1YRWA

Crystal structure of e.coli arna transformylase domain
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
300
structure length
291
Chain Sequence
MKTVVFAYHDMGCLGIEALLAAGYEISAIFTHTDFYGSVARLAAERGIPVYAPDNVNHPLWVERIAQLSPDVIFSFYYRHLIYDEILQLAPAGAFNLHGSLLPKYRGRAPLNWVLVNGETETGVTLHRMVKRADAGAIVAQLRIAIAPDDIAITLHHKLCHAARQLLEQTLPAIKHGNILEIAQRENEATCFGRRTPDDSFLEWHKPASVLHNMVRAVADPWPGAFSYVGNQKFTVWSSRVHPKAQPGSVISVAPLLIACGDGALEIVTGQAGDGITMQGSQLAQTLGLVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein ArnA
publication title Crystal structure and mechanism of the Escherichia coli ArnA (PmrI) transformylase domain. An enzyme for lipid A modification with 4-amino-4-deoxy-L-arabinose and polymyxin resistance.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 83
structure length 291
sequence length 300
ec nomenclature ec 1.1.1.305: UDP-glucuronic acid oxidase (UDP-4-keto-hexauronic acid decarboxylating).
pdb deposition date 2005-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
A PF02911 Formyl_trans_C Formyl transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.25.10 Alpha Beta Roll Methionyl-tRNA Fmet Formyltransferase; Chain A, domain 2 Formyl transferase, C-terminal domain 1yrwA02
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 1yrwA01
4NV1A 1C3EA 1FMTA 1GARA 4EW3A 4ZYUA 1ZGHA 1RBZA 4ZYZA 1JKXA 4DS3A 4PZUA 4ZZ2A 5J63A 4ZYWA 1MEJA 4YFVA 2YWRA 4ZZ3A 3KCQA 1CDEA 4EW2A 3LOUA 4YFYA 3OBIA 3DCJA 3DA8A 3P9XA 3TQRA 4TT8A 1S3IA 4TS4A 1CDDA 3NRBA 1RBMA 1RBQA 1ZLXA 1YRWA 1RC1A 4ZYTA 4ZZ1A 4EW1A 2BLNA 1MEOA 4R8VA 2GARA 1NJSA 3O1LA 3R8XA 4S1NA 4QPCA 1GRCA 4Q12A 5CJJA 3W7BA 4QPDA 3GARA 3N0VA 4ZYVA 3AV3A 2CFIA 1RBYA 1RC0A 1C2TA 3Q0IA 3AUFA 5J9FA 2BW0A 4ZZ0A 4ZYYA 2FMTA 4IQFA 4TTSA 3TQQA 1MENA 1ZLYA 4ZYXA
chains in the Genus database with same CATH superfamily
4AM8A 1N7GA 1PNRA 3LPCA 1UK9A 3U56A 4B31A 1F8YA 2WG1A 3UXMA 1O97D 2QSJA 2G63A 2QMHA 3W2TA 2CJXA 4HMPA 3OU6A 2LCIA 1XLWA 5KMGB 2P0EA 4P5PA 3WBKA 3EPJA 5H3CA 1WRBA 4P0TA 4KQCA 2FP4A 4AXXA 1P7CA 3L7JA 4R0VA 3U44A 5AM2A 2Y66A 2DCUA 3X1YA 1PQPA 2WUWE 3CLSC 4PSDA 3KHKA 5DF1A 3C2QA 1NXWA 3JQFC 4FFPA 4I6JA 5JBQA 4DV2B 3G2KA 3OKCA 3WLKX 1ZMXA 2UZ1A 3DZ8A 1SKQA 3E4DA 3KLNA 4TYWA 2LE0A 2WI8A 1OPRA 4K88A 4BKOA 2UUOA 4EY4A 2B1QA 5D3MB 1P7VA 3ABRB 3ZKAA 5CCEA 3P7MA 1P0QA 3K0CA 4LZJA 4YCAA 1TRHA 3V8BA 2P3QA 5ALUA 2F59A 3HXOA 3MRVA 2I1WA 2B21A 1MW8X 1LC0A 5B3JA 2AFRA 2Q49A 1XK7A 1WDKA 2RHGB 2AOWA 3VGJA 4EIWA 1QVVA 1XCOA 3I9JA 3WK4A 2R6CA 1GDTA 3KVOA 1AKEA 4MS3B 3OI7A 4DLWA 4Z7OB 4UTPA 4CLDA 3D1LA 1WHSB 4C0AC 2P9FA 3EVAA 3A10A 5LFAA 4LF4B 3EZ9A 2ZZKA 2VDWB 4NV3A 3WWEA 5CDHA 5HZKA 3FTPA 1QRSA 3UENA 4F92B 3VFDA 1RW4A 2IGBA 4OMDA 4MSUA 2W0MA 4MDHA 4L76A 4U7TB 3A26A 5IK2A 4D5EA 4FMCF 4EYOA 4KE6A 3S81A 3RTBA 5JCOC 1J20A 1RPZA 1RD4A 1XTRA 3H2SA 1NRWA 4DUGA 3TCXB 2QVGA 2COKA 2P6UA 2PS3A 2G40A 5JAZA 4HQRA 2P9ZA 3PL5A 5DGDA 5CXUA 3OZUA 4YB8A 4JX9A 1FQWA 1AHPA 2H6EA 1HFJA 3PX2A 1PHPA 2G9VA 1FMLA 2JGIA 4KVGA 5PGMA 3C8HA 4CLRB 5KX5F 3PQEA 1ECGA 2YIJA 3AEUA 1VC2A 1QCZA 3BWCA 3NIDB 4FWTA 3T3NA 5FUMA 1HG1A 1H2HA 1U81A 1XAIA 3H83A 4M0UA 3RUDA 1N1EA 2Z58A 1G9TA 2REBA 1ZFNA 2RHBA 2MWMA 3CURA 3HH8A 2RONA 1KIFA 2E5FA 3UW1A 4G26A 3L18A 1CXZA 4I50B 1NQOA 1YXMA 5DB4A 1O5IA 3SQDA 4D96A 1A9RA 3PGLA 2HH9A 1WZ2A 1JT2A 4XGNA 4AZ3B 1HTWA 5DM2A 3JQ9C 4F71A 2V65A 4RU1A 2JAHA 1I0IA 3KQMA 4G0OA 4YQYA 5EJ9A 2C7PA 4IS3A 3DZBA 4ZAZA 1DRKA 3SP1A 2X4GA 1JIJA 5C32A 2HL6A 1ESDA 2XW6A 3DBHA 2O8DB 4L95C 3IP8A 1AN0A 2BFBA 2Z6QA 1HL3A 3D43A 5EPEA 1J9EA 4RZIA 3KAJA 3RU9A 4WVLA 4P6VF 1M73E 2I29A 2QJTA 4D0RA 2WYUA 3LUAA 4TWAA 1E7YA 3MXTA 4NV1A 2W22A 1PR0A 2GBFA 5JVDB 4NEQA 1AXRA 3QHPA 1C30A 2C99A 1Z4KA 4PZPA 4HAVA 1EP1B 1F1JA 1CUUA 5DXAA 4QLBA 5KYXB 1TMGE 1VLHA 2GCEA 1KJ8A 1GYQA 3GCZA 1XZDA 4AJOA 1ZVQA 1M74A 4IIJA 4KEAA 1K5GA 1COWD 3FR8A 5AHXA 4ZIRB 3X44A 2CVZA 2Q3MA 3EA4A 4B85A 5CEEA 2P2SA 3UXEA 3KSAC 5J2TA 1KIAA 5EIFA 3DFIA 2FMIA 3HDQA 2P30A 2WPNA 4O4IF 3VH3A 2VRCD 2VDMB 3O75A 1KC1A 2BMDA 4BNDB 1CU1A 4HAUA 1DB3A 4Y0NA 4LUCA 5JXJA 1ZOOA 1TPYA 1X38A 1XZCA 1YI1A 2P69A 1BXKA 2VQSA 4GE0A 4H7JA 1NIPA 2QRLA 1MO5A 3W7AA 2P78A 3RAFC 4B4OA 2UYQA 2ZRKA 3M5PA 3E81A 2E18A 2X77A 4JBWA 1MHPA 3CNLA 4Q9IA 4IHAA 3CX4A 1SKAA 2KBEA 3STYA 4BX3A 2CGEA 2CNBA 1E7RA 3R4CA 4KL8S 2IH2A 1EFVA 1OBFO 2ZJYA 4MOWA 4DMFA 5AHKA 4Q7JB 2C29D 2CLKB 1U1FA 4JC5A 3RHZA 3Q9UA 2DFTA 4EJSA 2CMDA 1T36A 2QV7A 1G4AE 1QLJA 4DSTA 1U3WA 1KI6A 1ZK2A 4JLDA 4G2TA 3S44A 3ZYZA 1CULC 1S2NA 1HC7A 1A0OA 4WY8A 3SAJA 2XKBA 2QVCA 3KNZA 4UU8A 2F3UA 3GVCA 1TJYA 2FK7A 3QE0A 5CA1F 2I34A 3AEQB 1I9CA 2WP0A 2BSQA 5SZJA 1JB9A 3SJZA 3GLGE 2KI5A 4ARUA 2C4WA 4TTRA 3CNEA 5C3UA 4A5OA 4IIDA 5C0OE 1JG7A 4P3OA 1SBIA 3MQFA 3QFSA 2PG3A 4ZU6X 4ZK6A 2AS0A 3VR4A 4MCHA 3UFXB 3SNHA 1L5NA 2QRZA 2AEEA 3BD9A 4RJ2A 2G09A 4ZAYA 2CJYA 3UPDA 3QEKA 1K6JA 3KWJA 3PJFA 1KVQA 3UK1A 2V6IA 3TOVA 4M1TA 3HBJA 1H4QA 4TRMA 1ZKMA 5JQGF 1CUBA 2YKGA 3L7CA 1IULA 1NVVQ 2BN4A 1IN1A 5C37A 2GA9A 1SUCA 3ECCA 3K09A 2J46A 3F6EX 4CQMD 4XPZA 1W1WA 4OF4A 4MKHA 3OZDA 4M98A 3IIJA 1UMCB 1VHTA 4LWOA 3BD7A 5JTUA 4IOKA 1RIIA 2Q27A 4ETNA 3R23A 4AZVA 3SFTA 2NGRA 2FMTA 3WY9A 4X3OA 5EIWA 4ENSA 3GUVA 3DH0A 2QBYB 5SYNA 4EQ6A 4KNVA 1TCAA 3BIJA 2IXTA 4M49A 5BNTA 1FA9A 1FF9A 3S5UA 5K8TA 2OGTA 2XCRB 2B7LA 3BDAA 4ZOQI 3FOCA 3AVWA 2DM6A 4DN6A 1Z6XA 4ZQIA 3I39X 1ZMOA 2ZJZA 2ZGVA 4LRXA 4MS1B 3LL7A 4J7UA 4Q1CA 5WRFA 4YDQA 2C95A 4PC7A 4BMZA 1PV1A 3MWYW 5LJIA 2PT6A 1VPWA 4YAUA 1HFWA 2COEA 3EQ2A 3KD3A 4ASUA 3LDGA 2WD7B 2ZWIA 2O4CA 4C4OA 3B1JA 1YRBA 3A2KA 1ZJ5A 1Q1AA 3JQAA 2RGUA 3ZY2A 5E4JA 1XJ5A 1E1RA 1FTGA 5CBPB 2JLSA 4S0XA 3N3BC 3UWPA 1EEHA 1JMVA 1WUHS 4KRXA 5FL7D 3RFTA 1OGYA 1C0EA 4DMUB 5LMCA 3MGKA 4V0SA 1ACMA 1YULA 3M4YA 3QBJA 3KQKA 3DS8A 1GR1A 2NU8B 1J2TA 1O77A 2XF8A 4J0FA 1AUXA 4MR9B 2QVBA 2H85A 2IVZA 3FDFA 2WSBA 1WB5A 4HBGA 4NZNA 4OI2A 4REMA 5DVZA 4EI9A 2NU7B 1TZCA 5EA2A 4BGIA 7MHTA 6REQB 3TM5A 3C6ZA 4YPFA 2IA5A 4WFJA 2VEDA 3AHDA 5H82A 4OJYA 1Y1RA 4HGZA 3GJ4A 5AJZA 4FYJA 3H17A 4HXFB 4O63O 2VHUA 2ZRIA 3EEIA 3F2IA 3IPYA 4YO8A 5ETJA 4KMRA 5CDYA 1O95D 4PRLA 2GO7A 2G9NA 5KYVA 1W46A 3OJCA 3Q6NA 5BNFA 4BZQA 5BWMA 3FLMA 1XTVA 3C3PA 3PXXA 2VPZA 3JYNA 4L57A 4N3CA 2H1LA 2YYYA 1SCQA 3TOXA 4D5GA 2O2JA 3QI2A 4ZEXA 1R0YA 3EZGA 4BNIA 3RUCA 4NPAA 2VLIA 2HQ1A 1OZ0A 2ZOSA 1ORDA 4RTSA 1P31A 2FY8A 3FAKA 3PJEA 4FHFA 6YASA 2V55B 1PWEA 1X8KA 3G6WA 4HAWA 4WH0A 1XPOA 3HXLA 4IDGA 4A2PA 1RJ9A 2HFJA 3ANSA 1WXDA 1FFDA 1KEPA 3V2GA 4XRGA 5E7IA 1ZJWA 1T9AA 1XBTA 1QUFA 5LU8A 1QVZA 4GD3Q 2A5JA 2EJBA 1PR9A 3O31A 5FJIA 2BRUC 2JLRA 5FTJA 3X1DA 1NURA 3HDYA 5FWXA 5EJ8A 3QE9Y 1NMEA 2UKDA 2EX0A 2XUKA 3C1TA 3PNLA 2AKEA 3QPVA 3I0ZA 1LVHA 4JDPA 3RJTA 1C9MA 3G8DA 1ZZGA 2G08A 3HB7A 3P2EA 2HPHA 4U1RA 4F3YA 1CIPA 5C5CA 1EQAA 1CUEA 1XWWA 1Z2DA 2V5VA 3QYAA 3JQ7A 3VO8A 2AX4A 1VBFA 4Y3UA 1W96A 3PL1A 5EZYB 3ZE2B 4BLWA 1IJBA 4F85A 5CA0F 3P0IA 3K9NA 1HEUA 1DQPA 3ANMA 3FNGA 2VIIA 1O5TA 5KWSA 4FJ2A 2VZ0A 4Y8VA 1UQRA 4ADSG 5JS6A 2O0JA 2EZ8A 3OF2A 3NXSA 2YQZA 3FMVA 1ZK4A 2B25A 2ZAOA 4IO1A 4M1KA 1IBLB 1R9NA 1N9KA 3D6NB 1T8SA 3OVMA 4PAWA 4YDRA 4C22A 2H16A 1QF9A 3HJGA 4RD6A 4BUZA 4F8EA 3P2KA 4JBYA 4NLLA 2LXNA 3GFFA 4KOAA 2FWRA 4UC0A 1N9GB 3NAZA 3TAXA 3GH1A 3NVDA 1NKTA 4ABTA 2IEAA 2QD4A 2ZCJA 1KO5A 2X13A 3G17A 1KYIA 3R5HA 5IDVA 2VQFB 1EGHA 3AUKA 1FXUA 5ENVA 3LO8A 2B36A 1QBGA 1AMOA 3S55A 1D1QA 1UL1X 3O26A 4RHUA 4AFNA 4EBBA 5KNDH 4YRRA 3K0SA 1ZLYA 2BEUB 5IXYA 4YR9A 3T3HA 9LDTA 1TMKA 2ABWA 1VQ1A 4WNAA 1B4DA 4DSUA 4EFKA 3DC2A 2CMFA 4YUWA 5HUHA 5K01A 4L7QA 2OAQ1 3AU8A 2WWHA 3N74A 3WB1A 2GERA 1JAYA 4DCTA 2FPIA 3NTOA 2OXIA 3UH0A 3OT4A 1FFAA 3QNMA 1RBZA 1BWRA 1LTKA 1REQA 4JQZA 3GZTB 1KZ4A 4GPEA 4U3JA 1JZTA 4DBLE 3FPLA 2AFIA 2QZ4A 2QWXA 3EXHC 5F7XA 1SVMA 1OIWA 3PQDA 2YJGA 1M1ZA 1OVMA 2N0SA 4NBSA 2YWRA 5IAJA 2VK1A 3PQ4A 4LZAA 5AO9A 2OYSA 4RFSB 1ACLA 5CLQA 3REOA 2PT9A 4GOOD 4REQB 4K2HA 3C5VA 3PKZA 1JHUA 3N8NA 1UKYA 2EHJA 2H07A 3B6KA 3NYIA 5CR9A 3B1YA 1Y0BA 3H42B 2OUIA 4D9CA 2DB3A 1PX0A 2PUHA 5I9IA 2AOTA 3KKMA 3LSTA 3NTXA 4WCFC 4AG6A 3EAFA 1RS0A 2NG1A 1LX7A 2QEQA 5CTAA 4K0RA 3RCBA 3W06A 2FSIA 1UWLA 2ZSBA 4N8EA 3ZU2A 4RM2A 3NV9A 4B33A 5KIAA 3ZGXA 5KTNA 3W6PA 2VUSA 1X9GA 1VE3A 4LJ4A 1TM1E 3OF5A 2DSTA 3OIWA 4UULA 1Y5LA 1OUMA 3CWCA 3LKBA 4K28A 4ZCQA 3O4VA 3WGYA 2ECFA 3HFSA 3KLPX 2X9NA 3V8VA 3K9BA 4D80A 1UXKA 3BGSA 4KXLA 4WBSA 5FWYA 4L9AA 1MRNA 2EGHA 3F96A 4BNZA 1BDJA 4PX9A 3BBLA 4QO8A 4C30A 5F23A 3ZW9A 4W5TA 3FKQA 5IVDA 3TGLA 2CNDA 4OGWA 4PLVA 2JFVA 4LOJA 1EIZA 4GI7A 4I08A 3DZHA 2Q50A 1PZHA 3SM9A 2OT3B 3NHSA 3LHKA 4L27A 2JAPA 2YZ7A 3K5WA 3VOAA 1Z8NA 4UEQA 1IY9A 1CYDA 1JMKC 3H3XA 1P2GA 4YV7A 1PFUA 2NM0A 2YOFA 4JQYA 1XA0A 2OQRA 3U7HB 2PUCA 3LECA 1ENOA 2WA2A 1W52X 1BIFA 3B2EA 5FA5A 3VR1A 4QO7A 1XA4A 4ZEVA 2QNBA 4LK2A 3IILA 4JI3B 4YCDA 3T1QA 3OD5A 3WK9A 2XRFA 1CR1A 1SXHA 4WBNA 5BSWA 2OAEA 2DH6A 4IQ8A 3VJKA 3DR5A 3SC2A 1C3LA 4BLQA 1P0MA 2ZWOA 3TDNA 3THRA 2DFPA 2Q0QA 3O73A 1N2CA 2IIBA 1M9NA 4LECA 2RHJA 1RI2A 2QQ5A 2RC5A 4CM4B 1NKSA 4DVJA 1ARZA 4D8TA 1YR8A 4ZCSA 2PR2A 3AWIA 2Z57A 4JT2A 2EJUA 1DJQA 4X6YA 5TMEA 4UTRA 5EZYF 3G9XA 3F6YA 4BNTA 5EKSA 2JK0A 3KSBC 1Q0PA 3A1DA 1VDMA 3TRDA 1Z16A 5JAOA 3L1IA 1XVVA 2HNBA 2IPXA 2FEAA 3I3OA 4DXDA 1CR6A 1BKDR 5EP3A 4ZTBA 1JUDA 2F1OA 1C80A 1P2FA 2HM7A 2NTJA 1XRMA 3PJDA 5TDHA 5DU2A 1Y8RB 2BFFB 2QL7A 2B8EA 4CCYB 4X45A 1CF4A 2PSHA 4L5YA 2KJQA 2ZT6A 5JY6A 2PS1A 3PIIA 3TKYA 1G21A 4A0SA 5JUWA 4NL4H 4KIWA 4YMLA 3TL6A 1K92A 5FOXA 4CDGA 4QDJA 2CLOB 4FUTA 3H7AA 3AKDA 3F1KA 4KN9S 5FRDA 2O8FA 2IX9A 3ZLUA 2P8JA 4C5AA 4JJEA 5BVGA 4AYXA 4J2TA 4XX0B 3P9NA 1UEIA 4KDFA 5ITWA 3V1TC 1EWTA 4YRTA 4EX6A 3OPVA 4M7WA 1A2BA 1SKYB 3UGTA 4OLHA 5FUQA 4EKIA 5M2QA 3Q88A 5ALNA 1NBMA 3RU7A 5IABA 2I8LA 4B45A 3G3EA 1ZM7A 1FYXA 3W2EA 2OGSA 4G84A 3NHMA 5AH0A 2B20A 3TUZC 4RL6A 1CG6A 2FPUA 3IMGA 1GPBA 2HK9A 3T5BA 3VH2A 3BMCB 3QVOA 3N39C 1NQWA 2BELA 2FEWB 3LVFO 1VE5A 1J9ZA 1C9DB 2C4KA 5IJ0A 1GUYA 1ZGAA 5CLGA 1S3IA 3D1VA 4HI0E 1U8XX 3GZNA 2OFFA 5JYEA 2XCSB 4Q4DA 1A5ZA 3HZOA 1CUFA 2W6CX 4XSHA 1ZBDA 5DXJA 5LD2C 4BPBA 2QLLA 5DWDA 4WGGA 2OILA 1UZNA 3BFKA 1VCOA 1HLDA 4XLTA 1CIJA 3IT0A 3OHPA 4LDJA 4PTZA 2W7TA 4U9HS 1WVIA 1Y3HA 2E82A 3TO5A 4F04A 5JJIA 1C1HA 2XADA 4JJAA 4AF7A 2VT3A 2LDBA 4ARAA 1ZUNB 2ZCVA 3QUAA 5KNCA 2WWFA 4OHBA 1FFGA 3U7EB 3VBCA 2NUAB 4Z4HA 3CUTA 3LCVB 2HW8A 1KU0A 3OX1A 2JCXA 4FKBA 4FB4A 4LNHA 4YCSA 2CZGA 4R7ZA 1UC9A 5ADUS 4GPIB 3FXAA 4MI9A 3AXSA 1QZZA 2GTIA 3FCXA 4L5AA 5HTKA 1UANA 1CJBA 4NOMA 3K0EA 4H77A 2F00A 4OI1A 4BDSA 2EFYA 4QBKA 1A04A 2AI2A 2QR3A 5EWMB 4WD3A 5CHYA 3H9CA 4JC4A 2R7MA 3WRXA 1SUFA 1XD9A 3GD7A 3PNKA 2Q45A 4JJIA 1PTKA 1BFUA 2H2GA 1PJBA 1Y5MA 3AM5A 4QM7A 3O1IC 3OJOA 1G4UR 2JH8A 2ZXEA 1GZ5A 1LQUA 2F64A 2OXCA 4HAYA 2IU6A 3HCFA 3B8HA 4Y6PA 3S2FA 4AJHA 1O94D 4E2ZA 5G1PA 1HV8A 5AIBA 4ZZ0A 3GUYA 4B8ZA 2EU8A 1KA9H 4RTMA 3FUVA 3ND5A 3PLAE 1PJAA 1Z08A 2ALJA 3WAGA 1C7ZA 2CKMA 4KR7A 4CI9A 3SXUA 1KTIA 4FCWA 4U8GA 3ECSA 3P4XA 3OWHA 4H6XA 3QFFA 4LHVA 3TTTA 2FEOA 3WRYC 3I6QA 2JIDA 2ZPTX 1JIUA 3TOSA 4D8XA 1M67A 5FYQA 1EDBA 1WPRA 5TGTA 3G0GA 1BGWA 2Z0MA 4HH4A 4QBIA 4HQLA 4UHJA 3T1VA 3UMCA 4B48A 2QDKA 5C35A 5KU1A 1EHIA 2BCJQ 3KEMA 4IF4A 5JS8A 3RBXA 3MSCA 1ABFA 3AVXA 3VR6H 1NPTO 5THXA 1B23P 2O20A 2P11A 3EXAA 3ANTA 4ZI5A 4WUTA 4M36A 2Q2NA 5DHSA 3K1AA 1Z8DA 4K3VA 2D3TA 3TJMA 3EIQA 3RRFA 4KPYA 1Q0UA 4Q21A 2JD2A 1ZUIA 2QRQA 1XEWX 2B30A 2Z3WA 3O9MA 4IEFB 4YGYA 4ZT5A 1F3LA 4BQQA 1V1JA 1MT0A 3T9CA 4AB1A 3C6KA 3T9DA 2QNIA 5T6BA 2IOQA 1MB0A 1MX9A 3MTQA 4G8DA 3QF7A 4N76A 4JYBA 5C52B 2L0XA 2AJLI 2ZJ3A 2O7RA 3IO5A 4XYBA 4PN3A 2B82A 1POXA 3OP1A 2E5WA 2OY0A 1IBKB 1Z7BA 3JD2A 3IKVA 5AOAA 3NIGB 4U5QA 4RAQA 1LNZA 3VR5H 3CVOA 4LY0A 3T94A 4L51A 1LS1A 1CDZA 1OXBB 4GZ3A 3UCXA 1BFKA 4EMSA 4BNJA 4JELA 3G2PA 3AJ9A 2P27A 3FPSA 3VYWA 3FCCA 4G8CA 3QUCA 3KM0A 3T7SA 1GILA 1ODIA 3FDZA 1FZQA 5B4UA 2PUVA 2B9VA 3LWNA 3UXYA 2OFPA 3F67A 3RVNA 4HNTA 4Y6SA 1BYIA 3C6MA 3DBIA 1MIOB 3I1IA 1QPGA 2XZLA 1U90A 2V03A 4MARA 1P19A 2VDJA 3DHWC 3R75A 3W5DA 1W36D 3CIFA 1IHUA 3KZVA 5AIAA 2C00A 3OT5A 4M8KA 2R8ZA 2E0IA 4I66A 2WY2D 4ER0A 1LW6E 4QQNA 2FSHA 4X8HA 5BP7A 8OHMA 5EESA 4IL5A 4KI0A 4EYQA 4JWKA 2B3DA 1SBQA 1BNCA 2EEZA 4LHWA 4Z4FA 3MAGA 5BSMA 2OA0A 1XNQB 2ZLBA 1ZD2P 3VVCA 3MRTA 5SICE 1YMUA 3RK4A 1NUHA 1CIVA 2CXXA 2GVDC 3ONFA 5KHLB 4C7OA 4RKEA 1B93A 4MIEA 4YDHB 4JEIA 2N75A 3MLAA 2ZI4A 3T12A 1CQIB 3TLKA 2XUAA 1FSFA 1L4MA 1S1CA 2XB4A 4WSOA 4C4PA 1T6YA 1TC2A 4RYDA 3BJIC 5CGQB 4B4KA 3SJCA 3L79A 3HMQA 1SXJC 1B1CA 3OX4A 4MAMA 4P5EA 2GPTA 3LVBA 3DOIA 1L5SA 2R6GA 3L0SA 3LFTA 1NTOA 3MHPA 3PXAA 4G2NA 1RYHA 1K8RA 2JRCA 4G8JA 2HTEA 5FL3A 4E1VA 4EG0A 5HNKA 4A92A 4RJKA 5DDIP 2W2KB 3EBLA 13PKA 3L5OA 3LUGA 4KXQA 1NU6A 3WLIA 4AMGA 4F3CA 1RACA 4NK5A 3OAAD 2AN3A 4XGKA 2P2YA 4H3HB 1GP2A 1CEEA 3SYNA 5KMGA 4KYIB 5IMBA 4AXBA 2W4IA 4X8OA 1M1YE 3IUMA 1ZCFA 2W4QA 2XSZD 2FVXA 3CPEA 3QYPA 4HZGA 1S8NA 4Z86A 4I8XA 4P7GA 1KOGA 1PDWA 4ETMA 2BMWA 1UJ6A 3O83A 2GKSA 1RP1A 2QOEA 2QTHA 1IUOA 4KFUA 2NXNA 1W49A 5M7EA 5DCWA 3NP7A 3JWPA 4IXTA 1GEGA 1JH8A 2JGNA 3RSCA 2IVFA 2CVOA 2JA2A 3GU3A 4DZTA 5KQPA 1TTHA 1XVIA 2JLYA 3IHWA 4AICA 1JEEA 2GHQA 5DSXA 4EB8A 7GPBA 3SHVA 4R7TA 4HNQA 5D3MA 4FWIB 1XRNA 3U62A 6ADHA 2EWMA 4H18A 4QICA 4CL3A 1GL3A 4KQGA 5FPYA 3RW9A 3HTXA 1PHRA 4ZJYA 4GNKA 2B4KA 3Q40A 5LVAA 4ZAWA 3INRA 4V3BA 2IH5A 3AUAA 1KKMA 2Q4TA 2WWGA 3W6NA 5DCUA 2FN8A 5FULA 4MS3A 1V45E 2HSZA 2PSJA 3PTZA 4J1SA 3WA7A 5MHTA 3E5MA 3W8FA 1WHSA 4HX2A 3A9CA 2KM1A 2QN9A 3AI1A 3GZJA 2BE9A 4HRAA 3DBLB 2VDWA 1JDNA 3A4LA 1PL0A 2R5WA 1IXRC 2VYNA 4POAA 4BO9A 1OJLA 2PV7A 3GWZA 4L8VA 1XK6A 1TKRA 3PFKA 3RAJA 1WMDA 5B1YA 3K70D 4LJYA 3BHNA 5H80A 1R5OA 4MX8A 1NVXQ 2BFAA 2BM1A 3GLHE 2HPAA 1F8UA 5HPYB 1YB5A 2HYDA 2CB9A 2ESRA 1Q1GA 1R6AA 4HXYA 1PJ8A 2QD3A 1XJCA 1M1NB 6AT1A 3T06B 5L4NA 3LLUA 3WWPA 4AQ7A 3DGFC 3H1AA 4CQNA 2O2YA 2AIRA 1FRVA 3M1YA 4CIYA 3FR7A 1AUPA 3NHBA 3WLQA 3E8XA 4CLRA 1XDUA 3NHUA 1QO9A 1OLSB 4BO7A 2BEWB 5DLEA 2Y3IA 1Z15A 2CFRA 3MMZA 3PDCA 4KACA 5FJJA 2AG1A 1MDBA 3U3XA 5AVQA 4QRDA 1F4LA 2PFKA 1JPUA 4QUKA 1P74A 1CX9B 2IY9A 2PYDA 3G79A 2FOIA 3BXOA 4I50A 4MV3A 5AQEA 3ZWXA 1G55A 1CQZA 2FPGB 3ROQA 4FYWA 5HS4A 1P1BA 1U0JA 4NYJR 1KU6A 2NTVA 3Q2OA 3BA1A 4H6WA 3TQOA 2Z5GA 2WHQA 1RWXA 4HB2A 1AQ6A 1TDJA 4DILA 2GARA 2F90A 3LT4A 4G4GA 5DHFA 4KSYA 3VOBA 2YCBA 2O8DA 2HOQA 3LBHA 3VI3B 2I71A 1CC1S 4IPTA 1XQYA 3JR3A 2H57A 3KWLA 5EZ6B 5KJCA 1PYOA 3M6IA 2C7RA 2NP7A 1QCYA 1G2OA 2XVYA 4GR5A 5KTOA 4UAUA 4PPGA 1HDXA 3CSUA 4D2IA 1UKCA 5AD1A 1HXHA 4QBTA 1S2OA 1G63A 1OY1A 2OGZA 4OO3A 1HOTA 4ENRA 2WKQA 2XIJA 4IQ0A 1JHXA 1YASA 1S8OA 1PP4A 1X94A 3VYRB 5K8LA 5JVDA 6ABPA 3JD1A 4MYHA 4I1OA 1UOPA 4PNZA 1PEAA 2EDAA 2HXGA 3EFHA 3JXEA 3Q9SA 5CT6A 3OFKA 2AK3A 1NQ5A 1F2TA 3VZSA 5JCZA 2P0AA 1GQFA 3ZQ6A 2Q6KA 2TECE 5C4IA 1CP2A 1ZNZA 1S6YA 4XJVA 2PUBA 4LJ9A 4ZIRA 1CRPA 1VHWA 4MRRA 5CFLA 4LS3A 2XOEA 4I4TB 3ZJ4A 3CLSD 5BR4A 4MWEA 5C1DA 1G59A 2QSZA 4ZI7F 5B7GA 2ACKA 3QIVA 5CLJA 2IX3A 3H4IA 3ADOA 4W1QA 5GONB 4KQMA 4QD3A 5I8ZA 2C8KA 1PNQA 4C29A 1W88B 4TYQA 4OHYA 3PEFA 2HA5A 2M6KA 5JZBA 5LDDC 1H4SA 2PZLA 2P75A 4MAAA 1ZD8A 5JAIA 1X9IA 1RLTA 1H6DA 2P77A 4Z5XA 3I2YX 3M33A 2JFOA 2WU1A 4DIEA 1F5NA 3ANNA 2HLNA 3GDFA 2HTFA 3ZHOA 3U6BA 3UAVA 3G9TA 4NZPA 3SF8B 1IN4A 3L7LA 8ATCA 1NQUA 4FMDF 4K9SA 3WGKA 1K7FB 3LUPA 4LYAA 1T34A 4O08A 4XVRA 4BB0A 4O4LB 4QJBA 4KWHA 4K81B 3CF4G 2UUPA 4Q3BA 3OOSA 4PR0A 4WASA 2VK4A 1ZXBA 3P19A 4GX2A 4C4TA 2ZIWB 4IUDS 5LQAA 1E5XA 3ANYB 1ZIYA 3L6DA 4JDUA 5CB8A 4FS3A 2B35A 3AEQA 3NBKA 3GO4A 3QE3A 5A2QA 1Y6GA 2O3TA 1EEXB 3K53A 3RIXA 2FPLA 4KKXB 4NDAA 2XDAA 1T0IA 1OFVA 5DBEX 4WERA 1B3RA 1F8XA 1YL5A 3RI3A 4HLCA 1EJBA 2GRAA 3JQRA 2G72A 3FFWA 3QYJA 1KZ7B 2EC5A 4TKUB 4PVCA 1TKCA 4K8RB 4QLOA 2R48A 4FPXA 4N3AA 4XIFA 3UFXA 1GZVA 3TLJA 1UKBA 3W34A 4GMGA 1TUGA 1NZDA 4TT8A 4G5HA 1YWGO 3B36A 4LZOA 2GSWA 2WR8A 4P36A 4YGXB 2RHTA 3U80A 1KKUA 1UEXC 3GQBB 4AUNA 1EBFA 4Q3NA 3VHRA 1FFSA 1I4LD 1OFUX 2QLTA 3ML1A 1RQNA 1XCJA 4F4HA 3E8MA 3QENA 4P58A 3CPSA 4BFSA 2JVIA 2Q0SA 2WFAA 3F6CA 3H99A 4UVIA 4XSVA 1A5TA 1ONBA 4MO2A 4QUGA 1XTBA 4YRCA 2Z30A 2WIKA 1LKZA 4N47A 3GFSA 3HP4A 4L08A 2XYGA 5AVTA 4ZDJA 4A82A 1Z0IA 4KV7A 3VYSB 2Y92A 3CF6R 2QBYA 4NXNB 1UKAA 1DIAA 1TADA 2V7XA 1QLWA 3STVA 4ZT6A 3ELYA 1Z6YA 3E3MA 3IVGA 4XIGS 5FIUA 2ZSIA 4MVYA 2IUEA 4OFWA 4TQGA 5FLYA 3ST7A 2QUIA 2JVKA 2CE7A 4W5OA 1RXIA 2H9IA 3STUA 4ZDKA 1UXGA 1KAQA 1ODKA 3MJVA 4NENB 4ZAVA 4W1SA 4ZP1A 4OLJA 1BDHA 2V8BA 1QANA 3SVTA 1E2UA 3P9IA 4MS1A 1YRAA 2C96A 4LPSA 2OYCA 1FVXA 4R2HA 5L51A 5DNYB 2VBGA 1RC0A 4LOIA 4C6SA 1D2NA 3M70A 4QDXA 1FSSA 1HT0A 2W11A 4UZFA 1EE1A 1UJCA 4Q47A 1U28C 2CLEB 2WD7A 4S35A 4B4VA 1PV4A 3F5SA 4FNAA 1NVBA 1U2GA 4FDLA 3QFRA 2RGAA 4F6RA 3EGVA 4B5LA 1QHEA 3Q11A 4C0LA 1K66A 4E07A 2YJZA 1GD1O 5CBPA 1Y80A 1D4OA 1BWQA 4DW8A 2HFKA 1NLUA 4U8HA 2YYZA 3ZHTA 3WWYA 2DRIA 2QY6A 5EXDA 2V7WA 4F5DA 2IS4A 1TZBA 1A82A 3A04A 4FK8A 2NU8A 1A72A 2VDKB 5EQDA 4F97A 1P75A 3KVRA 1LVUA 4MR9A 5J59A 4YV0A 3IP7A 3H9BA 1E94E 2ZAIA 1AZSC 3PFGA 5I7AA 4HSGA 3SIRA 3TX2A 4UM9D 2BKLA 4OYLA 2NU7A 3I5UA 2ZFUA 1FPMA 2QPOA 4N48A 3BQMB 1JALA 4IXMA 3OZ7A 2GA8A 6REQA 1ODFA 4GF5A 4Y67A 3PFWO 1KC3A 3KD2A 1G8SA 3AUXA 1CVLA 1S1MA 4K9OA 1L4LA 3E9YA 4CM9A 3VSBA 5F98A 2OE2A 4I4TF 4M2LA 1J90A 4CT4B 1DUIA 1U8FO 3MOGA 1ADCA 1XTIA 5JQWA 1TOAA 2X14A 3G5LA 4C1NA 3JS5A 5EMKA 1VG1A 4U7WA 5FTWA 1HPLA 4WACA 3AK4A 1XTSA 4UE2A 2ZQZA 1IONA 4R6XA 1K68A 4OJTA 2JHPA 4Z53A 3N2LA 1O6BA 4L6IA 4NEGA 1I7DA 2ZT5A 4FFVA 1JBKA 1W4CA 4HDNB 4TTVA 4RBNA 4KFRA 2XHZA 4NX2A 2E6UX 3LPLA 2CF6A 3CZQA 2P9BA 5AKJA 1XAHA 2Q2WA 3O4RA 5IKOA 2J07A 3CZ5A 3PDHA 1MZVA 3OQ6A 3AP1A 3RC2A 4QFDA 2ATIA 4OXNA 1QV7A 2RBEA 1ZH2A 4KQJA 1A27A 5JD6A 1DRVA 1ADBA 1G20A 5K2MA 1K98A 3B48A 2IRWA 5AVKA 1IUPA 3CJTA 4BLRA 2C5SA 4MVXA 1ISJA 2PVCA 3ZGNA 1OE0A 3LP8A 2Q5FA 3U7FB 4ZOLA 2OP1A 3IE1A 2OWDA 4EPVA 3QVXA 3HYRA 3N05A 3B9RA 4G07A 5TPWA 4BQOA 2HAEA 5FQNA 3T9EA 2W70A 2ZTMA 4PGAA 2VXOA 4R69A 3TSAA 3BXHA 4DV3B 2I3AA 1W5FA 5BW6B 4ZGWA 3OZGA 3DYBA 4H6VA 4ILKA 5JEEA 5JCJD 4XDZA 2IDZA 5CLFA 5CUQA 3RVKA 1LF0A 2EKDA 4Q4AB 5DWVA 4OMCA 1IN7A 2FI1A 4P3YA 4KVZA 3AF2A 3D02A 2D2EA 1QZTA 1U1IA 2CMKA 1ETHA 3F4LA 3OLZA 1GQRA 2XOKA 1P3Y1 3NH6A 5REQA 1ATIA 2QN1A 3THSA 3VR0A 2X0DA 1XD2B 3EPLA 1IRIA 3P32A 4I1SA 1B14A 4WZZA 5CH3A 4KQHA 3CQ9A 1K5PA 1R00A 1XMJA 3PWTA 3DDNA 4BNXA 4AURA 1EUZA 1KYYA 3K16A 4HL6A 4RHTA 5EMLA 2SHKA 3D0RA 2XZDA 1R0SA 1T6BY 3N76A 2PZMA 2JZCA 3HZZA 4UAVA 3R9XB 5HR5A 4OBBA 4TSFA 3FGOA 1I4OA 2OESA 4MMXB 2IH4A 3Q6IA 4BMYA 1OAAA 4TSKA 5E9QA 3BE8A 3U5ZB 4JJ4A 3MCTA 4UUBA 3Q0TA 4P3KA 2FDXA 1C41A 1C9KA 1R15A 3JYHA 3GDWA 1UKZA 2G3YA 2FUNB 1KAHA 1ZCZA 3TCNA 1MT3A 3NBAA 2H5IA 2I1QA 3H04A 4S2EA 3MQ2A 1BH6A 2YWEA 2FW0A 3MMPA 4Q1EA 4DLNA 1YGPA 2GS9A 2JF0A 2NO0A 4JC8A 3TLXA 2VP6A 1VSTA 4B43A 4BECA 3EASA 4QPZA 2IPMA 5DTIA 3QLTA 3ESBA 3HBAA 4Q02A 5DO9A 5J58A 1V7ZA 5JPIA 3BGWA 4FEGA 2C7OA 1NDUA 1QIHA 5T57A 3NM5A 2VPYA 2QJRA 4GQIA 3ZIAD 1Q22A 1H2RS 1Z47A 4Q9LA 1J8MF 1TO1E 3V9AA 3KB8A 3NVMB 1ZMTA 4ZICA 1EZZA 1MGOA 3JYPA 3VKUA 5C8VA 5JZOA 3OLWA 2X42A 3U61B 4EUKA 1DKQA 3K1YA 2VJQA 2ZDQA 3UJCA 4PHHA 3DR3A 4HRVA 4MJ7A 4XRRA 4G63A 4PSUA 2F1RA 2I66A 4A03A 1JHPA 2ZRMA 4IIUA 3AUUA 1NXQA 3BILA 3OCZA 1OWMA 1RRFA 4GMXA 4QXPA 3ZLVA 4GU5A 4BMSA 1C7RA 2Q3LA 3LP5A 5DEOA 4B73A 4AAYA 4E5KA 4D9JA 4N49A 4QFBA 5EPOA 1SJ9A 5BSUA 1EJ0A 3KB2A 4IINA 3ZQUA 4KO8A 2BOVA 1TF2A 5ESRA 3ROFA 3U26A 3TD9A 1SD1A 2ZYRA 2VHVA 3PKIA 3I2GA 5CM2Z 3ASVA 3HCRA 3W9UA 4CJXA 4DWVA 4NI5A 4L0DA 4R8RA 2C59A 3UWDA 4YFYA 1ORIA 2X6RA 3ZI4A 3DVLA 1DBWA 1DIOB 4KMOA 2IXGA 2XLCA 2DOKA 2EX4A 4CV0A 4DA7A 3TFOA 2I62A 1QFJA 3EVBA 3VBEA 3IDFA 5L40A 1CJMA 3Q1KA 4QNRA 3U4HA 5CXQA 3TVDA 1FTWA 1GPH1 3WO0A 5KQGA 1L3BA 1XZIA 5EXXA 3RAGA 1EFHA 3KPUA 4TQUS 5CB6A 1WKVA 3LD9A 1E4YA 3LG2A 5C1BA 3PEWA 3UH1A 3PK0A 4R4JA 3BTOA 5B7NA 2E4AA 1WBJB 2XCQA 3KOMA 4HEQA 5DN9A 4ZZ1A 5ICCA 2Q2OA 2N3ZA 4J7AA 4NFLA 2HQSA 2WLSA 4NJEB 4UFOA 4X5OA 4G5XA 3RRMA 1K7SN 4JVOA 2YV1A 4CM4A 1LBTA 1PZMA 1JFFB 4IFBA 5CFMA 2OAGA 1E9VA 2IU3A 1N6NA 1YDMA 4K26A 4DR7B 2C42A 3Q7TA 4DLXA 1SPXA 4C0QC 1RXYA 3DE1X 3I5XA 1R0LA 1V11B 2ZPAA 3GNQA 4QU0A 2PPVA 4ZKEA 1KI1A 4JH0A 4C0WA 4IMPA 4KLCA 2Z9DA 4KTTE 1L5MA 5FKJA 3OHSX 1GN9A 3HUDA 3W8NA 2XZOA 3Q7EA 4LV6A 1A71A 1OC2A 3FVRA 4UBIA 3X1XA 1V1RB 3PPXA 5DFAA 2IYXA 1RCFA 3ETEA 4ZD6A 3FF4A 4QNNA 3RSOA 2O2XA 4HAIA 4PGHA 4CCYA 5EEGA 1QO0A 2HSGA 5LCXA 4Q66C 5JFTA 2FPRA 2ZBPA 4X7BA 1JE0A 2AFHA 2XWPA 2R8RA 2RBGA 4Q39A 5TX7A 2UZ4A 1VXRA 2Q3EA 1SXJE 2PDAA 2BWJA 3NHYA 3QUBA 2Y1WA 1EGVB 4RKWA 5DMXA 2ZK7A 2AMVA 1FNNA 1N6IA 2AYZA 3L6RA 4O2BB 4XX0A 1CQPA 5ALSA 5K3CA 1TVCA 4ZAFA 5SZKB 1PZEA 2XB9A 4JODA 5IM5A 4LZWA 3CGGA 1MENA 3P96A 2GDZA 5A2GA 4D81A 4LRQA 2VAMA 4IMRA 3SYTA 4A16A 1E20A 2FX2A 2PRYA 3MT8A 1Q1EA 1B0AA 2QTCA 3RS4A 4DE5A 2IHTA 1T4GA 4G0MA 2IE8A 2OK8A 4V0MA 2IEDA 1X92A 3BMCA 5DN6A 4DJ5X 4ECAA 3PWSA 5KO2A 1AKRA 1Q21A 3OLVA 4QQRA 1OTXA 1RLUA 4YUXA 1GG8A 1G8JA 1KMMA 1PS0A 3RVOA 3RS7A 5JNWA 1NVUQ 1F0YA 2DWPA 2XMZA 2XY4A 3CRVA 2HK7A 3KR2A 5ARCA 2NO7A 1ZD1A 2LKDA 4J29A 2P6RA 3AEXA 3OC6A 1WXWA 2GPNA 2PJUA 1DVRA 1Y4AE 2QYSA 3F9IA 3NW9A 3VR2D 4DCCA 3GLIE 4A2WA 1SC4A 1EQUA 1XCPA 2XR1A 4ARBA 4MPRA 1AK9A 4D02A 3UHOA 1DCTA 2Q5CA 3BB3A 1ZUNA 2SCUB 4LDZA 1C3VA 2P6OA 5AQ1A 2EL7A 4XB2A 2NUAA 4JLKA 1ZVJA 2YWXA 5FNVA 2O52A 4EENA 3H2GA 2QTLA 2VT2A 4R9RA 1NMYA 2KB0A 5ULLA 3RQSA 2HWKA 4PZYA 2C7BA 2HRDA 3M89A 2OZPA 1LX6A 1UIRA 4ND5A 2HWYA 4X20B 1W44A 3F4KA 1WCYA 1HYHA 1P7WA 5EWMA 4GI1A 1AO3A 2I7CA 3WYBA 4DANA 1CJKC 3VJRA 4HLUA 2OCIA 3HCEA 1Q1BA 2MYTA 3OMWA 3R6LA 4G9BA 4J6EA 3HB4X 5DCYA 4MLPA 3R5JA 1IHPA 2D74A 3QK7A 4M1MA 3FWHA 4M4SA 5A0VA 2X8JB 1Z6AA 1PG2A 3IIEA 1B8PA 4N0QA 3Q41A 4NJMB 1EVLA 4HQNA 3ZUPA 1E2PA 1KYZA 1RWVA 1Z5VA 4RIEA 4UPDA 3K0AB 4XXHA 1P2DA 1AA9A 4XYGA 3UJBA 4ZYTA 1FP1D 1XEFA 4GYJA 1K8YB 2GZDA 2I6TA 3KB6A 4TL6A 5E6SB 5MGBA 3BVPA 2H7CA 1XQ1A 2QAGB 4EY6A 4FGSA 5A6SB 2ZJ4A 5HF9A 3K6JA 1JRLA 1UXJA 2V7QD 2Z9CA 4C76A 4RF3A 3HV2A 2J9RA 4UBNA 3MTGA 4MHSA 1FS5A 2AXPA 1DJLA 1CUVA 3W04A 3ZBUA 2GH1A 1P4JA 1T91A 3Q9NA 1Q0ZA 1WD7A 2R96A 4LJ6A 3HI4A 4XCQA 4ZYVA 2EG5A 2GEKA 2WWYA 5BV1A 2P3SA 2GCOB 3SR0A 2BBSA 2QD1A 2REQB 3CNNA 3G59A 2G1PA 3AJEA 3RT7A 4DG8A 4BX0A 1G17A 1GG2A 3ZVMA 5JSFA 4FTWA 3G2QA 1NLZA 4TUYA 3DF7A 3VRHA 1JHQA 3DEKA 2AR9A 1FXWA 4KU4A 1N4AA 3FHJA 1H8ED 4GVPA 3IKLA 4CR7A 3FLBA 1I1HA 2ZVPX 1Z39A 3PD0A 2ZUEA 3NC0C 3IBTA 1BOOA 3ADDA 3RVDA 4J1TA 4RTJA 1QAQA 1TE2A 4DJJA 3Q3IA 1UBSB 1HH4A 2DT8A 3CWZA 4Q4HB 4ZVMA 1PS9A 3QTTA 5ARDA 2LCQA 4LVCA 5G4LA 2R5FA 1TU3A 3FUXA 5EUCA 3FHCB 4C4XA 1QK5A 1DEAA 4P08A 2VTBB 1SA0B 2J31A 1N6PA 1ORHA 2ZYTX 3ZGLA 3SZGA 1XEWY 3DTVB 5KNLA 3DOOA 1Y7IA 1ZJJA 5AI4A 1GZ4A 4DC9A 4TMFA 1NFQA 2GJSA 3F3KA 2JATA 4F3TA 1ZX1A 2A35A 1RC8A 2Q6VA 3ESCA 4F2WA 2GT1A 1E7SA 1PT9A 4Q6WA 4R6WA 3ILVA 4JQCA 3UOWA 2B4TO 4YC7A 3HVRA 2ZB2A 4O2BF 1R5NA 2VT6A 3LCJA 4S1VA 1N5MA 3IEPA 5DBIA 2RI1A 3FI0A 4QGFA 4YECA 5BYKA 2OHGA 3ZWQA 1O3YA 4LY9A 4P7FA 1V5EA 3V7YA 1M2WA 4PQEA 3RV4A 1I94B 4MWZA 5HE8A 4CV3A 4KMSA 2ZYSA 3C5CA 3R4VA 4JP3A 2NLOA 2OV1A 2DKOA 4R2XA 3BGDA 3CEMA 2O2SA 1TKBA 1GFSA 4Q7KA 2H1IA 1F7UA 3KVVA 2E4UA 5AW4A 1QM5A 1H8HA 1K63A 2JG3A 1CQWA 3IEXA 2JI9A 4H35A 1IBMB 3FNIA 3LDFA 3LX4A 1YKSA 5I9SA 3RSGA 4ZMSA 1IY1A 1DAKA 1SGWA 4FOTA 3UK2A 3WOVA 1CQIA 3J7TA 3DLTA 2P9YA 3DZGA 3BERA 1EVZA 3LOUA 3ZY3A 1KY3A 1SEPA 4A8JB 2XIQA 3AOGA 2C5GA 1O1YA 2RMKA 2NOAA 1X7XB 1U3FA 4EMTA 3B6EA 5JDIA 1UAAA 1XDSA 5F51A 5ERYA 5SY9A 3NRBA 1QIFA 1YE8A 2P79A 3DZKA 1OX4A 4MKIA 4CF3A 3KTAA 5EZSA 1YI8A 4KR6A 2W2KA 1FBTA 1NA5A 3VNQA 1HZJA 1UDBA 3MLBA 1Z56C 3SIXA 3H9EO 4CF5A 1KFEB 3TIXB 10MHA 3PUWA 5B3JC 4HK4A 1MTZA 2CL0X 4PYRA 1RDFA 3GVHA 3PTLA 3PIDA 4D6YA 1M8PA 3NS7A 4WV3A 3HCWA 1CETA 3FCAA 4DEXA 3F47A 1NG1A 4FCCA 2W2MA 1Z4QA 3H86A 3WBBA 3V8QA 3NYQA 4HYYA 2NO4A 4L72A 3WGGA 3U39A 2JIZD 1GQOA 1E2KA 3LY8A 1HDZA 4NMWA 3CCFA 4UASA 3VSCA 5ICFA 2DLNA 1MBZA 2AW5A 3A3YA 4CNBA 1T3LA 5A7HA 2ZB7A 3W90A 4YXFA 1RAGA 3L82B 3HM2A 4F4JA 5IT5A 2PD6A 3BRWA 4D4JA 3VUEA 4H6PA 4WDQA 2FWMX 1VKHA 2PX0A 4M38A 2EP5A 3R5KA 4QJ5A 2X0FA 4BKQA 3G2OA 1CHDA 1QIEA 5JC1A 5ILQA 2UXBB 3EY4A 3H87A 5NULA 1NKVA 2PNFA 5AYVA 2V0CA 4OBWA 2FKNA 4AIRA 1MC5A 2JI6A 3K8QA 3U3DA 4D8UA 5CVTA 5KVCA 2QB5A 2VJAA 4HNGA 3UK6A 2N42A 5HRCA 2UUCB 5TARA 3K7EA 4KFTA 2ROQA 1A7KA 4ESHA 5C5DA 4KNYA 4GKBA 3DBLA 1JLMA 1A8QA 4JD5A 2X3YA 3CW2A 4BMDA 3ASYA 1SD5A 2GN4A 5K9ZA 2VDOB 3IQWA 3PDWA 2F3PA 2OD7A 1KQOA 3H5WA 3MK31 5T7BA 3OTOB 5GPBA 4OJQA 1C14A 5IDWA 5GJVC 3IBYA 4B7ZA 3IQEA 5ALPA 1KDTA 3HXMA 1RM0A 4KG7A 2ZIUB 2ZRCA 1E3TA 3FM9A 4X90A 5ED0A 4YMGA 2PSEA 1M1NA 1RHUA 1Z0AA 2GBPA 2SBTA 4JBNA 4EELA 2QPTA 4C3OB 2C7VA 2PYZA 3TZEA 1U0NA 4XJSA 3EJ6A 5GJBA 1RE1A 3DT9A 5ALRA 1C4OA 5ER6A 4WKCA 2X1VA 5KHOC 3CE9A 2VHWA 3QU7A 2BISA 2XA1A 4G5FA 3NM4A 2AT1A 1OIVA 1OLSA 2BEWA 1CUGA 3HCNA 3BEOA 3MGAA 3DBRB 1U4SA 2I1LA 4ND7A 5DNDA 4HR7A 5GP1A 1GU1A 3QH4A 3WGLA 4GVLA 4IWNA 2DT5A 4HQ6A 5C53B 1NOIA 2XUJA 2R6AA 2V0NA 3AYXB 1BW9B 1QIMA 5CCDA 3H2HA 2FPGA 4BQNA 4YRNA 3PITA 4BQPA 1W5AA 4BTVA 1DQSA 4KYVA 2FW8A 2VXYA 4OXYA 1TZKA 1EJ2A 4EH1A 2WWRA 4L85A 1OFTA 2W71A 1XO1A 3D6HA 3L9WA 4JL6A 4RESA 4YHHB 1TAUA 3RKUA 1SU8A 2FKAA 3CISA 4HN2A 4YRDA 3PI7A 4XGIA 2WVJA 1J0XO 2YIVX 1BMTA 2LW7A 1IXKA 1SXJD 4RSGA 1VIYA 3LF2A 1JSXA 2C2MA 1N2SA 2XNKA 3PA8A 2HJWA 2JKYA 3HUFA 3A4YA 3K2IA 4R8MA 2BCEA 1PW5A 1VCHA 1MCZA 3H2YA 1LH0A 2JFHA 3FHOA 2RSLA 3MJEA 3RC1A 1X1BA 1J2JA 1KFBB 4IDEA 1GPYA 3ACDA 4LXYA 4XEHA 4CUZA 1PW7A 4TPKA 2XLBA 3CF2A 2FLKA 5I5GA 2AF3C 4E4TA 4JITA 4RADA 2IIQA 2H1VA 4J49A 1RLMA 3L7DA 1PSDA 4ATNA 1P8JA 3AKCA 1MJGM 4HLDA 1Q1NA 3LA6A 3DO8A 2GSDA 4LNUB 4MWDA 3GMDA 4I4TA 4YLEA 3SYKA 2X40A 3CN7A 4YJGA 4R71A 3MSXA 2NUTB 2CXNA 2OOKA 2TMDA 1Y33E 4OHPA 4XWTA 1EVEA 5GONA 5BNWA 4MA5A 3FZGA 1FVOA 1I3MA 3A4NA 2ERXA 3K92A 1U6IA 1W88A 2I0FA 3P5SA 1M6EX 3A58B 3QUQA 5ABPA 1W34A 3USZA 2YHUA 4TT3D 5G3ZA 5C1OA 5H68A 4DB2A 1QO7A 3FF1A 3Q7RA 5H16A 1R27A 3R0XA 4PS1A 1T26A 1Y48E 1YOVB 3DCYA 5LU9A 3HYLA 1XJWA 4REOA 4TMXA 1N32B 4K9NA 1LBSA 2BGWA 4BQRA 1JPJA 3SF8A 3HXTA 5K6AA 5ITVA 2JFQA 4X41A 2Q1UA 2ODBA 4X24A 4O4LA 3NC1C 2RKBA 4LMBA 1T4MA 4UOQA 2CDAA 3PGKA 4EX7A 5D3ZA 4OOFA 5CDGA 3HGMA 5JYBA 2UUBB 4DR1B 2WPDA 1BRMA 1YT5A 1QHIA 5LYYA 1JW9B 5GJWC 2ZJFA 4O1MA 4RVSA 3PPIA 3SKXA 2PGXA 5EIEA 2HJGA 3D5QA 1EBBA 1YR1A 1ULBA 2QMZA 3QVLA 3GAZA 3UHFA 1IQ0A 1JI3A 1MJHA 2GNAA 2PWBA 1TT7A 3INNA 3C87A 3SIWA 4LVUA 5JOQA 3D3WB 3FTQA 4F7DA 1UFVA 3JWGA 4ND8A 1AUQA 2A8YA 3A6JA 3B78A 3M49A 2NMVA 4UNIA 4G1FA 3OFND 3G8CA 4MB0A 2IXFA 4TKUA 5KNBD 3H4MA 2G0NA 1M0WA 1P5FA 2XVMA 3C0KA 3K9QO 1RR6A 1ZN9A 4TYMA 4Y2TA 5DI3A 2R5NA 3FTEA 4NCNA 2PU5A 4C1BA 3EEBA 4R5MA 3CUKA 1VG0B 2HR1A 2EL9A 1MUUA 2PMDA 3V9PA 2CNKA 3L43A 4EVQA 1EGMB 1E2NA 3L7MA 2F2TA 3KALA 5AT1A 1SVIA 3G2MA 2XUFA 3MD0A 2A0WA 4RQAA 5IJ9B 1FBNA 1XD8A 4QDUA 3OQHA 1GEEA 3EC2A 3LAWA 1XR3A 5CG2A 3MIZA 3LRXA 2JI4A 4DRXB 3Q7PA 4B2LA 2E89A 1IB0A 3RF7A 5HE9A 4O0LA 1Y82A 2H48A 2WE7A 5KZMB 3PRKE 3R0VA 4I9HA 2ECKA 2D6FA 3COYA 3GQVA 3KQTA 4BV9A 2L19A 3GRAA 3PUZA 4ZJZA 3S2SA 3MBIA 5B1DA 4BQFA 3Q6MA 1C7QA 1OGJA 5AI0A 1FJXA 4FONA 3W3AD 5CFQA 3L01A 1I5EA 1SG0A 3G13A 4JJ7A 1F17A 4OJKA 2D0OB 2W6JA 4NENA 3RWOA 3PV0A 1XAJA 3W7VA 1XZ8A 3HU1A 4ME6A 4OJMX 4BVLA 1A96A 2VRNA 1CQJB 1E6CA 3MD9A 4R3WA 3WLJA 1AQJA 2BCGY 1RKUA 1WSWA 2L17A 3L8CA 3OICA 3OLQA 3MCAA 4F38A 2CLMB 2WRZA 5AM3A 1Y4DE 4BFLA 1FSZA 3KOUA 3R76A 3BQ9A 3RS9A 3J80A 1ORTA 1LK0A 1N2OA 1Z2PX 3BTSA 2C5FA 4MYTA 1RU3A 1D2CA 2WJYA 1Z5WA 3PENA 4M55A 3RVLA 4URUR 1NNEA 2FSVC 1K8ZB 1OFHA 2VJDA 3SPXA 5CCBA 3NR2A 4LZZA 5ALOA 2R11A 4EA7A 3HWX1 3LNCA 2WKRA 2RCNA 4NE9A 1T8WA 1I9GA 1B6TA 5BWCA 1N2BA 2YVLA 2GFIA 5FUWA 4P4SB 5I9NA 1X15A 2KLHA 3NDPA 1VA4A 2BEJA 3R3UA 1LA2A 3R5XA 5CX1B 4C0HA 3GAMA 4FC6A 1O0SA 1COZA 1QIJA 1T35A 1YZKA 2QVZX 3D31A 3N86A 3WI7A 3SSAA 5AMXA 3HYNA 4Y2GA 3W8RA 5DBOA 1ZK1A 4C43A 3DPUA 1OXMA 1XP8A 4NYMR 5HIIA 1HF3A 5FR1A 4L3VA 2D2XA 2R7AA 3IIKA 3AH8A 4PC6A 5ES3A 3QBDA 3ZXIA 3I53A 4PAGA 3K2EA 1GGNA 5B2FA 1E6EA 3P26A 4BKPA 4NU5A 4H4DA 3UXHA 2Y67A 2GN9A 4RZ3A 5AJVB 4ARSA 3MPUA 5ALGA 3WLFA 4O4HB 3ESQA 4HMOA 4RTLA 3IUYA 1BXZA 1GKYA 4O4JB 4X00A 5BRJA 3ZJVA 1KRXA 2CW5A 2G1AA 4KHZA 5IUNC 3E58A 3ZH2A 3A6LA 1RHQA 1W1IA 2NSYA 4H60A 2JCSA 3N6RA 1GGKA 1V8OA 4E5DA 1JKIA 3LDAA 4HDNA 1PZNA 1F20A 2NQTA 2QAIA 1E63A 2D5CA 2WV9A 2VZ8A 2PUDA 1PZGA 4B0PA 2VZ9A 3QNWA 4N0EA 3EZ6A 4NBVA 4B3JA 1H69A 5HWSA 2EYQA 4BO4A 1DJPA 4WWHA 2JLXA 4K6OA 5JT1A 1ZC4A 2GCPA 4NDZA 5BQOA 1DAOA 3AR4A 4UHKA 3AVVA 3G7SA 1Q2XA 1DFIA 2RKWA 1BDIA 1FU7A 1LFDB 2X8LA 3NHKA 4PFKA 2GBCA 4B3XA 1GVHA 1E0AA 3EDCA 2BM8A 3WGUA 1AS2A 2Z2XA 1EVKA 1FP7A 3A2LA 4RA6A 1A9ZA 3O9VA 2LBPA 3T41A 1N78A 3C8ZA 2PLFA 5B7PA 4C3ZA 3GPDG 5EWLA 3WNZA 1LV7A 1QOZA 2PZBA 4V0KA 4Y0AA 1T2VA 1O4VA 2C54A 2MDTA 2NTYC 4GX5A 5G0SA 3NAGA 3RVJA 4EO7A 2R1UA 2EF0A 1F9AA 2GWHA 3B51X 4RETA 2QUJA 1VKZA 1E1YA 4QE3A 2OG1A 1DSSG 2OOSA 3L6OO 4WDRA 1L7RA 1S4MA 2X9QA 5D87A 3KCQA 2G4VA 2XNHA 1R0XA 2DWUA 3L92A 1MX1A 3CEAA 1K0UA 1LZLA 3K0BA 4G37A 4OMFG 1T1IA 1UJNA 3LY9A 1Z8HA 3OURA 4ENPA 5KNBH 2PJRA 3QHAA 4FT2A 1G5IA 1OLXB 1LQ2A 4Q4AA 2W2LD 4YCCA 3E7WA 4Z0TA 4BZZA 4EUSA 2CBGA 1OXSC 1HMYA 3IHTA 4TXNA 5TXGA 5F35A 5EHGA 4RULA 3OTHA 4WTOA 5L9AA 2PPLA 1H0RA 1A2QA 5EOVA 1RBQA 2A78A 1L5LA 4JLWA 5C8YB 2WJZB 2XE7A 3HSYA 3WISA 3NWEA 4XVCA 5GZ6A 1YDHA 2MSCB 4RF5A 2OKGA 1NASA 1L4UA 3AHJA 1BD4A 3GK3A 3Q4GA 2JZOA 2WAOA 3TCKA 3R9XA 2OHXA 3G0OA 3ONVA 4X1YB 4HY3A 4K6MA 3U7GA 4N5MA 3F3YA 2CEAA 5EHNA 1MX3A 1VJRA 4XR9A 4YV2A 3RU2A 2XGGA 3W1EA 5BWBA 4JGIA 2X23A 4AMBA 2PUEA 2AUMA 3O1LA 1C9YA 2VC2B 1R18A 2C7QA 1AZTA 1X7WB 2CBZA 1WW8A 3A0UA 5I9MA 2PKQP 4RK7A 3W3AH 1SWVA 1V2HE 5G0TA 3BORA 3WWZA 4E5YA 3JCZA 5KDOA 4EYEA 2XYRA 3QWAA 1MOSA 3KT0A 1X80B 1ZGBA 2VSFA 2PFSA 5F3WB 1UDWA 1T4DA 4Q1AA 3TW8B 3ORFA 2ASVA 3OPNA 4F5YA 1M8FA 2JL1A 4M0LA 4CG1A 2P2DA 2Q5QA 4Z1MD 4FSDA 4E6PA 1NBAA 2PX4A 3U16A 3FD8A 1ADGA 2EFHB 3FKJA 4N9WA 5KAMA 4XOIA 5LP6A 2D3WA 4HEJA 4P53A 5E1MA 5ADVA 5EKXA 2VOJA 5TT0A 521PA 1MABB 2I99A 1FX0B 2P7IA 2ZB3A 3B85A 3M5WA 4PR3A 3AEKB 3QLUA 2WTAA 2I2DA 3H11B 1VRWA 2CLCX 2ZUTA 4ENQA 5DULA 1XZBA 4IVNA 2CBXA 3TTWA 4PM4A 3TNLA 5CFNA 4CIAA 2Z8XA 3RHFA 4TTSA 2QF7A 3LF1A 1W5BA 4OX9B 3D81A 5K8CA 4ILEA 1QIIA 1ZP6A 2DHDA 4RK5A 1LDEA 1OTYA 2OWEA 2HWWA 3D59A 1XF1A 1XPJA 5D84A 4AN4A 2A94A 3FA2A 4GZ6A 4QAJA 1IBRA 4W7IA 3GAAA 1W75A 4RK4A 5D5HA 3TK1A 3W2IA 1T3ZA 1QE0A 5HF6A 5A5GA 3J7AC 3OA2A 4IG9A 4EFLA 2Y71A 5EP2A 1M2GA 1M8KA 1JEAA 2CL5A 1H2YA 2FXVA 1ICIA 1DPGA 1PR3A 2X0RA 2XJ9A 3HL0A 3FGPA 3IE2A 4H1UA 1TC1A 4MUXA 3IUJA 4O59O 3OOYA 5HKOA 2C3OA 4CLOB 1PDVA 4F1WA 2ZATA 4ESEA 1NMXA 2PBLA 1OV4A 4YUAA 3KSUA 5BOVA 3DE0X 3T9BA 3GYGA 3S7TA 3GFVA 4L16A 4IOMA 3TZHA 3DTYA 1MNQA 3LP6A 3V4ZA 4S12A 4AP6A 5BRAA 1PT7A 4LYJA 3OLCX 2WTNA 3AX6A 1RYBA 1O6GA 4NJEA 2F8SA 4YAKA 4FHGA 3CKLA 4JNKA 1N6RA 1SC3A 3H3JA 4PBRA 4UCWA 3D4PA 5D85A 4ZCPA 1GV0A 1SOVA 4EW2A 2L18A 1DIHA 5JBNA 2HDWA 1G66A 3G6KA 1L9XA 3GLQA 1TEVA 2DHRA 4BO1A 4RTRA 2NWQA 1QH8B 3OOHA 3FWYA 1U7ZA 5K3AA 1ZEJA 3MRSA 4ZO8A 5C5IA 1E2GA 1SUSA 1V11A 1WUTA 2J5RA 4XQ9A 3N6XA 3ZHSA 5DJ5A 4Z54A 1UUFA 5MFPA 2XJ4A 4EY8A 1OAOC 4KQFA 2Z2ZA 3SD7A 1MAWA 1Z8FA 2H2IA 3GLTA 4J0GA 4M8NE 4OQLA 5IN4A 5K0EA 1V1RA 1MG5A 5K05A 4DOMA 1ZRSA 2EFEB 5B4VA 621PA 1GCOA 4BNWA 3HP1A 3K4HA 4LAFA 2VPTA 2ZJ2A 1X7ZB 1THTA 2EFJA 2VJKA 4EUNA 3BFVA 3MTEA 1L5YA 1GGEA 3SE7A 3N59A 5IYZF 3BM5A 3AR8A 2B4RO 1CUYA 4AN1A 2RHCA 4JVNA 3OQNA 1RQLA 3OFSA 4WUVA 4CKZA 5AICA 4LOHA 2F67A 3X3HA 2CYAA 3IUSA 3LCUA 4OV6B 4ZRDA 1MO3A 2YICA 4YQZA 4TL8A 5F9MA 5KDLA 1QKKA 1LSJA 1SCUA 2J9XB 1DJNA 3DAPA 1DBQA 4GX1A 3NWPA 3G02A 4YPVA 5A4IS 1X9HA 5FLKA 3ZU5A 4MRSA 1CVRA 3TR0A 4DYHA 4WLNA 2JHFA 5I7HA 3S0JA 2OECA 2P9EA 1I0ZA 1TVKB 2L2QA 2VF8A 1EZ4A 2XB8A 3BD6A 3DZCA 4PQFA 3O4IA 2MTBA 2ZUWA 2WAYA 3FWZA 1JLSA 4E13A 2FSSA 3JD0A 4CM3A 2G1JA 3ZDZB 4M7OA 4GR4A 4PBSA 2ZE5A 5L3QB 4UCXA 4GO1A 5KBYA 1RYEA 2BR5A 2XDYA 4WZBB 3DSRA 4HDCA 4RTQA 5HKKA 1KL7A 3ILSA 2CY0A 2YXLA 3I0MA 3ZWAA 4YREA 3GGDA 5JD4A 1D2MA 2VF7A 3IGFA 1BE0A 2SCUA 2OEPA 1P1KA 3DXZA 3PSHA 3RJMA 2ECPA 4A23A 3O82A 3H8VA 1HE3A 5LL6P 3VH1A 2PL3A 1A97A 4K6KA 3NXKA 3S1AB 3DVSX 4OQQA 1A4IA 1LPOA 2QP4A 3N0WA 3NNDA 5G1OA 4CMGA 1CSEE 1W6UA 2Q6TA 4R84A 3ICEA 2H8KA 2YFYA 1TL7C 1QDLB 2B8NA 3NWJA 1E5DA 1NBHA 2VN8A 1NC3A 4KXVA 2PLWA 3DOUA 3QXXA 2V9PA 4X20A 3OY2A 4FYYA 4YPOA 3DP7A 1NJ8A 1TCVA 3KXLA 3OZTA 4NFYA 1OYWA 2ASEA 4XDGA 1HT2E 4B5KA 3RROA 3IHKA 3LZCA 3VPCA 3OZXA 4JEMA 2IYAA 1VJGA 3AHGA 5A0FA 2D06A 4DSAA 5D6OA 4Z7QB 1CP3A 3A1EA 1JEOA 4OHWA 2WFLB 5KWEA 5F7JA 4A0FA 2X8JA 3BCHA 4L07A 2WUVA 3EBPA 3KR0A 4RUKA 2ZU6A 3DWGA 3ZVRA 2YZKA 2RK3A 5A6VA 3K0AA 3OQVA 1US8B 2VL7A 1Y1PA 2ANCA 5FWDA 2AMYA 4KC0A 4XDYA 4CFSA 3RS8A 3UVEA 4AC9A 1E5VA 2DULA 2EFGA 3FNRA 4D44A 3FOZA 2IZ1A 1ZU5A 3PWKA 3IAEA 4WN9B 4RDXA 3KLOA 2XT9A 4K9RA 1EESA 1I1OA 5KYTA 2NSLA 2PS9A 3NHWA 1EXMA 2R6FA 3I61A 3WS7A 4N7MA 4PYNA 2J3JA 1YQ9A 1EXNA 1YGYA 2ZYVX 5EZ5A 2BJWA 2ZI3A 2GCOA 3PUJA 5KYUA 2D0PB 4B81A 2C9MA 4QXAA 3WNQA 2Q5LA 3EYAA 4CKEB 5JISA 2HJVA 1DDIA 2FFQA 2VCEA 1N0WA 2DHCA 1C3OB 1BX3A 1ZAYA 5D51S 3T1YB 3UNXA 3ABZA 1VSVA 3E0QA 1JILA 4K03A 4WKPA 3M6AA 4LVOA 2X76A 4DCJA 2QRVB 1ID8A 2JIBA 1YDFA 4K6GA 1Y9JA 1Z7WA 3HKBB 1WM1A 3O92A 4KREA 1ZI9A 2PUAA 1CJCA 3ILXA 2CNWA 1NF2A 1XXHB 2FK8A 3I5YA 5AM1A 4LF5B 2V7TA 4AP5A 3VO1A 2AN9A 7REQA 2FLWA 3GEEA 3C8MA 1EHCA 1NVVR 1OU4A 4AZ3A 3ESRA 4Q4HA 3O4GA 2ICAA 1NUQA 3ETJA 1K88A 5EUQB 3SJAA 2FF7A 3WP0A 1TAGA 3TMAA 1EB8A 2ZANA 3ZJ5A 1PF7E 3DTVA 4EY7A 3EQ9A 5B1EA 3R6GA 2BMJA 3BPSA 3M83A 3R2JA 5EKTA 1A9TA 2ECOA 3QOYA 4IJKA 1T1EA 3UZUA 3Q0IA 5ECWA 4NCJA 2QZ9A 5A3QA 3LC1O 4OX9Y 3IEUA 2O50A 2CLSA 5JZSA 1RWMA 1IOWA 4NKRA 1CR4A 2G6TA 3HFGA 3ADPA 4HFMA 3VDNB 4CI0B 4D3SA 4F56A 4M9RA 5LMZA 4ZTUB 2O59A 1YL7A 5B53A 2KWIA 4PRKA 1FSGA 5C8ZA 2C2KA 3L0OA 3QLJA 3C43A 2NTNA 4U00A 5K7SA 1A7AA 3I9NA 3FYUB 1EA7A 4CE6A 5DIFA 1MU0A 3FMGA 4ENTA 2BEVB 3UV3A 4EF5A 1FVHA 3WL5A 5EZQA 3G23A 3BJRA 3WO1A 3QF4B 1ZW6A 4W9NC 3UYKA 5KSYA 2MMCA 3PZRA 4R9NA 3ZWYA 4WCVA 3E4CA 5IVHA 1KEZA 1KO7A 2ILVA 4TMYA 3EQ6A 5DWQA 3BSFA 1FDTA 3OY7A 1XIVA 2CFSA 4CKCB 1C3JA 3B1FA 1OZHA 2ZCUA 2PMFA 3PGJA 3AF5A 4XD7A 1P2TA 3DL4A 4DR6B 3QU5A 4ITUA 3EUWA 4KQKA 2CXHA 1X7XA 4MQFA 1EWYA 1OOEA 4HGNA 6CHYA 4ZYZA 1ND6A 1S02A 2BL4A 1UAYA 4C0KA 4E5NA 1B74A 1OFUA 4E5VA 1P4SA 2GN1A 2XRYA 2RK6A 4F11A 2BGKA 5BW5A 2J9FB 3D7LA 3WR5A 3C4VA 3I4FA 3MRXA 3MTBA 4UUQA 1OHHA 2P4UA 2ETXA 3MUOA 3ZE8A 3U09A 1N6HA 3GY0A 5JD5A 4WXMA 1BMDA 4XUCA 1U0GA 1T4CB 4MI6A 5E0KB 1D1PA 5JSUA 4MUAA 4YWHA 3OQOA 4TXLA 2DBZA 5FTKA 3FWNA 4CDMA 3BJEA 2VJPA 2J1LA 4LYFA 2PKRA 1YVRA 1NN3A 3ZHCA 4BXOA 1WEHA 3FPGA 2QMOA 3ODPA 1MJNA 3QSGA 5AOBA 2RHLA 1TA0A 2CHFA 3ICPA 2GVZC 3RBAA 4Q4CA 4BIMA 1VRVA 1K1EA 5EJGA 2GAJA 1ISSA 3HJAA 2J6IA 4GPBA 1BSVA 4U2FA 1P1CA 3H5AA 1WA5A 1G8MA 1MXFA 2JCYA 3F7OA 1UBKS 3X2FA 1WY7A 3ZE0B 3LT2A 1KGDA 1R9MA 4DV0B 1NNLA 3ND8A 3O0TA 4DKJA 2O1SA 4F2DA 3T6KA 2H06A 1JH9A 1Z4LA 2JAWA 4EF4A 3OQIB 3O2SB 1I3KA 2RH9B 1MMFB 3GNSA 3RTGA 4CV2A 1S2GA 3DGEC 1ODTC 2QXTA 4F4FA 4RVHA 4DIOA 1G3MA 3NT2A 2NZ2A 2IY7A 3QBVA 2C3UA 3UJPA 3V8PA 1WSBA 1X7HA 4KGVA 4FHCA 4TYPA 4HVLA 1QLHA 2RFLA 3TR5A 2DBQA 1VGRA 2I4RA 3ND6A 1G5RA 2WT4A 4IEEA 4EYGA 1IOLA 1N7HA 5HUQA 2PBRA 2FFBA 1ZI6A 2CXTA 2QN7A 3CJRA 3NHZA 4V03A 1SVOA 4LBVA 4R8KA 4MV0A 1DX4A 4BBPA 2Z4RA 3PNQA 4GMFA 4R3UC 5TS3A 4HX5A 1A4RA 1NW8A 2VP2A 4KQIA 5AVYA 3PKJA 2EAUA 4K8OA 1TX4B 2J30A 3FLEA 3ZXUB 4D41A 1WF3A 1U80A 4NBRA 4I19A 4RKRA 3TEFA 3OE4A 4WRRA 3UTCA 3JQGB 4MUBA 4FP9A 4OYYA 4NHOA 3REGA 3CT4A 3PEVA 5DLQC 4IH1A 3C3YA 2ZXFA 1QOQB 1SZJG 1B0ZA 1SBCA 2JFWA 2XCOA 3N7AA 3NQ41 3P4YA 3V2HA 3DBRA 4JZYA 1SOUA 2GM4A 1C8VB 4IX1A 1YJ5A 2X0EA 1TYCA 2V7PA 1TAQA 3G5UA 4M0DA 4N8DA 1OH8A 3B52X 2PX6A 1QRUA 4HYQA 2OO5C 1BW9A 4TRJA 3EQ8A 1AHHA 3IKJA 2AWNA 1N8SA 4IJMA 1IY0A 3DJFA 4PZLA 4V0LA 1Z18A 2PM8A 3I09A 1EG2A 4ZOBA 2O1WA 3G5TA 3Q87B 3ON5A 5DGHA 2CV1A 2EP8A 2IYSA 1ESZA 2Y1XA 1G64A 3FOWA 3PF8A 2F6RA 4RHFA 3FSRA 1R64A 3I4LA 1JXQA 4L4XA 4RZUA 3PI6A 4J0KA 1HQCA 2VNSA 2C57A 3QJ5A 3M4JA 2O06A 4WJZA 4WK4B 4GZLA 1KGSA 1L7VC 1T2CA 1KK0A 4MUHA 3QW2A 4ISCA 4JA2A 4XCXA 3KZKA 3NAQA 4US0R 4YJ3B 5K0FA 1VPDA 2WJWA 3WGMA 3AIOA 1MH9A 5BPFA 2H8GA 1KXJA 2WF5A 1GL9B 1L8LA 1Y63A 2CFTA 2RJ3A 4KYUA 4YJ2B 1F12A 1E3EA 3I9LA 1JA9A 4B4DA 4BNGA 4C2UA 2I91A 3DM9B 1CY6A 1P4HA 2I65A 3E6AA 3ZDYB 2REXB 4EBFA 4I1RA 3AR2A 4MW7A 4LCBA 4DEYA 2ZBQA 4LNUA 3K8OE 4BQSA 3UAYA 2YUIA 5IH7A 2P1RA 2WUDA 4KHPB 5KC8A 1MB2A 4EARA 2EWVA 3PCXA 2G9RA 2AUTA 4O3FA 5FF9A 3A6EA 2VYVA 5FBVB 1XFDA 3N0RA 2W2TA 4BKRA 4NYJQ 2C84A 1NI4A 4ES6A 4OGFA 1DQRA 3JQDA 4DUGD 4EJ0A 2BSAA 4P4LA 2DFLA 3FFBA 4WESB 1PQYA 1YOVA 1C0KA 2QIPA 3PFBA 4RA9B 4UCFA 1Y9EA 1G5PA 4AMVA 4EPRA 2PGJA 1S89A 1HBJA 1GPLA 1PK9A 5H70A 4RH0A 5HKBA 1R4NB 1RM5A 5JJCA 2AFIE 3U9SA 1L4EA 3WKBA 5HQ3B 1UXHA 2XVAA 3HPRA 3FI9A 3O6VA 2VF5X 2DUJA 4C7VA 1CWUA 4PYQA 3VM6A 1JJAA 3OJLA 2NPIA 2Y4NA 2JCBA 1K75A 1ML4A 4LTMA 2YQ4A 4Z9FA 1Y1LA 3RTCA 1R0RE 2PO5A 2YVAA 3ETHA 3GJ5A 3LWDA 1EFTA 3MTAA 2X86A 3TLEA 5F78A 2IUSA 1F1BA 3FLAA 4TS9A 3UAZA 1Y5NA 5BMVB 5AW7A 3OWOA 2FZEA 1HNZB 4H1TA 1VLJA 4D9KA 2PH5A 2XTNA 1V5IA 1TXGA 1FLVA 1WXGA 3L0PA 1J42A 1XAGA 3PNYA 1CBUA 1XMQB 1JFLA 2C3YA 2WKPA 4ZV9A 3ZHVA 7MDHA 4IHJF 1QHYA 4X85A 4DA6A 2ENWA 1YUBA 4RPLA 1GUZA 5I47A 1T2NA 2O8BA 2PLAA 3O2JA 1CZHA 4B6PA 1NNUA 1SU6A 2YASA 1IY8A 1N92A 2C9BA 4AKIA 2GD0A 1E9BA 2XD9A 2YJ5A 3HWWA 3OZSA 3OH8A 2WU0A 1Y3FE 4A6DA 2CLDX 2J0UB 2PH1A 3LW7A 1PL7A 4ZI3A 1WULS 4FHDA 4NS1A 4KE7A 2PZ8A 4YP7A 1R2QA 3TNDA 2QY9A 2BHSA 5IJ9A 4DY4A 4IJVA 4QX6A 1QWOA 3T5AA 1A76A 2FW1A 1L4BA 2Q46A 2DQZA 4GMDA 4BMNA 4JXXA 5E8JA 4DRXA 5AJTA 2HEIA 5EHIA 4B7AA 3LQ4A 1IDOA 4GIBA 5AK6A 3UCEA 1A1VA 3BIFA 1U2GC 2HCJB 4A6PA 5D5PA 2CL6X 1H0SA 3FGZA 3G2LA 1ZIOA 3CIOA 4IH4A 3RD5A 1I2MA 1TMYA 5CURA 1DBRA 2G7MC 3IA7A 1VTKA 1V48A 4QOGA 5EVCA 4BO3A 3BJMA 3M6FA 4G89A 1W73A 3ERCA 2H0QA 4MCAA 2YBEA 4O5OA 2W6IA 4WLFA 1BN7A 3T52A 3KXDA 1NP6A 1OYOA 1ZSVA 2M6SA 1R6XA 3GPCA 3IBGA 4E88A 2JD1A 2G0AA 4INAA 1VHLA 1CQJA 4MROA 1V6SA 2DUNA 4B44A 3KKLA 4TWRA 1RWKA 3F6SA 1RRVA 3ORQA 3I01M 3OHMA 3RDPA 4ZGGA 1W36B 3NX4A 1HGXA 2YCLA 2ZJBA 5J3JA 3F1LA 2R4UA 2C83A 3SE0A 2FQXA 4TTIA 5GOTA 1SBZA 1FP2A 3PE3A 1SOAA 2VSQA 3HR4A 4N0DA 1E3DA 4PPYA 1UODA 3SYMA 4BVKA 1DO8A 3GPIA 1A9SA 3HRKA 2R2AA 5A5VA 3OEWA 5FOUA 1AIPA 3J81A 4BLPA 4EG1A 1RQ2A 4EYSA 1ZMRA 1PO7A 3HRHA 4P4SA 2B4QA 1U3TA 3QVGB 1MAAA 4P81A 4WI1A 4RM3A 5CX1A 4IILA 5SZHB 4B9AA 5ICEA 4MXDA 8MHTA 1IQRA 3AIIA 2ZWVA 4D8YA 3S27A 1QE5A 5LZ9A 3ELBA 2DBRA 3KCNA 1OV6A 1XRPA 2GASA 1KRWA 3AR3A 3W9SA 4EVSA 3ZUGA 4M53A 2QQFA 4ESOA 1G21E 2WG0A 1MNAA 4R68A 5JH7B 5K5EA 2R6ZA 4IZHA 4JS0A 2AHOA 1I7QB 2BTEA 1N8KA 3CUSA 3K9FC 2AN1A 4P0PB 1EFLA 4E5MA 3JATA 3VR4D 1ORVA 3QEOA 4DNQA 4GXNA 4RXUA 3FRHA 4O4HA 4XYLA 1ZM9A 2A33A 3KZMA 2WJIA 4O4JA 4PSVA 2X58A 4PCAA 1AKYA 2Z04A 4GQAA 1C5KA 2WDPA 2VHQA 4Y2JA 4F4IA 3MT0A 2OBLA 4L73A 3DLIA 5BNIA 1T25A 5HYVA 1N5LA 2QTFA 3VSDA 3W5SA 1N6OA 5BN3B 1JEQB 4HGOA 4RJJA 4D0NA 1H66A 3VA7A 2IPNA 3FPFA 3JSAA 1M34E 4AZTA 2FU5C 3LFHA 3DO6A 4XPIB 3T7IA 1KARA 4R5HA 3C7CB 2XQFA 3D2AA 4PY2A 2YV3A 3RYCA 3DAHA 5JJ5A 3EGWA 1GZUA 1XKLA 3OTQA 3P0HA 4XQ0A 2D5BA 3WSVA 4LQ4A 3K31A 2P6NA 4DSZA 4KR0A 4IVPA 1FPQA 2XCIA 2QTNA 3VDMA 1Q1QA 2WK1A 4N18A 4NBUA 2CFOA 1IK4A 3KAPA 3OE1A 2ZRBA 2B9EA 3Q3HA 5CHEA 5COAA 3NEJA 3I9MA 2C5BA 1O9GA 5EJFA 6NULA 5JBIA 3GFQA 1P72A 1HM5A 1Z36A 2P9QA 1DTEA 1DBIA 2HMYB 3IOEA 4LX0A 5DPMA 3KKKA 1JQEA 3V4FA 3WMEA 4ASUD 1J1IA 2J6HA 3FDJA 1UPUA 3AKEA 3K70B 5K0GA 1KZYC 4BVAA 2AQHA 1LRKA 1W59A 3ONDA 4BCCA 2BR3A 4NFHA 1E5LA 4IV5A 5DYYA 1Y6QA 2AR7A 4MYRA 1HSOA 1E1RD 1RMQA 3BH6A 5AVSA 5HQTA 3DL7A 5LIRA 3F6PA 5T4BA 3ZDEA 4IF6A 2Y6UA 1E2EA 1GPMA 1OLXA 2NSDA 1AKQA 1XSEA 2JJ8A 1J8DA 3HCOA 1GZ6A 1E4OA 1YZGA 4WE3A 1CUDA 5FLXA 2VJLA 2FCAA 3WWCA 4DGSA 4N5IX 3PC8A 1ZNQO 2QD2A 3TUJC 1BJRE 5LC1A 1D5CA 5C8YA 4TV9B 3TIGA 3WKCA 3RRJA 1N77A 3X1MA 4CZ2A 1U2ZA 1UMDB 1Z3IX 3W4KA 2F3RA 5JDCC 2DPXA 4OHXA 3RIGA 1RNLA 1Q11A 3W3ZB 1W0JD 3UF0A 3OZFA 4Z8XA 2H17A 5LQNA 1PR6A 2CVHA 2N1MA 3VU3A 1CEXA 4BAGA 1PJSA 4ZVPA 2DC1A 2XMBA 2O14A 3ZVLA 2QT0A 4LQDA 1X7WA 4DA9A 1YHZA 3ZX4A 4J0QA 5JECA 2NV0A 2RE8A 1AQNA 5AJUA 3H2ZA 2WIBA 2WJ6A 5KJ6A 221PA 1X80A 3DCJA 2BP7B 4ZJPA 1G0NA 4WLEA 1LZKA 3MAAC 2WTBA 5LXTF 4TS4A 1AKMA 1RLOA 3KAKA 4FFWA 3TW8A 1IMOA 2FPPB 3DNMA 1XYGA 3MTIA 3N2GA 1Y6FA 1E32A 1C7FA 2FPMA 1A8HA 2HA3A 2Z1NA 5E3JA 5CNJA 1ZH8A 4GSKA 3CMCO 5FP0A 5B30A 4HS9A 3VDQA 3B3QA 4LMAA 3BCRA 2QPAA 1Z2NX 4Q18A 3B6IA 1K3FA 2O2CA 1MABA 1NY6A 1FX0A 1PFKA 2G77B 3FJYA 2QXUA 4WK2B 3AEKA 5EP4A 1QYRA 4TMVA 3SQLA 1GAXA 1IZ0A 4R9UC 4BIIA 2O0LA 3HO6A 5SY4A 1COWA 2RGGA 3D2LA 3FYHA 1E3IA 3EEYA 3LHIA 5AKZA 4DDVA 4PONA 6LDHA 1I6KA 3GMSA 1M6WA 4HG2A 5DNAA 1GR0A 4ZT4A 4GP6A 2VRCA 1E79D 1DO2A 2DUWA 3AMVA 1CD5A 4YCNA 3QJYA 2G6BA 3T61A 8ABPA 1LPBB 3WSTA 1EVYA 2X5XA 3OU7A 3QXGA 2WHRA 2QMQA 2HSWA 2FG7C 4YY3B 3VISA 3OJFA 1Y3CE 2CFIA 3MS7A 4S24A 1MOQA 3K94A 2CNLA 1EYZA 1VG8A 2D8MA 4MICA 5IDYA 3VR4H 4UE3S 3LYUA 5EE1A 4G56A 3SIPA 4CMJA 4DR4B 3ER6A 4EHNA 1HUQA 2HWXA 3Q3CA 4EL0A 5HZMA 1E0DA 2GMWA 4LG1A 5KVQA 3VZRA 1EK2A 1N2IA 3ECAA 3AP2A 3WK6A 3O2QB 1SHKA 1YC2A 1OWOA 4PZ9A 1VCMA 4G1CA 3RJ9A 1NFFA 2NVWA 4DPLA 1HORA 5L8VA 1MPXA 3FNFA 4QVKA 1EUCB 1DE0A 1YFKA 2QM0A 1K7EB 2YN0A 4UBOA 4COKA 4N41A 3E7FA 2ZJOA 5J5VA 3UV6A 2XA9A 3DMTC 3NFYA 3SKYA 5IKPA 1KZ6A 1NBWB 4DAOA