1YSBA

Yeast cytosine deaminase triple mutant
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
156
structure length
156
Chain Sequence
TGGMASKWDQKGMDIAYEEALLGYKEGGVPIGGCLINNKDGSVLGRGHNMRFQKGSATLHGEISTLENCGRLEGKVYKDTTLYTTLSPCDMCTGAIIMYGIPRCVIGENVNFKSKGEKYLQTRGHEVVVVDDERCKKLMKQFIDERPQDWFEDIGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Computational thermostabilization of an enzyme.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords Cytosine deaminase
total genus 64
structure length 156
sequence length 156
chains with identical sequence B
ec nomenclature ec 3.5.4.1: Cytosine deaminase.
pdb deposition date 2005-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00383 dCMP_cyt_deam_1 Cytidine and deoxycytidylate deaminase zinc-binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.140.10 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase, domain 2 1ysbA00
2OBCA 4ILGC 2PW9A 4I43B 2P87A 3SBGA 2G6VA 4LC5A 1UWZA 1WWRA 1CTTA 2QLCA 4MSDA 4EG2A 3RZUA 2D5NA 2Z3JA 1JTKA 3DMOA 4ZD4A 4O8XA 4MS7A 1P6OA 4F7OA 2NX8A 3ZEFB 1UX1A 4OCNB 2NYTA 3ZPGA 4F3WA 1OX7A 1WN5A 1ZABA 2O95A 4E0QA 2B3ZA 3ZPCA 2W4LA 2A8NA 1Z3AA 2P8RA 4P9DA 5C2OA 2Z3GA 4LCOA 2HXVA 1ALNA 2Z3HA 3G8QA 3IJFX 4ZFRA 4LD4A 2KKSA 2O3KA 3EX8A 1WKQA 4O8XB 2O7PA 2FR6A 1TIYA 1YSBA 4K1RA 4HRWA 3OCQA 4HRQA 2HVWA 4P9CA 2B3JA 4P9EA 4MSMA 1YSDA 4LCNA 4NQLA 4OWPA 4JXEA 4LCPA 2ZNRA 2O96A 4PQTA 3DH1A 1OI0A 4QFTA 4ZD5A 4OWPB 2FR5A 2ZNVA 4KITC 4BGDC 3E1UA 4OCMA 5CW6A 4OCLB 1AF2A 2RPZA 5DCAJ 1MQ0A 3MPZA 4ZFTA 4OCLA 1RB7A 2D30A 1UAQA 1CTUA 1R5XA 3OJ6A 4D10F 2KCQA 4WIFA 4O8YB 2OG4A 4WIGA 1VQ2A 4MSJA 1UX0A 5GAOA 2G84A 4G3MA 3B8FA 4O8YA 5M59B 4MSQA 2HVVA 2Z3IA 3R2NA 5M52C 3RZVA 4OCNA 1R5TA 1WN6A 4LD2A 4OCMB
chains in the Genus database with same CATH superfamily
2OBCA 4ILGC 2PW9A 1M9NA 4I43B 2P87A 3SBGA 2G6VA 4LC5A 1UWZA 1WWRA 1CTTA 2QLCA 4MSDA 2B1GA 1ZCZA 4EG2A 3RZUA 2D5NA 3BH1A 2Z3JA 1JTKA 3DMOA 4ZD4A 4O8XA 4MS7A 1P6OA 4F7OA 3VX8A 2NX8A 1PL0A 3ZEFB 1UX1A 4OCNB 2NYTA 3ZPGA 4F3WA 4GGMX 4A1OA 1OX7A 1WN5A 1ZABA 2O95A 4E0QA 2B3ZA 3ZPCA 2W4LA 2A8NA 1Z3AA 2P8RA 4P9DA 5C2OA 2Z3GA 4LCOA 2HXVA 1ALNA 2Z3HA 3G8QA 1PKXA 3IJFX 4LD4A 4ZFRA 2KKSA 2O3KA 3EX8A 1WKQA 4O8XB 2O7PA 2FR6A 1TIYA 1YSBA 4K1RA 1P4RA 4HRWA 3OCQA 4HRQA 2HVWA 4P9CA 2B3JA 4P9EA 4MSMA 1YSDA 4LCNA 2B1IA 1G8MA 4NQLA 4OWPA 4JXEA 4LCPA 2ZNRA 2O96A 4PQTA 3DH1A 1OI0A 4QFTA 4ZD5A 4OWPB 2FR5A 2ZNVA 4KITC 4BGDC 3E1UA 4J6EA 4OCMA 5CW6A 4OCLB 1AF2A 2RPZA 5DCAJ 1MQ0A 3MPZA 4ZFTA 4OCLA 1RB7A 1OZ0A 2D30A 1UAQA 1CTUA 1R5XA 3OJ6A 4D10F 2KCQA 4WIFA 4O8YB 2OG4A 3ZZMA 4WIGA 1VQ2A 4MSJA 1UX0A 5GAOA 2G84A 4G3MA 3B8FA 4O8YA 1THZA 5M59B 1VK9A 2IU0A 4MSQA 2HVVA 2Z3IA 3R2NA 5M52C 3RZVA 4OCNA 4EHIA 1R5TA 1WN6A 4LD2A 4OCMB 2IU3A
chains in the Genus database with same CATH topology
2OBCA 4ILGC 2PW9A 4I43B 2P87A 3SBGA 2G6VA 4LC5A 1UWZA 1WWRA 1CTTA 2QLCA 4MSDA 4EG2A 3RZUA 2D5NA 2Z3JA 1JTKA 3DMOA 4ZD4A 4O8XA 4MS7A 1P6OA 4F7OA 2NX8A 3ZEFB 1UX1A 4OCNB 2NYTA 3ZPGA 4F3WA 1OX7A 1WN5A 1ZABA 2O95A 4E0QA 2B3ZA 3ZPCA 2W4LA 2A8NA 1Z3AA 2P8RA 4P9DA 5C2OA 2Z3GA 4LCOA 2HXVA 1ALNA 2Z3HA 3G8QA 3IJFX 4ZFRA 4LD4A 2KKSA 2O3KA 3EX8A 1WKQA 4O8XB 2O7PA 2FR6A 1TIYA 1YSBA 4K1RA 4HRWA 3OCQA 4HRQA 2HVWA 4P9CA 2B3JA 4P9EA 4MSMA 1YSDA 4LCNA 4NQLA 4OWPA 4JXEA 4LCPA 2ZNRA 2O96A 4PQTA 3DH1A 1OI0A 4QFTA 4ZD5A 4OWPB 2FR5A 2ZNVA 4KITC 4BGDC 3E1UA 4OCMA 5CW6A 4OCLB 1AF2A 2RPZA 5DCAJ 1MQ0A 3MPZA 4ZFTA 4OCLA 1RB7A 2D30A 1UAQA 1CTUA 1R5XA 3OJ6A 4D10F 2KCQA 4WIFA 4O8YB 2OG4A 4WIGA 1VQ2A 4MSJA 1UX0A 5GAOA 2G84A 4G3MA 3B8FA 4O8YA 5M59B 4MSQA 2HVVA 2Z3IA 3R2NA 5M52C 3RZVA 4OCNA 1R5TA 1WN6A 4LD2A 4OCMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OBC A;  4ILG C;  2PW9 A;  4I43 B;  2P87 A;  3SBG A;  2G6V A;  4LC5 A;  1UWZ A;  1WWR A;  1CTT A;  2QLC A;  4MSD A;  4EG2 A;  3RZU A;  2D5N A;  2Z3J A;  1JTK A;  3DMO A;  4ZD4 A;  4O8X A;  4MS7 A;  1P6O A;  4F7O A;  2NX8 A;  3ZEF B;  1UX1 A;  4OCN B;  2NYT A;  3ZPG A;  4F3W A;  1OX7 A;  1WN5 A;  1ZAB A;  2O95 A;  4E0Q A;  2B3Z A;  3ZPC A;  2W4L A;  2A8N A;  1Z3A A;  2P8R A;  4P9D A;  5C2O A;  2Z3G A;  4LCO A;  2HXV A;  1ALN A;  2Z3H A;  3G8Q A;  3IJF X;  4ZFR A;  4LD4 A;  2KKS A;  2O3K A;  3EX8 A;  1WKQ A;  4O8X B;  2O7P A;  2FR6 A;  1TIY A;  1YSB A;  4K1R A;  4HRW A;  3OCQ A;  4HRQ A;  2HVW A;  4P9C A;  2B3J A;  4P9E A;  4MSM A;  1YSD A;  4LCN A;  4NQL A;  4OWP A;  4JXE A;  4LCP A;  2ZNR A;  2O96 A;  4PQT A;  3DH1 A;  1OI0 A;  4QFT A;  4ZD5 A;  4OWP B;  2FR5 A;  2ZNV A;  4KIT C;  4BGD C;  3E1U A;  4OCM A;  5CW6 A;  4OCL B;  1AF2 A;  2RPZ A;  5DCA J;  1MQ0 A;  3MPZ A;  4ZFT A;  4OCL A;  1RB7 A;  2D30 A;  1UAQ A;  1CTU A;  1R5X A;  3OJ6 A;  4D10 F;  2KCQ A;  4WIF A;  4O8Y B;  2OG4 A;  4WIG A;  1VQ2 A;  4MSJ A;  1UX0 A;  5GAO A;  2G84 A;  4G3M A;  3B8F A;  4O8Y A;  5M59 B;  4MSQ A;  2HVV A;  2Z3I A;  3R2N A;  5M52 C;  3RZV A;  4OCN A;  1R5T A;  1WN6 A;  4LD2 A;  4OCM B; 
#chains in the Genus database with same CATH topology
 2OBC A;  4ILG C;  2PW9 A;  1M9N A;  4I43 B;  2P87 A;  3SBG A;  2G6V A;  4LC5 A;  1UWZ A;  1WWR A;  1CTT A;  2QLC A;  4MSD A;  2B1G A;  1ZCZ A;  4EG2 A;  3RZU A;  2D5N A;  3BH1 A;  2Z3J A;  1JTK A;  3DMO A;  4ZD4 A;  4O8X A;  4MS7 A;  1P6O A;  4F7O A;  3VX8 A;  2NX8 A;  1PL0 A;  3ZEF B;  1UX1 A;  4OCN B;  2NYT A;  3ZPG A;  4F3W A;  4GGM X;  4A1O A;  1OX7 A;  1WN5 A;  1ZAB A;  2O95 A;  4E0Q A;  2B3Z A;  3ZPC A;  2W4L A;  2A8N A;  1Z3A A;  2P8R A;  4P9D A;  5C2O A;  2Z3G A;  4LCO A;  2HXV A;  1ALN A;  2Z3H A;  3G8Q A;  1PKX A;  3IJF X;  4LD4 A;  4ZFR A;  2KKS A;  2O3K A;  3EX8 A;  1WKQ A;  4O8X B;  2O7P A;  2FR6 A;  1TIY A;  1YSB A;  4K1R A;  1P4R A;  4HRW A;  3OCQ A;  4HRQ A;  2HVW A;  4P9C A;  2B3J A;  4P9E A;  4MSM A;  1YSD A;  4LCN A;  2B1I A;  1G8M A;  4NQL A;  4OWP A;  4JXE A;  4LCP A;  2ZNR A;  2O96 A;  4PQT A;  3DH1 A;  1OI0 A;  4QFT A;  4ZD5 A;  4OWP B;  2FR5 A;  2ZNV A;  4KIT C;  4BGD C;  3E1U A;  4J6E A;  4OCM A;  5CW6 A;  4OCL B;  1AF2 A;  2RPZ A;  5DCA J;  1MQ0 A;  3MPZ A;  4ZFT A;  4OCL A;  1RB7 A;  1OZ0 A;  2D30 A;  1UAQ A;  1CTU A;  1R5X A;  3OJ6 A;  4D10 F;  2KCQ A;  4WIF A;  4O8Y B;  2OG4 A;  3ZZM A;  4WIG A;  1VQ2 A;  4MSJ A;  1UX0 A;  5GAO A;  2G84 A;  4G3M A;  3B8F A;  4O8Y A;  1THZ A;  5M59 B;  1VK9 A;  2IU0 A;  4MSQ A;  2HVV A;  2Z3I A;  3R2N A;  5M52 C;  3RZV A;  4OCN A;  4EHI A;  1R5T A;  1WN6 A;  4LD2 A;  4OCM B;  2IU3 A; 
#chains in the Genus database with same CATH homology
 2OBC A;  4ILG C;  2PW9 A;  4I43 B;  2P87 A;  3SBG A;  2G6V A;  4LC5 A;  1UWZ A;  1WWR A;  1CTT A;  2QLC A;  4MSD A;  4EG2 A;  3RZU A;  2D5N A;  2Z3J A;  1JTK A;  3DMO A;  4ZD4 A;  4O8X A;  4MS7 A;  1P6O A;  4F7O A;  2NX8 A;  3ZEF B;  1UX1 A;  4OCN B;  2NYT A;  3ZPG A;  4F3W A;  1OX7 A;  1WN5 A;  1ZAB A;  2O95 A;  4E0Q A;  2B3Z A;  3ZPC A;  2W4L A;  2A8N A;  1Z3A A;  2P8R A;  4P9D A;  5C2O A;  2Z3G A;  4LCO A;  2HXV A;  1ALN A;  2Z3H A;  3G8Q A;  3IJF X;  4ZFR A;  4LD4 A;  2KKS A;  2O3K A;  3EX8 A;  1WKQ A;  4O8X B;  2O7P A;  2FR6 A;  1TIY A;  1YSB A;  4K1R A;  4HRW A;  3OCQ A;  4HRQ A;  2HVW A;  4P9C A;  2B3J A;  4P9E A;  4MSM A;  1YSD A;  4LCN A;  4NQL A;  4OWP A;  4JXE A;  4LCP A;  2ZNR A;  2O96 A;  4PQT A;  3DH1 A;  1OI0 A;  4QFT A;  4ZD5 A;  4OWP B;  2FR5 A;  2ZNV A;  4KIT C;  4BGD C;  3E1U A;  4OCM A;  5CW6 A;  4OCL B;  1AF2 A;  2RPZ A;  5DCA J;  1MQ0 A;  3MPZ A;  4ZFT A;  4OCL A;  1RB7 A;  2D30 A;  1UAQ A;  1CTU A;  1R5X A;  3OJ6 A;  4D10 F;  2KCQ A;  4WIF A;  4O8Y B;  2OG4 A;  4WIG A;  1VQ2 A;  4MSJ A;  1UX0 A;  5GAO A;  2G84 A;  4G3M A;  3B8F A;  4O8Y A;  5M59 B;  4MSQ A;  2HVV A;  2Z3I A;  3R2N A;  5M52 C;  3RZV A;  4OCN A;  1R5T A;  1WN6 A;  4LD2 A;  4OCM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...