1YRXA

Structure of a novel photoreceptor: the bluf domain of appa from rhodobacter sphaeroides
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
118
structure length
118
Chain Sequence
AGHMVSCCYRSLAAPDLTLRDLLDIVETSQAHNARAQLTGALFYSQGVFFQWLEGRPAAVAEVMTHIQRDRRHSNVEILAEEPIAKRRFAGWHMQLSCSEADMRSLGLAESRQIVTVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Novel Photoreceptor, the BLUF Domain of AppA from Rhodobacter sphaeroides
pubmed doi rcsb
source organism Rhodobacter sphaeroides 2.4.1
molecule tags Transcription
molecule keywords hypothetical protein Rsph03001874
total genus 32
structure length 118
sequence length 118
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1yrxA01
3F44A 4FNHA 1QUPA 1X7VA 1MWYA 3E8OA 2KYZA 4HI1A 1Y9OA 3KG0A 4Y2KA 3WDOA 2IFXA 3LGMA 2OAUA 4HH1A 1X8DA 2OP5A 2QYCA 2JDJA 2HIQA 4F67A 1Q4RA 4DPOA 1FE0A 3LGNA 2BJEA 5A6WA 3CJKA 3CJKB 2AW0A 1N5SA 1W2IA 3BB5A 3BM7A 3KNGA 2W4DA 1P6TA 2K7KA 3VTIA 1TL5A 1YJVA 5B0FA 2BUNA 2AP6A 3BR8A 1FESA 1N5QA 4HL9A 1OSDA 2OKQA 3MCSA 2W4CA 3IWXA 1Q53A 2L3MA 1FVQA 2KT2A 5KAKA 5B0AA 3BN7A 2HLUA 3DXSX 5B0CA 2BYCA 1Y3JA 2OD6A 3BDEA 3HDSA 4A46A 3DCAA 3HFKA 1JWWA 3TNVA 2QIFA 2GO8A 4OJGA 5B0EA 4A47A 3TRGA 2VV5A 1SQEA 2FTRA 1Y0HA 4Y2MA 4NPOA 2K1RB 4Y2IA 1YJUA 2XMKA 1APSA 4ZOSA 5F0WA 2ACYA 2G9OA 4OIXA 1P8GA 5B09A 4YEAA 3GZ7A 1GXTA 2GGPA 2PD1A 2K7JA 3HF5A 2XMWA 3KG1A 1Q8LA 4A48A 1FE4A 2QLWA 5IXUA 5K9FA 1ULRA 3FRYA 1IUJA 1TUVA 3IWLA 2KT3A 1YRXA 1N5VA 1R6YA 2IYGA 4A4JA 4HH0A 1WD6A 2IYIA 3T9NA 1JK9B 2XMJA 2OD4A 2QLXA 3BF4A 2LQBA 1CC8A 2GV1A 2XMMA 2N7YA 4OJHA 4ZA1A 1KVJA 4OJ3A 2EW9A 4EFAC 2PGCA 3HHLA 2ZDOA 1YJRA 4NL5A 1OQ3A 5F0UA 2LDIA 1GXUA 1V3ZA 1YG0A 2LQ9A 4Q2MA 1VQSA 1S6OA 2K1RA 2HFOA 2RILA 5B0GA 3HX9A 2AJ1A 2HLTA 1VQYA 1OPZA 2CRLA 2LXFA 3HHLD 3HHLC 5B08A 4YDXA 4DL0C 1RJJA 2ZDPA 5B0DA 4Q2LA 1SI9A 2OMOA 2N4CA 2FIUA 1FVSA 1URRA 1TR0A 1OQ6A 1FD8A 1SB6A 4DN9A 1AFIA 3LO3A 1K0VA 2GCFA 1LQ9A 1N5TA 2RMLA 5T7LB 1TZ0A 1KQKA 1AFJA 2ROGA 2BJDA 2ASYA 2GGPB 5B0BA 3TOQA 2ROEA 2OFGX 3HHLB 3KKFA 4FNIA 2XMTA 5T7LA 2AJ0A 1XBWA 1X0PA 2HFNA 2HQIA 2Q3PA 2BBEA 2W4PA 3BGUA 1Q8BA 3FMBA 2XMUA 3UDCA 5A6PA 1AW0A 4HI2A 2FHMA 2VH7A 1MWZA 2XMVA 2RU9A 2N4DA 1TL4A 2GA7A 2ROPA 4QOTA 3QMQA 1YJTA 1S6UA 1CPZA 4OJ1A 2RSQA 1U7LA 1Y3KA 2FB0A 3MZIA 1CC7A 3QGPA 1KVIA 2GFFA 2KKHA 3FGVA 3K7RA 2K2PA 1FEEA 4U9RA 3I9ZA 2OFHX
chains in the Genus database with same CATH superfamily
1GTHA 1DTTB 2OSRA 1FWPA 2E1CA 1HQEB 2PMHA 2ZM6F 4CIOA 2KFYA 1R8CA 1F9FA 1Z1ZA 4IDKA 5KFHA 3EVOA 5FLXY 1IKVA 4R5PB 4F0HA 2PA3A 3T9ZA 2W8KA 1VMBA 2HNYA 3TR5A 1Y11A 3PW5A 1IR1A 3OT9A 3HZGA 4QR2A 4B3SF 2DXEA 4USJC 2YKAA 1S6QA 3DOLA 3M6WA 4M63A 4RO0A 3DOKA 4RNHA 4C48A 3KLEA 4TYAA 4DFMA 2AP6A 3DYAB 1BXNA 3EZOA 3IM8A 3MPVA 1SJ3P 4LFCF 3MMBA 1K47A 4QJVA 2DGUA 3RRGA 3C2PA 2LEAA 4ED4A 2OPRB 4QWCA 2X7IA 4I4BA 3CJQA 4X66J 1RWKB 2ZOMA 4Q43A 5JJBA 2KT2A 1TL7A 2KFNA 2V94A 5B0AA 2FGOA 1Q79A 1IN0A 1NDPA 3EGVA 4TLRA 2GQCA 1N5YB 3W5YA 1CBKA 2GJFA 3EGZA 1JWWA 1U4BA 1SVDA 2QG9B 2VHGA 2NR0A 4TNOA 4C8MA 1SQEA 3OR1A 2MLZA 3N0VA 5I3UA 2E7XA 1QLNA 3SCKE 5LT5A 2WBRA 5CAAA 1MROA 2YWKA 2QRRA 3M8QA 1P8GA 3P45B 1S0NA 2R7UA 2VFTA 1X4BA 3QIPA 1DY3A 3LQVA 3D6FB 3MF5A 1MU2A 4O44B 4ED2A 1VLOA 5E3RA 2BE7D 5K5MA 3VR1A 3J80Y 3IWLA 2YQ1A 4A4JA 1Q16B 3B54A 2B51A 4C3MA 2WTFA 1T9XA 3CSKA 2GV1A 3JSRA 3H5YA 3BQ1A 3ILLA 3FZ2A 4DR5J 3D0HE 5E41A 3M9MB 2COLA 2WHOA 4FYYB 4HT5A 5HI7A 2J7UA 3QZ7A 4MMOA 4O4GB 1SUQA 4F4YA 1VQ8S 3DLBA 2F7VA 4F26A 1Q7LB 1HNIB 1TUGB 1S77D 2OUGA 5HVGA 5IQ6A 3A3PB 4DL6A 2HHTA 2VA3A 3MM6B 1AA1B 1P1LA 2A3JA 2RDDA 5DJBA 3THTA 3TJ9A 4A8XA 3J81U 3HHLC 1PO6A 2FVSA 3AH6A 5KFAA 4ELVA 1HHSA 1SH0A 4YQWA 4P7TA 8ATCB 4RWXA 2FVQA 2BQ3A 2BDPA 4WK1A 1U6BA 3L95X 3AA8A 2EFNA 3B8HA 4EWTA 1WJ9A 4ZHRB 3MR5A 3JQJA 1JJ2R 4JI6J 1S57A 1TR0A 5HL7Q 3LO3A 3LP1B 4DG1A 2RMLA 4A8FA 4Y0FA 1V3RA 2MEWA 2B4VA 3ILIA 4DQQA 1Y5LB 1VQ6S 1X0FA 1F6TA 2ZKTA 3HSGA 3GLJA 4DX5A 4J9NA 1N34F 4BS2A 2FJBB 3BBBA 3M2UB 4DR2F 3M8RA 2IAJA 5KFVA 1X5PA 5T7LA 1ZM2A 2ZH7A 2RQCA 3OBIA 4YR2A 2ZH4A 2W4PA 1VC6A 1NK0A 3GG1A 3QGHA 4R5PA 5DQIA 3CCJS 5JXSA 4A8QA 2R42A 3SQGA 3FDSA 1DAXA 1R8PA 2CPZA 2LQ5A 3DGPB 2ACMA 2HFUA 1M5SA 1LK7A 1SPBP 3GV7B 1U7LA 3MZIA 4JI3J 3K5OA 4MK7A 2J6TA 1SBRA 2BVZA 2RS2A 3NL0A 3T1HF 1M5HA 1BHNA 3SEOA 1FEEA 2VJUA 4EBCA 4ED1A 1EP4B 2QYGA 1JLEA 1RT6A 2Z2ZA 2AX1A 3N4WA 4ZP7A 3PXGa 4GC7A 4OQJA 5GAGU 3AQPA 2O67A 2IFXA 2ZBPA 3LGMA 3ENWA 4XPCA 1N36J 3GU0A 1U1RA 2V4JA 3SXLA 2DNRA 2KN4A 4MIWA 1UEVA 4XK8C 3KJQB 2FJDB 3CIZA 3TZWA 5A6WA 2BJEA 2CZ4A 4M5IA 3TX0A 4X66F 2LDYA 1YTYA 3I32A 4M95A 2ZH5A 3P49B 1KLMA 4LSZB 4AUKA 2E7VA 2VQFJ 2BOAA 2V67A 3AD9C 4QIWD 5GAEU 5B0FA 3KXDA 1LKZA 2VPYB 3MM9B 1ZYQA 2VJVA 4ETZA 1NBEB 2AEJA 3MM8B 5HQMA 3DU6A 1PC5A 3LALA 2G0IA 3CCQS 3KK2A 1FRXA 1Q5VA 2E5HA 1FVQA 2M0GB 5MLCV 1XNQJ 3UR0A 1E6YA 1WTFA 2NSCA 1ZAVA 3C6UA 1F1BB 2HVDA 1GMUA 2HQFA 4PZVA 1WOOA 4C0OC 3CD5A 3T19A 4ZCKA 2UU9F 2MZQA 4OZLA 3W66A 2QIFA 2WBMA 3KHHA 5B0EA 2M9KA 2VG5B 5DZ6A 1M90T 3DRSB 1JIHA 2CKWA 2FTRA 5DM6Q 3HP6A 2CYYA 4DV6J 4DR6J 2IM2A 1WG4A 2LLZA 2ZVIA 4R0EA 4Z2XA 4X4TA 4U8YA 4YB1P 3CMAS 4B9SA 1JLCB 2YX4A 4NLXA 1N33J 4DSIA 4B3RJ 1B70B 1OO0B 2OEMA 2GGPA 3GZ7A 3BGLA 3SCLE 4PABA 2VOOA 3LH2S 3KG1A 4PXDA 3OTDA 3RBEA 3R6GB 4CO3A 4KH0B 1TUVA 5J2QA 2HS3A 1N5VA 3UVJB 3O2IA 4ANEA 2EKYA 1F2GA 4NX9A 2QA4G 2MY8A 4YMEA 4P74A 3VAHA 1EHWA 2JEFA 3HSZA 3I56S 2GVZB 3FUYA 4QIFA 1TKXB 2ZDOA 4OZNA 4JI6F 3S01A 2ZH6A 3BQ0A 2JSXA 2DGXA 3AD8C 2DH8A 4ILMA 4ZIVA 1VRTA 5EGYA 1RT3A 3GB0A 1Q78A 1QTNB 1U25A 2FJAB 1NKEA 2F5GA 3KJNB 4G1IA 4OYZA 4Q7AA 1P9YA 1T9YA 2H1YA 2VIHA 1BGXT 1VQYA 1N34J 1UEUA 3DLJA 1ZTTA 1RAJA 4M5LA 1RJJA 2JC1A 4XDDA 5BYQA 2MQMA 2X3GA 2OMOA 4CZCA 5FJ4A 2R7VA 3V81A 3ADAC 1R0AA 3BQ2A 1B7FA 3NGTA 4FS2A 5HLFB 3ETMA 3D3CJ 3KLGB 2LXIA 2AYBA 1RT6B 2ROGA 3U27A 2VICA 3K8WA 2ALYB 1S99A 4HACB 5G4DA 5KG1A 4W98A 5KFRA 3MR2A 1NJXA 2HW3A 2WSEC 3N79A 2ZE2A 2OFGX 3T5HA 4JI3F 3PX6A 2JRSA 1BD6A 1FNOA 1XERA 3BEGB 1NK6A 1J5OB 1X0PA 2EK1A 4UT4A 2IM0A 1FKOB 2QL7B 4FXDA 5M2RA 5L1IA 2W7OA 5L46A 8AT1B 2DTJA 4EEYA 3CPWR 1TL4A 3OW2R 5CYQB 1U1QA 1KTQA 4O23A 4IKAA 1U1NA 4IRCA 1J2VA 2CQ4A 1JLAA 2V8VA 2HRYA 3EZUA 2BE2B 3BGRA 3ENQA 3JTNA 3MM8A 2KZMA 3FGVA 3K7RA 3W8PA 1JX4A 2XLKA 3FSXA 3GYXB 4IG3A 2R8JA 1GMWD 2QGFB 4I1TA 4OFZA 2D41A 4RLEA 4ED6A 2RRAA 1MG7A 1MWYA 3PO4A 1UWAA 2ZZTA 4N77A 3KLEB 3DDNA 1ZETA 4JV2A 4PEOA 1H73A 2IM1A 3HVWA 4N5SA 1KBRA 4CH0S 2KRRA 5EHHA 2BM1A 3FBBA 4DPOA 2XCPA 2B43A 4C9DA 2L9WA 3CJKA 4QWBA 4Y65A 1NHUA 3NAHA 4NCBA 3G6XA 3DOMB 4V19X 4UZCA 3N5FA 1HR0J 3EXYA 4USWA 1QTMA 2WVBA 1YBAA 4QWDA 4YP3A 2MQ8A 2F3JA 5IV3A 1CJKB 3MUMP 5DDQC 3DLEB 3D4JA 3LP0B 5KT6A 3DXBA 3C14A 3OLBA 4E98A 4FPIA 2J0WA 3ET6B 2DRBA 3W5XA 1HNVB 3UQSA 2UVVA 4RNNA 2V68A 4NCGB 3V6HA 3OSPA 4ICLA 3MXHP 2HHUA 1T3NA 3UCUP 3ILJA 4LJMA 4N76A 5FIIA 3D68A 3DCAA 3H2VE 3CCVS 4X84A 4K0KF 4CYUB 4F4ZA 4ZKAA 3M6XA 4L76A 4OYOA 4AXJA 1U8SA 4EUVA 2DNGA 4DLEA 3TZYA 4GO7X 3KJVB 1LW0A 3BDPA 4UOGA 1JJ4A 1SC3B 4CLSA 5ETQA 1NJWA 2BJ7A 1RK8A 3CTRA 3R5JB 2J5AA 4WIIA 2AT1B 4HDGA 5K8MA 3MUTP 2KRBA 2Q79A 2M5YA 2HNZB 3DOKB 3OXFA 3EPGA 3QFWA 5GMDA 4EBEA 3J80U 3IR6B 1IUJA 2X1BA 4QPXA 1QDUB 4KIAA 4IUFA 2L41A 2W9CA 3NGRA 1ZAXA 1JNZB 2HEKA 1C0UA 2IYIA 3OLAA 3BF4A 4QIGA 2AYEA 1CC8A 2DY1A 2XMMA 3FRZA 3M7VA 3VGSA 2I2YA 2UUAF 1QAIA 4DSLA 4MAKA 5D6GA 3G8QA 3RW6A 2C2OB 2JLFA 4NLYA 2RHQB 3JYTB 3VCDA 4U7CA 4YY3F 1I51B 1NSAA 4HACA 3T1HJ 1OIAA 1YG0A 3R5BA 2R2SA 2ZE2B 1WNEA 3FEXB 1VQSA 2F40A 3CGIA 1SUQB 4PPDA 1JKHB 1YBUA 3CDBA 3HJFA 2NYIA 3UCZP 2IJFA 4RW6A 3D6TB 5ETKA 1TVRB 3HX9A 3TO8A 4DPUA 4NXMF 2MKYA 1X9MA 4ECRA 1VLYA 5DLGA 2YH0A 1N36F 2DO4A 2GIFA 1RT5A 4IO9Q 1F3VA 2QFIA 3CCTA 2JJ4D 4ZLNA 4Q8FA 3MAAA 3H2LA 1URRA 2HZCA 1OQ6A 1JLGB 3U1LA 3MPUB 1RA7A 1TL1B 1TZ0A 1ITPA 1X9SA 4KKOB 4K4WA 1RHRB 3Q0AA 4DFKA 4I6WA 5JVHQ 1PJ6A 5BYRA 2ASYA 3LOUA 3DMJA 2OIHA 3PKYA 4EZ9A 5C24B 1RWVB 1RABB 2WAQD 2UP1A 3RR8A 3KKFA 4WZQA 2C2NA 3PR4A 5GADI 1B0VA 1NHKL 1XR5A 4O3RA 2UUCJ 1K44A 2YNFB 4ZVQB 4C7QA 2GHPA 1EQ0A 1PCAA 2XSFA 3HJVA 3DRPB 4NASA 3M1VA 2W8LA 4OI1A 4ED7A 4I2QB 1CJUB 3GSIA 3IO1A 5E3QA 1FK9A 1PYOB 1F5BA 1REVA 4U7UD 4LSLB 2K06A 3ZNJ1 4X4OA 1VBXA 1CC7A 4KBIA 4DX7A 2KKHA 4IG0A 3CC4S 2K2PA 1T9UA 2VPZB 4BC9A 3TZZA 2KG0A 2FJXA 1RACB 2LKZA 1TV6B 1QUPA 1YWXA 2KXHA 2VDHA 3MMJA 4FNHA 3JTOA 4P2MA 2R7WA 4CLYA 3P3DA 5GMKa 4LF7F 1HIYA 1X4FA 2PSZA 4HHHA 3KK1B 2MPUA 4ED5A 3ENVA 1B99A 1Q4RA 4P75A 2IRXA 4ZPAA 2Y8YA 1KOOA 2X1AA 1DARA 4TN2A 2M70A 4MKYA 3MPDA 3SSRA 3UR3C 3US5A 2HPUA 3KNGA 4JV5F 1R6VA 2V8DA 5T41A 3ULHA 1KVKA 5DDRC 4DR3J 3RB4A 4E0DA 4IRKA 2E5LJ 5A0YB 3D6MB 3ZO7A 4ERDA 4RKUC 1S9EA 2QO3A 1Z2ZA 4QYZJ 2D3ZA 2PE8A 1LWFA 2POKA 1TL1A 2MY7A 2Y1LB 1H38A 2MJNA 1JLGA 3PYEA 4ANDA 4FF1A 1YGYA 2L3MA 3DDKA 4DQSA 2J9EA 2CJKA 2ZUAA 3N6NA 3HKWA 5A8KA 2E5LF 1HWUA 2B5JB 1VQ5S 3FZBA 4UZBA 4PQUA 2KJWA 2MKSA 1VJQA 4LFBJ 4TQRA 2XGPA 2YNFA 3HVAA 3P96A 3DC2A 2FC9A 1WF2A 2V4JB 4M5DB 4ZJLA 3PKMA 2RE1A 1TVRA 2FY1A 2DNYA 2W25A 4NXMJ 2RVJA 4RUCA 4ILRA 3Q2TC 5F0WA 5HVFA 2YKQA 1BQNB 4A8OA 2OPQB 4WZMA 4WU3A 1C1BB 2JVOA 2WK4A 3ZC4A 2WB1D 1XMBA 1VK8A 1HQUB 2HKEA 3T5KA 4Z7YA 2ALZA 2EG1A 3HI9A 3I82A 2ZHBA 4J9VA 2B4UA 4LVOP 3CD7A 1VRQC 1WEZA 4IFYB 1XQIA 2NYHA 4F2SA 2QN6B 4JYAJ 4KGXB 3U1NA 1F5AA 2I9SA 4ALZA 3M05A 4CM2A 4ZCMA 1VI7A 3NAIA 2B9XA 2DGOA 2GJIA 4ZN3A 2VOPA 2ZOFA 1XR6A 3M2UA 3MM7B 3KK3A 1GX6A 1TL3B 2XG8A 4I7FB 1NMEB 3IG1A 3EGNA 4DEZA 2P8IA 4LF1A 1RKJA 2BE2A 6FDRA 2XHCA 3MEGA 3K5PA 4USKA 3HK2A 1WOPA 3M32B 2HFVA 1PBUA 3LP1A 4DG1B 5B08A 1NK7A 4DCPB 1RT4A 4UY85 1AUSL 3POTB 4WE1A 3W8GA 2RQMA 5AE1A 4GVBB 2ZH8A 3SZ2A 1VQ4S 5KFGA 4F4KA 3JAMY 2KHDA 2B8PA 2HK2A 2KVQE 3I0SB 4AL7A 4X2BA 2YPYA 2VC1A 1SJFA 5K14B 2VBZA 2QLFB 3H0PA 3HD2A 1JXVA 4RW7B 5KFSA 5C7PA 1IBMF 3SCJE 4ECTA 2W2PP 5ITHA 3V6KA 1S9GB 4BLGA 3H59A 2OPQA 2WW8A 4UUXA 2GVDB 4KH1B 5D4LA 5CABA 5CH7B 1XMOJ 5ETRA 2XMTA 1WI6A 2XLJA 1RTJB 1O6XA 2EFVA 5BJRA 4B9TA 2HHXA 2VBYA 2CPEA 4JUZA 4BWMA 1HI8A 3PW7A 4XDCA 5HJXA 3OTEA 2OELA 5A8WA 4RU2A 1VQ9S 2FZKB 2L08A 5E2QA 1OY6A 4WWSA 2FDNA 3FNNA 4N8NA 3QIPB 5DQHA 3I0RA 1RE1B 3IRWP 1FKPA 4IG3B 2XI3A 3GIIA 4ED3A 3N6LA 3W2WB 1UWBA 5F9LA 2ZH3A 3K17A 2DGTA 1MMDA 3R27A 2HAIA 4LF4F 1ZS6A 3R5AA 3Q22A 2OTJS 1NHVA 2CJXB 4OYMA 3TQEA 4K7QA 2QYCA 1N32J 3EE3A 4UQTA 1S1TA 2G2OA 4B3TF 1S1UB 4CLPA 4NRTA 4DV3F 5F8GA 3KTQA 4PG8A 4MYUA 4TY8B 4X4QA 2F8MA 2LQ8A 1HNXJ 2UVUA 1TL5A 1ZPWX 4IH7A 4WP3A 2F8EX 2M52A 2ZNYA 3MR7A 3PJXA 3RG6A 3SIPB 3VGVA 4YY3J 1SL2A 4IR1A 2M8DB 4KSEB 2NCKL 2CADA 3FBFA 5C2GA 3EX7B 4F3QA 2RU3A 2XZTB 2AWZA 3V4IB 2IMWP 4DFJA 1D9FA 1IBKF 4JI8J 2DNNA 4K50A 4ECZA 2GIQA 1NPKA 4ZK7M 3NMRA 1HI1A 1FDNA 1U6FA 5CQGA 1JQGA 1WHXA 4X62J 4RNOA 2XQCA 3SBMA 1RADB 5EDWA 4HHUA 5IC6B 4PQAA 1UA0A 3A3OB 1LFPA 3CCRS 2FZGB 1PIEA 4JI8F 3HZEA 2IVFB 3A3NB 1HWKA 3HHEA 3GIRA 4AD6A 4ZN1A 3RAXA 1VQKS 2DRAA 2KM8B 4Q0BB 2CPFA 2VD3A 3MM9A 4CLTA 5C2CA 1NUEA 4KKOA 2UV8G 2JLEA 2DCLA 2LU2A 3ZFVA 4AT1B 2LFVA 3R7BB 5E33A 2OHDA 4O3OA 3UW1A 3V6JA 2AQ4A 2KT3A 4DOZA 3WBZA 4I2QA 2BM0A 3PRDA 1FXRA 1T9TA 1RHUB 5HBMA 2HYIB 4KPYA 1CEZA 4J9MA 2D3UA 1GFWB 2BV3A 2UUWA 5IC4B 1C1CA 2CPIA 1YJRA 3WX4A 3ZZRA 2Y1IA 2YKNB 4WBFA 4CLFA 2B0GA 2QL5B 1UCNA 1GXUA 1QE1B 3K8VA 5CYMB 2R2UA 2ZH9A 3CF5Q 4NLUA 2XEXA 1V5IB 3BYPA 4FS1A 3H7HB 3M8PA 4YHHJ 1UJ4A 2CXEA 2DITA 3C8YA 2VQEF 2DJWA 2HLTA 4DQRA 1XMOF 2IBOA 1HBMA 1SL0A 1TTHB 3X3UA 2EXUA 3W61A 4DL0C 1TKTA 3GFYA 3H8YA 4DF4A 2LECA 4DV4F 1T11A 4EBDA 1KFSA 2WVCA 2B3TB 2RRBA 1RP5A 2FIUA 4LRDA 4DUZJ 4DF8A 2ZC4A 3CEDA 4CM0A 1SJRA 4OYAA 2GCFA 2DT9A 4U7UK 3RRKA 2KZZA 5AJ3J 1F2HA 3NGDA 2BANB 3HHLB 4IOBA 4DUZF 4CLWA 4KO0A 5BYSA 2ABYA 1VQLS 4AQYJ 2GZOA 4C98A 3C16B 4TY8A 4UY8T 5KFZA 3OUYA 3NGUA 4MFBB 3IC1A 1GT8A 4C8NA 3TUZC 1T05B 3BGOP 1CJUA 3I6PA 2JZ5A 1DLOA 4J37A 5B7WA 2G2YA 5F3ZA 1GXLA 2HGMA 2ADBA 2KFZA 3AQOA 2ASLA 1P9QC 1XEZA 4AQYF 5F9NA 4X4VA 1DZ5A 1Y3KA 4AYBD 3IGNA 1UETA 4C0BA 3ETOA 1BE4A 3L4BC 1IWAA 3DM2B 3C14B 3UNYA 1MMLA 4PAAA 1HNXF 2L9DA 1Y5IB 2DEIA 2M88A 5LJ5Y 3PVXA 3ITHA 2YNHB 3GQCA 4Y2AA 2HRUA 2PMWA 1S0VA 3SI8A 2UVWA 1GMVA 2DR9A 1RWWB 3DGPA 1U02A 4HH1A 3KOAA 4M1KA 5LM7E 3IRXB 3L9ZA 1K9MT 3LGNA 3QRQA 1RHJB 1SIZA 4ZVEA 2B9WA 1AZSA 5FDLA 4JYAF 4Y3CA 1P6TA 3BGFA 3A8KA 3MMAB 4O44A 3B4MA 2DH7A 1WSVA 3AB2B 4WKYA 5LSLA 1S1VA 1YI2S 1HKAA 3CC7S 3WC2A 2FHJA 5A8RB 2GIRA 4OX9J 3JQKA 1CULA 3HHKA 1UFLA 1UVKA 2I0XA 5DZ7A 1LV5A 4CDIA 2D3O1 1N0UA 4HDHA 4G1PA 1OSDA 2C1EB 2W4CA 3CULA 3I9V9 5IQQA 1U2RA 1VRUA 4PXBA 4NLPA 2AGOA 3QRRA 1CJVB 1SL1A 5LSRA 3PM9A 4DSKA 3BDEA 2HAFA 1W25A 5GADU 2V63A 2VG6B 2W7PA 1PJ7A 3Q86A 3VZIA 2XGQA 4OV6A 3V4MA 4A47A 3AOAA 1X60A 1QSLA 2DGVA 4NOHA 2WVFA 4W92B 3QIDA 4MFBA 3TANA 1Y0HA 1VR6A 3KUHA 2E9TA 3D2WA 3E51A 2C2RA 3GONA 5ETNA 2XTJP 1UVNA 1HWIA 2EWHA 3F0NA 4B9LA 5AXKA 1JLFB 4Q0BA 3RYLA 4M5NA 1RAEB 3T6BA 3FEYB 5AXMA 1PG5B 5KG6A 2BMBA 3I55S 3G6ES 2CG4A 5LMUJ 1U1MA 3TW0A 4FN5A 4ZVTB 2LEBA 4IFYA 1XNRF 4KHPJ 1TMMA 4CYUA 5LJ3Y 4JI2J 1WDTA 3GR1A 4ES3A 3OFHA 2APOA 1AXQA 2NPIA 3M8SA 3TWZA 3M8YA 4G1QA 3QWPA 3TUPA 1KVJA 4DV4J 2PGCA 2Q43A 2RS8A 5KFEA 2C28A 1H74A 4LT6A 1SIWB 3C6TB 5D0GA 4RL1A 5C42A 2KDOA 4JV1A 5IT9U 3KG4A 2NLWA 1E6VB 3CWJA 3HVTB 1RT3B 3NWRA 2B4OA 3DM2A 4KB7A 2HFZA 3I5AA 3ZTQA 3W65A 1S1VB 2AJ1A 3MMAA 4IFVB 1IBLF 4NCAA 2WSFC 2GVZA 1QVFR 1FNMA 3PX4A 1N32F 2J8SA 4JI1J 4ZLPA 2ZDPA 2LA6A 2CVIA 4F4AA 5B0DA 1S6PB 2HS0A 3MEDA 2YNGB 4FKXA 1T05A 1RT1B 4E8UA 1MMNA 2QT7A 1LK5A 1WACA 1I3OB 4ECUA 1HNWJ 3MECB 1G1XA 1AFIA 1U24A 3NMAA 2LYVA 1R27B 2YNHA 4AFFA 3R7SB 2B7BB 3LF0A 3MMBB 4P52A 5IOLA 1CSJA 2GGPB 1NZ8A 3DYAA 5B0BA 4KTQA 1I1GA 4RW4B 1HPZB 1L5UA 1S6QB 1RT2B 1JLBB 2QZ8A 3DOLB 3FJ2A 3GWCA 3SSQA 3J7YU 2GC8A 4DR7J 2BKNA 4GRSA 3W9HA 1Z4UA 1R7IA 3RB6A 3ZTSA 3H5SA 3RZAA 2RAQA 1WEXA 3BGUA 5L9XA 2XMUA 1KN6A 4C0HA 1IM4A 1UVIA 1EKSA 2DR6A 3JB9k 4AL6A 3PV8A 2B9YA 1TL7B 3DN9A 1YIJS 2AYGA 1Q0NA 1UVMA 3UWTA 4YOEA 1GNKA 3CT9A 4KGMA 2GNKA 2CQ3A 2C2MB 2DIUA 2FB0A 2RSQA 3MAHA 3QGPA 3QLHA 1J5OA 2I8EA 1YLXA 2DGWA 2Y1RI 4I6AA 4RUAA 5G0RB 4OZ1A 3VTIA 1HYSB 4AE5A 1EKRA 3F44A 3N9UC 4N7TA 2QLBB 4FXVA 1X7VA 4K5RA 2EG2A 1PAEX 3AJ1A 3UDLA 1VC0A 2G2ZA 5F8HA 4USMA 2DGQA 4M5JA 5E0OA 1Y5NB 2IA0A 3M8ZA 4WTOB 1TQLA 1WUUA 2GHVC 1R8AA 4L3KA 3D0IE 2HIQA 4LSLA 1RTHB 3D66A 5KG3A 3PZPA 1FK9B 3DRPA 3D3BJ 4MH8A 1S5ZA 3HT0A 3CC2S 2MLYA 4J9LA 4I67A 1DBDA 1S1TB 4WTYA 1X4GA 3M1VB 2H54B 4RW9B 5SUHA 4P73A 4ZPDA 3CE8A 2N3LA 4FYXB 2XC9A 1ZH5A 1JLQA 3TUIC 2CJYB 4ECXA 3PW4A 2EPIA 4EYHB 3R3TA 3JS9A 3MGJA 4G6VB 4URQU 2JH3A 4WIQA 3FCWA 4DR4J 5K8NA 1RWMB 2A2CA 2VQEJ 3MCSA 3THVA 1S0MA 2H48B 2WB4A 1NK9A 1WEYA 2HGNA 2NUUG 2YPZA 3BN7A 3LP2A 4DCOB 3CMES 1NH8A 3HDSA 3I31A 3PACA 5L1KA 3CDWA 4GKJJ 1S4FA 2WVDA 3HFKA 4ID5A 1G6BA 2C3PA 3TJAA 4OJGA 3TNVA 4TU8A 1EETB 3TJ8A 3M9NB 4I2PB 4DSFA 2VV5A 4K4UA 3W2VB 2PEHA 4Y2MA 3EM1A 2Y3YA 2ASJA 2IAJB 3DHXA 1BWVA 2AJ4A 2QL9B 3FC9A 2PC6A 3JSYA 4MIAA 5D77A 2ZBQA 4IQMA 5G0RA 2B9EA 3JSMB 2GW8A 4OZJA 2R7SA 3HHNB 5J1EB 4WFAQ 1TK0A 3IWNC 2ZVSA 5D4NA 5IXUA 5K9FA 1ULRA 3FRYA 2HSEB 3FFIA 4DV3J 1NXIA 3S8SA 2MXYA 2PI5A 3P6YC 1R6YA 2ZHAA 3RRHA 1FXLA 2HHQA 2MYFA 4PG4A 3T9NA 4KQZA 1Q86T 1M1HA 2MB0B 1RU2A 3W5ZA 3CCWA 2N7YA 4WE1B 4ZA1A 5ETLA 2QSFA 4URGA 4QPTA 2Q6CA 4PPZA 5LMNF 2DR7A 4OI3A 5GMEA 3KYLA 5H9EJ 5DQGA 4K4SA 2A10A 2V2KA 5EX3A 3VAIA 1OQ3A 1HNZJ 2CQPA 1IM6A 1RT2A 4IH5A 3ZTRA 1HBOA 1S79A 2GQQA 4ZPCA 1FD2A 3R9LA 2HFOA 3G86A 5EWFA 3GJRB 4IOAQ 2LXFA 1VS3A 3MTKA 4DV1F 1IKWB 4OZ3A 4HKQA 2HQ3A 5F8NA 5F8LA 4P7VA 2FJWA 2CAJA 3ICLA 1KONA 4PWUA 1PJ5A 5EN1A 4K4XA 5H9EK 2FLNA 2N4CA 3LAMA 1D8ZA 4IFVA 5IWAJ 1YJ7A 4ZJOA 4B08A 4J9QA 1B7YB 4NLRA 1U0HA 3NKYA 5BXIA 2OEJA 1V9OA 2VKZG 2DR5A 2B7CB 1URNA 1UVJA 1RWUA 3P5BP 2IVMA 2DHHA 1ZM4A 4O0IA 3QNWB 4ZVGA 3DLKA 2RNEA 5D4PA 2DO0A 5J2PB 4DV2J 1TK5A 2DCUB 3KLVA 2AJ0A 3U02A 2V9WA 1KNZA 3QJLA 1B64A 3RGIA 5ETOA 4M5DA 1KS2A 1U1KA 4U8VA 3PX0A 4J90A 4YFUA 1YDLA 3HMJG 3OVAA 2QA4S 1NSKL 1I94J 1RT4B 2GA7A 2P2CB 5C5JA 3MD3A 5AXLA 1TFYA 4RU9A 2VUGA 4HR2A 5D8HB 2MTLA 2YXLA 2I5JB 4QBUA 1FDBA 2E1AA 3GCXP 1W2BR 4IR9A 1UP1A 4DHVA 2C22A 1TP7A 3V6DB 2GHWA 4PYAA 2BJ3A 4ILLA 4WCEQ 2KM8C 1BQXA 4QW9A 1N33F 3BJYA 1OYDA 5A76A 3C19A 4F3OA 2RDJA 3GJQB 2XZDB 5D0RA 2HZVA 3L7OA 4LBIA 4F2RA 4FYDA 1NZAA 3MEEA 3U7JA 4X65F 1LWCB 1M5PC 5KG7A 3ZZ0A 3DU5A 1N5YA 3CNQP 3BB5A 3GYNA 5AJ3F 4OI0A 2Q6BA 4Q45A 2FZCB 1CJVA 2LEPA 1YX2A 3ONQA 4O3NA 3H20A 3HM9A 3K5LA 4DQIA 3KK1A 2R4FA 1YJVA 2H5JB 3BN4A 4QR0A 5E3CA 5KFBA 4XIUA 1CULB 3ENAA 1DTTA 3MD1A 4U96A 1B0PA 1FKPB 4X4SA 1VISA 2C3OA 5IT0A 2MQLA 4OZ2A 1UAWA 3UD4P 3BH7B 3MR6A 2H65B 2FHOB 2ADCA 2F8HA 2V8GA 1GEHA 1LW2A 3KLGA 1K73T 2BYCA 2KB2A 2OD6A 3UI3A 1FHTA 4B3SJ 1RBLA 4ECYA 5HANA 2LU1A 4ZVRB 4U6PA 5L8RC 3TQ1A 1LWXA 1M5KC 2Z2MA 1UKUA 4J91A 3MFHA 3K57A 1QSYA 4ZVHA 1S7IA 3OTOJ 5HK4A 2HVZA 4I56A 1NH7A 2M4MA 1FRIA 2G9OA 3PJ9A 1U2FA 4ZOSA 2CJQA 3KDNA 2CNNB 4I68A 1BQMA 4F3MA 1GXTA 1RLDA 2FQQB 3H4BA 2KTQA 3ZZYA 1KQGB 2EK6A 2XMWA 4PXEA 5A0YA 4DV7F 3QJJA 3Q8RB 1WWHA 2YKNA 3MM5A 5MAOA 1FE4A 4B3OA 3NBPA 1KHWA 4O0NA 5HVHA 5GAHU 3TI0A 2XMAA 4NXNJ 4KGKA 3IN5A 5D78A 3T1YF 3I87A 1ELOA 3IS9B 2W9BA 2GAHC 1R0CB 2F1FA 2H5EA 1G3OA 1FRJA 1RAHB 3CW2C 2UVRA 1CS4A 2C2ZB 3MPYA 3N6MA 4XO0A 5KFYA 2Z57B 3KNAA 3Q89A 4KV8A 4DR6F 2LDIA 2W24A 1WF0A 2YKMB 4KO0B 4CH7A 3MCOA 1OS5A 5J2MB 1NO8A 1O5JA 4FXWA 1RTDB 4LF5F 1HYSA 4IG0B 2Z30B 4NA3A 1VQOS 4NZ6A 1RHMB 1S9FA 3DI6B 3DLGB 3G82B 4ZLLA 1OMSA 1NPRA 2F9JA 2FHKA 1N88A 1AROP 2U1AA 3HO1A 2NXJA 2YX7A 4Y2CA 4NLOA 3UD5A 2CA9A 2ZOGA 5I3QA 2EBEA 4OX8A 3UCGA 4DV0J 1IKYB 3Q8UA 4K2XA 3OHBA 3CJ2A 1K0VA 5L1LA 1N4LA 3QZ8A 1FKAF 2GMLA 2KL8A 2HWHA 3M8PB 4F50A 4ATNA 3IAS9 1C1CB 3DDIA 1DHMA 4URSA 1U47A 1GQEA 1Q81T 2GS8A 2HHHJ 4FNIA 4ECWA 3MMCA 3W60A 4MK8A 1X5TA 4DMZA 5F3TA 3W64A 2V2QA 2Q3PA 2X1GA 1XJWB 2C2EA 1RQ0A 5KG0A 3CCUS 3FQLA 4CNZA 1RBAA 1N0VC 3EICA 4LF9F 2ROPA 2KT5A 2ZJRQ 4ICLB 5KFNA 3NBPB 1OWXA 2ZM6J 3VV2B 2ZKUA 3GMGA 2KU7A 4KPCA 4PR6A 1PC4A 1JKHA 3I5CA 4KR0B 4QIEA 2OTLS 2FVPA 1O51A 1MWQA 4ZPBA 4O3SA 2DNQA 3QT7A 4HHJA 1EAYC 4PG6A 3SCIE 1LFWA 1Y9OA 4F7VA 1AUDA 3QT8A 4JI1F 2UXDF 2RUSA 2WOMA 2CQDA 4KGZB 5KFJA 4WFNQ 4C8ZA 4OHWA 1RBOB 3SQGB 1DTQA 1HHQA 1Y4ZB 3PDNA 4LF6F 4G3IA 5LOQA 1FT8A 3CXCR 2Y9HA 3CJKB 3C6UB 3OHAA 5KFDA 2H51B 3H90A 4DSJA 2J7WA 5L9NA 1EB0A 3KLFA 5E5NA 4M94A 3FVYA 2RJZA 2NXEA 3FCHA 4Q5VA 1ZPVA 1UMJA 2CQHA 3CJRA 3RJMB 3MUVP 1VBYA 2QSWA 2LQJA 4OI6A 4DL4A 4UQGA 2E9RX 4P2SA 2YKMA 1YJ9S 3H5XA 2JL9A 2OKQA 1LW0B 2PFDA 1T3OA 4F36A 5KAKA 3OXGA 3LAKA 3NS6A 4BDPA 3GTYX 3DRYA 3A8EA 1N6QB 4Q8EA 2ZZNA 1Y3JA 1KOHA 4FDFA 1H2VZ 2BACA 3J7YI 1D9DA 2J9DE 2CNOB 4UOHA 1HBUA 2MDAA 3OXLA 4KHMA 3O3LA 3UDVA 1L3SA 2DRDA 4GVBA 4ELTA 3TRGA 1FKOA 2BX6A 2MKHA 4X64J 5DG7A 4FPRA 3H40A 3QAUA 1FJGF 1OPIA 2VODA 1A7GE 3V6DA 4TY9A 3SYZA 5LXYA 3C6TA 3RB0A 3PHTA 3N5BA 5A8RA 3OL8A 4F4XA 2A0FB 2AGPA 2E1PA 1EQMA 2FLOA 4A48A 1JJHA 3I0RB 2AZ3A 2QLWA 2IIHA 3FBEA 2G13A 3P5TL 4O4GA 4TXSA 3R6LB 3W1YC 2XM3A 1Q7YT 1HARA 2AJQA 3H5UA 1R31A 1YSJA 4HH0A 1RDRA 1K8AT 4D3GA 1W7WA 4ED0A 1NK4A 2AJFE 1I94F 4ZPVR 1IVZA 2FGCA 2QMUB 1IKXA 3Q8YA 4XPEA 3OSNA 1EX8A 2HGLA 1S97A 1V3ZA 5CCMA 1KLNA 2XWYA 3QATA 2Q1LA 1RTIB 4TKTA 3QQCD 1SJQA 4CWBA 2DGSA 4ITSA 4CO0A 4Z7CA 3MAQA 3H42A 2W7AA 1XC9A 1TKXA 4QU7A 3JQMA 2CQIA 2VDIA 2VPWB 1MLAA 4LSNB 1SKRA 1RHQB 2KG1A 2NQPA 5HQ8A 2ZWOA 2EI5A 1HL6A 2V9KA 4CLZA 4IYQA 4DL5A 1M5VC 3W9IA 2VG7A 4LF2A 1Q95G 5KOXA 1UFWA 4CQ1A 5DRKA 1F3FA 4B9MA 3D5MA 5L38A 3CCZA 5KFKA 2DBBA 1Q82T 1T0TV 1C4AA 2EFPA 1ZM9A 2XSJA 3Q8SB 1CJTA 4C11B 7FDRA 2XO6A 1LWFB 4MKAA 3BO3A 4I7FA 2RH3A 4DR3F 2AD9A 1TU0B 1WC4A 2AEFA 1WKLA 3N01A 4R8UB 5KT7A 4R0JA 3MCNA 4USVA 5JVGQ 3W9JA 1D9AA 3DNCA 3R7NB 4DU7A 1UJ5A 2FHJD 5J1PA 2HVHA 5ADZA 2XS2A 1CQNA 4FYWB 2LCWA 1LXJA 2N4DA 4NLDA 5KFFA 4B9UA 4DR2J 1U49A 5CD4H 1RYSA 2MZTA 1C1BA 2AGQA 1DTQB 1YQHA 4OJ1A 5HP1A 1S1WA 3OFFA 3QSIA 3B78A 2YNIB 4KC5A 1I6JA 2HHWA 1VQMS 3CJ3A 4X4RA 2R2RA 1QE1A 1TV6A 3CO9A 1U26A 5CYMA 2ZH1A 5BR8F 4DPTA 4ENOA 2J8AA 1U8WA 3KG0A 1KWMA 2VZ9A 1D09B 1M1GA 1QJHA 1WKKA 2JC0A 1X4AA 2AMCB 1FRKA 2BKOA 1RZMA 1HBUB 2GQ2A 2MGZA 3SSSA 2JDJA 2ZJPQ 1EETA 1QSSA 2V8PA 1L3VA 1VCTA 5C25A 2R2TA 3LWMA 2AW0A 1UW9A 1H3DA 3KFWX 4OV1A 3KLHB 1T02A 4DL2A 3W63A 1YRUA 4NI2B 2BUNA 4Y6IA 2F63A 4WYWA 4YB7A 1X4CA 2KVIA 4X64F 5DGBA 4KJIA 4PUOA 2YH1A 2EC0A 1FJGJ 3BSCA 1UW4A 1GK8A 3CD0A 4ZIWA 2CDQA 1WC3A 1NB7A 1BWEA 5E3AA 2RUGA 1X4HA 3F41A 4NLVA 4DR4F 4WXOA 1QY7A 3Q8VA 3R8YA 1FA0A 3BS9A 1F9HA 1FTRA 1DLOB 1TKZB 2V50A 2M2BA 3BR9A 4ES1A 2IDEA 1UPMB 1RTHA 5EUHA 9RUBA 1FEHA 3FFIB 4NA1A 3C16A 3TP2A 2J9DA 1XMQJ 5J1EA 3RTVA 1IJFB 2H3EB 3RR7A 5J2NB 3H25A 1CLFA 2CPDA 1APSA 2XLIA 4IOCQ 4HVZA 4DR5F 2OH2A 3EJMA 2RF2A 4CTAB 3J7ZT 4K4ZA 1FDAA 3HF5A 2HHHF 2XSJB 3K89A 4DV5J 4OLPA 3F56A 4CO5A 2BQUA 2CQGA 4FP9A 1RYRA 2DKOB 3IFEA 4K0KJ 4DV6F 3AXMA 1F60B 4NYPA 3LTOA 3IS9A 2NZCA 5CD4A 2W9BB 1ZBTA 2IYGA 5C25B 1KKHA 2D9PA 5KFPA 1YJNS 4GKKJ 1N52B 4JV5J 1FRHA 3L09A 4EI2A 2D69A 1RCXB 3L7UA 2FJVA 2CNKB 2EKNA 2E5GA 1VYAA 4KFBB 4JI5F 4XAKA 3O44A 2JFKA 1UWBB 4Q2MA 4ZLJA 4RJVA 5C24A 5EWEA 4MKVA 2K1RA 2YNIA 3UNGC 1M1KT 5CA5A 4GKKF 2XYPB 4NZ7A 4OHVA 4QU6A 2RHSB 4W90B 4MT1A 3RUBL 1T95A 3CJTA 4H54A 2ZJQQ 3ZZPA 2CRLA 1QVGR 2RIJA 2V2VA 2K8GA 4TYBA 4JI5J 1WHYA 2O3DA 1G4CA 4NWBA 4O3PA 5HMWA 5HMZA 3OR2B 1S6PA 4ZPTR 3RAMA 5KFXA 1H2TZ 4I64A 1FVSA 5D0HA 3SV3A 5HMXA 3RAQA 4B3MJ 3AHPA 2BW2A 3VGUA 4B3TJ 4DSEA 3ZNUA 4LREA 5T7LB 4DV7J 2QLJB 1NKBA 5DDOC 1KQKA 2EVZA 2ZITA 1LNQA 2RF2B 3W7BA 2C2DA 2Y8WA 2GVDA 2DXFA 1HFEL 4CH1A 3R97A 3WQPA 3MFIA 3HVRA 2BXJA 1T7PA 1C0TA 4B17A 1XBWA 1LWCA 4G1QB 1WTBA 2DB1A 4EGLA 2HURA 2BJ9A 3QYYA 1NK8A 1IBKJ 1MWZA 2RU9A 1G7CB 5GAHI 1NPPA 4Y00A 3QMQA 4X62F 4LMZA 4I6YA 2P9EA 2DXDA 3PTWA 5KFIA 5IZHA 4PWDA 1FFSB 2N3OA 1SKSA 3Q83A 4C11A 3BO4A 2D9OA 1ROFA 1RTIA 1FWLA 5AXNA 4A8MP 4CCHA 3T3FA 3WIUA 1SQFA 3HLUA 1VHIA 4RR5A 4QWEA 2O66A 3KJVA 5IS2A 2KYZA 1XTZA 1CQMA 3AOCA 3NOCA 4JI0F 2CPYA 1K1SA 3GV8B 2YQ3A 2DY9A 2H5IB 2J0SD 1UPPA 1S48A 4N8OA 1LW2B 2XYGB 2E29A 3B6BA 5H9FK 3FMWA 4MTPA 1U0SA 4PWWA 5DDPC 1J5EJ 2CG8A 2JHEA 4DDFA 2RT3A 2BRKA 2FLPA 3DLEA 3QO9B 2HRTA 4OI2A 1IBMJ 1CJKA 1SJ4P 2R8HA 1BQNA 1XIQA 2XBPA 1H7XA 1RTZA 3IXQA 5F8IA 1HNIA 1DURA 3LW5C 3MOJB 1Y10A 3FSYA 3CUNA 4HL9A 2HVIA 1F9EB 1RWOB 1Q53A 2I6WA 2EFGA 4B3RF 3ZZTA 4CO1A 1S10A 2QFJA 2VFRA 3J7Z5 3GJTB 3ZTOA 4HYKA 2PO4A 1HNZF 4AXIA 1QD1A 2AHOB 3DHWC 4ZP9A 3WZ0A 5DGAA 2BEFA 1U1OA 4A8YA 1PBAA 4H4KC 3T5JA 3NNHA 3V5RA 3VVUA 1Q8KA 1RTJA 3QFHA 2OPSA 3MEGB 3VAJA 1RT7B 1VJWA 4L74A 2OI2A 4FKYA 4A8SA 2NS1B 1SKWA 1TL3A 2OJ3A 2MSSA 2ACYA 1DQ9A 3AY0A 2BANA 3R5CA 2HBQB 5GAEI 2R8GA 4YEAA 4B02A 3VALA 4PWDB 4DFPA 3QWUA 5J1NA 1VRTB 4QW8A 3B82A 3MR3A 4LVNP 2AIRB 4DQPA 3D54A 2UZAA 2C2KB 3OR1B 5I3UB 4YR3A 1REGX 2KXFA 2HBZB 2UV8A 3M2RA 5FD1A 5SZTA 2LXUA 4F4WA 4DL3A 4FBTA 1OYEA 3DFEA 2G1DA 4MIBA 1EIYB 1IXKA 3NNCA 4LBHA 4OJ3A 4WJBA 2JOQA 1S49A 1C0TB 1Q1KA 3DGVA 1N54B 3DLGA 4H4MA 4NL5A 3EVMA 1EZZB 2J0XA 4OYBA 3MI7X 2CJBA 2OLWA 4P2FA 1RWNB 3MPWA 1JXEA 2AJ2A 1S6OA 1IKXB 5EWGA 2D3OR 4TLQA 5K8PA 1VBKA 4L3NA 4YB6A 5AE2A 3U1MA 1WKJA 2DIVA 4J9RA 3HHLD 4FYVB 4J9OA 1WC6A 4DU8A 5IM0B 4A8KA 1NK5A 1SKUB 4P9SA 3ZTPA 4NLGA 4IH6A 3GJSB 5KG2A 1TKDA 3IRXA 1FD8A 1SB6A 2W2QP 3D1OA 4M5MA 3I4HX 5D15A 1HQEA 2D74B 3NS7B 3IR7B 1M5OC 3PO5A 4DCJB 1R8HA 3DMJB 1MROB 2IPOB 3VZHA 4FF4A 2DH9A 2MZRA 3IGVA 3MWBA 1YVFA 2LMIA 2QA1A 5A2QU 4FVMA 1XNQF 5HN0A 3NP5A 4OYPA 3A13A 2OSQA 3UE2A 2CZVC 4DS5A 3OL7A 3NGKA 3FMBA 4DI6A 3BV8A 3S6EA 5LXRA 3T6JA 2V4QA 4ELUA 3HSJA 1LEOA 1NEEA 3D9BA 2OMLA 3DLHA 4J5OA 4QOTA 1YJTA 1S6UA 4TVAB 2XY6A 2CQCA 3MMCB 4RW6B 5F8MA 5IV4A 5IT4A 1J5EF 1RAGB 3EWGA 4ED8A 2IHR1 3K5MA 2JNJA 4KRWA 5F8JA 2BJ1A 2QE5A 4WFYA 1JLCA 3GPAA 2E5JA 2RRNA 3OL6A 4H4MB 4QIVA 5J2NA 1IQZA 2A1BA 2NUHA 3FK4A 4UTGA 4OHYA 3A4TA 2VPXB 2YWFA 2ZBIA 2WONA 4J7CA 4NEZA 4DN0A 1KC8T 2HBYB 4F67A 1SV5A 2B4PA 5HROB 4EMDA 1KEKA 5CZXA 3VAMA 5LMUF 1U1PA 2W2OP 1S0OA 2NZ4A 4BWJA 4YR0A 3M9OB 4LFAF 3FKBA 3JXOA 1BY9A 3LUYA 2JLGA 4O3QA 5KFUA 4F0MA 2XS5A 4RUBA 1XK8A 3G87A 4PUOB 2XNRA 3UN2A 2CQBA 4RW4A 4WK3A 2V5HG 4KY3A 2HNDA 3NNAA 1JLBA 3TEHB 4I0WA 2J6SA 1GX5A 4LFBF 1N5QA 2A18A 3RBXA 1BUXA 2VL1A 1KP6A 2RKIB 2BJ8A 3IWXA 4OX6A 1KLMB 1RT1A 3WC0A 3NG8A 2YNGA 2IJNA 4C3KA 5B0CA 1HA1A 2Z56B 3PJWA 1SXLA 1ICEB 3V2UC 4A46A 2VU5A 5A2QY 3OJSA 2IMOA 1IBLJ 2VFSA 5AT1B 4V19J 1UEKA 1PYSB 3PNIA 2ILZA 3NLCA 5IM0A 4LQ9A 1N48A 4QYZK 2OEKA 4RNFA 2PI4A 4BC7A 1JLEB 2XZWA 3FSIA 1ZM3A 4DR1J 3BPDA 4PG7A 4DPWA 5M2UA 3G8SA 3DRRA 1IJEB 2DHXA 4CRJA 5B09A 1V3SA 2JVRA 2WVEA 1PILA 4C8KA 1GH8A 2V0NA 4LR8A 2EFOA 1FRLA 3NGSA 2D1CA 4IRDA 1UJ6A 4LUBA 1XNRJ 4QWAA 3KHGA 1EARA 4B9NA 1RSCA 2IC3B 5KFOA 3DKDA 2AX0A 3MEEB 4H4OB 4CNYA 1ZOTA 2BE9B 4E2FB 1JK9B 2XMJA 2ZFHA 2OD4A 3KDOA 2G0JA 1HD0A 4WU2A 4NLSA 2XHWA 3EDRB 3ILOA 4FF2A 4RW8A 2BW7A 4WP9A 4DPYA 5HO4A 2YWWA 1FX4A 2HNZA 2WSCC 4N56A 1D0EA 1L3UA 3AA9A 5F0UA 1JMTA 4EO8A 2JEGA 2VF3A 2WRMA 7FD1A 5J2MA 3PY8A 2IM3A 5KFLA 2CJAA 2H4YB 5K8OA 4NYZA 2EFQA 1R3NA 1HQ2A 2HVEA 2QV6A 3DRXA 3MM7A 2PEBA 4ZP6A 1VK3A 5E7OB 5THWA 2UU9J 5ETMA 4DUYF 2PFFB 3OTCA 2HWTA 2MKIA 4JI0J 2YWEA 2Z58B 3AFGA 1AT1B 3G96A 2VG6A 4ZVPB 3TEGA 3Q23A 1Z2LA 4WF9Q 2UXBJ 1PSDA 3SFGA 1X4EA 5H1SV 4X4NA 3BKFA 2V2ZA 3O1LA 4CLLA 2HZAA 3P8BB 3ET6A 1VBZA 2VBWA 3GG0A 2FJEB 4USUA 3WIVA 4USHA 2DNMA 2OGUA 3EDQB 1WHWA 2CJ9A 3FBCA 1AFJA 2DEJA 2F65A 1DQAA 1NLKL 3PRBA 2ROEA 3IA0A 2LA4A 3T1AA 1PGZA 2R7OA 3CIMA 2N7CA 4PG5A 1DQ8A 4IQXA 1VGYA 2CQ0A 2HQIA 3C15B 3NRBA 4HTJA 3O6QA 3MURP 4LF7J 2DYAA 5U47A 1AZSB 1UL3A 4HI2A 1B4SA 4ID5B 4ZDNA 3KJFB 5DG9A 3LGHA 2ILYA 2ATCB 3AB4B 3LP2B 2HHSA 3M2VA 3NCQA 4IDKB 2FVRA 3D7SB 4NRUA 3BKUA 4NMLA 4PKDB 3QGGA 1R8BA 2HK3A 3O5TB 4LBPA 3VQTA 1M0SA 1K1QA 1ZA1B 4RNMA 1VFJA 4ZJQA 1Y00A 2JFDA 1S7HA 1UTAA 2HBRB 2YX1A 2ZD1A 3M6UA 2LVWA 3F73A 4HI1A 2V69A 2X51A 1ZTWA 4Y2KA 3G4SS 1A9NB 5DS7A 4J9UE 2HHVA 1S12A 1WDDA 3FCVA 2MJUA 3EZ5A 4M5KA 1HWJA 1RGVA 3GFZA 4NZ0A 1FE0A 3PRVA 3RBDA 3UVJA 2R8IA 1VRUB 5CXTA 4PYDA 3ZZUA 1W2IA 3BM7A 2UUAJ 4RPFA 3CVKA 3Q2SC 2WONB 3GIKA 4J9PA 3K5NA 2AYMA 1HMVB 2CIMA 3PYGA 1TAQA 2ERRA 4EYIB 5LMNJ 1IWGA 2MKJA 1HBOB 1ZZFA 1VDHA 3JAMU 1H0HB 2CVEA 5LSOA 1FNXH 1EJ7L 1YHQS 2JX2A 5HLFA 4C8LA 2ZBRA 2DNOA 4OZ0A 4K5SA 3KLFB 2DNKA 2MMYA 2HLUA 3AJDA 1RHKB 1KR4A 3MHYA 4WPAA 4F04B 1VQPS 4LQ3A 2MQQA 2FY8A 4RBUA 1KDNA 4NE9C 1WC0A 4OL8A 2GO8A 1SJ1A 3SFUA 4ZMMA 3D0GE 4EZ6A 5J2PA 3HHDA 4Q44A 4P2XA 4NPOA 2K1RB 1NNDA 2J76E 1Q5YA 4I69A 1VIXA 2DHAA 4OIXA 4DS4A 1KHVA 2MHNA 2PD1A 2PDAA 2L9NA 1U0HB 1NCLA 3AXKA 4L6V3 4NI2A 4U67Q 1NKCA 2GMHA 4C4WA 3CJ0A 3HULA 2PMZD 1A0OB 1Q8LA 3RBZA 1U6ZA 2KXNB 2KI2A 3KUGA 3D1QA 1HLWA 1KFDA 1REVB 1FF2A 2MLXA 4Y34A 1T8EA 4PRFA 1IQTA 2I1RA 1WD6A 1RKIA 1FRMA 3OPKA 3QGIA 1RCOB 3BKTA 5I42B 4DUYJ 4WFZA 1N8RT 1HR0F 2CQ2A 1S59A 3OUYB 2XO7A 2LP4A 2BABA 1UFKA 2R7RA 2FLLA 1KQFB 2HIYA 3HHLA 1SC1B 2MKKA 5L39A 2GMJA 2C3YA 2NXCA 4FZVA 4ZCLA 3L7PA 5LL6d 1RWXB 1B3TA 4NA2A 5KFWA 3NCPA 1X9WA 5KT2A 3O8WA 5CZVA 1LWEB 2I38A 3OV7A 2MZ1A 2QC3A 2DR8A 3DRSA 4EK2A 3H2UB 2H9ZA 1OY8A 2A6MA 3A8JA 2AV5A 3HT3A 2ATLA 5HMYA 3M6VA 3FEZA 1JNRB 4F02A 2NSBA 3VAKA 2QJ3A 3M30B 2QEXS 2WCXA 4LFAJ 1RXOB 1DJ0A 4DN9A 3OVSA 1FCAA 5H9FJ 3KK2B 1RAOA 1QM9A 1C4CA 1NU4A 2B6AA 2K3IA 2MQNA 3IBWA 4RWWA 4Z37A 3J81j 4WFBQ 3BSNA 4ECQA 5ETPA 3D67A 2BJDA 5KT3A 4LF9J 5M2PA 1HMVA 2EBGA 2MZJA 4FVCA 5L1JA 3W2VA 1R43A 3ZXWA 3VAGA 1CS4B 3QLHB 1NM2A 3MECA 4MKBA 4CO2A 2YKOA 1NJIT 2VG7B 5ETTA 1X5SA 4ZVFA 3IM9A 2GO9A 3H4DA 3UD3P 2MZSA 3MEDB 3HD1A 3UFCX 4N47A 2NPFA 4Y28C 3PFOA 1FERA 3ZZOA 4F25A 5A6PA 2VH7A 2F4VF 3HFVA 1C0UB 2HG4A 3TA0A 3E01A 4ECSA 1E6YB 1FFWB 2DNLA 4CO4A 4U95A 4CLUA 4H4KA 5HSPA 1HD1A 1T94A 4MYTA 3TZXA 4B3OB 4MK9A 3QRPA 3EGWB 4DR1F 1EP4A 4QZVB 1NRKA 2XY7A 1HPZA 4DBQA 2HQCA 1C2PA 4LRCA 2DISA 3T5LA 2HMIB 3IBCB 2ZEJA 5KOWA 1WSRA 2OFHX 2K3KA 2ZBCA 3EVWA 3G6VA 2VASA 3SMZA 2QA2A 4C97A 5KFCA 2MQOA 3QO9A 3W3SA 3AT1B 3QSYB 4KHRA 4LIWA 1X8DA 4DV1J 3MCMA 1GMWA 3SQOP 2L48A 2IRYA 5A8WB 1RA6A 3TX8A 4ZVUB 1H7WA 4NLQA 3LWLA 4DZ6A 1SH3A 1MSWD 2CZ9A 1N5SA 4ES2A 5CCLA 5IWAF 2XB2D 2EC2A 2W4DA 3T1YJ 1L3KA 1DRZA 3GP9A 1U2CA 1FDDA 2F4FA 1WF1A 3FQKA 3GIMA 3IBFB 4BBYA 3HSDA 4BHQA 5D3GB 2KJVA 6FD1A 2NXUA 2A6OA 1VQ7S 1NAQA 1UVLA 2UUCF 1WORA 1FESA 1S1WB 1VIOA 3GYGA 3NS5A 3OD2A 2KH9A 2RQ4A 3LPEA 4LR9A 2MQPA 4LF5J 1U09A 3I0SA 4YDDB 1S1UA 3DXSX 4HEA9 5K14A 3BSOA 2VBXA 3OTBA 2MHEA 2AF6A 2XI2A 3POTA 2UUBF 1QAYA 2FYXA 1I5OB 2DK2A 2YY3A 3AD7C 2ZNZA 2Y1JA 4USIA 3CDAA 2SXLA 4HTIA 1JJCB 4OLOA 2F9DA 3E3XA 1B0TA 1BMQB 2CPXA 2FD2A 2XMKA 1D1UA 4BCAA 3G6YA 2OO4A 4OYWA 3TAMB 1KTVA 4ZS6A 1RU1A 1WC5A 3I5BA 4DX8H 3NCRA 5DETA 4PCQA 2IY5B 1RT7A 1KRPA 1L3TA 1W26A 3IR5B 4QQBA 4GKJF 4ZHRA 1OSCA 4WFXA 1YRXA 1FWKA 1NDCA 3NXZA 4GMKA 3R1HA 5JUMA 3D6HB 1D8YA 2IC3A 3HCXA 2FUG9 2LQBA 3BO2A 2DNPA 2IJRA 1O0PA 3N28A 4H4OA 2Y0BB 1IR0A 4WXWA 2EW9A 1HW9A 2CPHA 2G1HA 2WW4A 5CHCB 2XS7A 3V81B 3R2DJ 3G71S 4J9SA 4DL7A 3LP0A 2KYXA 3GIJA 2LQ9A 3CDUA 2BA9A 1H2UX 3QBCA 4C3LA 4ZVSB 4YS2A 3A8IA 3C3LA 1NB2A 1AYEA 4ECVA 4LF4J 4ZPWR 2GAGC 4ZP8A 3HXMA 4DXLA 4OZ5A 1OPZA 3KLIA 3PFEA 2P6SA 1G2EA 3E01B 1R0AB 2UXDJ 1ACMB 1RAIB 1SI9A 2PIIA 3CCSS 2RB7A 2W2MP 3TVKA 3EMTA 5A8KB 1FFGB 2G0CA 2X3DA 3ELHA 2N82B 5DG8A 2V4RA 2J0QD 1FJCA 2F4VJ 1CVJA 1PAUB 2IRUA 1S4EA 2UUTA 3C66A 1JLFA 3PYDA 3PIOQ 3KHLA 4QYRA 2VA2A 4GC6A 3Q24A 2BOPA 3OTOF 4NEYA 4C6AA 4M5GA 3RB3A 2P5VA 3WHIA 4C8YA 5E3PA 2W2NP 4CTAA 3EYZA 3R1LA 3SDEA 2CUYA 3PW2A 1S9EB 4LFCJ 4UOCA 3EPIA 2NREA 1TMJA 5F41A 3G2XA 4RBTA 3R2CJ 6AT1B 3C46A 2D7SA 2V34A 2BBEA 2M8HA 5GVQA 2E44A 2XYHB 2FHMA 2HWIA 2XMVA 2HHPA 1FX2A 1TKTB 2HQDA 3EUNA 5T14A 1R89A 4DR7F 3NEKA 2WOMB 2M7SA 3ISZA 5KFTA 1RWPB 5KT5A 5J2QB 3TAPA 1U48A 1KD1T 5I42A 1TUWA 1KVIA 2OPRA 2VFUA 1GAOA 1RLCL 4KE5A 3VQSA 1RI7A 4JB8B 4ANCA 3CJ4A 3VAFA 4CP5A 4U9RA 4LRBA 4ZITA 4ID8A 4M5HA 3E8OA 4KV8B 1VQNS 2YBVA 3WDOA 5FDLB 4F0KA 4DX6A 2OAUA 5K20B 1KSPA 4C8OA 2UXBF 2ZUGA 2OP5A 2HNYB 3PYFA 4I2PA 4KYZA 1OJ4A 3M30A 5ETSA 2Z2LA 5IFMA 3OR2A 3K59A 1U45A 3AAWB 4AL5A 1UZHA 3BBCA 4MJKA 3L3CA 2QTWA 1VOMA 4PXCA 1R0BG 4JP8A 3HPOA 4JBCA 1XR7A 2IDLA 2K7KA 3KHRA 2AKWB 2QMWA 5HATA 1QUVA 1JLQB 3CO0P 3MTJA 4X4PA 2BR0A 1AB8A 2XNQA 2XULA 3NY0A 3TA2A 2UXCJ 5KT4A 4X4UA 4YHHF 1VC5A 1SQGA 4RW9A 2JEIA 2Z0GA 1YKWA 1GTEA 2AZ1A 3BZQA 1FO1A 3MAAB 2J6UA 2CQ1A 4LIRA 4UF4A 3B4DA 4G65A 4RBVA 2V8HA 1RT5B 3CJ5A 4KGVB 2MGZB 2ZH2A 2DPIA 5ETVA 2BRLA 3R5GA 1H98A 1YBTA 3PG9A 2IVYA 4Y2IA 4R8UA 3UN3A 1VHFA 1YJUA 2A2DA 4RZRA 3Q8QB 4JI4F 2FPHX 2Z2YB 4DJBA 1WELA 3LANA 1HBNA 3UN5A 3UDEA 1CJTB 2GJ2A 2PA8D 2OPPA 1S9GA 2B6AB 2PN6A 3BPSP 3BSAA 2DNZA 3KUEA 4L72B 1ZAWA 1A6LA 3ISNC 3S1TA 3UPFA 1IKYA 2E9ZA 4P71A 3VHQA 1JXLA 3TAQA 2VG5A 4F8RA 4XTTA 3QAEA 4LF6J 2B8QA 2E1MC 4UUWA 2X1FA 5EX0A 3BREA 7AT1B 3OQ2A 1WG1A 2QX0A 3M2RB 1MW7A 2XY5A 3CJ8A 4RX6A 3MM5B 5HJYA 3KMSA 1N56A 4EFAC 4LSNA 4DZDA 2Q66A 2R7XA 3A12A 5D4OA 5I4MA 4OI4A 3V4IA 1S1XB 2ZWPA 2Y0SD 1BQMB 3AOBA 4K8RA 5GAGI 2ZZMA 2HQGA 1HNWF 2YWGA 1CG2A 1T03A 5KG4A 1YJWS 4LR7A 1YK9A 4NLWA 4A8WA 2E1RA 3ISND 2VFVA 2I5JA 4TQSA 2RILA 4EU0A 5JMNA 1MN7A 1YITS 3QT6A 1WHVA 3KMQA 5KFMA 4NMXA 2CDRB 4YDXA 2OPSB 2NXNA 3D28A 3CDEA 1YZ6A 1YRTA 1U1LA 1SCJB 1NDKA 1HW8A 1SC6A 2ZHOA 4Q2LA 4UW2A 4YB5A 1TK8A 3X1LB 5DO2A 2JWNA 1F5CA 3C15A 4HT7A 2VKRA 1X5OA 4JI7F 3KLIB 1HQUA 1LQ9A 3G8TA 3J7A1 3MM6A 5DLFA 1E6VA 2WZ1A 1MU2B 4V1Ak 2ZD1B 1PYTA 3EXCX 2RQKA 5HAOA 4OX7A 4WP8A 1IBCB 3LA0A 3W2WA 5C42B 4YN3B 4FF3A 1TAUA 3M8QB 3GSDA 3CD6S 1RAFB 3IAM9 3R5DA 5HP1B 4WYLA 1WC1A 3PIPQ 1P1TA 2HFNA 2J7KA 3M2VB 3THPA 3VVTA 3A1YG 3MOZA 1J27A 3JSBA 3DLLQ 3P4UB 2CFXA 2Z4PA 3GFXA 2MKCA 1X4DA 1F0XA 1DFDA 4PQUB 3MEKA 1TELA 2R3VA 1IKWA 1WI8A 3ZZZA 3CCES 4DV2F 2B5JA 1FXDA 1H6KX 1CPZA 2BQRA 2O5DA 2DD8S 4P10A 2CWKA 3AODA 2QMXA 3OL9A 3GCWP 2GFFA 3K0JA 4C2MA 1T03B 2B56A 2DHSA 3MDFA 4L75A 4LRAA 4NYOA 3TAMA 3OJUA 1XMQF 4LF8F 2KO1A 4WKRA 1ZA2B 3KWMA 3UO0A 2YVSA 2RDIA 1S1XA 4OYIA 5AE3A 1JLAB 1XN9A 3JTPA 2V6AA 4RW7A 2HMIA 2UXCF 3J7AN 3BGRB 3I96A 5CYQA 3NWGA 2HS4A 4CT8A 1P27B 4CT9A 4JI2F 1RAAB 8RUCA 4NCGA 3GV5B 3M4XA 4DUTA 3QPIA 4CI0B 1HNVA 1SV5B 1Q8IA 1WOSA 2FC8A 2YTCA 4GO5X 3S7RA 1N6QA 3PHEA 3DLKB 3VGTA 5KTQA 1RUSA 2G4BA 2OPPB 3I4PA 3PCOB 2MSTA 5D0EA 5D3GA 3BR8A 4ER8A 2FVCA 1XWLA 5FLXU 4JOUA 3KK3B 5I3PA 3TYTA 2R7QA 3OFGA 1UA1A 1H72C 3DOMA 3HKZD 2C3MA 1K0TA 3CCMS 1QAXA 1NJZA 5KFQA 3J81Y 4GVLA 2H4WB 3KLHA 3OVBA 2P9CA 2O01C 1Y7PA 1KQSR 4ZVOB 2JEJA 3BH6B 3GFHA 2E5IA 1NSQA 1HWLA 3K2YA 3TUJC 3VWSA 1BC6A 2W01A 2VB6A 3ITHB 4DLGA 3SV4A 4D3HA 1HBMB 1ZZNA 2U2FA 4B3MF 4K4TA 3CMQA 4M8LA 3WX8A 4YUDA 1TFWA 3CCLS 1V5VA 1X31C 3DRRB 2W1BA 4HLBA 2P9GA 4OHZA 2CNLB 2K7JA 4P72A 5BR8J 3QT5A 3CB4A 4KAIA 1S76D 1T9VA 2IA6A 4KFBA 1RISA 4S0MA 2E7WA 2O1PA 4JV0A 2YQ0A 1NJYA 3QJPA 3K58A 3AJ2A 2R9LA 1MN9A 2CPJA 2PT0A 3IMQJ 5HROA 2R8KA 2QLXA 2IBKA 4OJHA 2Z8QA 2YWHA 3M32A 3M8WA 4OX9F 4LRFA 2VQFF 1T9WA 4TU7A 3NOGA 2VC0A 3JSMA 2BKPA 3GR0A 1WG5A 2RKIA 3PEJA 4IO1A 3IG1B 4K2JA 2BZ2A 3HFZB 4USTA 3GILA 4J9KA 4K4YA 3PW0A 4NXNF 1FI4A 2P6TA 3Q8PB 4JI7J 2EEYA 2HNDB 3IP0A 3OFEA 1HHTP 4DWIA 3H98A 1RTDA 2AEMA 5B0GA 5RUBA 2VONA 3JYTA 3D1HA 4RW8B 2UUBJ 3E2EA 1JB0C 4TU9A 2DHGA 2RD5C 2C42A 1BLUA 1MNEA 1TKZA 2YKPA 3BBFA 3RU0A 3T41A 4UOFA 3VF0B 5KG5A 2CWXA 2DVIA 3TARA 1IKVB 4R25A 4OMFG 3RW7A 1D3WA 4KT0C 3PEHA 2W9CB 2R7TA 3CJSA 1HI0P 1NDLA 4O4RA 2KHCA 4ETXA 2AU0A 2DPJA 1N5TA 3DI6A 3G82A 1HBNB 3SDEB 4RUHA 3G9CA 1RB0A 1LWEA 3W62A 5CYJA 3GE9A 4DPXA 4QR1A 2C3UA 3TOQA 9ATCB 3PR5B 3LPYA 4QCLA 4KHPF 4DV5F 1O8BA 2J9CA 4EO6A 4N41A 1PKUA 2M3DA 4DV0F 1FJEB 4LF8J 4B9VA 2HFSA 4P6QA 1LXNA 3BYRA 1LOUA 1Q8BA 4OYXA 5HBMB 3UDCA 2XCAA 5IT9Y 1AW0A 4K59A 4OHXA 1SH2A 3TVZA 3TVYA 1QAJA 3TA1A 4K4VA 2E66A 1FTCA 2XWXA 5HQLA 2W9AA 4FBUA 2GX8A 4NLTA 1FJ7A 1UZDA 1SC4B 4X65J 2ASDA 1V6HA 5DM7Q 1NSPA 4ZCIA 1OY9A 2ZC3A 1YZ7A 4L73A 4W4MA 4CLKA 1S72S 4JI4J 3HVTA 1IR2A 3I9ZA 2DNHA
chains in the Genus database with same CATH topology
1GTHA 1DTTB 2OSRA 2E1CA 1HQEB 2PMHA 2ZM6F 4CIOA 2KFYA 1R8CA 1F9FA 1Z1ZA 4IDKA 5KFHA 5FLXY 1IKVA 4R5PB 2W8KA 2PA3A 3T9ZA 1VMBA 2HNYA 3TR5A 3PW5A 3HZGA 4QR2A 4B3SF 4USJC 2YKAA 1S6QA 3DOLA 3M6WA 4M63A 4RNHA 3DOKA 3KLEA 1HNZF 4Q8EA 4TYAA 4DFMA 2AP6A 3DYAB 1SJ3P 4LFCF 3MPVA 3MMBA 4QJVA 2DGUA 3RRGA 3C2PA 2LEAA 4QWCA 2OPRB 4I4BA 2ZOMA 4Q43A 5JJBA 2KT2A 2KFNA 2V94A 5B0AA 2FGOA 1Q79A 1IN0A 4TLRA 2GQCA 1N5YB 3EGZA 1JWWA 1U4BA 2NR0A 4TNOA 4C8MA 1SQEA 3OR1A 3N0VA 5I3UA 2E7XA 1QLNA 3SCKE 5LT5A 2WBRA 1MROA 2YWKA 2QRRA 3M8QA 1P8GA 1S0NA 2VFTA 1X4BA 3QIPA 3LQVA 3MF5A 1MU2A 4O44B 4ED2A 5E3RA 5K5MA 3VR1A 3J80Y 3IWLA 4A4JA 1Q16B 2B51A 4C3MA 2WTFA 3CSKA 2GV1A 3JSRA 3H5YA 3BQ1A 3FZ2A 3D0HE 5E41A 3M9MB 2COLA 2WHOA 4HT5A 5HI7A 3QZ7A 2J7UA 1VQ8S 4MMOA 4O4GB 1SUQA 4F4YA 3DLBA 4DR4F 2F7VA 4F26A 1Q7LB 1HNIB 1S77D 5IQ6A 4DL6A 2HHTA 2VA3A 3MM6B 1P1LA 2A3JA 5DJBA 4A8XA 3THTA 2FVSA 3HHLC 1PO6A 3AH6A 5KFAA 4ELVA 1HHSA 1SH0A 4YQWA 4P7TA 2FVQA 4RWXA 2BQ3A 2BDPA 4WK1A 1U6BA 3L95X 3AA8A 2EFNA 3B8HA 4EWTA 4ZHRB 3MR5A 1TR0A 5HL7Q 3LO3A 3LP1B 4DG1A 2RMLA 4A8FA 4Y0FA 1V3RA 2B4VA 4DQQA 1Y5LB 1VQ6S 1X0FA 2ZKTA 4BS2A 1N34F 4J9NA 2FJBB 3M2UB 4DR2F 3M8RA 2IAJA 5KFVA 1X5PA 5T7LA 1ZM2A 2ZH7A 2RQCA 3OBIA 4YR2A 2ZH4A 2W4PA 1VC6A 1NK0A 3GG1A 3QGHA 4R5PA 5DQIA 3CCJS 5JXSA 4A8QA 3SQGA 3FDSA 1DAXA 1R8PA 2CPZA 2LQ5A 1M5SA 1LK7A 3GV7B 1U7LA 3MZIA 3K5OA 4MK7A 2J6TA 1SBRA 2BVZA 2RS2A 3NL0A 3T1HF 1M5HA 3SEOA 1FEEA 4EBCA 4ED1A 1EP4B 1JLEA 1RT6A 3N4WA 2AX1A 4ZP7A 3PXGa 4GC7A 4OQJA 5GAGU 3AQPA 2O67A 2IFXA 3LGMA 3ENWA 4XPCA 1U1RA 2V4JA 3SXLA 2DNRA 2KN4A 4MIWA 1UEVA 4XK8C 2KXNB 2FJDB 3CIZA 4X66F 5A6WA 2BJEA 2CZ4A 1YTYA 4M95A 1XNRF 2LDYA 3I32A 2ZH5A 3P49B 1KLMA 4AUKA 4QIWD 5GAEU 5B0FA 1LKZA 2VPYB 3MM9B 1ZYQA 4ETZA 3MM8B 3DU6A 1PC5A 3LALA 3CCQS 3KK2A 1FRXA 2E5HA 1FVQA 2M0GB 5MLCV 3UR0A 1E6YA 1WTFA 2NSCA 1ZAVA 3C6UA 4C0OC 3CD5A 3T19A 4ZCKA 2UU9F 2MZQA 4OZLA 3KHHA 2QIFA 2WBMA 5B0EA 2M9KA 2VG5B 1M90T 3DRSB 1JIHA 2CKWA 2FTRA 5DM6Q 3HP6A 2CYYA 2IM2A 1WG4A 2LLZA 4R0EA 4Z2XA 4X4TA 4YB1P 3CMAS 4B9SA 1JLCB 2YX4A 4NLXA 4DSIA 1OO0B 3GZ7A 2GGPA 3SCLE 3BGLA 2VOOA 3LH2S 3KG1A 4PXDA 3OTDA 3RBEA 4CO3A 1TUVA 5J2QA 2HS3A 1N5VA 3O2IA 1F2GA 2EKYA 4NX9A 2QA4G 2MY8A 3VAHA 2JEFA 3I56S 4QIFA 1TKXB 2ZDOA 4OZNA 4JI6F 3S01A 2ZH6A 3BQ0A 2JSXA 2DGXA 2DH8A 4ILMA 1VRTA 5EGYA 1RT3A 3GB0A 1Q78A 2FJAB 1U25A 1NKEA 4G1IA 4Q7AA 1BGXT 1VQYA 1UEUA 3DLJA 1ZTTA 1RAJA 1RJJA 2JC1A 4XDDA 5BYQA 2MQMA 2X3GA 2OMOA 4CZCA 5FJ4A 2R7VA 3V81A 1R0AA 3BQ2A 1B7FA 4FS2A 5HLFB 3KLGB 2LXIA 2AYBA 1RT6B 2ROGA 3U27A 4F4XA 3K8WA 5G4DA 1S99A 5KG1A 3MR2A 5KFRA 1NJXA 2HW3A 2WSEC 3N79A 2ZE2A 2OFGX 3T5HA 4JI3F 3PX6A 2JRSA 1BD6A 1FNOA 1XERA 3BEGB 1NK6A 1J5OB 1X0PA 2EK1A 2IM0A 1FKOB 4FXDA 5M2RA 5L1IA 2W7OA 2DTJA 4EEYA 3CPWR 1TL4A 3OW2R 5CYQB 1U1QA 1KTQA 4O23A 4IKAA 1U1NA 4IRCA 1J2VA 2CQ4A 1JLAA 2V8VA 2HRYA 3EZUA 2BE2B 3BGRA 3ENQA 3JTNA 3MM8A 2KZMA 3FGVA 3K7RA 2XLKA 1JX4A 3FSXA 3GYXB 4IG3A 2R8JA 4I1TA 4OFZA 4RLEA 2D41A 4ED6A 2RRAA 3PO4A 1MWYA 4N77A 1ZETA 3KLEB 3DDNA 4JV2A 2IM1A 3HVWA 4N5SA 4CH0S 2KRRA 5EHHA 2BM1A 4DPOA 2XCPA 4C9DA 2B43A 2L9WA 3CJKA 4QWBA 4Y65A 1NHUA 3NAHA 4NCBA 3G6XA 4V19X 3N5FA 3EXYA 1QTMA 1YBAA 4QWDA 4YP3A 3MUMP 2F3JA 5DDQC 3DLEB 3LP0B 5KT6A 3DXBA 3OLBA 4E98A 2J0WA 2DRBA 1HNVB 3UQSA 2UVVA 4RNNA 4NCGB 3V6HA 3OSPA 4ICLA 3MXHP 2HHUA 3UCUP 4LJMA 4N76A 5FIIA 3DCAA 3H2VE 3CCVS 4X84A 4K0KF 4F4ZA 4ZKAA 3M6XA 4AXJA 1U8SA 4EUVA 2DNGA 4DLEA 4GO7X 3KJVB 1LW0A 3BDPA 1JJ4A 1NJWA 1RK8A 3CTRA 4WIIA 2J5AA 1U45A 5K8MA 4HDGA 3MUTP 1KC8T 2KRBA 2Q79A 2M5YA 2HNZB 3DOKB 3OXFA 3EPGA 4EBEA 3IR6B 1IUJA 2X1BA 4QPXA 4KIAA 4IUFA 2L41A 2W9CA 1ZAXA 1JNZB 2IYIA 1C0UA 3OLAA 3BF4A 4QIGA 2AYEA 1CC8A 2XMMA 3FRZA 4DSLA 2I2YA 2UUAF 1QAIA 4MAKA 5D6GA 3G8QA 3RW6A 4NLYA 2JLFA 3JYTB 3VCDA 4U7CA 4YY3F 1OIAA 1YG0A 3R5BA 2R2SA 2ZE2B 1WNEA 3FEXB 1VQSA 2F40A 3CGIA 1SUQB 4PPDA 1JKHB 3CDBA 3HJFA 2NYIA 3UCZP 2IJFA 4RW6A 3TO8A 1TVRB 3HX9A 1X9MA 4ECRA 1VLYA 5DLGA 2YH0A 1N36F 2DO4A 1RT5A 4IO9Q 3CCTA 2JJ4D 4Q8FA 3H2LA 1URRA 2HZCA 1OQ6A 1JLGB 3U1LA 1RA7A 1TL1B 1TZ0A 1X9SA 4KKOB 4K4WA 3Q0AA 4DFKA 4I6WA 5JVHQ 5BYRA 2ASYA 3LOUA 3DMJA 2OIHA 3PKYA 4EZ9A 5C24B 3CD6S 2WAQD 2UP1A 4WZQA 3RR8A 3KKFA 3PR4A 5GADI 1B0VA 1XR5A 4O3RA 2YNFB 4C7QA 2GHPA 2XSFA 3DRPB 2W8LA 3M1VA 4OI1A 4ED7A 4I2QB 3IO1A 5E3QA 1FK9A 1F5BA 1REVA 4LSLB 4X4OA 1VBXA 1CC7A 4KBIA 3CC4S 2KKHA 4IG0A 2K2PA 2VPZB 4BC9A 2KG0A 2FJXA 2LKZA 1TV6B 1QUPA 1YWXA 2KXHA 3MMJA 4FNHA 4Q0BA 3JTOA 2R7WA 4LF7F 5GMKa 3P3DA 1X4FA 2PSZA 3KK1B 2MPUA 4ED5A 3ENVA 1Q4RA 2IRXA 4ZPAA 1KOOA 2X1AA 1DARA 4TN2A 2M70A 4MKYA 3SSRA 3UR3C 3US5A 2HPUA 3KNGA 4JV5F 2V8DA 5T41A 3ULHA 5DDRC 4IRKA 3RB4A 4E0DA 5A0YB 4ERDA 4RKUC 1S9EA 2QO3A 1Z2ZA 4QYZJ 2D3ZA 2PE8A 1LWFA 2POKA 1TL1A 2MY7A 1H38A 2MJNA 1JLGA 4FF1A 1YGYA 2L3MA 3DDKA 4DQSA 2J9EA 2CJKA 3N6NA 5A8KA 3HKWA 2E5LF 1HWUA 2B5JB 1VQ5S 3FZBA 4PQUA 2KJWA 2MKSA 4TQRA 2XGPA 2YNFA 3HVAA 3P96A 3DC2A 2FC9A 1WF2A 2V4JB 4M5DB 3PKMA 2RE1A 1TVRA 2FY1A 2DNYA 2W25A 2RVJA 4RUCA 4ILRA 3Q2TC 5F0WA 2YKQA 1BQNB 4A8OA 2OPQB 4WZMA 4WU3A 1C1BB 2JVOA 2WK4A 3ZC4A 2WB1D 1XMBA 1VK8A 1HQUB 3T5KA 2ALZA 2EG1A 3HI9A 3I82A 2ZHBA 2B4UA 4LVOP 3CD7A 1WEZA 4IFYB 4F2SA 3U1NA 1F5AA 2I9SA 4ALZA 3M05A 4ZCMA 1VI7A 3NAIA 2B9XA 2DGOA 2GJIA 2VOPA 2ZOFA 1XR6A 3M2UA 3MM7B 3KK3A 1GX6A 1TL3B 2XG8A 4I7FB 3IG1A 3EGNA 4DEZA 1RKJA 2BE2A 6FDRA 3MEGA 3HK2A 3K5PA 3M32B 3LP1A 4DG1B 5B08A 1NK7A 1RT4A 4UY85 3POTB 4WE1A 5AE1A 2RQMA 2ZH8A 3SZ2A 1VQ4S 5KFGA 4F4KA 3JAMY 2KHDA 4AL7A 3I0SB 4X2BA 2VC1A 1SJFA 5K14B 2VBZA 4RW7B 5KFSA 1IBMF 3SCJE 4ECTA 5ITHA 3V6KA 1S9GB 2KM8C 3H59A 2OPQA 2WW8A 4UUXA 5D4LA 5CH7B 2XMTA 1WI6A 2XLJA 1RTJB 5BJRA 2EFVA 4B9TA 2VBYA 2CPEA 4JUZA 4BWMA 1HI8A 3PW7A 4XDCA 3OTEA 5A8WA 4RU2A 1VQ9S 5E2QA 2L08A 2FDNA 3FNNA 4N8NA 3QIPB 5DQHA 3I0RA 3IRWP 1FKPA 4IG3B 2XI3A 3GIIA 4ED3A 3N6LA 3W2WB 1UWBA 5F9LA 2ZH3A 2DGTA 1MMDA 3R27A 2HAIA 4LF4F 3R5AA 3Q22A 2OTJS 1NHVA 2QYCA 4UQTA 1S1TA 4B3TF 1S1UB 4NRTA 4DV3F 5F8GA 3KTQA 4PG8A 4MYUA 4TY8B 4X4QA 2F8MA 2UVUA 1TL5A 1ZPWX 4IH7A 2C2RA 2F8EX 2M52A 2ZNYA 3PJXA 1SL2A 4IR1A 2M8DB 4KSEB 3EX7B 4F3QA 2RU3A 2AWZA 3V4IB 2IMWP 4DFJA 1D9FA 1IBKF 2DNNA 4K50A 4ECZA 2GIQA 4ZK7M 3NMRA 1HI1A 1FDNA 1U6FA 5CQGA 4RNOA 1WHXA 5EDWA 4PQAA 1UA0A 1LFPA 3CCRS 4JI8F 3HZEA 2IVFB 3HHEA 1HWKA 2DRAA 3RAXA 1VQKS 4Q0BB 2KM8B 2CPFA 2VD3A 3MM9A 4KKOA 2UV8G 2JLEA 2DCLA 2LU2A 3ZFVA 5E33A 4O3OA 3UW1A 3V6JA 2AQ4A 2KT3A 4DOZA 3WBZA 4I2QA 2BM0A 3PRDA 1FXRA 1CEZA 5HBMA 2HYIB 4KPYA 4J9MA 2D3UA 2BV3A 2UUWA 1C1CA 2CPIA 1YJRA 3WX4A 3ZZRA 2Y1IA 2YKNB 2B0GA 2R2UA 2ZH9A 1QE1B 1GXUA 3K8VA 5CYMB 3CF5Q 4FS1A 4NLUA 2XEXA 3M8PA 1UJ4A 2DITA 3C8YA 2VQEF 2DJWA 2HLTA 4DQRA 1XMOF 2IBOA 1HBMA 1SL0A 3X3UA 4DL0C 1TKTA 3GFYA 3H8YA 4DF4A 2LECA 4DV4F 4EBDA 1KFSA 2B3TB 2RRBA 1RP5A 2FIUA 4DF8A 2ZC4A 3CEDA 1SJRA 2GCFA 2DT9A 4U7UK 3RRKA 2KZZA 3NGDA 2BANB 3HHLB 4IOBA 4DUZF 4KO0A 5BYSA 2ABYA 1VQLS 4C98A 4TY8A 4UY8T 5KFZA 3OUYA 4MFBB 3IC1A 1GT8A 4C8NA 3TUZC 1T05B 5B7WA 3I6PA 4J37A 2JZ5A 1DLOA 5F3ZA 1GXLA 2HGMA 2ADBA 3AQOA 2ASLA 1P9QC 1XEZA 4AQYF