1YS5A

Solution structure of the antigenic domain of gna1870 of neisseria meningitidis
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
156
structure length
156
Chain Sequence
b'MQSHSALTAFQTEQIQDSEHSGKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGSDDAGGKLTYTIDFAAKQGNGKIEHLKSPELNVDLAAADIKPDGKRHAVISGSVLYNQAEKGSYSLGIFGGKAQEVAGSAEVKTVNGIRHIGLAAKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lipoprotein
publication title Solution structure of the immunodominant domain of protective antigen GNA1870 of Neisseria meningitidis
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Signaling protein
total genus 28
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2005-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 1ys5A01
5T5FA 2KDYA 4O3YA 4O3WA 2KC0A 4O3ZA 3HOLA 3HOEA 4O4XA 3UAQA 3VE1A 3PQUA 4AYNA 3VE2A 2W80C 2LFUA 3V8UA 4AYDC 4O4UA 3PQSA 4AYMC 4O3XB 2W81C 4U9CA 1YS5A 4Z3TA 2Y7SA 3KVDD 4QQ1A 4O49A 4AYEC 2YPVA 4AYID 5EE2A
chains in the Genus database with same CATH superfamily
1MM4A 1MPFA 4D64A 4PR7A 3AAAB 5KAIO 3VZWX 2FGQX 3AA1B 4AYEC 3VZUX 1G90A 2WVPA 2Y0KA 4RLBA 3PF1A 4G75A 5G26A 2R4PA 4O4XA 3AA7A 5G38A 3DA4A 1Q9GA 2ERVA 4FMSA 2WJQA 4B61A 2F1TA 2X27X 3UU2A 3K19A 3AAEB 3POXA 3A0HO 1ORMA 3AA6A 2J1NA 2AXTO 3C5OA 3BS0A 2XMXA 3HW9A 3LK2B 4FSOA 4GCPA 4O4UA 5E79O 4PUXA 1Q9FA 2N2MA 2XTQA 1GFPA 2QTKA 3A2SX 2R8AA 3DWNA 4LSHA 2OMFA 5B66O 4AKRB 1QJ8A 2ZLDA 5GV0A 1MM5A 2KZ7B 2YPVA 4AYID 1S5LO 4D5UA 3LK3A 4C4VB 5IYUA 2R4OA 4CTDA 2IWWA 3G7GA 3WI4A 4N75A 3O0EA 6PRNA 3NJTA 2MNHA 4FRTA 4GF4A 4O3WA 5AFUK 5B5EO 1ZHXA 3UPGA 5KAFO 3HOLA 2XTRA 3EMNX 2X9KA 1IZNA 3QRAA 2FGRA 3VY8X 4AZLA 3POUA 4D65A 3SY9A 7PRNA 8PRNA 3VE2A 4GHBA 2PRNA 3V8UA 3SYSA 3SZVA 3LK3B 3QRCA 4GCQA 4AYMC 2N2LA 3AA0A 3LK42 4RJWA 3PORA 1YS5A 4GCSA 4KR8A 4N59A 4RJXA 4F4BA 4IL6O 2J4UP 1THQA 2KXPB 3PGUA 5DL8A 5PRNA 3SZDA 2GE4A 4O49A 3VZTX 1QJPA 5H2FO 1BT9A 3BRYA 4FZLA 2XE3A 4UB6O 4LSIA 3WI5A 2F1VA 2R4NA 1T16A 4FSPA 3AA1A 5T5FA 3VY9X 2R4LA 2MHLA 4O3YA 3T20A 3SYBA 2KC0A 3KZIO 5AFUL 5TISO 5JDPA 3HWBA 3UAQA 4AFKA 3POQA 2LHFA 4FESA 4FUVA 1OPFA 3PQUA 2XE2A 2JQYA 3GP6A 3VE1A 3LK41 3AA7B 5ADXK 2Y2XA 4N58A 4BUMX 3PGRA 2Y0LA 2R88A 2JMMA 2F1CX 4AYDC 3PQSA 3AA6B 2Y0HA 4AKMA 2PORA 1OSMA 1H6S1 2WJRA 3AA0B 3DWOX 4U9CA 5DL5A 5G3AA 4K3BA 4AKRA 1GFQA 4N74A 2KZ7A 3A0BO 4C00A 2M06A 1BXWA 3KVDD 4LSFA 4C4VA 2YNKA 5EE2A 4C69X 2XE5A 3BRZA 1ZHTA 1ZHZA 3AAAA 4PJ0O 1BH3A 4AUIA 2KDYA 1ZHWA 2R89A 4FQEA 3JTYA 4E1TA 2M07A 3DZMA 5D5DA 3RBHA 3DA3A 4O3ZA 4JCHA 1HXUA 3HOEA 4LSEA 5DL7A 1QJ9A 4FZNA 1ZHYA 1HXTA 3FYXA 2O4VA 5GTHO 1IZNB 1GFMA 1PHOA 4AYNA 5ADXL 2W80C 5FVNA 2LFUA 3AAEA 4FZMA 4RLCA 4UB8O 5DL6A 3SY7A 3TZGA 1P4TA 3LK2A 3NSGA 1GFOA 2XE1A 4KRAA 4KR4A 1GFNA 2IWVA 2W81C 4O3XB 2K0LA 2KXPA 4RL9A 1HXXA 5GTIO 1PRNA 5G39A 4E1SA 4Z3TA 2Y7SA 4K3CA 3WU2O 4JFBA 1E54A 1T1LA 4XNKA 4XNLA 2K4TA 4QQ1A 3T24A 3PGSA 4FRXA 4FT6A 4FOZA 2ODJA 2ZFGA 3PRNA 4G76A 2XG6A 3T0SA 3JCUO
chains in the Genus database with same CATH topology
1MM4A 1MPFA 3AAAB 3VZWX 2FGQX 3AA1B 3VZUX 1G90A 2Y0KA 4RLBA 4G75A 5G26A 4O4XA 3AA7A 3DA4A 1Q9GA 2ERVA 4FMSA 4B61A 2F1TA 2X27X 3UU2A 3K19A 3AAEB 3POXA 3HW9A 1ORMA 3AA6A 2J1NA 3C5OA 3LK3A 4O4UA 2XMXA 4FSOA 3LK2B 4PUXA 1Q9FA 2N2MA 2XTQA 1GFPA 2QTKA 3A2SX 4LSHA 2OMFA 4AKRB 1QJ8A 2ZLDA 5GV0A 1MM5A 2KZ7B 2YPVA 4AYID 4D5UA 5IYUA 3G7GA 3WI4A 3O0EA 6PRNA 2MNHA 4FRTA 4GF4A 4O3WA 5AFUK 1ZHXA 3UPGA 3HOLA 2XTRA 3EMNX 3QRAA 1IZNA 3VY8X 2FGRA 4AZLA 3POUA 4D65A 3SY9A 7PRNA 8PRNA 3VE2A 4GHBA 2PRNA 3V8UA 3SYSA 3SZVA 3LK3B 3QRCA 4GCQA 4AYMC 2N2LA 3AA0A 3LK42 4RJWA 3PORA 1YS5A 4GCSA 4KR8A 4N59A 4RJXA 4F4BA 2J4UP 1THQA 2KXPB 5DL8A 5PRNA 2GE4A 4O49A 3VZTX 1QJPA 1BT9A 4FZLA 2XE3A 4LSIA 3WI5A 2F1VA 4FSPA 3VY9X 3AA1A 5T5FA 4O3YA 2MHLA 3T20A 3SYBA 2KC0A 5AFUL 5JDPA 3HWBA 3UAQA 4AFKA 3POQA 2LHFA 4FESA 4FUVA 1OPFA 3PQUA 2XE2A 3GP6A 3VE1A 3LK41 3AA7B 5ADXK 2Y2XA 4N58A 4BUMX 2Y0LA 2JMMA 4AYDC 3PQSA 3AA6B 2Y0HA 4AKMA 2PORA 1OSMA 1H6S1 3AA0B 4U9CA 5DL5A 4D64A 4AKRA 1GFQA 2KZ7A 2M06A 1BXWA 3KVDD 4LSFA 2YNKA 5EE2A 4C69X 2XE5A 1ZHTA 1ZHZA 3AAAA 4AUIA 1BH3A 4E1TA 2KDYA 1ZHWA 3JTYA 2M07A 5D5DA 3RBHA 3DA3A 4O3ZA 4JCHA 1HXUA 3HOEA 4LSEA 5DL7A 1QJ9A 4FZNA 1ZHYA 1HXTA 3FYXA 2O4VA 1IZNB 1GFMA 1PHOA 4AYNA 5ADXL 2W80C 5FVNA 2LFUA 3AAEA 4FZMA 4RLCA 5DL6A 3SY7A 3TZGA 1P4TA 3LK2A 3NSGA 1GFOA 2XE1A 4KRAA 4KR4A 1GFNA 4O3XB 2W81C 3SZDA 2K0LA 2KXPA 4RL9A 1HXXA 4E1SA 1PRNA 4Z3TA 2Y7SA 4JFBA 1E54A 4XNKA 4XNLA 2K4TA 4QQ1A 3T24A 4AYEC 4FRXA 4FT6A 4FOZA 2ODJA 2ZFGA 3PRNA 4G76A 2XG6A 3T0SA 4GCPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5T5F A;  2KDY A;  4O3Y A;  4O3W A;  2KC0 A;  4O3Z A;  3HOL A;  3HOE A;  4O4X A;  3UAQ A;  3VE1 A;  3PQU A;  4AYN A;  3VE2 A;  2W80 C;  2LFU A;  3V8U A;  4AYD C;  4O4U A;  3PQS A;  4AYM C;  4O3X B;  2W81 C;  4U9C A;  1YS5 A;  4Z3T A;  2Y7S A;  3KVD D;  4QQ1 A;  4O49 A;  4AYE C;  2YPV A;  4AYI D;  5EE2 A; 
#chains in the Genus database with same CATH topology
 1MM4 A;  1MPF A;  4D64 A;  4PR7 A;  3AAA B;  5KAI O;  3VZW X;  2FGQ X;  3AA1 B;  4AYE C;  3VZU X;  1G90 A;  2WVP A;  2Y0K A;  4RLB A;  3PF1 A;  4G75 A;  5G26 A;  2R4P A;  4O4X A;  3AA7 A;  5G38 A;  3DA4 A;  1Q9G A;  2ERV A;  4FMS A;  2WJQ A;  4B61 A;  2F1T A;  2X27 X;  3UU2 A;  3K19 A;  3AAE B;  3POX A;  3A0H O;  1ORM A;  3AA6 A;  2J1N A;  2AXT O;  3C5O A;  3BS0 A;  2XMX A;  3HW9 A;  3LK2 B;  4FSO A;  4GCP A;  4O4U A;  5E79 O;  4PUX A;  1Q9F A;  2N2M A;  2XTQ A;  1GFP A;  2QTK A;  3A2S X;  2R8A A;  3DWN A;  4LSH A;  2OMF A;  5B66 O;  4AKR B;  1QJ8 A;  2ZLD A;  5GV0 A;  1MM5 A;  2KZ7 B;  2YPV A;  4AYI D;  1S5L O;  4D5U A;  3LK3 A;  4C4V B;  5IYU A;  2R4O A;  4CTD A;  2IWW A;  3G7G A;  3WI4 A;  4N75 A;  3O0E A;  6PRN A;  3NJT A;  2MNH A;  4FRT A;  4GF4 A;  4O3W A;  5AFU K;  5B5E O;  1ZHX A;  3UPG A;  5KAF O;  3HOL A;  2XTR A;  3EMN X;  2X9K A;  1IZN A;  3QRA A;  2FGR A;  3VY8 X;  4AZL A;  3POU A;  4D65 A;  3SY9 A;  7PRN A;  8PRN A;  3VE2 A;  4GHB A;  2PRN A;  3V8U A;  3SYS A;  3SZV A;  3LK3 B;  3QRC A;  4GCQ A;  4AYM C;  2N2L A;  3AA0 A;  3LK4 2;  4RJW A;  3POR A;  1YS5 A;  4GCS A;  4KR8 A;  4N59 A;  4RJX A;  4F4B A;  4IL6 O;  2J4U P;  1THQ A;  2KXP B;  3PGU A;  5DL8 A;  5PRN A;  3SZD A;  2GE4 A;  4O49 A;  3VZT X;  1QJP A;  5H2F O;  1BT9 A;  3BRY A;  4FZL A;  2XE3 A;  4UB6 O;  4LSI A;  3WI5 A;  2F1V A;  2R4N A;  1T16 A;  4FSP A;  3AA1 A;  5T5F A;  3VY9 X;  2R4L A;  2MHL A;  4O3Y A;  3T20 A;  3SYB A;  2KC0 A;  3KZI O;  5AFU L;  5TIS O;  5JDP A;  3HWB A;  3UAQ A;  4AFK A;  3POQ A;  2LHF A;  4FES A;  4FUV A;  1OPF A;  3PQU A;  2XE2 A;  2JQY A;  3GP6 A;  3VE1 A;  3LK4 1;  3AA7 B;  5ADX K;  2Y2X A;  4N58 A;  4BUM X;  3PGR A;  2Y0L A;  2R88 A;  2JMM A;  2F1C X;  4AYD C;  3PQS A;  3AA6 B;  2Y0H A;  4AKM A;  2POR A;  1OSM A;  1H6S 1;  2WJR A;  3AA0 B;  3DWO X;  4U9C A;  5DL5 A;  5G3A A;  4K3B A;  4AKR A;  1GFQ A;  4N74 A;  2KZ7 A;  3A0B O;  4C00 A;  2M06 A;  1BXW A;  3KVD D;  4LSF A;  4C4V A;  2YNK A;  5EE2 A;  4C69 X;  2XE5 A;  3BRZ A;  1ZHT A;  1ZHZ A;  3AAA A;  4PJ0 O;  1BH3 A;  4AUI A;  2KDY A;  1ZHW A;  2R89 A;  4FQE A;  3JTY A;  4E1T A;  2M07 A;  3DZM A;  5D5D A;  3RBH A;  3DA3 A;  4O3Z A;  4JCH A;  1HXU A;  3HOE A;  4LSE A;  5DL7 A;  1QJ9 A;  4FZN A;  1ZHY A;  1HXT A;  3FYX A;  2O4V A;  5GTH O;  1IZN B;  1GFM A;  1PHO A;  4AYN A;  5ADX L;  2W80 C;  5FVN A;  2LFU A;  3AAE A;  4FZM A;  4RLC A;  4UB8 O;  5DL6 A;  3SY7 A;  3TZG A;  1P4T A;  3LK2 A;  3NSG A;  1GFO A;  2XE1 A;  4KRA A;  4KR4 A;  1GFN A;  2IWV A;  2W81 C;  4O3X B;  2K0L A;  2KXP A;  4RL9 A;  1HXX A;  5GTI O;  1PRN A;  5G39 A;  4E1S A;  4Z3T A;  2Y7S A;  4K3C A;  3WU2 O;  4JFB A;  1E54 A;  1T1L A;  4XNK A;  4XNL A;  2K4T A;  4QQ1 A;  3T24 A;  3PGS A;  4FRX A;  4FT6 A;  4FOZ A;  2ODJ A;  2ZFG A;  3PRN A;  4G76 A;  2XG6 A;  3T0S A;  3JCU O; 
#chains in the Genus database with same CATH homology
 1MM4 A;  1MPF A;  3AAA B;  3VZW X;  2FGQ X;  3AA1 B;  3VZU X;  1G90 A;  2Y0K A;  4RLB A;  4G75 A;  5G26 A;  4O4X A;  3AA7 A;  3DA4 A;  1Q9G A;  2ERV A;  4FMS A;  4B61 A;  2F1T A;  2X27 X;  3UU2 A;  3K19 A;  3AAE B;  3POX A;  3HW9 A;  1ORM A;  3AA6 A;  2J1N A;  3C5O A;  3LK3 A;  4O4U A;  2XMX A;  4FSO A;  3LK2 B;  4PUX A;  1Q9F A;  2N2M A;  2XTQ A;  1GFP A;  2QTK A;  3A2S X;  4LSH A;  2OMF A;  4AKR B;  1QJ8 A;  2ZLD A;  5GV0 A;  1MM5 A;  2KZ7 B;  2YPV A;  4AYI D;  4D5U A;  5IYU A;  3G7G A;  3WI4 A;  3O0E A;  6PRN A;  2MNH A;  4FRT A;  4GF4 A;  4O3W A;  5AFU K;  1ZHX A;  3UPG A;  3HOL A;  2XTR A;  3EMN X;  3QRA A;  1IZN A;  3VY8 X;  2FGR A;  4AZL A;  3POU A;  4D65 A;  3SY9 A;  7PRN A;  8PRN A;  3VE2 A;  4GHB A;  2PRN A;  3V8U A;  3SYS A;  3SZV A;  3LK3 B;  3QRC A;  4GCQ A;  4AYM C;  2N2L A;  3AA0 A;  3LK4 2;  4RJW A;  3POR A;  1YS5 A;  4GCS A;  4KR8 A;  4N59 A;  4RJX A;  4F4B A;  2J4U P;  1THQ A;  2KXP B;  5DL8 A;  5PRN A;  2GE4 A;  4O49 A;  3VZT X;  1QJP A;  1BT9 A;  4FZL A;  2XE3 A;  4LSI A;  3WI5 A;  2F1V A;  4FSP A;  3VY9 X;  3AA1 A;  5T5F A;  4O3Y A;  2MHL A;  3T20 A;  3SYB A;  2KC0 A;  5AFU L;  5JDP A;  3HWB A;  3UAQ A;  4AFK A;  3POQ A;  2LHF A;  4FES A;  4FUV A;  1OPF A;  3PQU A;  2XE2 A;  3GP6 A;  3VE1 A;  3LK4 1;  3AA7 B;  5ADX K;  2Y2X A;  4N58 A;  4BUM X;  2Y0L A;  2JMM A;  4AYD C;  3PQS A;  3AA6 B;  2Y0H A;  4AKM A;  2POR A;  1OSM A;  1H6S 1;  3AA0 B;  4U9C A;  5DL5 A;  4D64 A;  4AKR A;  1GFQ A;  2KZ7 A;  2M06 A;  1BXW A;  3KVD D;  4LSF A;  2YNK A;  5EE2 A;  4C69 X;  2XE5 A;  1ZHT A;  1ZHZ A;  3AAA A;  4AUI A;  1BH3 A;  4E1T A;  2KDY A;  1ZHW A;  3JTY A;  2M07 A;  5D5D A;  3RBH A;  3DA3 A;  4O3Z A;  4JCH A;  1HXU A;  3HOE A;  4LSE A;  5DL7 A;  1QJ9 A;  4FZN A;  1ZHY A;  1HXT A;  3FYX A;  2O4V A;  1IZN B;  1GFM A;  1PHO A;  4AYN A;  5ADX L;  2W80 C;  5FVN A;  2LFU A;  3AAE A;  4FZM A;  4RLC A;  5DL6 A;  3SY7 A;  3TZG A;  1P4T A;  3LK2 A;  3NSG A;  1GFO A;  2XE1 A;  4KRA A;  4KR4 A;  1GFN A;  4O3X B;  2W81 C;  3SZD A;  2K0L A;  2KXP A;  4RL9 A;  1HXX A;  4E1S A;  1PRN A;  4Z3T A;  2Y7S A;  4JFB A;  1E54 A;  4XNK A;  4XNL A;  2K4T A;  4QQ1 A;  3T24 A;  4AYE C;  4FRX A;  4FT6 A;  4FOZ A;  2ODJ A;  2ZFG A;  3PRN A;  4G76 A;  2XG6 A;  3T0S A;  4GCP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...