1YS5A

Solution structure of the antigenic domain of gna1870 of neisseria meningitidis
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
156
structure length
156
Chain Sequence
MQSHSALTAFQTEQIQDSEHSGKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGSDDAGGKLTYTIDFAAKQGNGKIEHLKSPELNVDLAAADIKPDGKRHAVISGSVLYNQAEKGSYSLGIFGGKAQEVAGSAEVKTVNGIRHIGLAAKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the immunodominant domain of protective antigen GNA1870 of Neisseria meningitidis
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Signaling protein
molecule keywords lipoprotein
total genus 28
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2005-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 1ys5A01
3VE2A 3UAQA 2Y7SA 3VE1A 3KVDD 4O3XB 4O49A 4AYNA 3HOLA 3V8UA 4QQ1A 4O3YA 4O4XA 5EE2A 3PQUA 3HOEA 2KDYA 4AYDC 4O3ZA 4AYID 4Z3TA 2W81C 2YPVA 4U9CA 1YS5A 4O4UA 2LFUA 3PQSA 2KC0A 4AYEC 4AYMC 2W80C 5T5FA 4O3WA
chains in the Genus database with same CATH superfamily
3HWBA 5DL6A 5H2FO 3T24A 3DA4A 1QJ8A 3UAQA 4AZLA 3AA6A 4E1TA 5KAFO 1Q9GA 1GFQA 4CTDA 4RLCA 4D65A 3HOLA 2YNKA 3WU2O 3POUA 5AFUK 4QQ1A 4LSEA 2N2LA 3AA0B 4KR4A 3JCUO 6PRNA 4PUXA 2Y0KA 2WJRA 2J1NA 3DZMA 3LK3A 2LHFA 2KXPA 4BUMX 3QRCA 2YPVA 3AAAB 3C5OA 3SY7A 2K0LA 5DL7A 4O4UA 3SY9A 3AA1A 4XNLA 4PJ0O 4AYMC 2W80C 3A2SX 2KXPB 2M07A 1BH3A 3G7GA 5G38A 8PRNA 5JDPA 4FRTA 5DL8A 3AA7B 2KZ7A 2WVPA 2PORA 4FQEA 4O3WA 4RLBA 2K4TA 3QRAA 5TISO 4RJWA 4GF4A 3VE1A 5B5EO 5GV0A 2KZ7B 3KVDD 2QTKA 4FT6A 4C69X 1H6S1 2XTQA 3A0BO 3O0EA 3PGRA 3WI5A 3DWNA 3TZGA 2R4OA 4D5UA 5G3AA 5E79O 2IWWA 4AKMA 3SZDA 3V8UA 3PGSA 4N59A 3SZVA 1BT9A 5GTHO 3PQUA 3A0HO 1ZHXA 3HOEA 5KAIO 2KDYA 3LK42 3UU2A 5FVNA 4AYID 5G39A 4FUVA 4JCHA 1S5LO 3SYBA 2R89A 3WI4A 3BRYA 2ZFGA 3NSGA 5GTIO 1G90A 1PHOA 4UB6O 4FZMA 3POXA 3T20A 2IWVA 2R8AA 3PQSA 4FMSA 1PRNA 1GFPA 5D5DA 2F1CX 4D64A 1ZHYA 2FGQX 4LSIA 1P4TA 1QJPA 3AA6B 2OMFA 4B61A 3FYXA 2XE1A 3PF1A 2J4UP 4XNKA 2O4VA 4FZLA 3VE2A 2N2MA 5IYUA 1Q9FA 3VY8X 3BS0A 3VY9X 1OPFA 4F4BA 2XE5A 3AAEB 3POQA 3PRNA 2ZLDA 4G76A 4AYNA 3LK2A 4FOZA 4O3YA 5G26A 4AKRA 3AA1B 1HXXA 1IZNB 3EMNX 4AUIA 4K3BA 1MM5A 1QJ9A 4AYDC 5B66O 4O3ZA 1T16A 5ADXL 4JFBA 4RJXA 2W81C 4LSHA 1GFNA 4FESA 3PORA 4LSFA 3HW9A 2M06A 4AKRB 2GE4A 2LFUA 3K19A 1THQA 3AA0A 3DA3A 3SYSA 3GP6A 3BRZA 1BXWA 3LK3B 2X27X 3PGUA 2XTRA 2XG6A 2R4NA 2R88A 4GCQA 4AFKA 3UPGA 2ODJA 2ERVA 5T5FA 2PRNA 4FZNA 3NJTA 3RBHA 4FRXA 4KR8A 2Y0LA 2F1VA 2X9KA 2R4PA 2Y7SA 4FSOA 4O3XB 3T0SA 4O49A 3VZWX 1OSMA 3AA7A 4N74A 4IL6O 1E54A 2XE2A 3AAAA 3JTYA 4GCPA 4C00A 3AAEA 1ORMA 4GCSA 4O4XA 5EE2A 3KZIO 1T1LA 3VZUX 2MHLA 4PR7A 2WJQA 4FSPA 2AXTO 3DWOX 5DL5A 2F1TA 1MM4A 3LK41 5AFUL 4Z3TA 7PRNA 2XMXA 4E1SA 2JQYA 4C4VB 2R4LA 4U9CA 3LK2B 2JMMA 1YS5A 3VZTX 1ZHWA 5ADXK 2KC0A 1ZHZA 4UB8O 1IZNA 4AYEC 2FGRA 4C4VA 4KRAA 4G75A 1GFOA 2Y2XA 1HXUA 2Y0HA 4RL9A 2XE3A 1GFMA 1ZHTA 4N58A 5PRNA 1HXTA 4GHBA 4N75A 2MNHA 1MPFA 4K3CA
chains in the Genus database with same CATH topology
3HWBA 5DL6A 3T24A 3DA4A 1QJ8A 3UAQA 4AZLA 3AA6A 4E1TA 1Q9GA 1GFQA 4RLCA 4D65A 3HOLA 2YNKA 3POUA 5AFUK 4QQ1A 4LSEA 2N2LA 3AA0B 4KR4A 6PRNA 4PUXA 2Y0KA 2J1NA 3LK3A 2LHFA 2KXPA 4BUMX 3QRCA 2YPVA 3AAAB 3C5OA 3SY7A 2K0LA 5DL7A 4O4UA 3SY9A 3AA1A 4XNLA 4AYMC 2W80C 3A2SX 2KXPB 2M07A 1BH3A 3G7GA 8PRNA 5JDPA 4FRTA 5DL8A 3AA7B 2KZ7A 2PORA 4O3WA 4RLBA 2K4TA 3QRAA 4RJWA 4GF4A 3VE1A 5GV0A 2KZ7B 3KVDD 2QTKA 4FT6A 4C69X 1H6S1 2XTQA 3O0EA 3WI5A 4D5UA 3TZGA 4AKMA 3SZDA 3V8UA 4N59A 3SZVA 1BT9A 3PQUA 1ZHXA 3HOEA 3UU2A 2KDYA 3LK42 5FVNA 4AYID 4FUVA 4JCHA 3SYBA 3WI4A 3NSGA 2ZFGA 1G90A 1PHOA 4FZMA 3POXA 3PQSA 4FMSA 1PRNA 1GFPA 5D5DA 4D64A 1ZHYA 2FGQX 4LSIA 1P4TA 1QJPA 3AA6B 2OMFA 4B61A 3FYXA 2XE1A 2J4UP 4XNKA 2O4VA 4FZLA 3VE2A 2N2MA 5IYUA 1Q9FA 3VY8X 3VY9X 1OPFA 4F4BA 2XE5A 3AAEB 3POQA 3PRNA 2ZLDA 4G76A 4AYNA 3LK2A 4FOZA 4O3YA 5G26A 4AKRA 3AA1B 1HXXA 1IZNB 3EMNX 4AUIA 4AYDC 1MM5A 1QJ9A 4O3ZA 5ADXL 4JFBA 4RJXA 2W81C 4LSHA 1GFNA 4FESA 3PORA 4LSFA 3HW9A 2M06A 4AKRB 2GE4A 2LFUA 3K19A 1THQA 3AA0A 3DA3A 3SYSA 3GP6A 1BXWA 3LK3B 2X27X 2XTRA 2XG6A 4GCQA 4AFKA 3UPGA 2ODJA 2ERVA 5T5FA 2PRNA 4FZNA 3RBHA 4FRXA 4KR8A 2Y0LA 2F1VA 2Y7SA 4FSOA 4O3XB 3T0SA 4O49A 3VZWX 1OSMA 3AA7A 1E54A 2XE2A 3AAAA 3JTYA 4GCPA 3AAEA 1ORMA 4GCSA 4O4XA 5EE2A 3VZUX 2MHLA 3T20A 4FSPA 5DL5A 2F1TA 1MM4A 3LK41 5AFUL 4Z3TA 7PRNA 2XMXA 4E1SA 4U9CA 3LK2B 2JMMA 1YS5A 3VZTX 1ZHWA 5ADXK 2KC0A 1ZHZA 4AYEC 1IZNA 2FGRA 4KRAA 4G75A 1GFOA 2Y2XA 2Y0HA 1HXUA 4RL9A 2XE3A 1GFMA 1ZHTA 4N58A 5PRNA 1HXTA 4GHBA 2MNHA 1MPFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VE2 A;  3UAQ A;  2Y7S A;  3VE1 A;  3KVD D;  4O3X B;  4O49 A;  4AYN A;  3HOL A;  3V8U A;  4QQ1 A;  4O3Y A;  4O4X A;  5EE2 A;  3PQU A;  3HOE A;  2KDY A;  4AYD C;  4O3Z A;  4AYI D;  4Z3T A;  2W81 C;  2YPV A;  4U9C A;  1YS5 A;  4O4U A;  2LFU A;  3PQS A;  2KC0 A;  4AYE C;  4AYM C;  2W80 C;  5T5F A;  4O3W A; 
#chains in the Genus database with same CATH topology
 3HWB A;  5DL6 A;  5H2F O;  3T24 A;  3DA4 A;  1QJ8 A;  3UAQ A;  4AZL A;  3AA6 A;  4E1T A;  5KAF O;  1Q9G A;  1GFQ A;  4CTD A;  4RLC A;  4D65 A;  3HOL A;  2YNK A;  3WU2 O;  3POU A;  5AFU K;  4QQ1 A;  4LSE A;  2N2L A;  3AA0 B;  4KR4 A;  3JCU O;  6PRN A;  4PUX A;  2Y0K A;  2WJR A;  2J1N A;  3DZM A;  3LK3 A;  2LHF A;  2KXP A;  4BUM X;  3QRC A;  2YPV A;  3AAA B;  3C5O A;  3SY7 A;  2K0L A;  5DL7 A;  4O4U A;  3SY9 A;  3AA1 A;  4XNL A;  4PJ0 O;  4AYM C;  2W80 C;  3A2S X;  2KXP B;  2M07 A;  1BH3 A;  3G7G A;  5G38 A;  8PRN A;  5JDP A;  4FRT A;  5DL8 A;  3AA7 B;  2KZ7 A;  2WVP A;  2POR A;  4FQE A;  4O3W A;  4RLB A;  2K4T A;  3QRA A;  5TIS O;  4RJW A;  4GF4 A;  3VE1 A;  5B5E O;  5GV0 A;  2KZ7 B;  3KVD D;  2QTK A;  4FT6 A;  4C69 X;  1H6S 1;  2XTQ A;  3A0B O;  3O0E A;  3PGR A;  3WI5 A;  3DWN A;  3TZG A;  2R4O A;  4D5U A;  5G3A A;  5E79 O;  2IWW A;  4AKM A;  3SZD A;  3V8U A;  3PGS A;  4N59 A;  3SZV A;  1BT9 A;  5GTH O;  3PQU A;  3A0H O;  1ZHX A;  3HOE A;  5KAI O;  2KDY A;  3LK4 2;  3UU2 A;  5FVN A;  4AYI D;  5G39 A;  4FUV A;  4JCH A;  1S5L O;  3SYB A;  2R89 A;  3WI4 A;  3BRY A;  2ZFG A;  3NSG A;  5GTI O;  1G90 A;  1PHO A;  4UB6 O;  4FZM A;  3POX A;  3T20 A;  2IWV A;  2R8A A;  3PQS A;  4FMS A;  1PRN A;  1GFP A;  5D5D A;  2F1C X;  4D64 A;  1ZHY A;  2FGQ X;  4LSI A;  1P4T A;  1QJP A;  3AA6 B;  2OMF A;  4B61 A;  3FYX A;  2XE1 A;  3PF1 A;  2J4U P;  4XNK A;  2O4V A;  4FZL A;  3VE2 A;  2N2M A;  5IYU A;  1Q9F A;  3VY8 X;  3BS0 A;  3VY9 X;  1OPF A;  4F4B A;  2XE5 A;  3AAE B;  3POQ A;  3PRN A;  2ZLD A;  4G76 A;  4AYN A;  3LK2 A;  4FOZ A;  4O3Y A;  5G26 A;  4AKR A;  3AA1 B;  1HXX A;  1IZN B;  3EMN X;  4AUI A;  4K3B A;  1MM5 A;  1QJ9 A;  4AYD C;  5B66 O;  4O3Z A;  1T16 A;  5ADX L;  4JFB A;  4RJX A;  2W81 C;  4LSH A;  1GFN A;  4FES A;  3POR A;  4LSF A;  3HW9 A;  2M06 A;  4AKR B;  2GE4 A;  2LFU A;  3K19 A;  1THQ A;  3AA0 A;  3DA3 A;  3SYS A;  3GP6 A;  3BRZ A;  1BXW A;  3LK3 B;  2X27 X;  3PGU A;  2XTR A;  2XG6 A;  2R4N A;  2R88 A;  4GCQ A;  4AFK A;  3UPG A;  2ODJ A;  2ERV A;  5T5F A;  2PRN A;  4FZN A;  3NJT A;  3RBH A;  4FRX A;  4KR8 A;  2Y0L A;  2F1V A;  2X9K A;  2R4P A;  2Y7S A;  4FSO A;  4O3X B;  3T0S A;  4O49 A;  3VZW X;  1OSM A;  3AA7 A;  4N74 A;  4IL6 O;  1E54 A;  2XE2 A;  3AAA A;  3JTY A;  4GCP A;  4C00 A;  3AAE A;  1ORM A;  4GCS A;  4O4X A;  5EE2 A;  3KZI O;  1T1L A;  3VZU X;  2MHL A;  4PR7 A;  2WJQ A;  4FSP A;  2AXT O;  3DWO X;  5DL5 A;  2F1T A;  1MM4 A;  3LK4 1;  5AFU L;  4Z3T A;  7PRN A;  2XMX A;  4E1S A;  2JQY A;  4C4V B;  2R4L A;  4U9C A;  3LK2 B;  2JMM A;  1YS5 A;  3VZT X;  1ZHW A;  5ADX K;  2KC0 A;  1ZHZ A;  4UB8 O;  1IZN A;  4AYE C;  2FGR A;  4C4V A;  4KRA A;  4G75 A;  1GFO A;  2Y2X A;  1HXU A;  2Y0H A;  4RL9 A;  2XE3 A;  1GFM A;  1ZHT A;  4N58 A;  5PRN A;  1HXT A;  4GHB A;  4N75 A;  2MNH A;  1MPF A;  4K3C A; 
#chains in the Genus database with same CATH homology
 3HWB A;  5DL6 A;  3T24 A;  3DA4 A;  1QJ8 A;  3UAQ A;  4AZL A;  3AA6 A;  4E1T A;  1Q9G A;  1GFQ A;  4RLC A;  4D65 A;  3HOL A;  2YNK A;  3POU A;  5AFU K;  4QQ1 A;  4LSE A;  2N2L A;  3AA0 B;  4KR4 A;  6PRN A;  4PUX A;  2Y0K A;  2J1N A;  3LK3 A;  2LHF A;  2KXP A;  4BUM X;  3QRC A;  2YPV A;  3AAA B;  3C5O A;  3SY7 A;  2K0L A;  5DL7 A;  4O4U A;  3SY9 A;  3AA1 A;  4XNL A;  4AYM C;  2W80 C;  3A2S X;  2KXP B;  2M07 A;  1BH3 A;  3G7G A;  8PRN A;  5JDP A;  4FRT A;  5DL8 A;  3AA7 B;  2KZ7 A;  2POR A;  4O3W A;  4RLB A;  2K4T A;  3QRA A;  4RJW A;  4GF4 A;  3VE1 A;  5GV0 A;  2KZ7 B;  3KVD D;  2QTK A;  4FT6 A;  4C69 X;  1H6S 1;  2XTQ A;  3O0E A;  3WI5 A;  4D5U A;  3TZG A;  4AKM A;  3SZD A;  3V8U A;  4N59 A;  3SZV A;  1BT9 A;  3PQU A;  1ZHX A;  3HOE A;  3UU2 A;  2KDY A;  3LK4 2;  5FVN A;  4AYI D;  4FUV A;  4JCH A;  3SYB A;  3WI4 A;  3NSG A;  2ZFG A;  1G90 A;  1PHO A;  4FZM A;  3POX A;  3PQS A;  4FMS A;  1PRN A;  1GFP A;  5D5D A;  4D64 A;  1ZHY A;  2FGQ X;  4LSI A;  1P4T A;  1QJP A;  3AA6 B;  2OMF A;  4B61 A;  3FYX A;  2XE1 A;  2J4U P;  4XNK A;  2O4V A;  4FZL A;  3VE2 A;  2N2M A;  5IYU A;  1Q9F A;  3VY8 X;  3VY9 X;  1OPF A;  4F4B A;  2XE5 A;  3AAE B;  3POQ A;  3PRN A;  2ZLD A;  4G76 A;  4AYN A;  3LK2 A;  4FOZ A;  4O3Y A;  5G26 A;  4AKR A;  3AA1 B;  1HXX A;  1IZN B;  3EMN X;  4AUI A;  4AYD C;  1MM5 A;  1QJ9 A;  4O3Z A;  5ADX L;  4JFB A;  4RJX A;  2W81 C;  4LSH A;  1GFN A;  4FES A;  3POR A;  4LSF A;  3HW9 A;  2M06 A;  4AKR B;  2GE4 A;  2LFU A;  3K19 A;  1THQ A;  3AA0 A;  3DA3 A;  3SYS A;  3GP6 A;  1BXW A;  3LK3 B;  2X27 X;  2XTR A;  2XG6 A;  4GCQ A;  4AFK A;  3UPG A;  2ODJ A;  2ERV A;  5T5F A;  2PRN A;  4FZN A;  3RBH A;  4FRX A;  4KR8 A;  2Y0L A;  2F1V A;  2Y7S A;  4FSO A;  4O3X B;  3T0S A;  4O49 A;  3VZW X;  1OSM A;  3AA7 A;  1E54 A;  2XE2 A;  3AAA A;  3JTY A;  4GCP A;  3AAE A;  1ORM A;  4GCS A;  4O4X A;  5EE2 A;  3VZU X;  2MHL A;  3T20 A;  4FSP A;  5DL5 A;  2F1T A;  1MM4 A;  3LK4 1;  5AFU L;  4Z3T A;  7PRN A;  2XMX A;  4E1S A;  4U9C A;  3LK2 B;  2JMM A;  1YS5 A;  3VZT X;  1ZHW A;  5ADX K;  2KC0 A;  1ZHZ A;  4AYE C;  1IZN A;  2FGR A;  4KRA A;  4G75 A;  1GFO A;  2Y2X A;  2Y0H A;  1HXU A;  4RL9 A;  2XE3 A;  1GFM A;  1ZHT A;  4N58 A;  5PRN A;  1HXT A;  4GHB A;  2MNH A;  1MPF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...