 2C1EA 1WHSB 3ZYZA 2DCMA 3RSSA 1K9VF 2A1UB 5SV2A 4UM9B 2OSVA 3JVDA 2PWBA 3LECA 3EZLA 4RMNA 4FYMA 1P4HA 3MQFA 4F85A 1O6GA 5JZVA 4ZYUA 5ERXA 2XQJA 3ZV5A 2D1RA 1HYHA 3LBAA 1Y3AA 2VJAA 4G1MB 2D74A 3ZPXA 3AVYA 4FFBB 1Q77A 4FCVA 2ZS9A 4GMHA 2JFGA 3O21A 3IVAA 1OYYA 4FEEA 3K0CC 1E3WB 4MV3A 2AB0A 4KGZA 4YMGA 1Q1GA 2AMYA 3L46A 1ACJA 1VLLA 3T3EA 2D5AA 5IAEA 2FUG1 4X3PA 1PVVA 2NU7A 1I3LA 4QFCA 1FXWA 4QDXA 5F9HA 2MOKA 4M9ZA 2JRCA 2PO7A 2YINC 4NEGA 4X9XA 3RS3A 4Z3KA 2OZLA 3ICEA 2XPCA 3GAAA 4I46A 1QTNA 5T64A 3EWNA 1VRVA 4DLXA 4LXIA 2J07A 3R5JA 4DR1B 1X38A 2O14A 2OXIA 4V38A 3FFTA 2C8VA 1GNLA 2QAJA 3K0KA 3PE6A 4UE6A 4ECEA 1ODTC 4KH1A 1E92A 2DPYA 4KX3A 4AS1A 2AYXA 4DEVA 1D8TA 3C87A 2HD4A 1OJ7A 1RXYA 3NUZA 5A2QA 3FYDA 4UEOA 5H16A 4M1OA 1NUUA 4A03A 3ER6A 1FYDA 2B7BA 3OY2A 1XQ6A 4B09A 4PR0A 3PQFA 4I19A 4YCBA 2IYEA 1XQYA 1RQLA 2HBQA 1GOTA 1U7WA 4W5QA 9ATCA 2WU3A 5A2GA 2QRHA 3EZGA 1PJBA 4U7HA 1GTG1 1BXGA 2QVCA 1PE0A 4HO1X 1II8A 1V4BA 4YRCA 4D8XA 1OLUA 2NVBA 5IJZA 1NYQA 3WI7A 4DKJA 2DFPA 2ZT7A 2YZ7A 4PO1A 1ZI6A 3EA5A 2I67A 4KNWA 4MI3A 6ABPA 2YZ2A 4PLHA 4OOFA 3O8RA 2QF7A 1VIAA 1AKYA 4U2FA 4AJIA 5B7QA 3WGZA 1CB7A 2B6HA 4HXYA 4JKOA 3DFUA 1DKMA 2VPZA 2ZM6B 4Y2UA 3VR4A 2QMQA 4YAJA 1P72A 4BVEA 1JQKA 4EUEA 3P5SA 3TD2A 4MWSA 5A4DA 4INOA 3Q7RA 1FBTA 1WUKS 2KW5A 3R7LA 5IXYA 2YWGA 5MFPA 1YU6A 2WQZA 4FXPA 4BMXA 2QTTA 3D8UA 1M1YB 4FGUA 3KQLA 4M8KA 4FK8A 1CQIA 3HYSA 2JFYA 3L8GA 1JFLA 3LT4A 3MJEA 3ROZA 1YDMA 2WI8A 3LA6A 4R40A 1C3OA 4AM8A 1JQAA 1TUBA 5DLPA 3EEOA 5DM2A 2D2IA 2A35A 3AIMA 3IEVA 1WEKA 3HN6A 3QVMA 1M8KA 4URWR 3VPGA 3WC4A 4DUPA 2VDKB 3JARB 2DUNA 1XJWA 2AH5A 4HAIA 2K7ZA 4JKIA 1L5HB 4OBXA 2QM3A 3WG9A 2WYWA 3PZBA 3I42A 3CNLA 2G63A 3BCHA 2GXAA 4CLDA 3DM5A 3O92A 4QUKA 2HIMA 5TQ2B 5FKJA 2QXUA 1CJUC 2WWFA 3H42B 3SQNA 3TNDA 3VU9A 3KZOA 3NBMA 5D1NA 5FOVA 3OZXA 5B3AA 4C5CA 4CL8A 1JEQA 1GY8A 5BN3B 3N9IA 5K9ZA 1G18A 1M1ZA 1PJQA 1UJ2A 4LDJA 3ADOA 3BS4A 3GJQA 3GV0A 5BURA 1D09A 3G1UA 1KQFA 2DCUA 3FBGA 1IUKA 2X0FA 5L4SA 1HYBA 3AEZA 3I1JA 3K96A 3OZ7A 1JFFB 2VDLB 1VDZA 2YZKA 1USKA 2NGRA 2WV7A 4IKOA 1BQ3A 3CBQA 3HC7A 2DFVA 5EWLA 1H6CA 3EIHA 1Q0PA 4XLLA 7MDHA 5TARA 3GL9A 4M1MA 1W5TA 2HYIC 3KUKA 1NQTA 2UYOA 4LYEA 1KFJB 3WLTA 3B1JA 3EFOB 1WW2A 1W581 1SHJA 1H9CA 1G20E 2WNSA 3CLHA 5E1OA 4CQNA 1QGYA 4MLZA 4MP3A 3MERA 2JZOA 2Y1DA 3GFOA 1FBNA 2VXOA 3DDNA 1PNRA 2WJAA 2G4CA 2CWWA 2ZT5A 1QO9A 1Z7YA 3DP9A 4OATA 1D3AA 2H1SA 1QVWA 4L78A 5CDUA 2WT8A 3LHFA 1VE3A 1A9YA 3KYCB 3NORA 4JP8A 1M34A 2GSWA 4KRXA 3VDMA 3TG8A 1GNQA 4NX2A 3A25A 4MOWA 2I3GA 1XE3A 5CG2A 4AY2A 2GAJA 3CVUA 3BK7A 4URUR 5AK5A 3RDPA 4JI0B 1NBOA 5CAEB 4DCVA 4WY5A 3ZHSA 5C1OA 3PA6A 4FX5A 3OM0A 1T1IA 2O7VA 4URFA 5JMOA 5J2TB 3H13A 4FYJA 3U7QA 1UEJA 2ZR7A 2WEKA 5K3FA 2GD2A 3HEBA 1B6GA 4DA9A 3CKKA 1LK5A 4MRVA 4GSLA 1NNI1 4AQ7A 4H7EA 1W0KA 4JLPA 2ZI3A 4UXJA 5HF8A 4HSEA 3P9IA 2GA8A 3HSYA 1YUNA 5AM0A 3OZTA 5EMKA 1LTQA 3PDIA 2JAPA 5EWMA 2BZSA 5HZMA 2A0KA 1B16A 5FEMA 3SKVA 3QMMA 2QP4A 1C7ZA 1FQKA 3ADCA 3SKXA 1TAUA 1YVUA 1MAHA 5F23A 2JPDA 3CNQS 3U7IA 1DHTA 3WJ7A 3SVTA 1A4UA 2UXCB 3E1KA 5FV7A 1J24A 1PJ8A 4X1KA 3WHLA 1VJ5A 3NOVA 2V4UA 4I2VA 4MB2A 3VR3A 1EPUA 1ZCAA 2HSZA 4GMDA 2G5TA 3ZCQA 5BN4A 3IT0A 4YYZA 1U0GA 1QV6A 2WJZB 3CX8A 3QPWA 4QU9A 5DP2A 3ZK7A 2FWJA 2P9TA 3PXGA 1ADCA 2R4UA 4R69A 3HPRA 5LM3A 5FORA 3CQ9A 3HA7A 2ERCA 5ITVA 5DRTA 3K9GA 4LHWA 3U9SA 2ENUA 2GZHA 4Y7DA 3S1SA 3PPXA 4G09A 4IQ4A 2OM2A 2EW8A 2ZQZA 2X5XA 4OQ4A 1T36A 3BL6A 2YZGA 4TN5A 5CJJA 4IXDA 1VFPA 5D5HA 4RTQA 2TMGA 1KYTA 2YIDA 5F1KA 3QXGA 4Y6QA 3FCCA 3S2FA 1FNCA 1UJCA 4AY5A 5KX5F 5H82A 4LWOA 1UP7A 2P9ZA 3O75A 3B2NA 2VSQA 4FCCA 4LDQA 3L0OA 4RQAA 3GN2A 1BHJA 2VF2A 3ELDA 5JATA 2EZ9A 1EVEA 5KZMB 1ETUA 4GF5A 4QPJC 3W4IA 4S1TA 2AS0A 3THWB 2GAFA 5DYYA 4RTLA 4EJSA 4EZEA 4QOIA 2NM0A 2ZATA 1LB1B 2H0AA 3AHJA 2YH2A 3AEUB 4RPJA 3HXQA 1SQ6A 4BPBA 4D46A 3F4LA 2OAEA 4JT4A 5FTMA 4AY4A 3ZQUA 4Q19A 4Q9KA 3V46A 3KPJA 1H1LA 3DSRA 1PZEA 5E4FA 2DF8A 3IHKA 3DE5X 3PVSA 2YIMA 5AVJA 3KSDO 5TEWA 4GX5A 4CM8B 1VHQA 1J2UA 2I4NA 3M49A 1XVIA 4DBVO 1E4EA 1UMBB 3OCWA 5BORA 4GMGA 3HI4A 3II6X 1NOJA 2IBMA 2C3OA 4MDHA 5TSDA 5AVOA 1S3IA 4EF6A 1YR3A 2E18A 1V8BA 4NF2A 4LCEA 2HEGA 4D0NA 2FV8A 3FLMA 5JYDA 5FI1B 2C5SA 4ED9A 2QNRA 3AI2A 3C4JA 1ICEA 4HAUA 2YRWA 1YR7A 2QA5A 3FOCA 3IUMA 3P4UA 4LC0A 4P54A 3HYLA 1NF8A 4TLEA 4U2KA 3N0XA 4FUQA 4A4DA 3VDRA 2IOHA 3EX7C 3A9TA 1N0VC 4C7OB 2W2TA 3AWDA 3EQ6A 5FLXA 2ZRPA 2XF8A 3G2MA 4D9JA 4HDNB 3QEBZ 5A3JA 5DWQA 2P1ZA 3EC2A 4RANA 1PV4A 2AYYA 2VH2A 4JYCA 4PZEA 4BRUA 2IS4A 2R6AA 1YQQA 2CJFA 3CYFA 3GLHB 9LDBA 3B85A 2J7PD 1V2GA 1Y80A 3G2PA 5F2OA 3UHJA 3ITDA 3Q2IA 1CIJA 2X6QA 2EWMA 3Q6MA 3QF4A 4KRYA 2E55A 1JIUA 1DINA 1QDLB 2EJBA 1QE3A 4A0GA 4D9BA 4OFWA 4NCIA 3LFHA 3U56A 4OJTA 1DQPA 3EEBA 4R54A 4D5GA 4E15A 1E1CB 4P33A 2OZPA 1S4MA 4FGKA 3P0JA 3RABA 1OXSC 3QPAA 3Q10A 4Z4CA 2I2XB 1ZAYA 3NYRA 1X74A 4YRSA 2I4MA 1KC1A 4M1ZA 4YRLA 1EUDB 4NBLA 2VQ6A 1GT91 1M6WA 3UIEA 3TZ6A 1K7XB 3OP1A 4QPCA 4X00A 4YQEA 5IXJA 5KWEA 1EESA 2HSEA 4QU0A 1P2VA 4EY8A 5LWHA 3AB8A 5LZ5A 2X9GA 5FYDA 2XGGA 2ZTMA 3B5EA 2FFHA 1X42A 4X7PA 3JAMA 1F2UA 2HA4A 2CDNA 4DDTA 1SCUA 1L7RA 5FP0A 2OBFA 4I1YA 2NUAB 1RXEA 1SKMA 4B3MB 1U99A 3FUUA 5JCZA 1DIHA 1RYYA 3LA8A 1LK7A 4OFBA 1XPRA 3QNUA 4JASB 4EDFA 1VPWA 2J0UB 2MINA 1AZTA 1NJ5A 4MYRA 4L51A 3TR6A 2BHRA 4HG2A 4BNIA 3HFJA 3TKLA 1O57A 2PUHA 2KBEA 3ZZMA 3AXSA 3FR7A 1O0SA 2PSFA 3OQNA 2BZ1A 5TGTA 3CSSA 1TZKA 3QMWA 3BK2A 3K73O 1T24A 3E18A 1ZN9A 1HE1C 3KL4A 3OPXA 2IRWA 4NV1A 4DNFA 1QZ3A 4MR8B 1WV1A 4LVUA 2CKDA 4QNNA 1XX6A 1NHWA 4KIGA 1I1QB 4MVJE 4B47A 1RYBA 4MKFA 4P84A 5HM8A 2JFFA 4MVJP 4RHXA 5DSXA 5A5EA 2VHUA 4F2PA 4KPGA 4CG3A 2I76A 5B6IA 1R3UA 4QICA 2GAAA 1EGAA 4JR2A 3VAAA 3AKDA 3LPAA 3TQSA 4QKQA 4C22A 1LFAA 5FBVB 5AUPB 5JZMA 4UCQA 3RAJA 4MDEA 3O5AA 2YFYA 1J90A 2FJUA 5KJCA 3O8BA 1AQUA 4CR6A 1XLUA 4DILA 4MVWA 3ZHOA 4L72A 1F3OA 2FWAA 1C14A 4X24A 1Z4LA 2VWGA 4DABA 4EG1A 3PENA 5LSAA 1VKZA 4RNCA 4W5RA 1VI2A 2J45A 4E2FA 4YT2A 3V1YA 1U7TA 1HA3A 4M4SA 4UQOA 4PLPA 1GKIA 2JLVA 3Q9SA 4G4SP 1L4EA 2FMIA 2H9IA 3PP8A 4TSFA 4GXQA 4OMUA 2ZR9A 4P4LA 4YJ3F 1JQBA 2H1IA 2BR4A 3RS7A 1US8B 3CONA 2DFLA 5GM2A 3F47A 1H6DA 5A7FA 4TWAA 2BE9A 1V3VA 2YYYA 3GJTA 3GRKA 1XCLA 1C7QA 1IJFA 4IVQA 3WMXA 1NQ5A 1HV8A 1OSNA 4C04A 3O74A 1UJNA 3GFRA 2HDOA 5I01A 4L74A 2CFRA 3SPXA 5BYBA 3OT5A 5IP5A 4BP9A 2H7VA 2FCRA 3N2KA 4FIDA 4ES6A 1GV0A 4KRGA 4B9AA 1G8MA 1TC2A 2APJA 4QE3A 5C5DA 3THWA 3CH6A 2IVFA 4R1QA 4IJ6A 4BB6A 1KXZA 2F90A 2PPLA 3BL5A 5DHAA 5KJ6A 4Z3OA 3FYUA 2VATA 1ZIOA 3WISA 5DOZA 5JH7F 2D5LA 1V25A 4ZEOA 3AZQA 5CX4A 3W4KA 4CCYB 5CNIA 3UAOA 2ZREA 2ZU0C 3TIIA 4YV0A 2VOJA 4PYOA 1P45A 4HDSB 2Z09A 4G97A 1O9HA 3RANA 3ONEA 3ZC3A 4ZGBA 3K6SA 2NUBA 3SR4A 2V7BA 4L0QA 4W7HA 5IYZA 5IS2A 1T2AA 4DWJA 3SJ7A 4D43A 2L69A 2Z8YM 4NCAA 4DAEA 4MQFA 2REQA 1O95A 4RH3A 4R1LA 4PAOA 4YUAA 2G3YA 4F4JA 1NBHA 1XVTA 3FPGA 3UKDA 1F2UB 1U3DA 1YB2A 3W1EA 1IDOA 4EX7A 2Z5LA 3R7WB 2PUTA 1XPOA 2XBUA 2UKDA 3TIGA 4YV7A 1CUJA 3DCNA 4LJ8A 5FAXA 3L04A 3ONNA 4P0TA 1IQ0A 2DY1A 2BTQA 4FD2A 1E1NA 3DVRX 4AG6A 1GUBA 1V3UA 1NJGA 1YI0A 2FGJA 1QG6A 2J6IA 4J9VA 4QGAA 1L7BA 5TPZD 4ER0A 2BKUA 1K6MA 1RJ9A 1U81A 2L0XA 2RHMA 2WD7A 3UICA 3Q5GA 3NPMA 4JQCA 4YWJA 3WE7A 2R65A 3H9BA 1YA4A 3BHJA 2IF0A 3RRMA 2GUGA 3LYAA 4RPIA 3PDCA 4MV7A 5F9MA 1FFYA 2AOUA 3IVXA 2P6UA 2XB6A 1JT2A 1Y8AA 5J3JA 4S1NA 1E8NA 1JPNA 1PZNA 4TLCA 3UHAA 2WRZA 4OI0A 1GO2A 1YJBA 2PD6A 1F4VA 4MGHA 2DPXA 1J56A 3OHSX 5DTRA 2QZ4A 1HWYA 2WG1A 5EA2A 3GQBB 1ORRA 2YFKA 5EMLA 3VX3A 2ZJYA 4BASA 3IEKA 2VWQA 1UDXA 2OO5A 4HADA 3CLUD 1VHLA 4MS4B 4DQLA 1MU0A 5FWYA 5HKOA 4N3AA 3AO0B 2CZGA 4AW9A 3DT6A 3FGZA 1CQXA 5CURA 4EI8A 2XB4A 2OQVA 3VM6A 3RIXA 3N86A 4F3TA 4PFJA 4RTOA 3WWOA 3JQGA 4YRMA 2SNIE 4FGWA 4M1YA 5T8KA 2H7YA 3P8ZA 3SF0A 1PSWA 3D5TA 2C4MA 4PN7A 4N48A 3PCRB 3QVKA 4R1OA 4IW3B 2WVGA 1HT2E 2YY5A 3EGXA 3OH8A 1XD2B 5A71A 4LF6B 2ONCA 2A0FA 3DF9A 4C29A 4AJHA 3T7DA 1M2FA 2Y92A 3GIWA 5T5QA 1PG2A 4PCAA 5H02A 5C18A 5BSKA 2CMFA 5C80A 4X7MA 1V96A 3TL6A 1QCDA 2OK7A 2E89A 3TQOA 4BATA 3LUAA 4P82A 2SBTA 3F8WA 3E70C 3I1YA 1QIEA 3GFPA 4K40A 3GFTA 5AJUA 3ZE2B 4W5JA 4UAGA 4KKVA 1BZYA 3HKDA 3I9OA 5C35A 1XTPA 1BW9A 1ISHA 4NJOA 3U49A 1WVMA 4IQ8A 4LYFA 3NONA 1D0IA 1RI3A 1T2CA 1TO6A 2FW8A 1QS0A 4WZAA 1SAYA 1T6ZA 5J9FA 2WD7B 1E3LA 4R41A 2WA2A 4RPHA 4JMLA 2I3AA 2YVKA 5JVDF 1ZIPA 1ZOSA 2ZKLA 5DWVA 1LBIA 5F2NA 1U1DA 3OMWA 3OT1A 2CJWB 1FRVA 1IHUA 2SHKA 3O3CA 3IOEA 4MGIR 4LW8A 2ALJA 4NESA 2GMWA 2FEKA 4QRDA 2C5LA 3G9QA 1ML3A 4RABA 3INNA 4FXOA 4IYRA 4R7GA 3AR3A 4B82A 4OBBA 2Q6VA 3UA3A 2IEGA 3GP5A 4UASA 1LTKA 2CE7A 2EWVA 2I1VB 4YP6A 1YAJA 5A3RA 2ZYIA 3SOZA 1LSJA 3BCRA 4S05A 2EJVA 2NSHA 4MUJA 5JJKA 4RZ3A 3IXLA 5IRCD 1UBMS 2X1MA 2A1TR 2FW1A 4HRAA 4MWZA 5B58T 4M0DA 2Q6OA 3C3EA 4NNPA 5IC5A 1J8FA 1V45E 1XCGB 5IVKA 2OO5C 1ZNZA 4N3GA 2QT1A 4YAIA 1DP4A 2R85A 3OX3A 4OM8A 4N12A 4CLXA 1JKJA 1MPTA 3AJDA 1PDVA 1U3CA 2ZJ6A 3ZW8A 4S1PA 5IVHA 4MUGA 2O05A 2N42A 3UHOA 2PXAA 2ZT6A 2AOTA 2XNSA 3HCNA 3KLBA 4L9SA 3BMNB 3QVSA 1YNSA 4G5XA 3DMDA 4BGIA 2G0TA 1TQ2A 2PYZA 4ER5A 1SUWA 5B1IA 3OJEA 5JARA 3BDVA 1N6OA 3E2MA 2VJNA 3EF3A 5FPSA 3JD2A 5HDQA 4DWOA 1TA0A 2PZFA 5LXTF 4BX2A 3RF7A 1QQAA 3FOBA 1JIIA 4BZQA 2DWQA 3FWHA 3NR2A 3EEQA 3ORRA 5AM1A 4YJGA 2ZJ0A 3OZDA 4YV1A 3H1EA 1D9XA 2J67A 2Z1DA 4LBWA 1SN7A 1Q3HA 3ROGA 3AONB 4XPZA 4YIHA 1TJPB 2DB3A 3OX2A 2PH7A 1CIPA 1MJHA 4BC1A 5JSFA 1CF9A 2G4LA 3DP7A 4O0LA 4GPIB 1S8OA 1Z38A 3BH6A 4V39A 1DZIA 2WYIA 5BSUA 1QVAA 1Z5VA 2C54A 1IJEA 4CMEC 5KIAA 4RZSA 2C5EA 2FETA 1HZZC 4AMVA 3OF5A 1AMNA 1YZ3A 3KOMA 2VJKA 4KLZA 5AK0A 4DMLA 4O4IB 4YMWA 4GYJA 1SCKA 1T91A 1YR9A 2BHTA 2WT4A 2Y76A 4NE2A 4F4HA 2YYZA 4QO7A 3KBOA 3L93A 3TKAA 2Y4OA 3ADBA 1TIPA 1XMSA 1C4XA 3F6PA 3Q5EA 1GCIA 3NWPA 4X66B 1J1IA 2OZLB 5BQOA 2B35A 4H4EA 2L2QA 4EBFA 1KFEB 1R10A 4UM9D 5DGTA 3MTAA 4D2IA 2WSBA 1DAMA 2NU7B 1S2OA 3K2EA 3R74A 1MNAA 1IY1A 4QDTA 1DE0A 3HM2A 3T8YA 3ZDAA 4WXMA 3T5DA 2W71A 3M89A 1E69A 1LI5A 4ZT3A 1Y9DA 4YJDA 4PGAA 4DIFA 5KHOC 4QUGA 1C2TA 2VAWA 2QPOA 1Z25A 4H77A 5BO5A 2R86A 1J2JA 1Z6GA 2QQGA 5LUBA 1ZIDA 3MS7A 4CPDA 4PNEA 3SJBA 5BVHA 2VTEA 3H11A 4EFMA 5JNWA 3QOWA 1R74A 1P6QA 1HLDA 2JI4A 2A6PA 3B1ZA 1VHJA 1YDGA 2GBIA 3P71T 5JVDB 4DT1A 1NVTA 2W93A 3OJ0A 4ZT7A 1I1OA 3ETEA 2SKDA 2AQ8A 5DI9A 3ZXUB 1L1QA 5EWJB 5ICGA 1BN7A 2VTBA 2D1QA 1BU5A 2YVLA 3IPRA 3LNCA 3NBYC 1PF7E 4GOND 2HFKA 1LC3A 1QH8B 3IAM1 5JEDA 4K2HA 2QN3A 1XBTA 2GDJA 2GYWA 3B1KA 4RGVA 5CVVA 4D9EA 4BLPA 1I5OA 4V0MA 3UWOA 3KZKA 3MUNA 4NZPA 3EHDA 1VJCA 5EC8A 2OYCA 4ND2A 1JKXA 3W5UA 3N6RA 2QTCA 1FDOA 4WKBA 4N8DA 3W9BA 1NVAA 4RNDB 3TNJA 4Q4HB 3U0VA 2PX5A 3KKLA 4OA8A 4ZHSA 1XYVA 4FI3C 4QBHA 4QO8A 3HFRA 3W8EA 1MN6A 4MW1A 3UXMA 2R8ZA 3ACBA 1NFFA 1U0OC 2D8AA 3ILSA 4IHKA 3PX3A 2QX9A 5EJGA 4GXRA 4BP1A 5BYAA 5EJ5A 3UT6A 2G25A 2X19A 2QLTA 4REQA 3I4LA 3PWSA 1E63A 1DIBA 4M21A 2IUEA 3WA6A 3WGLA 2B21A 2J9ZB 4G41A 2B3TA 3COWA 3KC2A 5BUQA 2FNAA 3FFXA 3GZ4A 4FS3A 3DZCA 5EE1A 1GGHA 5BNTA 2ZDHA 1XRSB 2VHCA 3C6MA 3BAZA 3RQSA 3ZWCA 4N39A 4I4TB 1GG5A 4RLFA 5DYIA 3DKRA 4WZ6A 2B8NA 4R0MA 4Q02A 3NJ4A 5GP1A 4Z7QB 1R9GA 4BNGA 1BQ4A 3JPWA 4PLVA 4Y0NA 2FX3A 2OLEA 1QGZA 3RRXA 4Z0PA 2R66A 4WZAE 5I7EA 3CUSA 3ZWMA 4WN9B 4XRRA 4XYEA 3H99A 4IIHA 4PRLA 1IEXA 2C9ZA 5CX1A 1SU8A 4DBLE 2JCXA 3WMFA 2AE1A 1X8LA 2L18A 1X77A 1IVYA 1J2RA 1ZQ9A 1R64A 4LOKA 1UPTA 3UAYA 2J33A 3MW8A 2O1XA 3H6HA 4BO3A 1T2EA 1VIMA 2F7SA 2R25B 4DADA 2JGRA 3NBFA 2B8EA 1B0AA 4X20B 2FRDC 3RR2A 5C1IA 3X44A 1FTGA 1NP7A 2HMUA 3JQ9C 3TWOA 3ZE0B 3I37X 4BRZA 1FW6A 2RHLA 1YVPA 1LNZA 5EWJA 2VTBB 5FIUA 3N74A 3FD8A 1P91A 1TZBA 3EH1A 1KYXA 1WMSA 2ZT8A 3H7IA 3GLIE 1ZD9A 4BQOA 4F91B 4D4JA 1VLMA 1Q2XA 2CJYA 3U44A 3NANA 1E2HA 3LQYA 1EFAA 3OZFA 5EYPB 5JSQA 1AOXA 4U0KA 5IF3A 2VTVA 3KOWA 3NEJA 1GL9B 4EAAA 1JWBB 1DAOA 1ADBA 1KMMA 1NFQA 1SCNE 3WB9A 1XMOB 1AKWA 3AHGA 3PL5A 1JG3A 3A6DA 2RBEA 2FUG6 4V03A 1M34B 3T7TA 2C3MA 1OE0A 4LE2A 1DJQA 4H1HA 1XMVA 1N5OX 1T8UA 1FFWA 3A6GA 1P6XA 1W73A 2F3QA 3PEFA 4UEJA 3AM3A 3E7XA 4JX9A 2OFFA 3DFKA 4BTEA 1YI1A 3T5AA 1K86A 3CTPA 4K9OA 3GW8A 2H2IA 1XXLA 2YV3A 1SCBA 2JA1A 2CL6X 4G8JA 3LPNA 4I1SA 2XBMA 4NC9A 4EEZA 1OGJA 1NIJA 2P67A 3R9IA 3AVOA 4D99A 4WZBA 4EFLA 1L8XA 2PDAA 1OAOC 4HT3B 2W42A 3WDLA 4NBUA 3AUXA 1CZLA 1C3LA 4OQLA 3GLGE 3I01A 4UPVA 1A7JA 1AG9A 3HUTA 4LUCA 3BKXA 2XMRA 2Z2YA 4IMPA 5K3FB 2X8AA 4EVRA 4CNQA 5KWSA 1HQKA 3PDJA 5A02A 1UODA 3V4FA 3GH1A 3BE8A 3S68A 4D3DA 3KJHA 4RWEA 3HGQA 4OYRA 3FSRA 2ATVA 5DF1A 3STTA 4Y2YA 2PN1A 2FEOA 3KSUA 1IQRA 1AGYA 4KO1S 3CMMA 4V0RA 2DLCX 3GBVA 5B57C 1F8GA 4GPAA 3HCOA 5EHIA 1AKMA 1M1NA 1N6IA 1RTKA 2I6TA 4S1WA 1LJUA 2OPBA 4QU5A 1WLYA 3ZWXA 1YVEI 1KOFA 1P7WA 5JE8A 2OCGA 3CGWA 4PBRA 4UNNA 2B61A 2HXYA 4PGHA 1II0A 2IXTA 2QTZA 1NKVA 4WJKB 4F96A 4PE5B 1KY2A 4LOHA 3DE1X 3I0MA 2PX6A 3F5QA 3GCWA 3F7TA 3T1QA 1SVUA 1LW6E 4N65A 3AZOA 5AKGA 2ZANA 4Y1RA 1P5FA 3ED5A 1Q50A 1AHPA 4GNKA 5ALOA 3A05A 3E5RA 4B8YA 1ZY2A 2MJLA 3NM4A 1B00A 5K3BA 3G5LA 5HFJA 4FCWA 1TCCA 1GAEO 3FRHA 5AKIA 4I3FA 3EBPA 1W4CA 2YDXA 3GRRA 2A9FA 4ZREA 2HZBA 4ND6A 4DLLA 5K5EA 4MA0A 2HLPA 4LF8B 3OWXA 3OD1A 4FFVA 3GCXA 3VZPA 3BWBA 3CLTD 3E22B 2NZXA 4ZO6A 4HDMB 3KBBA 4K9DA 5AOCA 2O1SA 1U65A 1D5WA 1E2FA 3ZJTA 3KV1A 1K4YA 1QVRA 4KVZA 5J4HA 2SKCA 4LJYA 2HLDA 4LV8B 3A1NA 3BERA 3RVRA 3I61A 1EWYA 4H7DA 1NZDA 1KY5A 2HF7A 2II6A 1SBCA 2V9PA 1UBNA 3K2IA 3I9V6 5SY4A 3BIJA 3RFTA 3UYKA 2EJCA 2FMFA 4DCGA 1UK8A 2QSUA 2I8AA 3GRCA 4Q6WA 4HEHA 3UB2A 4B4KA 1P1RA 3NALA 2KMLA 4HQNA 4QVIA 1TMYA 1JDBB 2IEZA 3N39C 4LHYA 2HMTA 2BAGA 2XKJE 4OJQA 1AD2A 1VZ3A 1QVVA 3A6KA 4GZ6A 1KMCA 3R3ZA 4MICA 5ER9A 3RB8A 3V9PA 1M54A 1KFBB 4IO0A 1MNQA 2BF7A 4TTJA 3QMVA 2EKQA 4OHOA 3F7OA 5IMBA 1GDTA 1DXYA 2AVDA 5IFKA 2C29D 5EIHA 4IDDA 3P4YA 1UWVA 3LBIA 3WGVA 4NCJA 3BHNA 1ESMA 5HF9A 4A1FA 4D25A 4JUAA 2Y6UA 4M0FA 1BE6A 2R1TA 4PFSA 3LKBA 5A4KA 4KNVA 1WULS 5KQRA 3UMJA 1BKYA 4XIGS 2OC9A 1QRAA 3JWIA 5IKEA 4I8IA 3L1IA 2QPAA 3T9AA 1B93A 3PD7A 4X92A 4CTNA 2WE8A 2I6GA 3D8SA 4B8ZA 4TVSA 3N2IA 3TDNA 1YACA 4IKPA 4XYLA 4EI9A 4FTWA 4OH1A 2WU1A 1U3TA 1V5WA 1E79A 2BCJQ 4KR9A 1SHZA 2RK4A 1O7JA 1QGDA 4U6NA 2R1UA 3RREA 5A5VA 4X6UA 3O8QB 4HGZA 2HIAA 2IYNA 3HA2A 4CN8A 3RS9A 5BWOA 3PR3A 5CB4A 2H3EA 4KVAA 2ZSKA 3ZVRA 2HMWA 3F3MA 3KAPA 3VSBA 1K68A 1G4AE 1Q1BA 2MYNA 3MJDA 3D2AA 4C03A 1RJGA 1YQWA 2Q9AA 1BA2A 2WHRA 4V24A 4I1PA 2ZU6A 4RPKA 4K6KA 5SY9A 3D8BA 1BS2A 2OD9A 4GWGA 4N6GA 1IUPA 1U2DA 3T7EA 5CDYA 3C6QA 2VRBA 3S1AB 1T1SA 1RACA 2WJ3A 1PTKA 4PV7A 4AZSA 4CIDA 1IMJA 2UYCA 2P79A 3MCWA 4HLUA 1FX1A 1JWAB 2O3SA 2V58A 2AR7A 3KE8A 3L8DA 4E46A 3NMUF 4BCCA 4Q9DA 1MQAA 3V7NA 3CVOA 4RD1A 1IY9A 2WUFA 4WVLA 1E1MA 4XWYA 3ZJVA 1PFYA 1R2QA 3CLUC 4H1VA 5KYTA 1KMHB 4PSUA 3UOWA 4JLWA 4F7WA 2H2FA 1TIBA 2R7MA 3OJWA 3EXHC 5A5DA 2P2ZA 4OY3A 4IXMA 4UHHA 3WB1A 3UT0A 4ZU6X 5G41A 1CUHA 1AHHA 3EPKA 1GGVA 2V59A 2G28A 3TRJA 5JH7A 3L1KA 2GEVA 4G0UA 4R2XA 3BM5A 1NMYA 4J91A 4FHCA 1AIPA 4PNPA 1XVAA 3ILXA 3DE3X 2H7XA 4E88A 4HV4A 2QL5A 5EVCA 1EX9A 3QTBA 3QITA 1L1FA 3ULKA 4AXBA 4CLOA 1EM8A 4CKXA 5JFGA 4ZCSA 1DRKA 3V8VA 1KDTA 2ODEA 2FYTA 4LSGA 5CTAA 3RG2A 3ENWA 1THZA 3CCFA 3T9EA 3PUJA 1B0ZA 4ENRA 2W58A 2R6R1 3R7SA 3DDUA 2XT6A 2NIPA 3D4BA 2XMBA 1ND6A 5CJPA 1A8PA 2FPKA 3E9CA 3HP7A 4Q39A 2C61A 3OF3A 3EVFA 4MRPA 3VPDA 4PSCA 2V74B 1SPXA 4TYNA 3F67A 3NC4A 1BVRA 1E7MA 5HQTA 4QBFA 1TDJA 5B1EA 1PR9A 4TKLA 1YJQA 1Z7EA 1L7MA 1QXSA 3FIUA 4TL6A 4GGPA 2VP2A 4KQ6A 4EELA 4ZYVA 4RL6A 5EXEA 4MMZB 2E82A 3U61B 4PSVA 4E11A 4XX0A 5B3LA 2CSXA 2D1YA 4QASA 2NQ2C 3HB7A 4NZMA 3RFUA 2FX2A 4JBYA 3ZXXA 5C37A 3CZ9A 4QYTA 4FM9A 1LV8A 5T4FA 1NI5A 4NBNA 4XIFA 1VE1A 3A3PA 1SVOA 2Q41A 2LDBA 3Q3EA 4LRWA 4UUMA 4WBXC 4QXMA 1US8A 4N5NA 1HGXA 1CYDA 1GV1A 1OBCA 2E37A 2P8SA 1IG3A 3IIEA 4IHJF 5KOHA 2QGFA 2XMZA 1X14A 1GQQA 2JIOA 3VPXA 2BCEA 4UATA 1QHHA 1JBKA 3ILVA 1R0ZA 1Z4JA 1FP1D 3ONFA 4EJMA 1GM5A 2FPOA 1G8KA 2J3EA 5D3ZA 2C8KA 1CVLA 5KYYA 2DWPA 3R5FA 3KTAA 3VU0A 1G63A 2W2VA 4N54A 3T4EA 1PJ4A 3IQEA 3CW9A 4FHDA 4FIZA 3PBKA 5C7YA 2QZJA 3R4VA 2UVDA 3STVA 1ECPA 3K0EA 2ZUFA 1J8VA 1JA1A 4AN1A 4LS3A 4BQPA 1Z8HA 2IELA 4LZAA 4QXAA 5A04A 3KQNA 5JYBA 1Z6AA 3NG1A 3PWTA 4UUQA 2A4MA 4CUJA 4A16A 2VP0A 3N6VA 2XNDA 2DHQA 1IXZA 4F5EA 3EFBA 5DM1A 3PQ3A 3X1KA 3KU4A 5HKBA 2ODQA 4KR6A 5HK9A 4DLZA 5DSTA 2ZYAA 2X41A 4H18A 2YMMA 2PR7A 2XCOA 2N0SA 2IP2A 1BRMA 3B89A 4LJRA 1JFVA 4RC9A 1Q0HA 2IL1A 2R6CA 2O0KA 3EVCA 2VQEB 1M2KA 4B7UA 1I2MA 2JD1A 1ZO8A 2PU7A 3KZNA 3FNIA 2FPLA 2ZRMA 5JHGB 3VX4A 3FCEA 3P2YA 2CJWA 2LRHA 4BV2A 2VA8A 3H8VA 3IO3A 3UY4A 3HI6A 2HBYA 3ZCXA 2EGGA 1IXKA 4HNHA 3Q72A 2DETA 3KVYA 1A04A 1SD1A 2JG3A 5EUQB 4G23A 2HK7A 1O58A 1UC4B 1O9GA 1S02A 2W8BB 4I1UA 5K0ZA 2JFBA 1JG7A 1LJ8A 4D9KA 1FFGA 2YFHA 4C0AC 3BHIA 1ZD8A 2VDVE 3LDHA 1JNYA 2ZJZA 3UJHA 5GADl 2MDTA 2EFCB 3HA5A 4PO3X 4I1RA 1N7IA 5AVZA 2O8FB 1D2MA 3ND8A 1I0LA 1L4LA 1O1YA 4KXMA 1V43A 4XGRA 5I45A 3MPOA 3IAAA 4X84A 5E7MA 4ZMRA 2OXFA 1XZ8A 4UAUA 1KK2A 2WSLA 2QOEA 2PH3A 2FZVA 4HUQB 3GELA 3D0QA 1PJ2A 4MR8A 2G9UA 2J3MA 2Q8QA 3EVDA 4PZUA 5HJ7A 5I7HA 3X0DA 1P9NA 3I1IA 3TI7A 5LQKA 4KSYA 1VLHA 2B4TO 3JAKA 5JZ9A 3B9RA 1J2TA 2V97A 3BSWA 4UBMA 4NJEB 1KZGB 3CRNA 3W5CA 1KVRA 1T8YA 4L5IA 1Z6ZA 3EXEA 4MR9A 2TS1A 1T1JA 5IDXA 4FFDA 1DADA 1FMLA 3ASZA 1T3SA 3N07A 3THSA 4KQMA 4YAFA 4YREA 3AKZA 3CZCA 3LF1A 4ZU1X 1JAYA 2Q9BA 1F1BA 1EK2A 1ISFA 3WAJA 3BXZA 3OWHA 4ZQIA 4W9MC 5IT0A 5GTDA 2NAPA 2VNAA 1N6RA 4J8PA 5JNSA 2HOQA 1Z4PX 1EHIA 1OA0A 2G9ZA 2SCUB 3D8RA 5AKKA 5EQTA 4BNWA 3ZI0A 2Y0CA 2VKTA 1RLMA 3TLGB 3EZ6A 1OAOA 1FXUA 4B4VA 1C3XA 2OUKA 2W2LD 1VLJA 4E32A 3OZEA 4GWKA 1ABBA 4EKNB 3FETA 4M0LA 3IO5A 2PMEA 3SGLA 4E30A 5EOVA 2PYIA 5D51S 2Y1LA 3K1TA 4EY3A 2KPOA 1Z2CA 4UVIA 2WIFA 2QBYB 1KIMA 3W5VA 3EEIA 4MIOA 4UU8A 1R4ZA 1AK1A 2Y1OA 4ZCLA 5TY0A 5FPYA 5D5PA 1I24A 2RKBA 2UZ1A 3JYQA 1L4NA 3R0IA 3STWA 4B3GA 5B58C 1IOVA 1IM2A 4IGEA 1I7SB 1NW3A 2GLXA 1SIWA 5KQMA 1O96B 1BTOA 2R87A 3B5JA 1XN1A 1JDUA 3PFCA 2HCJB 2W7TA 1IZ8A 2RHHA 1FOEB 2WP0A 3EC7A 1PT7A 3W2FA 1BH6A 2QG9A 3V1TC 5DNCA 1H3FA 4X90A 4C6RA 5JAHA 1DS6A