1YRXA

Structure of a novel photoreceptor: the bluf domain of appa from rhodobacter sphaeroides
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
118
structure length
118
Chain Sequence
AGHMVSCCYRSLAAPDLTLRDLLDIVETSQAHNARAQLTGALFYSQGVFFQWLEGRPAAVAEVMTHIQRDRRHSNVEILAEEPIAKRRFAGWHMQLSCSEADMRSLGLAESRQIVTVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Novel Photoreceptor, the BLUF Domain of AppA from Rhodobacter sphaeroides
pubmed doi rcsb
source organism Rhodobacter sphaeroides 2.4.1
molecule tags Transcription
molecule keywords hypothetical protein Rsph03001874
total genus 32
structure length 118
sequence length 118
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1yrxA01
4OJ3A 2QLWA 3BB5A 3BF4A 3HDSA 3CJKA 2OD6A 1P8GA 2HFOA 2XMWA 2CRLA 3DCAA 5B09A 1Q8BA 2LXFA 1IUJA 1TR0A 2ASYA 3GZ7A 2HFNA 5KAKA 5IXUA 3F44A 1R6YA 4A48A 2RU9A 2XMMA 3MCSA 2FB0A 1URRA 4OJ1A 2N7YA 2HLTA 2K1RB 1YG0A 2GA7A 2XMKA 2GGPB 4OJGA 3TNVA 1X0PA 4FNIA 1OQ3A 5B0DA 1AFIA 2OAUA 3HHLC 3KNGA 3QMQA 1OPZA 1TZ0A 1OQ6A 2XMJA 3FRYA 1VQYA 1FE0A 1S6UA 2K1RA 4NL5A 3T9NA 2W4CA 1FVQA 1MWZA 2HIQA 3BM7A 4A4JA 2KT2A 3BGUA 1N5SA 2HQIA 2OP5A 4A46A 2GO8A 1FVSA 1W2IA 1K0VA 1SQEA 1YJVA 2ROEA 1WD6A 1GXTA 5A6PA 2PD1A 3I9ZA 5T7LB 1X7VA 2RMLA 4HH0A 1ULRA 1Q8LA 1YJRA 2AJ0A 2HLUA 1OSDA 4ZOSA 3TRGA 3UDCA 1FEEA 1TL4A 4U9RA 2RSQA 3HHLA 4YDXA 3KG1A 2ROGA 4FNHA 5B0BA 2OFHX 4HL9A 1S6OA 2Q3PA 2VV5A 3BN7A 2XMUA 4ZA1A 1AW0A 2OKQA 1XBWA 2VH7A 2KYZA 4DL0C 1AFJA 1VQSA 2OD4A 4DPOA 5B0CA 1JK9B 3BR8A 1RJJA 3IWLA 2RILA 2K2PA 2N4CA 1YJUA 3HX9A 2G9OA 4Q2MA 1Y9OA 1YJTA 1Y0HA 2K7KA 4F67A 1CC8A 1Y3JA 1Y3KA 1N5QA 2FHMA 4OJHA 2GV1A 1GXUA 2L3MA 1CPZA 1KVJA 1SI9A 1LQ9A 3LGMA 2W4PA 2GGPA 2ZDOA 3HHLD 2QLXA 4Y2IA 2XMVA 3HHLB 1TUVA 1FD8A 4HH1A 2GCFA 2AJ1A 4A47A 1Q4RA 1TL5A 2XMTA 2IYIA 3CJKB 3KKFA 5T7LA 1U7LA 1KQKA 3E8OA 2N4DA 2JDJA 2BJEA 2BUNA 2W4DA 3KG0A 2LQ9A 4HI1A 1Q53A 2IFXA 2EW9A 2K7JA 3LGNA 5B0FA 2LQBA 2OMOA 2AW0A 4Y2MA 4OIXA 5B0AA 1JWWA 4YEAA 2LDIA 2BJDA 2BYCA 2KT3A 2GFFA 2FTRA 3TOQA 5F0WA 1SB6A 3HF5A 3DXSX 4QOTA 1CC7A 5A6WA 2QYCA 2ZDPA 2ROPA 5K9FA 2KKHA 1YRXA 2AP6A 2PGCA 3K7RA 5B0GA 4DN9A 3IWXA 1FE4A 5B08A 3FGVA 3QGPA 4HI2A 1APSA 2ACYA 3VTIA 2BBEA 3BDEA 5B0EA 1KVIA 1QUPA 1N5TA 1V3ZA 2QIFA 5F0UA 1X8DA 4Y2KA 1N5VA 2FIUA 3FMBA 4NPOA 1FESA 3WDOA 3HFKA 2OFGX 4Q2LA 1P6TA 2IYGA 1MWYA 3MZIA 3LO3A 4EFAC
chains in the Genus database with same CATH superfamily
2R7QA 4ZCMA 2FJXA 4RU2A 4MKBA 3R5CA 2MKKA 3KK3B 2OD6A 3UN3A 4LF7F 2BX6A 2OMLA 2PC6A 1T9YA 2ZZTA 5A8WA 2FPHX 5JMNA 3O5TB 3AFGA 4B9NA 1IUJA 2UUWA 1XR6A 2J6UA 1TUGB 4JV5F 4NLUA 2OTLS 1N34J 4DWIA 4X64J 1KHWA 4USWA 2MDAA 1I5OB 2FVQA 1URRA 2F65A 3UI3A 2CG4A 2ALYB 4TU7A 2RDJA 1NLKL 1NMEB 3QJLA 2ZJQQ 4P72A 3KK2B 4LF9F 3H98A 2ILYA 3T5HA 1PYTA 2ZH5A 2WB1D 4MKAA 1FKPB 2FVCA 4ZLPA 1HI0P 1RQ0A 1REVB 2DCUB 5HROB 3NP5A 4LRBA 1RT4B 4I67A 3W5ZA 1VQYA 5FD1A 1SJRA 1S6UA 2FJBB 3ZZOA 1VMBA 4ED7A 4M95A 1MLAA 2E44A 2HIQA 2QSWA 1NSQA 9RUBA 3AD8C 2AGPA 3LW5C 5G0RA 4LFAJ 8ATCB 1FCAA 4NYPA 4OI4A 3EPGA 2EK6A 1E6VA 4PYAA 1S12A 2FHJA 2RMLA 5HATA 2QV6A 2DYAA 1VBYA 1VYAA 2Q79A 3DRPB 3PRBA 5C25A 2OO4A 4K5RA 4CP5A 2AYGA 4KTQA 5B0BA 1RTJB 3HKWA 3J7YI 2GVDB 2Q43A 4N7TA 1NZAA 3Q8UA 4EYIB 3MTKA 3DLEB 1UWBB 4N41A 1U2CA 1HW8A 4I2PA 2BABA 5KFYA 1AW0A 2F4VF 2VH7A 4I6YA 2J9DA 4URQU 1RHUB 2BW7A 2EEYA 1JIHA 1WOPA 2DHAA 2OD4A 3AXMA 1FO1A 3KLIA 1U47A 2BJ3A 4TY8B 1M5VC 1TAQA 1MROA 2MKCA 1Y9OA 3PYDA 2M0GB 3AJ1A 1ZM9A 1NKEA 3TA0A 4CQ1A 4DU8A 3JAMY 5EWFA 2MXYA 3M2UB 1AUDA 5E0OA 3CJSA 5IWAJ 2V8VA 1JLAB 2P2CB 3E01B 3PEHA 3QIPA 3OSNA 2GJIA 2NSCA 3OTDA 2NXEA 3ETOA 1YJWS 2Y9HA 1F60B 2XMTA 3H8YA 1XNRF 4H54A 2DGQA 2ZWOA 2ZHBA 2XTJP 2NUHA 2OHDA 2HFSA 2EW9A 4IRCA 2R7TA 3RUBL 3HKZD 5B0AA 3RR8A 3C6UB 2LYVA 3NS7B 5DDRC 1KFDA 1RWWB 4TU8A 2CPIA 2LDIA 2QGFB 1XNQJ 5LMUJ 4QR1A 2E7XA 1VC5A 2FTRA 1V5IB 5CYQA 4DF4A 3QJPA 4Q45A 3MR2A 1S9FA 2J6TA 2W2MP 3LGHA 4DV3J 2W9AA 4DLGA 4WP3A 2GO9A 5EHHA 4ECXA 3OFFA 4B9TA 3FBBA 2G1HA 1T9VA 2PGCA 2X3DA 4HT5A 3VVUA 2R8GA 2KVQE 4ANCA 4WFZA 1TKDA 2BJ8A 3IWXA 1HD1A 3TARA 3FBCA 2HQCA 1DY3A 1MN7A 4DR2J 1VQMS 3POTB 4MFBA 4OLPA 1D9FA 2M9KA 3HD2A 1IWGA 2ZZNA 1S4EA 3SCIE 1S9EA 3EGVA 4ILLA 2DO4A 1XNQF 5EUHA 1EQMA 4DV2J 1HYSB 2DGTA 3DI6B 4OHZA 1FFWB 3KLGB 4IDKB 3P45B 2KHCA 2W7PA 4OX6A 1PYOB 2ALZA 4KO0B 3WDOA 3HFKA 4DPUA 1HBMB 2MSTA 1SIWB 4OZJA 1FWPA 2MQMA 4PG5A 4L3NA 3BB5A 2QFJA 2CZVC 3Q8RB 3D1HA 2VQEJ 5E3CA 1ZTTA 1UFWA 3FMWA 1RWKB 3I56S 3EGZA 3E3XA 3DOLB 1DQAA 3QT6A 3K5MA 1EP4B 2QA2A 2YBVA 2KZMA 2ASYA 4ANEA 4FVCA 1S97A 5KFUA 3MWBA 3F44A 4CO0A 4RR5A 1HYSA 4GKJF 4X84A 3D9BA 3H5YA 3ULHA 3QAEA 4QIEA 3MCMA 2V2QA 2L9WA 3R27A 2GGPB 3NRBA 3K58A 1R8AA 3MAHA 4DL6A 1RAHB 1NK0A 1K47A 4U95A 2AKWB 1N36J 5GAEU 2H1YA 2HHSA 3O2IA 2QLJB 3BSCA 1WSVA 3FC9A 3M8YA 2LU2A 2V50A 2ZVSA 2HRYA 1YBTA 1BXNA 2AGOA 1WC1A 3GWCA 3TJ8A 1LKZA 3SZ2A 1U1QA 1K0VA 3NBPA 4ECVA 3CTRA 1FFGB 1OIAA 1HKAA 2D9PA 2VL1A 3MHYA 1VQ5S 2VONA 1CQNA 3BS9A 2AEFA 4AQYJ 3ITHB 1G2EA 3IWNC 1DLOB 2C1EB 4Y2AA 4LF6F 4P10A 1EB0A 1LWCA 2B5JB 2QE5A 3HVRA 3PR4A 1KQSR 4W90B 2VV5A 4KY3A 4P7VA 5L1LA 2HWTA 4F4YA 3CUNA 3GCXP 3G82A 2V34A 5J2QB 5DQGA 4C9DA 1RLCL 4LF9J 3DLKA 4TN2A 2AMCB 2MQPA 4UUXA 4RW4A 1VBXA 3CC7S 5HL7Q 1NU4A 3ZTQA 4KSEB 1SH2A 2HS3A 5F9LA 1B3TA 1SUQB 4LREA 3TZZA 3DGPB 3O1LA 2HRTA 2MZJA 2IDEA 1KVKA 5IQQA 1VS3A 3U1MA 1N5QA 1S1TA 3MMBA 4URSA 3ZXWA 1GXUA 4CWBA 2I1RA 1CPZA 3ZZUA 1S1WA 4LT6A 4QYZJ 4LR9A 4CLYA 2LEBA 3FVYA 3CCQS 2VFTA 4OL8A 1JLGA 2H5EA 4I56A 4ZLLA 1KTQA 1PJ5A 1TK0A 3M05A 1TL5A 3TJ9A 5ITHA 1PAUB 2LECA 2KM8C 1BQNB 1U7LA 1HWUA 1TUWA 2JDJA 2C2KB 5B0FA 2E1CA 3LGNA 2WAQD 4WTYA 1FRIA 2ZJRQ 2KVIA 2XSFA 5JXSA 2YX4A 3JTOA 4YFUA 3DLGB 2KXNB 2EC2A 1HNZF 1RB0A 3LP2A 3AB2B 5CXTA 1RADB 5IT4A 4H4MA 2XQCA 1TTHB 1VHIA 2NXCA 3HF5A 3DXSX 1Z2LA 3GFYA 3JSBA 4FXWA 3I5CA 2FHKA 5CCLA 3GIKA 5K9FA 2XGQA 1QTMA 3M8PB 3GIRA 3FCWA 1HHSA 3OPKA 4L75A 2R4FA 4NCBA 1IM6A 4DN9A 1VC0A 1I51B 1TAUA 3FSIA 1RBOB 2DNGA 3NS6A 5M2PA 2XI3A 3QRQA 4O4GB 1LWFA 1VHFA 1KHVA 1FTCA 1RT2B 3EUNA 1MG7A 3QZ8A 2PA8D 1H74A 3FNNA 3OV7A 4XK8C 3RB4A 2CQ0A 2CQHA 4ID5A 2QN6B 5DDOC 1SC1B 2HK3A 1RWOB 2HZCA 4AXJA 2OSQA 2GS8A 1X8DA 1O51A 2X1AA 3NWGA 1ZBTA 2HW3A 1RT3B 1X4DA 1LV5A 1ZPWX 1SVDA 4MKVA 3TA1A 3I5BA 1QSLA 2NPIA 1UPPA 3HT0A 5L9NA 4OJ3A 4LF8F 4KHPF 3MMJA 2DBBA 3MAQA 2RF2A 2BDPA 3CO0P 1N54B 1C0UB 3S7RA 4DZ6A 5DO2A 3KJFB 3J7ZT 4NLPA 3BZQA 4NCGA 3LOUA 1N5YB 3NS5A 3F41A 2W25A 3VV2B 4UQGA 4A8XA 2F3JA 4DX6A 2JEIA 2JC1A 3KDOA 1NHVA 5CAAA 1WG4A 2JH3A 4MK8A 5E3AA 1C1BB 4KGXB 4DSFA 1IKYB 1KDNA 2OI2A 3H4DA 3MM6A 3KNGA 3CMQA 2OEJA 4FXVA 4FYYB 3W61A 4CO2A 4USKA 3PZPA 4NZ6A 3R9LA 2MKSA 3GU0A 2ZKTA 1XR7A 4PWWA 3HXMA 1FDDA 1KD1T 1ZAWA 2IAJA 2E9RX 2LU1A 2R3VA 4H4OB 4KB7A 3IRXA 2KT2A 5J1EB 3IN5A 1TV6A 3BN4A 4ED0A 2HQIA 4NLGA 3HVWA 3TAMA 3NNCA 4EI2A 3EZUA 2DHSA 4DV0J 1YJVA 2P5VA 2X7IA 3SXLA 4GRSA 2J7WA 2B8PA 2C3MA 3DI6A 3ICLA 3J81Y 4RKUC 1C1BA 2YWEA 3LP1A 1IQTA 1TL1B 1DLOA 1TL4A 1U6BA 4LF6J 2DH8A 2R7OA 3KLIB 3HJVA 1Q1KA 1JXEA 1F9EB 4HL9A 5F8HA 2KYXA 4P71A 3TUJC 3ZZ0A 3DYAA 5J2NB 4KH1B 4O3NA 3DRYA 2QC3A 2MTLA 3UPFA 4JI6F 3DFEA 2PMHA 3D3BJ 4CRJA 3QGGA 4TLQA 3ILOA 4M5IA 4G6VB 3PG9A 4DEZA 1FDAA 3GV7B 2UU9F 4PQUB 2V68A 4JI8F 3SDEB 1GT8A 4M5LA 3UR3C 1R0AA 5F3ZA 3MAAB 2XMVA 2C2MB 1NCLA 4WZMA 4FDFA 1FD8A 2XYGB 4LIWA 4B9VA 4ZVSB 1TK5A 4RW6B 2QSFA 3C15A 5F41A 3CJKB 2JZ5A 3UDVA 1IJEB 2M5YA 2MPUA 4QWDA 2W4DA 4DG1A 3FZBA 4JV0A 1H6KX 3H5XA 3SQOP 4LVNP 2ZHOA 1V3RA 2JLFA 4X66J 3D0IE 4EWTA 1RZMA 2B5JA 2DNOA 5KFLA 5J1EA 1N33F 3T3FA 2OPRA 1YITS 3HMJG 3NBPB 3PX0A 5HO4A 3TOQA 1S79A 4HACB 2QFIA 4OZ3A 5F0WA 3Q24A 4JI7J 4LFBF 2BV3A 1EETA 2UUBJ 3RBDA 2H51B 2Z8QA 4DR3F 1SJ4P 2J8SA 3V6JA 1S49A 3FKBA 2HAIA 3DLGA 5RUBA 2C2NA 2J0XA 4F04B 4EZ9A 1M5KC 4U7UD 1C1CA 1HBNB 1RP5A 2WOMB 3GG0A 3M8QB 3M9NB 3BO3A 3V81A 1HNWJ 4IO1A 3HZEA 2R7VA 1KP6A 2V2ZA 2HWHA 2DR9A 5ADZA 2GQCA 5KFZA 5KT5A 1WORA 2BM0A 4M5KA 2ZJPQ 3IO1A 4KRWA 1ZZNA 2UXBJ 3M8RA 4BWJA 1V3ZA 2W9CB 2V9WA 1ZM4A 4ES3A 3Q89A 3DRRA 3W2WA 1S1TB 1EETB 4WWSA 2CG8A 4NLXA 4N8NA 3NEKA 3WX4A 5HQMA 4UUWA 4NWBA 4ZP8A 4J37A 2B8QA 3GJQB 3TR5A 4DX7A 3GIJA 2DY1A 3PX6A 5A76A 2VG5A 1LXNA 2HQ3A 4DL2A 5SZTA 3DOLA 2XS2A 2NXUA 1Y5IB 4DS5A 4UY85 6FD1A 3HHNB 2B43A 1RKIA 2A3JA 2NSBA 4O44A 2LA6A 3IBFB 4IR9A 5KT2A 1PSDA 4DG1B 3GZ7A 4M5JA 2HFNA 4C3MA 2DNRA 4LRCA 1RLDA 4TY9A 1REVA 3MCSA 2HKEA 1UA1A 5IM0A 4L6V3 2GA7A 3OHAA 1UPMB 3LALA 3MM7B 4K7QA 1OMSA 1NJYA 2E5LJ 1FJGJ 1Z2ZA 2EI5A 2KRBA 2Z56B 3R5AA 2DNPA 2W2OP 4B9LA 3QYYA 1RT6A 4CYUA 5B7WA 1SL1A 1RT1B 1B70B 2VA3A 4B9MA 1TZ0A 1OQ6A 1R31A 3R8YA 4EYHB 2GHWA 4DOZA 1SV5B 4TYBA 3AJDA 1NDPA 2DNKA 1CVJA 5K8MA 2OP5A 2KB2A 1RAEB 4CT9A 2D3ZA 1UMJA 3SQGB 2IIHA 3VF0B 1B99A 3ZTPA 4OI3A 4PAAA 2F4VJ 1BQNA 2VASA 3C19A 3B54A 1N32F 2A18A 3HSDA 3P4UB 3ET6B 3W8GA 1XTZA 3THVA 4UOGA 2R9LA 1RBAA 4JYAF 4QBUA 3TW0A 2RSQA 4K4TA 4YDXA 2VU5A 1KBRA 2ROGA 1YZ7A 3C6UA 3I0RA 2LDYA 3N79A 4MYTA 1S0MA 1S6OA 4V19J 3PNIA 4KGZB 4NLWA 3DOMB 3FFIA 2XWXA 2WCXA 3HFVA 5KFXA 4OHYA 3KLHA 4LFAF 3BH6B 4KE5A 2MZTA 4Z7YA 4AYBD 3VAKA 4JOUA 3OHBA 2FC9A 4NLSA 2J9EA 1Q5YA 1IKYA 1QTNB 1RJJA 2ZOGA 3L7PA 4PPZA 2HFVA 4DR7F 4F67A 1BY9A 2V94A 4PG6A 3CNQP 4ZVPB 1T03A 1LQ9A 5LSLA 4YHHF 2V6AA 1WC3A 2OJ3A 3NOCA 2V4RA 2DRAA 5HVGA 3BO2A 1UVJA 2DIUA 2VPZB 3AODA 3MD1A 4DUZF 1M5OC 2XHWA 5D8HB 4AL7A 1Q4RA 2UUTA 3UVJB 1FK9A 3W9IA 3TNVA 1VQ6S 1G6BA 1KQKA 3PO4A 4FN5A 4CZCA 1S1VA 1I3OB 4ZVRB 2IY5B 2BUNA 2BEFA 4ITSA 3A3PB 5IC6B 2MKHA 3DMJB 3FEXB 4DL3A 1ZYQA 3LAMA 2HS4A 1FF2A 1T94A 4B3MF 4DXLA 3FQKA 3E51A 5CD4A 4DL4A 1WHXA 5D4PA 1S1UA 1UL3A 5D15A 5H1SV 4IFYB 1T05B 3T1YJ 4Q8EA 3PW7A 2P6SA 4HACA 3W63A 2IM3A 1T9UA 2RHQB 2BANB 3JTPA 4DUZJ 4I4BA 3E2EA 1LWFB 1SJ1A 1WHYA 3PW4A 1NXIA 2WW4A 3CIMA 4QU7A 4ZPVR 2VQFF 3N01A 1Q0NA 3O6QA 4ZN3A 3WIVA 1X4AA 2VKZG 1R0AB 5IT9Y 1RT2A 3H5UA 1BE4A 4DJBA 1KVIA 4U8VA 4PUOA 4EK2A 4G1PA 5H9EK 1FXLA 2MKYA 3Q22A 4BC9A 4C8KA 4IFYA 1T05A 2HVEA 2FZKB 2CJBA 2CPJA 3MEEB 2AF6A 3DRRB 4OYPA 3SDEA 1K9MT 1JKHB 4NPOA 3S6EA 2QA1A 1H2TZ 1VCTA 3C6TA 4I2QA 2UVVA 4ES1A 4K4YA 1U09A 2BQUA 4X65F 3LO3A 3N0VA 4YQWA 2LEPA 3IR7B 1X5TA 1KFSA 4ILRA 4P52A 4IQMA 3UCUP 3UVJA 1OWXA 2KHDA 1W7WA 2OPSB 3QBCA 4DN0A 4J9MA 1N32J 4ZIWA 1S1VB 2I5JA 2MHEA 4D3GA 4EZ6A 1ICEB 1PO6A 5D4NA 3RYLA 2CNLB 1R6YA 1RAJA 4I0WA 3CC2S 3BQ2A 4NYOA 3MMBB 2XMMA 3PXGa 2DXFA 3MI7X 4MK9A 4C7QA 2FLNA 4G3IA 2EC0A 1JKHA 3GYGA 1LOUA 5FDLA 1ZOTA 2YH1A 2ZH4A 1HL6A 5G0RB 3MM6B 2IVMA 4G1IA 2XY5A 2U2FA 2ZBIA 4H4KC 3G96A 1FJGF 4OV6A 1VRQC 5CD4H 1SKRA 2V67A 3CCWA 5KFQA 2I2YA 2N3OA 2E1AA 2KL8A 1PC5A 2RKIA 5ETSA 4DL5A 3FBEA 2EXUA 4NL5A 3T9NA 1RCOB 2HQFA 4A4JA 1ZM3A 2KO1A 1ZA2B 2R2RA 3D6FB 4A46A 3HD1A 3TX8A 3CT9A 1HA1A 3F56A 4DMZA 2E7VA 4KKOB 2FDNA 2V69A 5THWA 4RUCA 1S72S 2C3OA 3HHKA 3I9ZA 4MYUA 2COLA 3SQGA 3JS9A 3CE8A 2AQ4A 3WC2A 4DV4J 5HP1B 4YR0A 2AX0A 4NMXA 3J80Y 2FC8A 1JLQB 5HK4A 3SSQA 3T5LA 2YWKA 2B51A 4PG4A 1I94F 1FRJA 2RS8A 2X1BA 3HHEA 2QLBB 4HDHA 2NZ4A 2D41A 1C0TB 3LPEA 3MEDA 4Z37A 2QL5B 5H9FK 3ENVA 4EO8A 1LK5A 4PQUA 3MD3A 1FA0A 5LMNF 1RDRA 2YKMA 4ELUA 1WTFA 2N4CA 4HEA9 4PXEA 1YI2S 2G9OA 1S10A 1UKUA 1WI6A 1MN9A 1QE1A 3I5AA 1QDUB 2XZTB 3ENWA 2M52A 5HQ8A 1W25A 3KFWX 3W5YA 4HKQA 3PYFA 1S6PA 4OX9J 4K8RA 3VCDA 4DV7J 2OEKA 4Y2IA 2ZDOA 2GIFA 1JLCB 2FZCB 4PEOA 1QAYA 1IBLJ 3HVTA 3EWGA 3KXDA 2B9EA 2BQ3A 5E3QA 2V9KA 2DKOB 4R8UA 4F0MA 4QJVA 5L46A 1C2PA 3J81j 1XMQJ 2E9ZA 4PRFA 1VQ7S 3F0NA 2CQDA 4RW8B 3B6BA 1WOOA 5BXIA 2K7JA 4NXMF 2ASJA 3PKYA 2EFNA 1HNVA 2OMOA 2PDAA 3QT5A 3HULA 1JWWA 1KN6A 4YEAA 4XPEA 3MPVA 1UFKA 1LK7A 4LF8J 1NPRA 1EHWA 1S6PB 3FSXA 3MXHP 4WK1A 4NLTA 1XN9A 3VZHA 4GC6A 2R8HA 3D66A 2XSJA 3ETMA 3HFZB 4L76A 4XAKA 3VGSA 3KJVB 5C24B 2FVPA 4U7CA 2Q6BA 3A4TA 1HBOA 4WF9Q 2Y8YA 1KLNA 2HHVA 2E66A 4S0MA 1EQ0A 1JLEA 2LFVA 4AE5A 3VAHA 3ADAC 3LP0A 1T03B 2IA6A 4GKKJ 4PR6A 3IGVA 4A8MP 1PIEA 4DQSA 3MR5A 2IJRA 1X4GA 2W01A 5KG5A 2IBOA 2J7UA 3KUGA 4CM0A 1OY8A 2LLZA 4DFJA 5F0UA 4F4KA 1R8PA 2QJ3A 4DSIA 2FIUA 1NH8A 2YY3A 5CQGA 1SJFA 1PCAA 3DRXA 4CT8A 5LJ3Y 2HQGA 4ECSA 1Q95G 4WBFA 2QT7A 5DM6Q 4IO9Q 4PUOB 4P2SA 2VG6B 1F9FA 5A2QU 4GVBA 4QWCA 3TAQA 1CULB 1HWIA 4M5MA 4YR3A 1HNZJ 1RI7A 4NI2A 3SSRA 4IYQA 4UOCA 1F1BB 2NR0A 1JLCA 2Z2ZA 1S6QB 1V9OA 3PJ9A 5F8MA 1URNA 2HZAA 3OT9A 2P9EA 5KAKA 5I3UB 1Y4ZB 2B7CB 1YSJA 4GC7A 2CJAA 4JP8A 4ECUA 1H98A 2FHOB 3AXKA 3IMQJ 2YKQA 4C2MA 1S1UB 5HMXA 2KG0A 1VDHA 4ZP7A 1IKXB 1JLFB 3MGJA 2ZZMA 4M94A 4KYZA 3NGTA 1BHNA 3CJ2A 1NPPA 2ADBA 1KRPA 5JVGQ 2J9CA 4YMEA 2DK2A 4C3KA 2MY8A 3MPDA 1B0PA 1KS2A 3PW2A 2X1FA 1RSCA 2IMWP 2GC8A 2K1RA 2L9NA 1A6LA 4IH6A 4KGVB 3KOAA 2B6AB 4CTAB 1PGZA 5DGAA 5GADI 4ZJLA 1WEYA 1N5SA 3UR0A 2GO8A 1ZPVA 1RK8A 5I42A 1B4SA 1SQEA 1LXJA 4AD6A 1RAIB 4YB1P 2PD1A 1TMMA 3IAS9 3TZYA 2E1MC 1YBUA 3LP1B 5FLXU 3HP6A 3GP9A 4MAKA 2CIMA 3PACA 2VOOA 4UOFA 4USMA 3G6VA 5M2UA 3VGUA 1L3VA 3JAMU 3T19A 3KMQA 3MEGA 4ICLB 5KG7A 4F2RA 1TL7B 2C2EA 1H3DA 4OI1A 4JI2F 1FJ7A 2ZH7A 3SMZA 3KLHB 4FVMA 1XBWA 2F5GA 1RCXB 1QLNA 1AFJA 2RRAA 4NI2B 3R7NB 3NL0A 1F3FA 3BR8A 2CWKA 3CDBA 2H4YB 2VFVA 3QAUA 4N8OA 1T95A 1UVKA 1GXLA 3LUYA 4JUZA 5L8RC 1Y0HA 2MZRA 4NEYA 3OVBA 1UVMA 4F4AA 2CDRB 1H2VZ 4ZVQB 3OD2A 1N0VC 2MZQA 4QZVB 5D78A 2IPOB 4UW2A 2QLXA 4NXNJ 3JSRA 3PYGA 4ZJQA 3G8TA 5KFFA 2FY8A 1TUVA 5M2RA 3MPWA 2O67A 2VPWB 4L74A 1GAOA 4A47A 1YTYA 3W9JA 3CMES 3IBWA 1N8RT 3MM9B 3T9ZA 3KKFA 3DM2B 2F4FA 1NB7A 3E8OA 4AL5A 2DNLA 2F40A 3MOJB 1UTAA 3KJNB 5IT0A 1ZAVA 3IR5B 3A3NB 1JJ4A 4ELTA 3PCOB 4J9LA 3W2VA 4Y2MA 1BMQB 2DD8S 2YWHA 2X1GA 2OPRB 1NRKA 2RQ4A 4ZVGA 5HN0A 3PYEA 3GSDA 4CLTA 3K17A 3D4JA 1K0TA 2APOA 2VDIA 3M6WA 4K2XA 4ZHRA 2ZBCA 4RBUA 1HQUA 2LKZA 3NY0A 4ZMMA 1XQIA 1B0VA 2PMZD 1YRXA 1HLWA 3G86A 2VZ9A 4FPIA 2R8KA 3QRRA 2BJ7A 4YN3B 4WFYA 1UAWA 1X4EA 3ISND 1WKJA 4DF8A 3OJUA 3CCRS 2IAJB 2JNJA 2B4VA 3GONA 2UXDF 3OJSA 1KOHA 2ABYA 1GX6A 1O8BA 2CQPA 2NZCA 3PV8A 3R2DJ 1K73T 3UDEA 1KSPA 2HHWA 4IOAQ 2RRBA 1N5TA 2Y0BB 4QIGA 5LXYA 4WFAQ 3A8JA 5F8NA 3M2UA 2BKPA 4RX6A 4ED5A 5LSRA 1FESA 3RAXA 5DLFA 1JB0C 1UZHA 2OFGX 2LXIA 2ASDA 3BQ0A 1S9EB 1LFWA 1G1XA 3NG8A 1WF0A 2AD9A 4DCOB 1OJ4A 1UETA 3BF4A 3CJQA 5LMUF 1R89A 1VK3A 1Y11A 3NAHA 1U1KA 2KJVA 2G13A 4ZKAA 3OVSA 2GMHA 4R0EA 3W5XA 3TANA 4X4PA 1T8EA 3Q8QB 1N4LA 1IKWB 1M5SA 5KFOA 3K59A 3T5JA 1RT3A 4NRUA 3RB6A 1F6TA 4QPTA 3J80U 3SFUA 3G4SS 5KFSA 1RWPB 2WSCC 3B8HA 3K8VA 4PYDA 4BBYA 5I3UA 4LQ3A 3QPIA 1GMWA 1L3SA 4KJIA 4LMZA 2HVIA 3KLEA 3HHLC 1YLXA 3EXCX 1SKUB 3U27A 4F3OA 1AFIA 3C15B 2AZ3A 2XMJA 2YWWA 1RT5A 3BKTA 2ZNZA 3BGOP 4HHJA 1RWXB 5K5MA 3W60A 3MDFA 3IR6B 1K44A 1H73A 4CO3A 2AV5A 2B0GA 2JSXA 3FSYA 5MLCV 3AA9A 2AEMA 2GX8A 4C48A 5DETA 1QM9A 2HLUA 1S0NA 2H48B 3BKFA 3DMJA 3W64A 3H59A 2JFDA 5GAHU 3PIPQ 2G2OA 3KHLA 2OPPB 2XBPA 3I6PA 4Q0BA 4EMDA 1RT6B 2ZE2A 2RNEA 3ZZZA 3UDLA 4B3RJ 1CJVA 1FDBA 2CJ9A 4DI6A 4DSEA 1Z1ZA 4LVOP 4YR2A 1NK8A 1R7IA 3MUMP 2FLOA 3DDKA 4PPDA 1SJQA 4DPOA 2QTWA 2PO4A 4Y34A 1WG1A 5K14A 3EVMA 4J9SA 3MM8B 2ZBPA 1D3WA 2DGUA 2I38A 2PT0A 4Q2MA 3H5SA 3K89A 2HBZB 3BGFA 4LUBA 1CC8A 2DH9A 4ZPCA 2G0JA 2CQ3A 2O01C 4NLVA 4P74A 1HPZB 3R7BB 4E8UA 2L3MA 2QLFB 3OTOF 4I2QB 2O5DA 1RHKB 2HVHA 1HWKA 2NS1B 4J9NA 1WELA 1IKXA 1JLFA 4DFKA 4FF4A 3GCWP 4OI2A 3R7SB 3CD0A 3SCJE 5DZ6A 1HNVB 1RT7B 3M30A 4MMOA 4JI5J 2DGSA 2VC1A 2ZITA 3FFIB 4ZVFA 5EWGA 2QA4S 3KLFB 1TKTB 3KLVA 4RW8A 3F73A 4ED2A 1HI8A 3EYZA 5LT5A 4CLWA 4LSLA 2RT3A 2HQDA 2K8GA 3M2RA 2MB0B 3CCTA 3WC0A 4DU7A 4JV5J 1HBMA 3EMTA 2FD2A 4B3MJ 1PC4A 5HJXA 4F02A 4LBHA 2HHXA 1BWVA 2MLZA 1V6HA 1N88A 3AD9C 2HFUA 5A0YA 1KTVA 4QIWD 1BLUA 4WXOA 4E0DA 4X4NA 1QUVA 5KFJA 4YUDA 2IC3A 2LCWA 3SCLE 1NJXA 1IBMF 4ZHRB 2DR7A 3BEGB 4HHHA 1P27B 4C8NA 4NLOA 5A6WA 3RU0A 4HDGA 2ZDPA 2IVFB 2O66A 1FD2A 2WW8A 1AXQA 2Z0GA 4MH8A 3GYNA 3O8WA 4P6QA 5KFKA 2RDDA 2YWFA 4RO0A 2ZM6J 2F8HA 4F4ZA 2AYBA 2DGWA 4B3TF 1FWKA 4ECQA 1RTIA 1Q7YT 2WSFC 4F4XA 4HHUA 1KONA 3POTA 4MFBB 1IR1A 5J2PB 2ACYA 2ZVIA 1HQ2A 4HYKA 2NQPA 1APSA 2OPPA 4MKYA 5KOWA 2H54B 3V6DA 3BSNA 3BDEA 3OQ2A 4I1TA 5T14A 1IBCB 3UN2A 5KG1A 3G2XA 3UD5A 1F0XA 3DHWC 4LF2A 5HP1A 3AD7C 3BGRA 3FMBA 2I6WA 5KFVA 1T02A 2HURA 3HZGA 3KUHA 1BQMA 3D54A 2MJUA 2JEJA 4O3OA 1SKWA 5IT9U 1X9SA 3GPAA 2CQGA 3N4WA 5KG3A 1RWVB 3MMCA 1MU2B 1U1OA 2C3UA 1WDDA 3TX0A 1EP4A 5IC4B 2Q66A 2CRLA 3MAAA 3O44A 2W24A 3H20A 1UVNA 2UXCF 3M2RB 2UV8G 1RXOB 5CYJA 2AYEA 1IR2A 1HBUB 5FDLB 3SSSA 3SEOA 1H38A 4RW9B 4O3SA 2W9CA 1DZ5A 1WG5A 2FB0A 4F2SA 3W2WB 4PWUA 2HLTA 4NLYA 4TU9A 1H72C 1FX2A 2MQLA 1VOMA 2XMKA 2JL9A 1M1HA 1AB8A 1CJUA 2XNQA 1W26A 3EE3A 2EFQA 4GO5X 4LRFA 2VKRA 2YTCA 2V0NA 4NCGB 3RZAA 4FP9A 5HI7A 2JX2A 1TKZA 4WE1B 4DX8H 4Q43A 2F7VA 3GQCA 1SC3B 1NKCA 4KV8B 5I4MA 2HEKA 2R8JA 5JUMA 4WYWA 3D68A 1U1MA 4KAIA 3D0GE 4MIWA 1VI7A 1CJTA 3CEDA 3IM9A 4CLZA 1FVQA 1U0HB 4RNFA 2WSEC 4X64F 4DR6J 1S59A 3D3CJ 2HNDB 4KFBB 4PXBA 4XTTA 2RQCA 1FVSA 4E2FB 3OUYB 1M0SA 2XO7A 4A8OA 4PKDB 1QY7A 1RTZA 4Y3CA 1NDKA 3HSGA 1RISA 1ULRA 2UP1A 1GX5A 1JLQA 5E3RA 4H4OA 5DDQC 1QVFR 2HGMA 1KQFB 4ZLJA 3PJXA 2B56A 2BE7D 1K8AT 4O0IA 4OYBA 1REGX 3L7OA 4OZLA 5HROA 3ZFVA 5J2QA 1NBEB 2PMWA 1M1KT 2M70A 2E5HA 4K4SA 1H7XA 1VFJA 2Z4PA 2Z2YB 3TZWA 2JWNA 1FTRA 1IBKJ 5U47A 1VQKS 2PI5A 2CA9A 3HVTB 4BLGA 3GR0A 4PG7A 3MOZA 1FEHA 3BREA 4ECRA 1RA6A 4RBTA 4CLPA 2O3DA 1IKWA 2CPHA 3TQ1A 1DTTA 1LW0A 2KM8B 1B0TA 2DVIA 2P9GA 2ERRA 2W4PA 3HHLD 5EX0A 4NA1A 2ZH9A 4B3RF 1AUSL 1R8BA 1AROP 4N77A 2WRMA 1S48A 4OHWA 2GCFA 4RWWA 5DS7A 2XMAA 4DZDA 4IUFA 1C0TA 4R5PB 3DM2A 3LP2B 2IYIA 4C4WA 3VAIA 2IHR1 3PIOQ 4CLFA 2FVRA 3RRGA 4WFXA 4FS2A 1JQGA 3KG0A 5KFGA 4F3QA 2KRRA 3IG1A 3RB0A 3DOKB 3SIPB 1N33J 4I7FA 2LQBA 3A8IA 5KFPA 4IFVA 4M1KA 1VQPS 1SH0A 4DCPB 3G6YA 2GQQA 7FD1A 5C24A 2BJDA 5D0EA 1R8CA 4CCHA 2RH3A 2DY9A 4PCQA 2IC3B 2L08A 4O0NA 2V4JB 1CC7A 1D8ZA 3NKYA 1MWQA 4PABA 5GMEA 4DUYF 1YHQS 4ANDA 3DU6A 5ETKA 2UVUA 1ZH5A 4B3OA 1T11A 3T1HJ 2CPZA 4XDCA 4BS2A 4X4UA 4CM2A 1WC4A 4RZRA 3KK1B 2GW8A 1WJ9A 6FDRA 1RGVA 5AXLA 3D1OA 2HFZA 4JI4J 2J0WA 2A1BA 2YKPA 3V2UC 2VOPA 3WHIA 1IBMJ 1VQ8S 1NEEA 4K59A 4WIIA 3R1HA 5KT3A 4KBIA 4JI6J 3MM8A 1RWMB 2PE8A 4QQBA 4J91A 4NE9C 1HFEL 4NA3A 1OY6A 5BYQA 1B7YB 1CULA 1RACB 2WBRA 3FDSA 1UEUA 1HPZA 3PRVA 1TKXA 2I5JB 1FRKA 4YY3J 1DJ0A 4DFPA 4ELVA 3HHDA 2YNIB 5KFMA 4X2BA 3PHTA 4FF2A 1KLMB 2W1BA 5L38A 5KT6A 1N5YA 1SCJB 2DGVA 5LOQA 4JI5F 1O6XA 4R5PA 2RF2B 3CWJA 4F25A 3C2PA 3C14B 1C0UA 2E5IA 2IRUA 2V8DA 2ATCB 3UQSA 4RU9A 4CO4A 4DV0F 3DDIA 2EKNA 3W3SA 2YPYA 1IQZA 2ZHAA 2MQNA 2KXFA 2VC0A 1FERA 1FK9B 2JVOA 1TQLA 3DGPA 4NMLA 2QL9B 5GAGI 2RU3A 4OJ1A 3D2WA 4B3TJ 4M8LA 3CCLS 2HGNA 1TKXB 3MUTP 2FLPA 3NOGA 3H4BA 3NLCA 3V4IB 4K5SA 2QYGA 3NCPA 2GIQA 2FYXA 2H9ZA 4HVZA 4CI0B 3UNYA 2BMBA 4TYAA 3GR1A 3MUVP 1OQ3A 1H2UX 3QGIA 4KKOA 4ER8A 1UVLA 4K50A 2CNNB 1FRXA 2EFOA 3GSIA 4DR3J 5KOXA 1YIJS 2OGUA 1IM4A 1U8WA 3HSJA 3MECA 2JOQA 4QR0A 3WX8A 4DPYA 3BSAA 2JVRA 3B82A 1FX4A 3DXBA 4QR2A 4WTOB 3K57A 1RTDB 2K3IA 1VQNS 3QFWA 1VRTB 4MTPA 1W2IA 2CJQA 4QYZK 4ZP9A 4X66F 1T7PA 1F2GA 4F36A 3EJMA 1TL7A 5GMDA 1TKTA 1X7VA 3OUYA 3C3LA 3TZXA 5T41A 3JSYA 4ZOSA 2XLJA 1UA0A 1GEHA 2HNDA 3UW1A 4H4KA 2YNHA 4QYRA 3THTA 1R27B 3W66A 5I3PA 4FXDA 5AXNA 4OYZA 3VAFA 4LFCJ 2GAHC 3NMRA 1M5HA 2NXJA 2V8GA 2WK4A 3MFHA 4NXNF 3IAM9 1BD6A 1AZSB 4DL0C 5JVHQ 4JI8J 2B6AA 3KK3A 4K0KF 2LMIA 5IS2A 1T9WA 2GJFA 1CJUB 2RILA 5K14B 1NK7A 2W8LA 4C8OA 1RTJA 5FIIA 5KFIA 3UO0A 1YJTA 4TLRA 2M8DB 5F8JA 2FVSA 5K8PA 1PILA 2AT1B 4OJHA 1N48A 2VPYB 4HLBA 1RYRA 4JI1J 2QZ8A 4OZ0A 4J9UE 2I8EA 3FK4A 2AJ4A 2OLWA 4JI2J 3AQPA 1V5VA 2FGOA 1YQHA 3K5NA 4Y6IA 3RR7A 1RT4A 3QATA 2M4MA 2N4DA 1HWJA 2YVSA 1XWLA 5ETQA 1UFLA 5HMWA 1U0SA 1BQMB 1ELOA 2F63A 3M9OB 4Y28C 4OV1A 1R43A 3I0SA 1FWLA 4KHRA 1O5JA 3I96A 4DBQA 3RG6A 1ZS6A 4ALZA 4CLSA 4ECWA 4HTIA 2R2UA 1U25A 1VRUA 1MW7A 2VG5B 2HVZA 4M5DA 2GFFA 4TXSA 1R0BG 1S9GA 3I87A 4C8ZA 2XC9A 2EG2A 2B9YA 3OW2R 4YP3A 1U1RA 3IP0A 4ED1A 4NOHA 2BOAA 1JNRB 2B3TB 2QYCA 4IOCQ 3UNGC 1HHTP 1NJZA 2BXJA 2UUCF 4EGLA 1PYSB 3GYXB 2J9DE 4YB6A 3HM9A 3A8KA 1FNXH 3HO1A 2XCPA 2OH2A 2UUCJ 3GJRB 3TVKA 3ZTSA 4XIUA 3EZ5A 1XMOJ 3FGVA 1IWAA 3L09A 3BBBA 1FHTA 2KXHA 1Q5VA 3QT8A 4YDDB 3N6MA 4C3LA 3MM7A 1XIQA 1KR4A 8AT1B 4DUTA 1GH8A 1EAYC 1RBLA 3M2VB 3ZZYA 1WOSA 1MNEA 1OS5A 3QWUA 2FHJD 1TKZB 5CZVA 5C7PA 2ILZA 1VRUB 4M5DB 2MQOA 4JB8B 3DLEA 4USVA 3VHQA 3K5LA 1U2FA 2FZGB 1TMJA 4LRAA 3VAMA 2QRRA 3N6NA 2WBMA 3RAMA 1FDNA 1TL1A 3ZNJ1 2CYYA 1NAQA 2FJEB 2QMUB 2YPZA 3AOBA 1SUQA 2KT5A 3MEGB 4ICLA 2QLWA 4LBPA 5BYSA 2JEGA 1L3UA 1GMUA 5I3QA 3ENAA 1Y7PA 1ZM2A 1WACA 1F2HA 3CVKA 2CPXA 2V8HA 2VG7B 4F8RA 2DO0A 2LXFA 3DLBA 1YVFA 4FYXB 4RW7B 4DV6F 1VLYA 2OEMA 2LA4A 3HSZA 1VQLS 2G2YA 4LQ9A 3KTQA 2J0QD 2NREA 3CDAA 4X62F 2N7YA 2OPQA 4IOBA 1GTEA 1QD1A 2K1RB 4MT1A 3B4DA 1WEXA 2QG9B 2LP4A 5CZXA 3I82A 1X4HA 2K06A 5E33A 3SBMA 5K20B 4WE1A 3Q23A 4MIAA 2XLKA 2AJQA 1RHJB 1UWBA 4EO6A 2RRNA 3OBIA 1PBAA 4RL1A 4LIRA 1KQGB 2DCLA 5DG7A 3N6LA 1I6JA 2CJXB 5L39A 2P8IA 2W4CA 4B9SA 3PM9A 3K5PA 2CNOB 2EK1A 3BGUA 1QJHA 2IJFA 2OSRA 3VVTA 1X4CA 1EIYB 3BH7B 3IA0A 1WD6A 2CVIA 4X4SA 4F4WA 4C6AA 4Z7CA 1TFYA 3A8EA 1CJKB 1XEZA 2HSEB 1SH3A 2Y1LB 3UDCA 1VK8A 3DHXA 2Y1JA 4DFMA 2B4OA 2I0XA 5KT4A 1X0FA 3GV8B 3ISNC 2D3OR 2FJWA 3KG1A 1U4BA 4PZVA 2Q3PA 5ETLA 3BQ1A 3BN7A 1WKLA 1EX8A 2WVDA 2KJWA 2OKQA 4DV7F 2W9BA 2KYZA 1YRTA 4DV2F 5CYMB 2HZVA 4A8FA 3PFOA 4W92B 2GJ2A 3DU5A 4O4GA 5HVFA 4OYOA 1E6YA 3P96A 5D6GA 3U7JA 2XLIA 5KFWA 3JXOA 4C0BA 4XPCA 3KHRA 2IMOA 3KYLA 3CPWR 2ZUGA 1HR0J 2D3O1 2IBKA 4DQIA 3LH2S 5J2PA 2Y1RI 2EKYA 2MKIA 3BV8A 3B4MA 3TEGA 1QVGR 1UVIA 1TL3A 2ZEJA 4ZPBA 2J7KA 1SC4B 2PN6A 2VBZA 4HH1A 3OXFA 4UQTA 3G71S 1HNIA 2CQIA 1S7HA 1D9AA 2HHQA 1HARA 1BQXA 1WHWA 5GAGU 5D3GA 1G3OA 1NH7A 3LPYA 3DOKA 1S7IA 1CQMA 2WVBA 4OYWA 1YKWA 4NEZA 4CH0S 5LJ5Y 3NGDA 3MR6A 3N5BA 4OIXA 3HI9A 1JLGB 3A12A 3DLJA 3MR7A 4RBVA 4TKTA 4CTAA 4DPXA 1VQ4S 3GMGA 1U1NA 1UWAA 3Q0AA 1LFPA 4WP9A 2CQ4A 5K8NA 4RNMA 3PW5A 4ZCKA 5IOLA 1X9MA 2VODA 3HJFA 1RAFB 2KTQA 3GJSB 4L72B 3PKMA 3K8WA 1VIOA 2ROPA 2J6SA 4JI4F 2EG1A 2KKHA 4OQJA 2M2BA 1YZ6A 1YX2A 1D8YA 3KK1A 4LF5J 4M5GA 5B0GA 2A6MA 1UJ6A 2F8EX 3G87A 4OZ5A 5AT1B 3WBZA 5B08A 4DV1F 2MZSA 3T1HF 1SKSA 3R97A 5DRKA 2N7CA 4DUYJ 1S1XA 3GB0A 5F8IA 1QE1B 1NB2A 1K1QA 2VFUA 2QMWA 4O3PA 4WCEQ 8RUCA 5L9XA 3SFGA 3L3CA 3BGRB 2YNFB 5HVHA 5KG4A 5DG9A 3EPIA 5E41A 4TQSA 4NXMJ 4Y00A 4ZIVA 3IM8A 3CDEA 1S4FA 1P6TA 4KFBA 1Z4UA 4NLRA 1D0EA 4A8QA 4Q0BB 4QW9A 3EGNA 3QJJA 3ZNUA 4J5OA 3C14A 2HFOA 2IM1A 1IBLF 4GO7X 4PWDA 1K1SA 1MMDA 3D67A 5IZHA 1B7FA 1RTHB 5FLXY 2VFSA 1S5ZA 1JLBB 1X60A 4KC5A 1P9QC 3OL8A 3LWMA 3H2LA 2N82B 2BW2A 1U45A 1YRUA 4F0HA 4DR2F 3OSPA 4IH5A 5HANA 4ED8A 1IBKF 4JV1A 2CWXA 3EDRB 2XSJB 4M5NA 2CQCA 3KG4A 1X0PA 2CPYA 4OX8A 4FNIA 4ZVUB 3TAMB 3W7BA 5B0DA 1DTQB 2CJKA 1VRTA 1PG5B 4ZPAA 3THPA 2V4QA 4DV3F 4OYMA 1HR0F 4FYDA 2DGXA 3W62A 1FXDA 2DB1A 1T9XA 2VD3A 3FRYA 4Q7AA 2G4BA 5F3TA 4CO1A 2DRDA 1CEZA 3T1YF 4C8YA 3CIZA 3M6VA 2DPJA 4DV4F 5KFBA 1WC5A 1YGYA 3FCVA 3MCNA 3EM1A 4F3MA 2VDHA 5A6PA 2ASLA 1GXTA 1GQEA 3T6BA 1D1UA 1HMVA 4IDKA 4NZ7A 1ACMB 3JQKA 4LSNB 3IG1B 4CDIA 2AEJA 4O23A 3HHLA 4F50A 4DSKA 4KH0B 2MYFA 1XMBA 2YX7A 3CC4S 4UY8T 2B9WA 4ECYA 3P3DA 3ZTRA 1NDCA 1ZZFA 2DTJA 1D09B 3D1QA 4I2PB 4RJVA 5A2QY 4YHHJ 2GVZB 3DRSA 5IWAF 2UUAJ 2CVEA 5E5NA 5SUHA 4F0KA 4C0HA 1U24A 3IS9B 4DX5A 1VQOS 5K8OA 4DR7J 3D7SB 3JB9k 2RQMA 4DV5J 3CCMS 1U48A 3DYAB 5J2NA 5HMZA 3QZ7A 1M5PC 2EPIA 2E29A 1SI9A 3QT7A 2GGPA 3DLKB 4C98A 4CLKA 3CCSS 2HGLA 3OL9A 3HHLB 4NASA 2X3GA 3I0SB 2IVYA 3Q8YA 2C2DA 4ILMA 4X62J 3OFEA 5LL6d 2ACMA 2GIRA 5KFHA 1OYDA 4KR0B 2L41A 4DR1F 4DSJA 4JYAJ 4B08A 2XS5A 4JI0J 4CIOA 4ZK7M 1TV6B 3V6HA 3N28A 5CH7B 1CBKA 4C8MA 3GIIA 4ZPWR 1F5BA 2WONB 4DCJB 4QU6A 5D4LA 4ZITA 2E5LF 3UFCX 5D0GA 1JJHA 4OZ2A 2WZ1A 5ETRA 2ZD1B 4P2XA 3US5A 6AT1B 4J9PA 3PY8A 4FF3A 3PW0A 2V4JA 4X4RA 4DR4J 4RNHA 2Q1LA 2VJVA 3C8YA 3LP0B 4QPXA 4EBCA 1GMVA 3NNAA 1KWMA 4NZ0A 2DNYA 5DJBA 1X9WA 4I6WA 1J2VA 1U6FA 2Q6CA 2GMJA 3H90A 2BZ2A 1NJWA 2UVRA 4B02A 5DQIA 4ATNA 2RJZA 3D6HB 5CA5A 4HI2A 2XY6A 1UW4A 2LEAA 1SXLA 4UTGA 1JJ2R 2UZAA 3LWLA 1T3OA 4ZVEA 3M8QA 1QAXA 1XMOF 2DT9A 1Q8IA 4KIAA 3J7A1 5AE3A 2ZD1A 3GV5B 2P6TA 4Y2KA 3RGIA 1S1WB 4LF4J 4DR6F 2RDIA 1VBZA 2DRBA 1RWNB 3EICA 3VALA 3ISZA 4WU3A 2HIYA 3CJTA 4RW7A 4ZPTR 4KGMA 2XGPA 2A6OA 2YNFA 3CJKA 1NUEA 1UCNA 4PXCA 1GFWB 4B3SJ 4RUAA 3SI8A 1LW2A 1U1LA 1UZDA 2QL7B 2XMWA 3GTYX 3ZZTA 2B7BB 2M3DA 3BKUA 1P9YA 3TP2A 3DC2A 4WIQA 3MTJA 3TVYA 3OTOJ 2DHHA 4DR5F 3M1VB 2DIVA 4RW6A 2DNQA 1UW9A 2B4UA 3CD5A 1YG0A 3QIDA 4UT4A 5HSPA 2EWHA 3AH6A 4OJGA 4CNYA 3J7YU 2VPXB 2YQ0A 3MM5B 2PEHA 5E7OB 1XK8A 4FYWB 3TAPA 2ZOFA 3RB3A 2H5JB 4A8YA 4HT7A 5C2CA 4DQRA 3ZZRA 3QLHB 5L1IA 1J5OB 1S99A 1OPZA 3Q8VA 4ETXA 1FE0A 1RTIB 4LFBJ 3V5RA 5FJ4A 2HVDA 2YKNB 1U8SA 3W9HA 1IVZA 3G6ES 2OTJS 1R3NA 3HVAA 3CGIA 3M1VA 5IQ6A 3TWZA 5ETMA 3MCOA 2AJFE 1ROFA 5CYQB 5F9NA 3CJ5A 2Y8WA 1RU1A 2EFPA 1RHQB 3RBZA 1FEEA 3TRGA 4YS2A 2DXDA 4LSNA 2FGCA 5AE2A 2HWIA 2OFHX 1HWLA 1DRZA 5ETTA 3QRPA 2V63A 3ZO7A 3RAQA 4USHA 1HNXF 3TQEA 4AT1B 4ZCLA 4BDPA 4Y2CA 2BRLA 1RTDA 2ZH1A 1M1GA 2UU9J 3EX7B 3B78A 1TFWA 1WF1A 2RVJA 1SPBP 3H2UB 5EX3A 4R8UB 1HQEB 2Z30B 1BUXA 2R7RA 1ZTWA 4QWEA 1VC6A 2FHMA 3NGKA 3FEZA 4CH7A 1J5EJ 1TK8A 3NMAA 3GE9A 2P9CA 3OXGA 4LBIA 2CZ9A 1U02A 3C66A 1QSSA 3G9CA 1O0PA 5KTQA 1MSWD 3NCRA 3PR5B 2AJ1A 1C1CB 1HBNA 2WOMA 3BR9A 3DDNA 1G7CB 1UEKA 1Y5NB 3RJMB 4OZNA 2RS2A 1FI4A 3CD7A 3CJ4A 3P5BP 4I6AA 5KFRA 1WI8A 3U1NA 3H25A 2KDOA 1VR6A 4FKYA 4FS1A 3RTVA 3VGTA 2A10A 3LAKA 2AW0A 3HK2A 4EUVA 4EBDA 4WP8A 3P49B 2F9DA 2WONA 2BE2A 3H2VE 2W7OA 2MLYA 5L1JA 1VJQA 4HR2A 2JRSA 2MY7A 4WPAA 3TUIC 2UXBF 1RT1A 4AXIA 1DTTB 1YK9A 3MR3A 2H5IB 2W7AA 1MMNA 4RW4B 2VIHA 1YBAA 4E98A 1FRMA 1UJ5A 1FFSB 2XZWA 1HNWF 5BR8J 4MK7A 5LSOA 3MMAA 1FE4A 2FQQB 2POKA 3J7AN 2H4WB 2YXLA 2J5AA 3CJ3A 2ZBRA 3FJ2A 3QO9A 4W4MA 3MEKA 1S1XB 3EZOA 4DV1J 4U67Q 4FYVB 4WKRA 2V8PA 1IKVA 4OI6A 3AJ2A 2JEFA 4JI7F 2X51A 3GFHA 3CO9A 4C11A 3KLEB 5EN1A 4BC7A 3BPDA 4KPYA 3LA0A 4NYZA 1CJKA 4P2FA 1FKOB 2SXLA 1CS4A 3A13A 4F7VA 2Y0SD 2ZH2A 2VBWA 4L73A 2BJ9A 1RUSA 3RBXA 1DFDA 4FBUA 2Z2MA 3CD6S 2D9OA 2CKWA 5DM7Q 3NCQA 1RKJA 4ZVHA 2IYGA 3CCJS 3CMAS 3DLLQ 5D77A 2HYIB 3SV4A 4GMKA 2DNHA 2E1RA 2RHSB 1NK6A 1NK4A 2OUGA 2AX1A 2PFDA 4WJBA 3IRWP 2DPIA 4OHVA 2XB2D 1RA7A 3R1LA 3SCKE 2D74B 3N9UC 5DQHA 1AZSA 3DCAA 2FJAB 4QIFA 3DGVA 1Q8BA 2DR8A 3PVXA 1SL0A 4V19X 2GQ2A 3ZTOA 1ZA1B 1H0HB 1X4BA 2XULA 3V4MA 3RBEA 2AZ1A 2LQ8A 3HCXA 2GHPA 4DDFA 4P73A 1DAXA 4YB7A 2KI2A 3M7VA 4IG3B 5KFCA 1DBDA 2CPFA 2YX1A 4MIBA 5AE1A 2XCAA 4O3QA 1HBUA 2IRYA 2AHOB 2B4PA 2BVZA 2AJ2A 3BO4A 2OAUA 3W8PA 4AUKA 4X4VA 3DOMA 4X4OA 3R6LB 1S9GB 4ZPDA 1XJWB 1RT5B 1WUUA 4M5HA 5F8LA 3QO9B 1S6QA 1VGYA 3UCGA 3QSIA 2KN4A 5LXRA 3NNHA 1Q78A 5KFTA 5HMYA 3EGWB 2DISA 2RB7A 4OYIA 2JLEA 4HH0A 2HRUA 3M6UA 3VR1A 2J8AA 2W2NP 1Q8LA 2ZBQA 2G2ZA 3M32A 5D4OA 4CNZA 2YKNA 3OFHA 4LR8A 3OR2A 3EDQB 3R5BA 1KNZA 3HPOA 3M2VA 2M8HA 3BYRA 2YKOA 5C5JA 2E9TA 4O3RA 4USUA 3VZIA 4K4XA 2J0SD 1F5AA 4KHMA 4NRTA 5CCMA 4LF4F 1Q86T 4ZA1A 2IM0A 2FLLA 2GVZA 3DRSB 3LF0A 1JLEB 3DN9A 1VBKA 5GVQA 5DG8A 2JJ4D 1OY9A 2VJUA 1VQSA 2RIJA 4OI0A 5B0CA 4WFBQ 4WYLA 3VWSA 1N0UA 4CH1A 1QAIA 2J76E 1KLMA 2E5JA 4ID5B 5E3PA 2ATLA 4GKJJ 2E7WA 3PHEA 5D0RA 5GMKa 1B64A 2NXNA 2WHOA 1Y3KA 3I9V9 3IXQA 3L7UA 4N56A 2GV1A 2ZFHA 4KT0C 1N6QB 2MHNA 2HMIB 1Q7LB 3QSYB 1R6VA 4K4ZA 3JQJA 2FY1A 1L5UA 1D9DA 1SL2A 1TP7A 1RE1B 2CQ2A 1KKHA 4J7CA 2C2OB 2UV8A 4I68A 4ZLNA 3CCES 1SIZA 4C0OC 2BKNA 2WVFA 3JQMA 2DR6A 2RKIB 3JYTA 2DEJA 1UJ4A 3NAIA 4IG0B 2F1FA 1Y10A 4AQYF 1T3NA 4G65A 4HI1A 2NPFA 2D3UA 4NCAA 5DZ7A 1S76D 2UXCJ 3QIPB 3ZZPA 2ZH3A 3M8PA 2C3PA 4Y0FA 3SV3A 3AY0A 1QSYA 2EFVA 4ETZA 1Q82T 2CFXA 3BGLA 4JI0F 3WIUA 1P1LA 3D28A 1N6QA 2HMIA 2HHUA 3AT1B 3ET6A 3RRHA 1ITPA 4KO0A 2XM3A 3Q8PB 4USJC 3X1LB 4GKKF 3KHHA 3GJTB 3C46A 4IFVB 1X4FA 1YDLA 3CJ8A 3K7RA 4I64A 4QCLA 3V81B 4W98A 4RNOA 2HHHF 3OR1A 2MSSA 5AXMA 3CCVS 3R5JB 4AFFA 4Q8FA 3D5MA 1JXLA 3R2CJ 2M88A 2YNHB 1X5PA 5C42A 3G8QA 4QW8A 4WU2A 1WSRA 1ZETA 3TJAA 3IBCB 3ILIA 3T5KA 1H7WA 3AAWB 1QUPA 3BBFA 3R3TA 5IV4A 3KMSA 5DDPC 1FKOA 4LF5F 4WZQA 1LW0B 1S57A 3L4BC 5CYMA 5J2MB 1BGXT 4A8KA 5A8KA 3H7HB 2U1AA 4J90A 5MAOA 2VQEF 2R7XA 1FJEB 1OSCA 3CSKA 2XWYA 4IH7A 3RW7A 2RQKA 4J9KA 3R5GA 5CHCB 2EBGA 2G1DA 4N47A 1VQ9S 1VLOA 2MQ8A 2RD5C 3QQCD 1P8GA 2W9BB 3VAJA 1CLFA 4B3SF 2E5GA 2MGZB 4UOHA 3X3UA 3Q86A 4OX9F 3E01A 3TO8A 3PO5A 4DSLA 3EVWA 3RRKA 2W8KA 3J81U 5IXUA 1A0OB 1WDTA 2DXEA 1LWXA 2RU9A 2Z57B 4X4QA 4DLEA 1HD0A 2IM2A 2XG8A 2XZDB 5E2QA 2OELA 5J1NA 2NCKL 3AHPA 5J2MA 4CO5A 2EVZA 3OXLA 3CJ0A 4P75A 4C97A 2CDQA 4KGKA 4UF4A 4RUHA 5A8KB 2AWZA 1RU2A 4IG3A 2G0IA 2DNMA 3ILJA 4U7UK 3W2VB 4J9QA 3AA8A 4B3OB 2CAJA 2GMLA 2Z2LA 5I42B 1DQ9A 2BA9A 2Y1IA 3GLJA 2KG1A 3AOAA 3FZ2A 2CQ1A 1U49A 3MM9A 4LF1A 1I94J 3HLUA 1WKKA 4PG8A 1CJTB 3OR1B 3N5FA 4M63A 4OZ1A 5GAHI 2XYHB 3CB4A 3G6XA 5KT7A 1WC0A 1EZZB 7AT1B 2VBXA 4IRDA 1L3KA 3KJVA 2F8MA 2ROEA 3CJRA 5BYRA 2VUGA 5HJYA 2H3EB 3UD3P 2R8IA 2BJ1A 1WEZA 2H65B 2O1PA 2OPQB 1KOOA 1CS4B 2AJ0A 3MEEA 3J7Z5 4A8SA 3TEHB 1VJWA 2V5HG 3DRPA 1XNRJ 3V6KA 2HPUA 1RAOA 1E6YB 4RUBA 3M6XA 3TUPA 1NK5A 3T41A 3A3OB 2QX0A 1E6VB 1WHVA 2EBEA 3ENQA 1N36F 1S0OA 1QAJA 1LEOA 2A0FB 2NLWA 2VB6A 3BSOA 2JC0A 5G4DA 1HI1A 5IFMA 4DS4A 1F3VA 1T0TV 3AQOA 3UWTA 4OYAA 2A2CA 4URGA 2K7KA 1FNMA 2GHVC 2VG6A 3U02A 3M9MB 3KUEA 2KFNA 3WZ0A 2KZZA 2JHEA 3CCUS 3G82B 4IRKA 3CDUA 4L3KA 1KVJA 2EFGA 4KQZA 4LSZB 1VISA 1U26A 3V4IA 1KC8T 4LRDA 1SQGA 3KK2A 4Z2XA 1DHMA 1NKBA 3WQPA 3NGUA 2VF3A 2ZE2B 3T1AA 1WWHA 3S8SA 4X65J 2BE2B 4RLEA 3PTWA 5T7LA 5CABA 5DLGA 2CXEA 4IR1A 4RNNA 4YOEA 3CULA 4DV6J 2IFXA 3OR2B 4PXDA 1EARA 2YNIA 4DPTA 4GVLA 4ZP6A 4DQQA 1XR5A 3A1YG 1Q81T 1V3SA 2DH7A 1JX4A 1FNOA 2CADA 3FCHA 3LANA 2IDLA 4WK3A 2ZH6A 3CF5Q 4IQXA 3M8SA 4O4RA 4TNOA 3ONQA 3IGNA 7FDRA 1R8HA 1SB6A 3MF5A 5EGYA 5IM0B 4U6PA 5HLFA 3M32B 3TYTA 2BOPA 4D3HA 3Q2TC 2C28A 2ZH8A 2HK2A 4EEYA 4JV2A 2HHTA 2XS7A 4G1QA 2RUSA 2BACA 2L48A 3CDWA 2XI2A 4MJKA 1I1GA 2BANA 1XERA 1Q79A 2XYPB 2BBEA 1LWEA 1TVRB 2KU7A 1GK8A 4FZVA 4LR7A 4XDDA 2MQQA 1HIYA 5AXKA 3IC1A 3K2YA 5B0EA 1SQFA 1MROB 3O3LA 1IJFB 1MU2A 3DLHA 1GTHA 2CPDA 4ZDNA 3S01A 3OLBA 1AT1B 3JSMA 5A8RA 2R7WA 1MWYA 2YKAA 3MZIA 3I31A 3PRDA 2HHPA 3HDSA 1W2BR 3Q2SC 3I32A 3TI0A 2A2DA 2OPSA 2IJNA 2DNZA 3CW2C 1YJNS 1TL3B 5HQLA 5D3GB 2VICA 2MLXA 3NWRA 1JMTA 2NYIA 4EBEA 2LXUA 2HG4A 1NSPA 1A9NB 3MM5A 1HNIB 4JI3F 4CYUB 4P7TA 1TU0B 2C2ZB 1UEVA 1RYSA 1X5OA 3D0HE 2HHHJ 3QNWB 3NXZA 2CQBA 1F5CA 2OIHA 2M7SA 3M8WA 4DL7A 3UCZP 1N56A 3KJQB 2IRXA 3M8ZA 1RAAB 2D69A 2LQ5A 1JXVA 5JJBA 1XC9A 3MMCB 3QMQA 4UZCA 2DGOA 4YB5A 1L3TA 1M90T 4HTJA 2GZOA 2MEWA 3FQLA 2PFFB 3G8SA 2CJYB 1HQUB 2HNZA 2IA0A 2WVCA 3UD4P 4K0KJ 2UXDJ 1PBUA 4EU0A 3H42A 1JLBA 4RPFA 3Q8SB 1EKSA 3D6TB 1OYEA 2YH0A 2HS0A 2KFYA 4LFCF 1Y00A 1NHKL 3NGSA 4FKXA 4J9VA 4V1Ak 5LM7E 1DURA 1OSDA 3SYZA 3ITHA 4ED6A 2Y3YA 3V6DB 4U9RA 4U96A 4ZCIA 2YNGB 2HBYB 4FNHA 2CUYA 2VBYA 2QA4G 2C2RA 2BQRA 2I9SA 2YQ1A 4ZVTB 3OVAA 4AL6A 2W2QP 3VQSA 3QLHA 3H0PA 5EWEA 4ED3A 1SJ3P 1KEKA 2DNNA 2UVWA 5KFNA 5F8GA 4BCAA 1U0HA 2AYMA 4NX9A 1HHQA 2GVDA 2K2PA 1YJUA 2XO6A 3I4HX 4OHXA 3MFIA 4A8WA 1PKUA 2LQJA 1WC6A 4PQAA 1N34F 1HMVB 3C16B 1CJVB 3R5DA 4CLLA 2XHCA 4OFZA 1OPIA 4OMFG 4O44B 4ZVOB 3W1YC 2YNGA 4OLOA 4LF7J 4RW9A 5KFEA 5HAOA 3BDPA 4DPWA 2K3KA 1S77D 5J1PA 3VGVA 4ED4A 3S1TA 2MJNA 2AGQA 2ZOMA 4K4VA 5ETPA 4N76A 3D6MB 2LQ9A 2AU0A 1Q53A 1U2RA 2HNZB 2RAQA 1F9HA 2BYCA 4K4UA 3C16A 3ILLA 2WVEA 3Q83A 4F26A 1Q8KA 2YWGA 4WKYA 2R7SA 3TUZC 4QOTA 5HLFB 1GMWD 5D0HA 1SV5A 1FKPA 4KPCA 4ZS6A 2MZ1A 2YKMB 4IKAA 2ZWPA 2CNKB 2C3YA 2PA3A 2PSZA 2V2VA 1P1TA 2AP6A 3GFZA 4P2MA 4LJMA 4QIVA 2GAGC 3ELHA 3IFEA 4JI1F 3I55S 1J5EF 4Q44A 5KFAA 3TVZA 3QGPA 5C42B 2UUBF 1X31C 5AJ3F 1BWEA 2W2PP 2BE9B 4ENOA 3OLAA 2VHGA 2PEBA 2R2SA 4ERDA 1WF2A 2N3LA 3PJWA 4OYXA 4N5SA 2XY7A 1R0CB 3VAGA 1HNXJ 3H40A 1CSJA 2CPEA 3K0JA 9ATCB 1TELA 2G0CA 3GIMA 3U1LA 3EVOA 3UE2A 3VQTA 4Q2LA 4X4TA 2MGZA 3BJYA 2QEXS 1YJ7A 1SBRA 2QO3A 3PFEA 1HQEA 1T9TA 4JBCA 3KDNA 5KFDA 2R2TA 2FUG9 3P8BB 4I69A 1NM2A 1NJIT 4GVBB 3KNAA 3KLFA 3MMAB 3CCZA 2C22A 2ZKUA 2VG7A 3AB4B 3FRZA 1NDLA 2L9DA 3OTBA 3MURP 5B09A 2NYHA 3QFHA 1IR0A 1NPKA 1TR0A 5IV3A 3OTEA 1BC6A 1RAGB 1WTBA 3LQVA 1RT7A 3M30B 4U8YA 4A48A 1GNKA 5KG2A 2XEXA 3MPUB 3BBCA 4ID8A 1XMQF 5HBMB 1JLAA 2ZUAA 4H4MB 2F9JA 5A8RB 2C42A 4TY8A 5BR8F 1SC6A 1RTHA 2DJWA 2HNYB 3M4XA 3FEYB 5ETVA 4UZBA 1LNQA 4OX7A 3UN5A 4B9UA 3MPYA 1UP1A 3PEJA 2D7SA 1NK9A 4NA2A 4R0JA 1MWZA 3BM7A 3DKDA 5C25B 3BYPA 4ECZA 1DQ8A 2DHXA 3KWMA 4I7FB 5LMNJ 2B9XA 4ECTA 1RWUA 1NSKL 1RABB 2JFKA 1OO0B 3PDNA 3BPSP 4WFNQ 2WTFA 4DQPA 2WB4A 3MEDB 2BR0A 1PJ7A 2BRKA 4DHVA 5T7LB 2KH9A 3FBFA 5HBMA 2PI4A 2R7UA 1YJRA 3OL7A 5GAEI 2YQ3A 1G4CA 2D1CA 3IRXB 3GILA 5C2GA 2DITA 1IKVB 4USIA 2MMYA 4C11B 4CLUA 5ETOA 4FF1A 3TA2A 1U6ZA 2V2KA 1FKAF 4YY3F 3FUYA 4ZJOA 1Y5LB 1DARA 3OTCA 2XMUA 5DGBA 4R25A 4NLDA 3ZC4A 2DHGA 5H9EJ 1FJCA 3L95X 1NSAA 1LW2B 2KFZA 1U1PA 1JK9B 1LWCB 3NGRA 2RUGA 3IWLA 2Z58B 4P9SA 3HX9A 1FRLA 3RW6A 3T6JA 5EDWA 3AOCA 5GADU 4K2JA 1J27A 1N52B 4FBTA 1Y3JA 2ZC4A 2MKJA 1C4AA 2VFRA 3R6GB 1HW9A 3OFGA 1Q16B 3LGMA 4BWMA 3L9ZA 4RWXA 4ZN1A 5A8WB 2JLGA 1FT8A 3QGHA 4TQRA 2AIRB 3P5TL 5H9FJ 1X5SA 3W65A 1FRHA 3IS9A 1RHRB 1S0VA 3P6YC 4C8LA 3HT3A 4KHPJ 1JJCB 5KG0A 2FJDB 4DR4F 1IXKA 1ZAXA 3GG1A 4QWAA 5L1KA 1J5OA 3PX4A 2CZ4A 1IN0A 1EJ7L 3EXYA 4TVAB 2BJEA 2DR5A 2RE1A 2NUUG 5KG6A 3JSMB 2HNYA 1PJ6A 3JYTB 3GFXA 1HBOB 1A7GE 1WNEA 1YJ9S 2LVWA 2KT3A 4Y65A 3JTNA 4ES2A 4KV8A 2PIIA 1VIXA 5AJ3J 1MMLA 4LSLB 4FPRA 3OL6A 1EKRA 4DR1J 1C4CA 2HBQB 3C6TB 1PAEX 4BHQA 1LWEB 2R42A 4K4WA 2HAFA 3LTOA 4G1QB 3DNCA 1NZ8A 2DEIA 5ETNA 1AYEA 1JNZB 4DV5F 1NNDA 1YWXA 2GNKA 3MECB 4IG0A 1TVRA 3VTIA 3CXCR 1RHMB 2E1PA 1AA1B 2QMXA 2BKOA 3QWPA 4JI3J 1CG2A 3I0RB 1NHUA 1DTQA 5A0YB 2HBRB 2QIFA 2VQFJ 4DR5J 2UUAF 2ZNYA 3KLGA 4B17A 4NLQA 4Q5VA 4WXWA 4USTA 3KHGA 2ZM6F 1N5VA 2ADCA 4J9OA 2ZC3A 2XNRA 1FXRA 3I4PA 4QWBA 2BM1A 2VA2A 4PWDB 3K5OA 4XO0A 2FJVA 1NO8A 4J9RA 5BJRA 4EFAC
chains in the Genus database with same CATH topology
2R7QA 4ZCMA 2FJXA 4RU2A 4MKBA 3R5CA 2MKKA 2OD6A 4LF7F 2OMLA 2PC6A 5A8WA 2FPHX 3O5TB 1IUJA 2UUWA 1XR6A 2J6UA 4JV5F 4NLUA 2OTLS 1KHWA 2MDAA 2FVQA 1URRA 3UI3A 2CG4A 4TU7A 2RDJA 3QJLA 2ZJQQ 3KK2B 4LF9F 3H98A 2ILYA 3T5HA 2ZH5A 2WB1D 4MKAA 1FKPB 2FVCA 4ZLPA 1HI0P 1RQ0A 1REVB 2DCUB 5HROB 3NP5A 1RT4B 4I67A 1VQYA 5FD1A 1SJRA 1S6UA 2FJBB 3ZZOA 1VMBA 4ED7A 4M95A 2E44A 2HIQA 2QSWA 2AGPA 3LW5C 5G0RA 1FCAA 4NYPA 4OI4A 3EPGA 2EK6A 1E6VA 2FHJA 2RMLA 2QV6A 1VBYA 2Q79A 5C25A 3DRPB 3PRBA 2OO4A 4K5RA 2AYGA 4KTQA 5B0BA 1RTJB 3HKWA 3J7YI 2Q43A 1NZAA 4EYIB 3MTKA 3DLEB 1UWBB 4N41A 1HW8A 4I2PA 2BABA 5KFYA 1AW0A 2F4VF 2VH7A 4I6YA 2J9DA 4URQU 1JIHA 2DHAA 2OD4A 1FO1A 3KLIA 1U47A 4TY8B 1M5VC 1TAQA 1MROA 2MKCA 1Y9OA 2M0GB 3AJ1A 1ZM9A 1NKEA 3TA0A 4CQ1A 3JAMY 2MXYA 5EWFA 3M2UB 1AUDA 5E0OA 2V8VA 1JLAB 3E01B 3PEHA 3QIPA 3OSNA 2GJIA 2NSCA 3OTDA 3ETOA 1YJWS 1F60B 2XMTA 3H8YA 1XNRF 4H54A 2DGQA 2ZHBA 2NUHA 4IRCA 2EW9A 2R7TA 3HKZD 5B0AA 3RR8A 3C6UB 2LYVA 5DDRC 4TU8A 1KFDA 2CPIA 2LDIA 4QR1A 2E7XA 1VC5A 2FTRA 5CYQA 4DF4A 3QJPA 4Q45A 3MR2A 1S9FA 2J6TA 2W9AA 4DLGA 2GO9A 5EHHA 4ECXA 3OFFA 4B9TA 2PGCA 2R8GA 4HT5A 1HD1A 1TKDA 4WFZA 3IWXA 3TARA 1VQMS 3POTB 4MFBA 4OLPA 1D9FA 2M9KA 2ZZNA 3SCIE 1S9EA 4ILLA 2DO4A 1XNQF 5EUHA 1HYSB 2DGTA 3DI6B 4OHZA 3KLGB 4IDKB 2KHCA 2W7PA 4OX6A 2ALZA 4KO0B 3WDOA 3HFKA 1HBMB 2MSTA 1SIWB 4OZJA 2MQMA 4PG5A 4L3NA 3BB5A 2QFJA 2CZVC 3Q8RB 3D1HA 5E3CA 1UFWA 3FMWA 3EGZA 3I56S 3E3XA 3DOLB 1DQAA 3K5MA 1EP4B 2QA2A 2KZMA 2ASYA 4FVCA 1S97A 5KFUA 3MWBA 3F44A 4CO0A 1HYSA 4X84A 3H5YA 3ULHA 3QAEA 4QIEA 3R27A 2L9WA 2GGPB 3NRBA 3K58A 1R8AA 3MAHA 4DL6A 1NK0A 5GAEU 2HHSA 3O2IA 3BSCA 2LU2A 2ZVSA 2HRYA 2AGOA 3GWCA 1LKZA 3SZ2A 1U1QA 1K0VA 3NBPA 4ECVA 3CTRA 1OIAA 2D9PA 1VQ5S 3MHYA 2VL1A 2VONA 1CQNA 3BS9A 3ITHB 1G2EA 3IWNC 1DLOB 4Y2AA 4LF6F 1LWCA 3HVRA 2B5JB 2QE5A 1KQSR 3PR4A 2VV5A 4P7VA 5L1LA 2HWTA 4F4YA 3CUNA 5J2QB 5DQGA 4C9DA 3DLKA 4TN2A 2MQPA 4UUXA 4RW4A 1VBXA 3CC7S 5HL7Q 1NU4A 4KSEB 1SH2A 2HS3A 5F9LA 1SUQB 3O1LA 5IQQA 4DWIA 2MZJA 4TU9A 1VS3A 3U1MA 1N5QA 1S1TA 3MMBA 4URSA 5KFCA 1GXUA 1JJ4A 2I1RA 1CPZA 3ZZUA 1S1WA 4LT6A 4QYZJ 2LEBA 3FVYA 3CCQS 2VFTA 4OL8A 1JLGA 2H5EA 4I56A 1KTQA 1TK0A 3M05A 1TL5A 5ITHA 2LECA 2KM8C 1BQNB 1U7LA 1HWUA 2JDJA 5B0FA 2E1CA 3LGNA 2WAQD 4WTYA 1FRIA 2ZJRQ 2KVIA 2XSFA 5JXSA 2YX4A 3JTOA 4YFUA 3DLGB 2KXNB 1HNZF 3LP2A 3AB2B 5CXTA 5IT4A 4H4MA 3HF5A 3DXSX 1Z2LA 3GFYA 3JSBA 4FXWA 3I5CA 2FHKA 5CCLA 3GIKA 5K9FA 2XGQA 1QTMA 3M8PB 3OPKA 1HHSA 2R4FA 4NCBA 4DN9A 1VC0A 1TAUA 3FSIA 2DNGA 3NS6A 5M2PA 2XI3A 4O4GB 1LWFA 1KHVA 1FTCA 1RT2B 1VHFA 3EUNA 3QZ8A 2PA8D 3FNNA 3OV7A 3RB4A 4XK8C 2CQ0A 2CQHA 4ID5A 5DDOC 2HZCA 4AXJA 2OSQA 1X8DA 1O51A 2X1AA 3NWGA 1ZBTA 2HW3A 1RT3B 1X4DA 1LV5A 1ZPWX 3TA1A 3I5BA 1QSLA 2NPIA 5L9NA 4OJ3A 4LF8F 4KHPF 3MMJA 2DBBA 3MAQA 2RF2A 2BDPA 1N54B 1C0UB 3S7RA 5DO2A 3J7ZT 4NLPA 3BZQA 4NCGA 3LOUA 1N5YB 3NS5A 3F41A 2W25A 4UQGA 4A8XA 2F3JA 2JEIA 2JC1A 1NHVA 4DSFA 1WG4A 2JH3A 4MK8A 5E3AA 1C1BB 1IKYB 3H4DA 3MM6A 3KNGA 4FXVA 4CO2A 3PZPA 4NZ6A 2MKSA 3HXMA 2ZKTA 1XR7A 1FDDA 1KD1T 1ZAWA 2IAJA 2E9RX 2LU1A 4H4OB 4KB7A 3IRXA 2KT2A 5J1EB 3IN5A 1TV6A 3BN4A 4ED0A 2HQIA 4NLGA 3HVWA 3TAMA 3NNCA 3EZUA 2DHSA 1YJVA 2P5VA 3SXLA 2J7WA 2C3MA 3DI6A 3ICLA 3J81Y 4RKUC 1C1BA 2YWEA 3LP1A 1IQTA 1TL1B 1DLOA 1TL4A 1U6BA 2DH8A 2R7OA 3KLIB 1Q1KA 1JXEA 4HL9A 5F8HA 2KYXA 3TUJC 3ZZ0A 3DYAA 5J2NB 4O3NA 3DRYA 3UPFA 4JI6F 3DFEA 2PMHA 3QGGA 4TLQA 4G6VB 4DEZA 1FDAA 3GV7B 2UU9F 4PQUB 3SDEB 4JI8F 1GT8A 3UR3C 1R0AA 5F3ZA 2XMVA 4WZMA 4LIWA 1FD8A 4B9VA 1TK5A 4RW6B 2QSFA 5F41A 3CJKB 2JZ5A 1IJEB 2M5YA 2MPUA 4QWDA 2W4DA 4DG1A 3FZBA 4JV0A 1H6KX 3H5XA 4LVNP 2ZHOA 1V3RA 2JLFA 4EWTA 3D0IE 5J1EA 2B5JA 5KFLA 2DNOA 1S10A 1N33F 3T3FA 2OPRA 1YITS 3HMJG 3NBPB 3PX0A 5HO4A 3TOQA 1S79A 5F0WA 4LFBF 3Q24A 2BV3A 1EETA 3RBDA 2Z8QA 4DR3F 1SJ4P 3V6JA 1S49A 2HAIA 3DLGA 4EZ9A 2J0XA 1M5KC 2WOMB 1C1CA 1HBNB 1RP5A 3GG0A 3M8QB 3M9NB 3BO3A 3V81A 4IO1A 3HZEA 2R7VA 2HWHA 2DR9A 5ADZA 2GQCA 5KFZA 5KT5A 2BM0A 2ZJPQ 3IO1A 4KRWA 1ZZNA 3M8RA 4BWJA 1V3ZA 2W9CB 2V9WA 1ZM4A 4ES3A 3DRRA 3W2WA 1S1TB 1EETB 4NLXA 4N8NA 3WX4A 4UUWA 4NWBA 4ZP8A 4J37A 3GIJA 3TR5A 3PX6A 1U1OA 2VG5A 1LXNA 2HQ3A 4DL2A 5SZTA 3DOLA 2XS2A 2NXUA 1Y5IB 4DS5A 4UY85 6FD1A 3HHNB 2B43A 1RKIA 2A3JA 2NSBA 4O44A 2LA6A 4IR9A 5KT2A 1PSDA 4DG1B 3GZ7A 2HFNA 4C3MA 2DNRA 4TY9A 1REVA 3MCSA 1UA1A 5IM0A 4L6V3 2GA7A 3OHAA 3LALA 3MM7B 1NJYA 1Z2ZA 2EI5A 2KRBA 3R5AA 2DNPA 4B9LA 3QYYA 1RT6A 5B7WA 1SL1A 1RT1B 2VA3A 4B9MA 1TZ0A 1OQ6A 1R31A 4EYHB 2GHWA 4DOZA 1SV5B 4TYBA 2DNKA 1CVJA 5K8MA 2OP5A 2KB2A 4CT9A 2D3ZA 1UMJA 3SQGB 3VF0B 4OI3A 1BQNA 2VASA 1N32F 2A18A 3THVA 1XTZA 2R9LA 4JYAF 4QBUA 3TW0A 2RSQA 4K4TA 4YDXA 3I0RA 2ROGA 3N79A 3C6UA 4MYTA 1S0MA 2LDYA 4V19J 1S6OA 3PNIA 4NLWA 3FFIA 2XWXA 2WCXA 4OHYA 5KFXA 3KLHA 4LFAF 3VAKA 4KE5A 2MZTA 4AYBD 4JOUA 3OHBA 2FC9A 4NLSA 2J9EA 1RJJA 1IKYA 2ZOGA 4PPZA 3L7PA 4DR7F 4F67A 1BY9A 2V94A 4PG6A 1T03A 1LQ9A 5LSLA 4YHHF 2OJ3A 2DRAA 2V4RA 3BO2A 1UVJA 2VPZB 2DIUA 3MD1A 4DUZF 1M5OC 5D8HB 2XHWA 4AL7A 1Q4RA 2UUTA 1FK9A 1VQ6S 1G6BA 1KQKA 3PO4A 4FN5A 4CZCA 1S1VA 2BUNA 4ITSA 2MKHA 3DMJB 3FEXB 4DL3A 1ZYQA 3LAMA 2HS4A 1FF2A 1T94A 4B3MF 3FQKA 3E51A 4DL4A 1WHXA 5D4PA 1S1UA 1UL3A 4IFYB 1T05B 4Q8EA 3PW7A 2P6SA 2IM3A 2BANB 3JTPA 3E2EA 4I4BA 1LWFB 1SJ1A 1WHYA 3PW4A 3CIMA 4QU7A 4ZPVR 2VQFF 3N01A 3O6QA 1X4AA 2VKZG 1R0AB 5IT9Y 1RT2A 3H5UA 4DJBA 1KVIA 4PUOA 1FXLA 4G1PA 3Q22A 4BC9A 4C8KA 4IFYA 1T05A 2CJBA 2CPJA 3MEEB 2AF6A 3DRRB 3SDEA 1K9MT 1JKHB 4NPOA 3S6EA 2QA1A 1H2TZ 3C6TA 4I2QA 2UVVA 4ES1A 4K4YA 1U09A 2BQUA 4X65F 3LO3A 3N0VA 4YQWA 2LEPA 3IR7B 1X5TA 1KFSA 4ILRA 4IQMA 3UCUP 4J9MA 1OWXA 2KHDA 2OPSB 4DN0A 1S1VB 2I5JA 2MHEA 4D3GA 4EZ6A 1PO6A 5D4NA 3RYLA 1R6YA 1RAJA 4I0WA 3CC2S 3BQ2A 4NYOA 3MMBB 2XMMA 3PXGa 4MK9A 3MI7X 4C7QA 4G3IA 2FLNA 2EC0A 1JKHA 1LOUA 5FDLA 1ZOTA 2YH1A 2ZH4A 1HL6A 5G0RB 3MM6B 2IVMA 4G1IA 2XY5A 2U2FA 2ZBIA 4H4KC 3G96A 1FJGF 5CD4H 2I2YA 1SKRA 3CCWA 5KFQA 2N3OA 2E1AA 1PC5A 2RKIA 4DL5A 4NL5A 3T9NA 4A4JA 1ZM3A 2KO1A 2R2RA 4A46A 3TX8A 3CT9A 1HA1A 3F56A 4DMZA 4KKOB 5THWA 2FDNA 4RUCA 1S72S 2C3OA 3HHKA 3I9ZA 4MYUA 2COLA 3SQGA 3CE8A 2AQ4A 3WC2A 5HP1B 4YR0A 2AX0A 3J80Y 2FC8A 1JLQB 3T5LA 3SSQA 2YWKA 2B51A 4PG4A 1I94F 1FRJA 2RS8A 2X1BA 3HHEA 4HDHA 2NZ4A 2D41A 1C0TB 3MEDA 4Z37A 3ENVA 4EO8A 1LK5A 4PQUA 3MD3A 1FA0A 5LMNF 1RDRA 2YKMA 4ELUA 1WTFA 2N4CA 4HEA9 4PXEA 1YI2S 2G9OA 1UKUA 1WI6A 3I5AA 1QE1A 3ENWA 2M52A 5HQ8A 1W25A 3KFWX 4HKQA 1S6PA 3VCDA 4Y2IA 2ZDOA 1JLCB 1QAYA 3HVTA 2BQ3A 5E3QA 2V9KA 4R8UA 4QJVA 1C2PA 2E9ZA 4PRFA 1VQ7S 2CQDA 4RW8B 2K7JA 4NXMF 2ASJA 3PKYA 2EFNA 1HNVA 2OMOA 2PDAA 1JWWA 1KN6A 4YEAA 4XPEA 3MPVA 1LK7A 1S6PB 3FSXA 3MXHP 4WK1A 4NLTA 1XN9A 3VZHA 4GC6A 2R8HA 2XSJA 4XAKA 3KJVB 2FVPA 5C24B 4U7CA 2Q6BA 1HBOA 1KLNA 2HHVA 2E66A 1JLEA 4AE5A 3VAHA 1T03B 3LP0A 2IA6A 4PR6A 3IGVA 4A8MP 4DQSA 3MR5A 1X4GA 5KG5A 2IBOA 2J7UA 2LLZA 4DFJA 5F0UA 4F4KA 1R8PA 4DSIA 2FIUA 1NH8A 2YY3A 5CQGA 1SJFA 5LJ3Y 3DRXA 4CT8A 4ECSA 4IO9Q 2QT7A 5DM6Q 4PUOB 4P2SA 2VG6B 1F9FA 4QWCA 3TAQA 1HWIA 4YR3A 1RI7A 3SSRA 4IYQA 4UOCA 2NR0A