1YS5A

Solution structure of the antigenic domain of gna1870 of neisseria meningitidis
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
156
structure length
156
Chain Sequence
MQSHSALTAFQTEQIQDSEHSGKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGSDDAGGKLTYTIDFAAKQGNGKIEHLKSPELNVDLAAADIKPDGKRHAVISGSVLYNQAEKGSYSLGIFGGKAQEVAGSAEVKTVNGIRHIGLAAKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lipoprotein
publication title Solution structure of the immunodominant domain of protective antigen GNA1870 of Neisseria meningitidis
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Signaling protein
total genus 28
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2005-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 1ys5A01
3HOEA 4O4UA 3KVDD 4AYID 5T5FA 2KDYA 4Z3TA 4U9CA 4O4XA 2LFUA 2W80C 2YPVA 3PQSA 4AYMC 4O3YA 4AYEC 3HOLA 4QQ1A 3VE1A 5EE2A 4O3WA 4O49A 3UAQA 4AYNA 3VE2A 3PQUA 2Y7SA 2W81C 1YS5A 4AYDC 4O3ZA 2KC0A 3V8UA 4O3XB
chains in the Genus database with same CATH superfamily
3HOEA 5GTHO 3SYBA 4AUIA 3LK2A 3GP6A 2R4NA 1ZHZA 3SYSA 3DA4A 3WI5A 2IWWA 5JDPA 5GV0A 4N58A 2Y0HA 3A2SX 2WJQA 5KAFO 1HXUA 1QJPA 2F1TA 3PF1A 1OSMA 2LFUA 3AA0B 4GCQA 3AA7A 3LK41 5IYUA 1IZNB 5AFUL 3HW9A 3LK42 1BT9A 1IZNA 2WVPA 4KRAA 2R4PA 5DL6A 3JTYA 5G39A 1MM5A 3HOLA 4QQ1A 5EE2A 2R4OA 3DWNA 4O3WA 3VE1A 4FQEA 5B66O 3T0SA 3VE2A 3WI4A 2M06A 2N2MA 1GFOA 1Q9FA 3BS0A 3POQA 2J1NA 3TZGA 5AFUK 1BXWA 4PUXA 4LSHA 5ADXL 3PGUA 4C4VB 2MHLA 3VY9X 2WJRA 2F1VA 1Q9GA 4E1TA 3AAAA 4LSIA 4RLBA 4AFKA 2KXPB 2XE2A 2XTQA 3LK3A 2GE4A 1GFNA 3LK2B 2FGRA 4AYID 4IL6O 2R4LA 3DA3A 4XNLA 5G3AA 4Z3TA 2ZLDA 4JFBA 3POUA 2Y0LA 3SZDA 2F1CX 2YPVA 4FZNA 3AA7B 3PQSA 4FOZA 5E79O 4AKMA 6PRNA 4FRXA 4K3CA 4N74A 3K19A 4GHBA 4D5UA 5H2FO 3AAEB 2K4TA 3AAEA 2Y0KA 4FSPA 4G75A 4GF4A 5FVNA 1QJ9A 3FYXA 3UAQA 2JMMA 4XNKA 4UB6O 3PRNA 3G7GA 1GFMA 2R89A 7PRNA 2O4VA 1MPFA 3SY7A 3POXA 4FT6A 3AA1B 4G76A 4AYDC 4B61A 3AA1A 1THQA 3AAAB 4JCHA 3V8UA 1MM4A 4LSEA 1QJ8A 5B5EO 2LHFA 2PRNA 2XG6A 3DZMA 3LK3B 3A0HO 4FZMA 5G26A 8PRNA 5ADXK 1H6S1 4N75A 3KVDD 1ZHWA 4F4BA 4N59A 5TISO 5DL5A 4AKRB 2YNKA 4U9CA 2FGQX 4O4XA 3VZWX 2AXTO 2XE3A 2QTKA 2W80C 4AKRA 1PRNA 4LSFA 4AYMC 2KZ7A 2R88A 2ODJA 3NJTA 4RL9A 4AYEC 2PORA 5D5DA 4O49A 3SZVA 3PGRA 4FRTA 5G38A 2ERVA 2MNHA 4D64A 3T20A 3UPGA 2W81C 4KR4A 2ZFGA 3JCUO 1S5LO 4FMSA 1ZHYA 1ZHXA 1YS5A 3AA6A 2JQYA 1OPFA 2Y2XA 3PGSA 4PR7A 4RJXA 4O3ZA 1T1LA 5DL8A 4AZLA 4C69X 2X9KA 4GCSA 4KR8A 4FSOA 3UU2A 3VZTX 4O3XB 1GFPA 4RJWA 3BRYA 4FUVA 4O4UA 1ZHTA 3KZIO 3QRAA 4D65A 3RBHA 4FZLA 3T24A 4FESA 5T5FA 2KDYA 1P4TA 3PORA 4K3BA 5DL7A 3WU2O 3AA0A 3HWBA 2R8AA 3QRCA 1BH3A 1T16A 1HXTA 1ORMA 2XE5A 3DWOX 3NSGA 5KAIO 3SY9A 2KZ7B 2XMXA 4O3YA 4RLCA 2XTRA 3BRZA 5PRNA 3VY8X 1G90A 1HXXA 1GFQA 3EMNX 4AYNA 2OMFA 4UB8O 4C00A 4GCPA 2IWVA 3PQUA 4E1SA 4CTDA 3O0EA 2K0LA 2Y7SA 3A0BO 1E54A 5GTIO 4C4VA 2X27X 3VZUX 2N2LA 2XE1A 3AA6B 4BUMX 2J4UP 2KC0A 1PHOA 2M07A 4PJ0O 3C5OA 2KXPA
chains in the Genus database with same CATH topology
3HOEA 3SYBA 4AUIA 3LK2A 3GP6A 1ZHZA 3SYSA 3DA4A 3WI5A 5JDPA 5GV0A 4N58A 2Y0HA 3A2SX 1HXUA 1QJPA 2F1TA 1OSMA 2LFUA 3AA0B 4GCQA 3AA7A 3LK41 5IYUA 1IZNB 5AFUL 3HW9A 3LK42 1BT9A 1IZNA 4KRAA 5DL6A 3JTYA 1MM5A 3HOLA 4QQ1A 5EE2A 4O3WA 3VE1A 3T0SA 3VE2A 5AFUK 2M06A 2N2MA 1GFOA 1Q9FA 3TZGA 3POQA 2J1NA 1BXWA 4PUXA 4LSHA 5ADXL 2MHLA 3VY9X 2F1VA 1Q9GA 4E1TA 3AAAA 4LSIA 4RLBA 4AFKA 2KXPB 2XE2A 2XTQA 3LK3A 2GE4A 1GFNA 3LK2B 2FGRA 4AYID 3DA3A 4XNLA 4Z3TA 2ZLDA 4JFBA 3POUA 2Y0LA 3SZDA 2YPVA 4FZNA 3AA7B 3PQSA 4FOZA 4AKMA 6PRNA 4FRXA 4D5UA 3K19A 4GHBA 3AAEB 2K4TA 3AAEA 2Y0KA 4FSPA 4G75A 4GF4A 5FVNA 1QJ9A 3FYXA 3UAQA 2JMMA 4XNKA 3PRNA 3G7GA 1GFMA 7PRNA 2O4VA 1MPFA 3SY7A 3POXA 4FT6A 3AA1B 4G76A 4AYDC 4B61A 3AA1A 1THQA 3AAAB 4JCHA 3V8UA 1MM4A 4LSEA 1QJ8A 2LHFA 2PRNA 2XG6A 3LK3B 4FZMA 8PRNA 5G26A 5ADXK 1H6S1 3KVDD 1ZHWA 4F4BA 4N59A 5DL5A 2YNKA 4U9CA 2FGQX 4O4XA 3VZWX 2XE3A 2QTKA 2W80C 4AKRA 1PRNA 4LSFA 4AYMC 2KZ7A 2ODJA 4RL9A 4AYEC 2PORA 5D5DA 4O49A 3SZVA 4FRTA 2ERVA 2MNHA 4D64A 3T20A 2W81C 4KR4A 2ZFGA 4FMSA 1ZHYA 1ZHXA 1YS5A 3AA6A 4AZLA 1OPFA 2Y2XA 5DL8A 4C69X 4RJXA 4O3ZA 4GCSA 4KR8A 4FSOA 3UU2A 3VZTX 4O3XB 1GFPA 4RJWA 4FUVA 4O4UA 1ZHTA 3QRAA 4D65A 3RBHA 4FZLA 3T24A 4FESA 5T5FA 2KDYA 1P4TA 3PORA 5DL7A 3AA0A 3HWBA 3QRCA 1BH3A 2XE5A 1HXTA 1ORMA 3NSGA 3SY9A 3WI4A 4AKRB 4E1SA 2KZ7B 2XMXA 4O3YA 4RLCA 2XTRA 5PRNA 3VY8X 1G90A 1HXXA 1GFQA 3EMNX 4AYNA 2OMFA 4GCPA 3PQUA 3O0EA 2K0LA 2Y7SA 1E54A 2X27X 3VZUX 2N2LA 2XE1A 3AA6B 4BUMX 2J4UP 2KC0A 1PHOA 2M07A 3UPGA 3C5OA 2KXPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOE A;  4O4U A;  3KVD D;  4AYI D;  5T5F A;  2KDY A;  4Z3T A;  4U9C A;  4O4X A;  2LFU A;  2W80 C;  2YPV A;  3PQS A;  4AYM C;  4O3Y A;  4AYE C;  3HOL A;  4QQ1 A;  3VE1 A;  5EE2 A;  4O3W A;  4O49 A;  3UAQ A;  4AYN A;  3VE2 A;  3PQU A;  2Y7S A;  2W81 C;  1YS5 A;  4AYD C;  4O3Z A;  2KC0 A;  3V8U A;  4O3X B; 
#chains in the Genus database with same CATH topology
 3HOE A;  5GTH O;  3SYB A;  4AUI A;  3LK2 A;  3GP6 A;  2R4N A;  1ZHZ A;  3SYS A;  3DA4 A;  3WI5 A;  2IWW A;  5JDP A;  5GV0 A;  4N58 A;  2Y0H A;  3A2S X;  2WJQ A;  5KAF O;  1HXU A;  1QJP A;  2F1T A;  3PF1 A;  1OSM A;  2LFU A;  3AA0 B;  4GCQ A;  3AA7 A;  3LK4 1;  5IYU A;  1IZN B;  5AFU L;  3HW9 A;  3LK4 2;  1BT9 A;  1IZN A;  2WVP A;  4KRA A;  2R4P A;  5DL6 A;  3JTY A;  5G39 A;  1MM5 A;  3HOL A;  4QQ1 A;  5EE2 A;  2R4O A;  3DWN A;  4O3W A;  3VE1 A;  4FQE A;  5B66 O;  3T0S A;  3VE2 A;  3WI4 A;  2M06 A;  2N2M A;  1GFO A;  1Q9F A;  3BS0 A;  3POQ A;  2J1N A;  3TZG A;  5AFU K;  1BXW A;  4PUX A;  4LSH A;  5ADX L;  3PGU A;  4C4V B;  2MHL A;  3VY9 X;  2WJR A;  2F1V A;  1Q9G A;  4E1T A;  3AAA A;  4LSI A;  4RLB A;  4AFK A;  2KXP B;  2XE2 A;  2XTQ A;  3LK3 A;  2GE4 A;  1GFN A;  3LK2 B;  2FGR A;  4AYI D;  4IL6 O;  2R4L A;  3DA3 A;  4XNL A;  5G3A A;  4Z3T A;  2ZLD A;  4JFB A;  3POU A;  2Y0L A;  3SZD A;  2F1C X;  2YPV A;  4FZN A;  3AA7 B;  3PQS A;  4FOZ A;  5E79 O;  4AKM A;  6PRN A;  4FRX A;  4K3C A;  4N74 A;  3K19 A;  4GHB A;  4D5U A;  5H2F O;  3AAE B;  2K4T A;  3AAE A;  2Y0K A;  4FSP A;  4G75 A;  4GF4 A;  5FVN A;  1QJ9 A;  3FYX A;  3UAQ A;  2JMM A;  4XNK A;  4UB6 O;  3PRN A;  3G7G A;  1GFM A;  2R89 A;  7PRN A;  2O4V A;  1MPF A;  3SY7 A;  3POX A;  4FT6 A;  3AA1 B;  4G76 A;  4AYD C;  4B61 A;  3AA1 A;  1THQ A;  3AAA B;  4JCH A;  3V8U A;  1MM4 A;  4LSE A;  1QJ8 A;  5B5E O;  2LHF A;  2PRN A;  2XG6 A;  3DZM A;  3LK3 B;  3A0H O;  4FZM A;  5G26 A;  8PRN A;  5ADX K;  1H6S 1;  4N75 A;  3KVD D;  1ZHW A;  4F4B A;  4N59 A;  5TIS O;  5DL5 A;  4AKR B;  2YNK A;  4U9C A;  2FGQ X;  4O4X A;  3VZW X;  2AXT O;  2XE3 A;  2QTK A;  2W80 C;  4AKR A;  1PRN A;  4LSF A;  4AYM C;  2KZ7 A;  2R88 A;  2ODJ A;  3NJT A;  4RL9 A;  4AYE C;  2POR A;  5D5D A;  4O49 A;  3SZV A;  3PGR A;  4FRT A;  5G38 A;  2ERV A;  2MNH A;  4D64 A;  3T20 A;  3UPG A;  2W81 C;  4KR4 A;  2ZFG A;  3JCU O;  1S5L O;  4FMS A;  1ZHY A;  1ZHX A;  1YS5 A;  3AA6 A;  2JQY A;  1OPF A;  2Y2X A;  3PGS A;  4PR7 A;  4RJX A;  4O3Z A;  1T1L A;  5DL8 A;  4AZL A;  4C69 X;  2X9K A;  4GCS A;  4KR8 A;  4FSO A;  3UU2 A;  3VZT X;  4O3X B;  1GFP A;  4RJW A;  3BRY A;  4FUV A;  4O4U A;  1ZHT A;  3KZI O;  3QRA A;  4D65 A;  3RBH A;  4FZL A;  3T24 A;  4FES A;  5T5F A;  2KDY A;  1P4T A;  3POR A;  4K3B A;  5DL7 A;  3WU2 O;  3AA0 A;  3HWB A;  2R8A A;  3QRC A;  1BH3 A;  1T16 A;  1HXT A;  1ORM A;  2XE5 A;  3DWO X;  3NSG A;  5KAI O;  3SY9 A;  2KZ7 B;  2XMX A;  4O3Y A;  4RLC A;  2XTR A;  3BRZ A;  5PRN A;  3VY8 X;  1G90 A;  1HXX A;  1GFQ A;  3EMN X;  4AYN A;  2OMF A;  4UB8 O;  4C00 A;  4GCP A;  2IWV A;  3PQU A;  4E1S A;  4CTD A;  3O0E A;  2K0L A;  2Y7S A;  3A0B O;  1E54 A;  5GTI O;  4C4V A;  2X27 X;  3VZU X;  2N2L A;  2XE1 A;  3AA6 B;  4BUM X;  2J4U P;  2KC0 A;  1PHO A;  2M07 A;  4PJ0 O;  3C5O A;  2KXP A; 
#chains in the Genus database with same CATH homology
 3HOE A;  3SYB A;  4AUI A;  3LK2 A;  3GP6 A;  1ZHZ A;  3SYS A;  3DA4 A;  3WI5 A;  5JDP A;  5GV0 A;  4N58 A;  2Y0H A;  3A2S X;  1HXU A;  1QJP A;  2F1T A;  1OSM A;  2LFU A;  3AA0 B;  4GCQ A;  3AA7 A;  3LK4 1;  5IYU A;  1IZN B;  5AFU L;  3HW9 A;  3LK4 2;  1BT9 A;  1IZN A;  4KRA A;  5DL6 A;  3JTY A;  1MM5 A;  3HOL A;  4QQ1 A;  5EE2 A;  4O3W A;  3VE1 A;  3T0S A;  3VE2 A;  5AFU K;  2M06 A;  2N2M A;  1GFO A;  1Q9F A;  3TZG A;  3POQ A;  2J1N A;  1BXW A;  4PUX A;  4LSH A;  5ADX L;  2MHL A;  3VY9 X;  2F1V A;  1Q9G A;  4E1T A;  3AAA A;  4LSI A;  4RLB A;  4AFK A;  2KXP B;  2XE2 A;  2XTQ A;  3LK3 A;  2GE4 A;  1GFN A;  3LK2 B;  2FGR A;  4AYI D;  3DA3 A;  4XNL A;  4Z3T A;  2ZLD A;  4JFB A;  3POU A;  2Y0L A;  3SZD A;  2YPV A;  4FZN A;  3AA7 B;  3PQS A;  4FOZ A;  4AKM A;  6PRN A;  4FRX A;  4D5U A;  3K19 A;  4GHB A;  3AAE B;  2K4T A;  3AAE A;  2Y0K A;  4FSP A;  4G75 A;  4GF4 A;  5FVN A;  1QJ9 A;  3FYX A;  3UAQ A;  2JMM A;  4XNK A;  3PRN A;  3G7G A;  1GFM A;  7PRN A;  2O4V A;  1MPF A;  3SY7 A;  3POX A;  4FT6 A;  3AA1 B;  4G76 A;  4AYD C;  4B61 A;  3AA1 A;  1THQ A;  3AAA B;  4JCH A;  3V8U A;  1MM4 A;  4LSE A;  1QJ8 A;  2LHF A;  2PRN A;  2XG6 A;  3LK3 B;  4FZM A;  8PRN A;  5G26 A;  5ADX K;  1H6S 1;  3KVD D;  1ZHW A;  4F4B A;  4N59 A;  5DL5 A;  2YNK A;  4U9C A;  2FGQ X;  4O4X A;  3VZW X;  2XE3 A;  2QTK A;  2W80 C;  4AKR A;  1PRN A;  4LSF A;  4AYM C;  2KZ7 A;  2ODJ A;  4RL9 A;  4AYE C;  2POR A;  5D5D A;  4O49 A;  3SZV A;  4FRT A;  2ERV A;  2MNH A;  4D64 A;  3T20 A;  2W81 C;  4KR4 A;  2ZFG A;  4FMS A;  1ZHY A;  1ZHX A;  1YS5 A;  3AA6 A;  4AZL A;  1OPF A;  2Y2X A;  5DL8 A;  4C69 X;  4RJX A;  4O3Z A;  4GCS A;  4KR8 A;  4FSO A;  3UU2 A;  3VZT X;  4O3X B;  1GFP A;  4RJW A;  4FUV A;  4O4U A;  1ZHT A;  3QRA A;  4D65 A;  3RBH A;  4FZL A;  3T24 A;  4FES A;  5T5F A;  2KDY A;  1P4T A;  3POR A;  5DL7 A;  3AA0 A;  3HWB A;  3QRC A;  1BH3 A;  2XE5 A;  1HXT A;  1ORM A;  3NSG A;  3SY9 A;  3WI4 A;  4AKR B;  4E1S A;  2KZ7 B;  2XMX A;  4O3Y A;  4RLC A;  2XTR A;  5PRN A;  3VY8 X;  1G90 A;  1HXX A;  1GFQ A;  3EMN X;  4AYN A;  2OMF A;  4GCP A;  3PQU A;  3O0E A;  2K0L A;  2Y7S A;  1E54 A;  2X27 X;  3VZU X;  2N2L A;  2XE1 A;  3AA6 B;  4BUM X;  2J4U P;  2KC0 A;  1PHO A;  2M07 A;  3UPG A;  3C5O A;  2KXP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...