1YSCA

2.8 angstroms structure of yeast serine carboxypeptidase
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
421
structure length
421
Chain Sequence
b'KIKDPKILGIDPNVTQYTGYLDVEDEDKHFFFWTFESRNDPAKDPVILWLNGGPGCSSLTGLFFELGPSSIGPDLKPIGNPYSWNSNATVIFLDQPVNVGFSYSGSSGVSNTVAAGKDVYNFLELFFDQFPEYVNKGQDFHIAGESYAGHYIPVFASEILSHKDRNFNLTSVLIGNGLTDPLTQYNYYEPMACGEGGEPSVLPSEECSAMEDSLERCLGLIESCYDSQSVWSCVPATIYCNNAQLAPYQRTGRNVYDIRKDCEGGNLCYPTLQDIDDYLNQDYVKEAVGAEVDHYESCNFDINRNFLFAGDWMKPYHTAVTDLLNQDLPILVYAGDKDFICNWLGNKAWTDVLPWKYDEEFASQKVRNWTASITDEVAGEVKSYKHFTYLRVFNGGHMVPFDVPENALSMVNEWIHGGFSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE CARBOXYPEPTIDASE
publication title 2.8-A structure of yeast serine carboxypeptidase
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase(carboxypeptidase)
total genus 115
structure length 421
sequence length 421
ec nomenclature ec 3.4.16.5: Carboxypeptidase C.
pdb deposition date 1994-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00450 Peptidase_S10 Serine carboxypeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.410 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1yscA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1yscA01
5FXMA 5HF8A 4IQ4A 3IVMA 2HA3A 3W9UA 2PX6A 1SCQA 3ILSA 4ZV7A 4QZVA 4L72A 3WMRA 4KE8A 4C87A 4UHDA 1EI9A 1D07A 2XMZA 1XROA 4G8DA 4BC0A 4CIBA 2BUCA 3WWDA 1XQWA 4PNZA 1LPPA 4FBLA 2NW6A 1IMJA 2B61A 3VKFA 4NVRA 2ACKA 4X97A 4I19A 3R3UA 4J0CA 3BF8A 1QIFA 2CUTA 1QIIA 3C8DA 1Y37A 2XQFA 4FHZA 2UZ0A 1SFRA 3B3QA 3V9AA 3WKAA 1BRTA 1SC9A 2Z5GA 4KAAA 3V1LA 1MX5A 4X95A 3A2NA 4Y2UA 3DOHA 3WL7A 1CUDA 2BUAA 1WHTA 5I8PA 4GDMA 2Y1KA 2C5FA 2VJAA 5ALUA 5HK9A 4RNCA 1GPNA 2HL6A 5JYCA 1VA4A 2CB9A 2WSLA 3STTA 1WB6A 3ESAA 3H2GA 4X71A 1AZWA 1QOZA 4UBNA 3ESDA 4LHEA 3YASA 2IITA 2O2GA 2WHPB 4DMCA 2VA9A 1CQWA 2ZYHA 5DJ5A 5BOVA 4FKBA 5DTIA 3HZOA 3O95A 2XLBA 2P8SA 1CPYA 4BAUA 3QM1A 2XMGA 5AK4A 3IIIA 4JYPA 3DCNA 3STXA 1DQYA 5JZ9A 1UK7A 4DLNA 1A88A 4BC1A 5ALYA 4F5ZA 3KOOA 1W4LA 1XZJA 2VAVA 3W9BA 5AM5A 4QLOA 5T4HA 3PFCA 4LIPD 1MPXA 4Y7DA 2HFKA 3L1IA 1TCAA 2I3DA 1ODTC 4EZIA 1ISPA 2BGNA 4CIAA 2C4HA 4Q3LA 1CUUA 1ODSA 1MO2A 1C4XA 1EINA 4EHBA 4U2FA 2O7VA 2RIPA 2Z8XA 1JU4A 3WKDA 3G0IA 3D7RA 4HXEB 4U2EA 4ZREA 5AKJA 4OYYA 2HA4A 4AB1A 1ORWA 4DMKA 4ITVA 5JD4A 4GW3A 2C7BA 2PPLA 1R4ZA 3I2JA 2WHRA 2WQZA 1CUWA 4BBZA 1VOTA 5ALNA 3C5WP 1CUBA 4KR0A 5ALDA 1LNSA 4H0CA 3SC2A 3H19A 2RONA 5AIAA 5K3CA 2C0PA 2V97A 1YAJA 1MAAA 2HRQA 3FLAA 4LKOA 3AZQA 1ZI8A 3H18A 4H77A 4DM7A 2OQIA 2BGRA 4WCVA 3VJMA 3IURA 5CT9A 1K5PA 3VVLA 2EEPA 5K3AA 4QDXA 1LGYA 3GBSA 1LPAB 5T4BA 1EB8A 1H22A 1IZ8A 2DHCA 3EQ7A 3K9BA 5ESRA 6YASA 3TRDA 3E0XA 1GQSA 3FYUA 3QH4A 1VA5A 3STYA 3H1BA 1XZDA 4U2GA 3WIOA 4KACA 3LP5A 4X91A 1YAHA 5DNWA 1CUAA 4Q1VA 5E2IA 4XJVA 3G0GA 5A7GA 4H7IA 1EH5A 4W1QA 1UK9A 1E8MA 3ICWA 3IBTA 3W2TA 1IVYA 3GZJA 3STVA 2OXEA 2JGFA 1W52X 4X6UA 5HZGA 3BWXA 3H0CA 4CI9A 4G9GA 2ES4A 1AX9A 4FFVA 4O08A 2W6CX 5LZ7A 3IUJA 2PSHA 2IX9A 4HRXA 5JASA 3TJMA 2XQKA 2JIDA 5CXUA 4W63A 5D6OA 5ALHA 5K3EA 3Q0TA 4N8SA 4OD0A 1GZ7A 3D2AA 4E15A 2ZJFA 4BDTA 4YX9A 1N5MA 1CRLA 3I2FA 2Y6VA 1E66A 4PSDA 1GQRA 2H1IA 1QJ4A 4J0IA 3CN9A 3KD2A 4H18A 4K6KA 3FOBA 3PE6A 4UUQA 3WWOA 1Y7HA 3WQHA 3EF3A 4V2IA 2I78A 2HU7A 3PUIA 3BJRA 5CT8A 1HDEA 3H17A 3WWPA 2Z3ZA 1SCIA 1DINA 5JD5A 3BIXA 1MNAA 2R11A 1AUOA 4K6GA 5JATA 4OB8A 2PKYX 4G5XA 5EI5A 1VZ3A 1CQZA 1G66A 2X8BA 4BP8A 1JT2A 4UHHA 3T4UA 4C88A 3G0BA 3W05A 2XMRA 5ALOA 3WK8A 3DEAA 3F67A 2E3JA 2GBGA 3HSSA 3G9TA 2V98A 1N8SA 3M3DA 5ALLA 2CZQA 1BN7A 3WJ1A 5CH8A 3C45A 5HKAA 1C7JA 4FFWA 3RK4A 4KRXA 4UHCA 1YB7A 2WIGA 3G02A 1THTA 4ZV9A 5CH5A 3LLCA 4AZ0A 1JJIA 3R41A 4B84A 5LIPA 2WJ3A 3MUNA 3HXKA 1UK8A 2EDAA 4KRYA 4G8CA 5E4YA 5KBYA 2HM7A 2XUQA 4MQLA 5ALTA 2XDWA 4TGLA 1QIHA 2WHQA 2OCKA 2XMSA 3I2HA 2AJBA 4B82A 3U1TA 4G9EA 1EHYA 3DKKA 1Q0ZA 1J07A 4DMHA 1RWQA 5H3HA 5AI4A 3R0VA 2HA0A 1XFDA 2D5LA 4AO7A 3R3YA 1TRHA 4QDTA 5IVIA 2FX5A 4XIIA 4H7FA 2V96A 4C01A 4DNOA 4Q3OA 3FYUB 2Q0XA 5ALXA 1CUSA 4X3CA 2W22A 3HYSA 4YASA 4MXDA 3WYNA 3HEAA 2YH2A 4PSUA 3EQ9A 4K6HA 2WJ4A 2ZJ7A 2B20A 1H2ZA 3L1HA 1AC5A 1YS2X 5AM1A 4ETWA 1BS9A 4HZGA 1ZI6A 1XRQA 4INZA 1QIEA 4QA9A 4WY5A 1M33A 1L7AA 1JKMA 4WFIA 3TGLA 4Y2QA 3CCCA 1QLWA 5HFAA 4B83A 3FBWA 3FYUC 3WKBA 3V1MA 1ACJA 1A8QA 2OCIA 1IUPA 3FCYA 3IDAA 5FRDA 1BCSA 4G4IA 2VF2A 4BATA 4UHEA 4BB0A 4QDOA 2RI6A 1LPMA 5FLKA 4BCDA 4UFNA 2WG0A 3LCRA 4BCBA 4GHWA 4Q3KA 2VJCA 3FVRA 2PM8A 4AMZA 3A2LA 5AI6A 4U2CA 3C5VA 4JH0A 4OUKX 2H7XA 5I9IA 3BDVA 3PFBA 1MX1A 3D59A 5A2GA 4G1FA 4BE9A 2QXUA 2OGTA 3B12A 1EX9A 4ZGBA 2PL5A 2OCGA 2DHDA 4PF1A 5C8ZA 3HLKA 1XRLA 4DSAA 4OPMA 4CFSA 3FAKA 1WOMA 1UWCA 2YYSA 1NU6A 3H04A 3OURA 3WI7A 5ALRA 1TCCA 5AK5A 4BTVA 3QZUA 1ZJ4A 2VJDA 4FDMA 4L0CA 4G4GA 2ZSIA 1CUXA 4I3FA 3CN7A 3AJAA 4FWBA 5JAPA 3RM3A 5CH3A 1PFQA 4J0DA 3BDIA 3ZV7A 3S8YA 2QMQA 4N5IX 4KYVA 1XZLA 5AI5A 5FP0A 3G7NA 3I2KA 3LIPA 4BAZA 1UOPA 5ALPA 3C8HA 4EB0A 5A62A 3WL6A 3AIKA 4FNGA 7YASA 3FWHA 5ALQA 4C4ZA 2DCMA 2QVBA 4UBMA 1Q84A 1CV2A 2XUHA 3E3AA 2HA6A 1FFEA 1VKHA 3I6MA 3AFIA 2J3QA 2XT0A 1LPNA 4GEGA 4H7HA 3GA7A 1THGA 3G9ZA 4JEIA 2H9YA 1QFMA 4HAIA 4WFJA 2VQ6A 3V48A 5LZ4A 3NWOA 3WLAA 5CW2A 3DKRA 2BKLA 3IUNA 2XUFA 5IVDA 1N1MA 5EHNA 1R9MA 2XE4A 2OLEA 3DDUA 3C6YA 3ANSA 3E1GA 1J06A 2DSNA 4OB6A 1MU0A 5I7UA 5AKEA 4QNNA 2X76A 2ACEA 1CUJA 2JEYA 2RHTA 2C0QA 5LZ5A 2CKMA 3OOSA 4KE7A 2DQYA 3LIIA 3GELA 3AZOA 5AO9A 2CJPA 1WB5A 2XMCA 1O6FA 3HACA 2VATA 2VT6A 1UKCA 4P93A 4IO0A 4DMFA 3VISA 3OM8A 3NOXA 1OCEA 1XZFA 3O9VA 1LZKA 1J2EA 5AJHA 5FDFA 5HCUA 3WK4A 1XZHA 5CT4A 3R3WA 5EIAA 2HA5A 1MTZA 1ODCA 4A23A 1H2YA 4D9JA 4C4XA 2WG1A 2R8BA 5IH7A 1Q0RA 4EY6A 2BJHA 3G8YA 3QITA 3MVEA 1EXWA 5BWBA 1MN6A 5HK8A 4CG2A 4DNFA 5SYMA 1FFAA 1QIMA 2WLSA 4U2DA 2JGEA 2XQIA 3I1IA 3N2ZB 1XRPA 3WWEA 2ZSHA 4KE9A 5AOBA 4X92A 4OYLA 3MGAA 3ZI7A 2DR0A 2Z3WA 4M0FA 1CUGA 3D3NA 2O7RA 2HFJA 1H2WA 3WK9A 3O4HA 1F6WA 4KJXA 1FFDA 4PO3X 1XLVA 1DWOA 2FJ0A 2AJDA 4PW0A 1TK3A 3E4DA 1WCYA 4DYHA 4BTLA 1IZ7A 1E5TA 4IH1A 4KAJA 3O4JA 5AM3A 5FUMA 1CUIA 1XKLA 1KEZA 1QZ3A 5ALMA 4J0JA 5CTAA 2XMQA 1HQDA 1W76A 3WL8A 3DJYA 5JD6A 4OB7A 5AM4A 4DNPA 1QIGA 2ZVDA 2WFMA 4JYMA 1XRRA 5AK3A 5AKGA 1DX6A 4NMWA 1ORVA 1BN6A 4QEKA 1MX9A 3H2JA 4E14A 1T4MA 5AIBA 1DX4A 3H2KA 5DYTA 1W1IA 3UUEA 5JAUA 1F0NA 3WL5A 3I2GA 2XUGA 4XVCA 3R3XA 3A6ZA 3FLBA 3ESBA 5DLPA 2AJLI 4W1RA 1R1DA 3VJLA 2WM2A 1DT3A 2GBIA 4BE4A 4OCZA 3SWWA 1ETHA 5ISMA 3T52A 5FV4A 4FTWA 1XZBA 3O4IA 4J3JA 5AKZA 1XRNA 1CUZA 5JALA 2BAGA 5AP9A 1QIKA 3IULA 1KU0A 3VDXA 3NUZA 2XUAA 3KWJA 5ALJA 4YPVA 5C8XA 5C7YA 1QTIA 3M82A 3KXPA 1NU8A 4BVJA 5DNUA 2WUEA 2WJ6A 5K3DA 3D2BA 4X85A 1G42A 2JF0A 3UUFA 4H7EA 3C6XA 3IUMA 2OQVA 4UFPA 2HA2A 3C43A 5ALKA 4DSZA 1FFCA 3HJUA 3GROA 3JWEA 1EA5A 1GXSA 1IUOA 1ZICA 2PBLA 4B0PA 4Y2PA 1USWA 1VJ5A 2I03A 3WJ2A 2O2HA 5C81A 2FJPA 2XUDA 4AMYA 1UZAA 1ZD3A 4P08A 5K5EA 2XMDA 3QPDA 1UOQA 2QS9A 2AJ8A 3F8SA 5D7BA 1LBTA 3O9MA 5HQ3A 2QRUA 4U2BA 3HI4A 5JIBA 1WPRA 1AURA 3ANTA 3CXUA 2WFLA 2G5PA 2WIDA 1K63A 2PVSA 1QGED 2OCLA 1YR2A 1FSSA 1GPKA 3IA2A 1AKNA 1JJBA 2XUJA 5JZBA 1UT6A 1C7IA 5HF9A 2JGKA 3IUQA 5AKLA 2OGZA 1CUEA 3DL7A 2GBFA 2QXTA 3G9XA 1ZIYA 4F21A 4JUIA 3V1KA 2J4FA 3DYVA 4CG1A 1U4NA 1OILA 1QIDA 1DTEA 3PF8A 4HXGA 5AI0A 4M0MA 4AZ3A 4BP9A 3AILA 2HDWA 4B80A 1QO7A 4BAGA 5HF6A 4J0HA 1QONA 1XLUA 4OSEA 4G4JA 1X70A 3TEJA 4AN1A 3JYHA 1QO9A 1VLQA 4LXGA 1A7UA 4B0OA 2Z8ZA 5FPQA 1ZD5A 1K4YA 1SCKA 2HADA 4DTCA 3WYDA 3D2CA 2WHPA 4FOLA 4QDZA 1GT6A 3F96A 5K3BA 2ROQA 2ZYRA 3C6ZA 5LKRA 3FCXA 2J4CA 4MJ3A 1UK6A 3AIMA 4RPCA 2X5XA 4BRZA 4B81A 4M0EA 1T2NA 3AINA 3FSGD 2QJWA 1YS1X 4FNMA 4Y2YA 5T4FA 4Q05A 4XX1A 4X00A 5ALSA 4EY8A 2WFZA 3BL8A 1XLWA 5LLSA 1XZMA 2I3ZA 4QE3A 5ALVA 3OPMA 2WTMA 1VE6A 3ICVA 4TPKA 5A7FA 4RE6A 4X93A 3WWCA 4L9AA 1DU4A 5LZ9A 1NX9A 4Q34A 5SYNA 5AICA 4ZXFA 4ZWNA 1MJ5A 2OPHA 3RLIA 1BE0A 5JAOA 1LLFA 1G4HA 1YSCA 1B6GA 1XZCA 1F8UA 1L7QA 1SOMA 4J03A 3M83A 3ZLUA 2XUIA 3LS2A 4J0KA 4KAFA 5LKAA 1HKHA 4MYSA 3NGMA 5ALFA 5LZ8A 2QM0A 4EY7A 4MEAA 2XLCA 4K2AA 1EK2A 3QPCA 5AI8A 1ZD2P 3G9UA 3A2MA 4Y2TA 5F4ZA 1ZGBA 4ZRDA 2WTNA 3H1AA 4EUSA 3WA6A 1CUFA 3PICA 4OU5A 4GI1A 4Q82A 2Y2VA 5HF5A 4X6XA 3WZLA 2XB6A 3SK0A 2VEOA 2XUOA 4A16A 3OTQA 1XZKA 5K3FA 4E11A 3H2HA 1YCDA 5CRIA 4HRYA 1MAHA 4W9RA 4H7JA 3HC7A 3W04A 4Y9SA 3FVTA 3BXPA 5BV7A 4UBLA 1P0MA 5HQ3B 2FUKA 5EGNA 4KE6A 3KSRA 2BCEA 2J3DA 1W75A 2WFLB 1ZOIA 2DFPA 2O2IA 1ZI9A 3D4LA 2QUAA 4KEAA 3O0DA 2DHEA 2RAUA 1LPSA 1YA4A 5AI9A 4ROTA 2PSFA 3FSGA 3BJMA 1XQVA 1EDBA 5IKXA 2XQJA 4P9NA 4WFKA 5IVKA 4E46A 1XZGA 1VE7A 2JGLA 3V1NA 2ECFA 1XKTA 3VXKA 4W1PA 4UFOA 4FMPA 1W6RA 1TAHA 4MYDA 1KU6A 1BCRA 1B41A 3EQ8A 1FFBA 4H7DA 4RE5A 1X2EA 2V9ZA 1QE3A 1IUNA 3IB3A 2QOEA 5JAHA 2QT9A 5FPPA 3EBLA 3UMJA 4Y2JA 4GLBA 4LYDA 1H2XA 2QR5A 3DYIA 1BEEA 2Y2UA 2ONCA 5C8VA 4N8EA 4DNQA 1YA8A 3EIOA 4ARAA 3R3VA 1UFOA 5E4JA 1R9NA 2WUGA 3D0KA 4X7BA 5ALIA 5EHQA 4BCCA 1UKBA 2GZRA 1GKLA 3WK5A 3P2MA 3SX4A 4EBBA 2AXEA 2PU5A 1UOOA 2VTVA 5AKHA 3GUUA 2WU3A 4J0GA 4PV7A 2WKWA 2OAEA 1AMNA 2PUHA 2WIKA 4S0XA 4H35A 3O4GA 2JGJA 5EFZA 1TIBA 3G0CA 1MT3A 4K5QA 4AXBA 1P0IA 2G5TA 2WUFA 1Z68A 2ORYA 1QIJA 5CXXA 5ALGA 1JMYA 5LYYA 5YASA 5A7HA 1JU3A 4UBIA 2VJBA 1ZJ5A 3I6ZA 3HRHA 4GECA 4XWGA 1CUCA 3PUHA 3BIWA 3WA7A 4HVTA 4BVKA 4LXHA 3QBJA 3CCBA 2PSDA 3MUOA 4X90A 4GBGA 1L7RA 2JBWA 2EDCA 5HKBA 4IH9A 3ZPXA 4B6GA 4UBOA 4MEBA 3B5EA 3H2IA 1ZIXA 1JFRA 4BRSA 2B4KA 2JGIA 5DYYA 4I4CA 4FLFA 1MNQA 1QTRA 1Q83A 4BDSA 1TCBA 1UXOA 3I6YA 4FLEA 2B9VA 5CMLA 1DWQA 2VAXA 3C87A 3R3ZA 2HIHA 1U8EA 1DQZA 4H7KA 2PSEA 4A5SA 4C6HA 3QMMA 3K2IA 4QDUA 3STWA 3AIOA 3A70A 1N5RA 2WU4A 5CURA 1XZEA 3WKEA 1EDEA 1XQXA 3GFFA 2YASA 1DWPA 2QKYA 4QWMA 4PSCA 4TVKA 5K3FB 2K2QB 5ALWA 1WM1A 2DQZA 2CMFA 4HS9A 1FJ2A 2ZJ6A 5EIHA 1E3QA 1J1IA 3C6BA 4C89A 5DTJA 4IHAA 1A8UA 1JJFA 4B7ZA 3I28A 2XI4A 1WPXA 2HRRA 3ZLTA 5LZ2A 2WIFA 1XRMA 5AKKA 2RGUA 4QLAA 1LBSA 1XZAA 1PJAA 4B85A 2XQGA 5FKJA 5CT6A 5JARA 2GBCA 4P92A 3QMVA 2ZYSA 4BYMA 4GXNA 5AKXA 5JADA 1CEXA 1I6WA 4WJLA 1E89A 2XUPA 5ALZA 3PI6A 5AKYA 5KREA 3QMWA 4AO8A 4OU4A 5AOAA 3VJKA 3WKCA 3HABA 4AO6A 4BZWA 1BROA 3ESCA 3PF9A 1P0QA 4YK7A 2H7CA 3KWFA 5T4EA 1F0PA 3VVMA 2HU8A 3U0VA 1EK1A 2D0DA 2C5GA 2G4LA 2RHWA 4C4YA 4X94A 1RP1A 4UBJA 3C70A 1G5FA 1CUVA 3DS8A 1TQHA 3DL4A 4B9AA 3WZMA 1E8NA 4WDRA 1TKRA 3L1JA 5FOQA 4X6YA 1WHSA 2CEKA 4EY4A 1U65A 4Y2XA 3DLTA 5AOCA 4LXIA 3JW8A 4WY8A 4L3WA 2WIJA 4HTAA 1R50A 5EHZA 1DT5A 2IIVA 2LIPA 3X3HA 2WG2A 1HBJA 4CCYA 3FYTA 2XUKA 1A8SA 4DIUA 2GYWA 1CR6A 3DOIA 3R40A 3DQZA 1EVEA 4Y2VA 1K8QA 5KWIA 1E8DA 1YB6A 5A71A 5KWJA 2OGSA 3M81A 5BWCA 3F98A 1CUHA 2WILA 4EA6A 1OXMA 1X2BA 3K6KA 4GWLA 4NZZA 4MWTA 4LYEA 1GKKA 4JNCA 2GYUA 5D3ZA 1HPLA 1QFSA 2YXPX 5A6VA 5HFNA 1Y7IA 5J3JA 1ZGCA 5AM2A 2GZSA 2JGMA 3RKSA 1PV1A 4HXFB 4G8BA 3KDAA 1XZIA 3ED1A 3PDCA 1H23A 1HLGA 5CBKA 3F97A 5IVHA 2H7YA 4EY5A 3Q8WA 1EB9A 3FLEA 4MWSA 5DNVA 2CBGA 2VSQA 3FNBA 5DYWA 1CIJA 2BUBA 2QJRA 4UPDA 4J7AA 5D3KA 4CG3A 3AUKA 5EHXA 1CFJA 4NS4A 4W1SA 4AX4A 5CT5A 4AQDA 5AH0A 1HL7A 3WK7A 4F0JA 1GPLA 1LPBB 4DGQA 1CVLA 5JANA 2PSJA 3OC0A 4UHFA 3S2ZA 3DD5A 3D5EA 5DWDA 5AKIA 1ZD4A 5ALEA 1YASA 1UKAA 1GGVA 3OG9A 3DNMA 4FLMA 2PUJA 3F9CA 2Y6UA 3QVMA 3RARA 2HHAA 1BEZA 4UHBA 2QZPA 3G0DA 3WK6A 4QWWA 5EIEA 4B9EA 1R3DA 4CCWA 3QYJA 4BZZA 4UBKA 1BU8A 3QPAA 4N5HX 1CUYA 1JMKC 2QTBA 2OG1A 2XMBA 3BE8A 2ZYIA 4BVLA 3WIBA 2HA7A 3N0TA 3STUA 2G63A 3BF7A 5AK6A 1U2EA 1K6EA 3I1YA 2JEZA 3ZLVA 2C58A 4Z49A 4Y2SA 2AJCA 4MQMA 1JI3A 4PQEA 1RYYA 3AZPA 1EDDA 5LP1A 1XQYA 1S8OA 2WUDA 1AGYA 2VT7A 1VXOA 2GYVA 4IH4A 5AHXA 1VXRA 2QUBA 3I2IA 4N8DA 1LZLA 4Y2RA 1WB4A 1O6GA 2PU7A 4AN0A 1LPOA 5JZSA 4FBMA 5AM0A 5E4TA 1R88A 1P0PA 1VZ2A 3ZWQA 1AQLA 4ZI5A 2HU5A 1CLEA 1ACLA 4RGYA 4WDQA 1EVQA 3W06A 2BFNA 4ARBA 4CCYB 2OAGA 4F60A
chains in the Genus database with same CATH superfamily
2IHTA 1Z15A 1SC5B 1PWYE 4E03A 4B7UA 1QB7A 1UH5A 1OSNA 1ZBQA 4KP7A 3RYFB 2QTVB 5KJCA 4R8KA 4CYMA 2FOXA 1P39A 4GGOA 2Z08A 4XX0B 2ESRA 3U44A 1DP4A 5ECYA 2AI3A 2P9HA 4EBFA 3OUZA 1W0JD 2X7XA 1GNTA 4B2LA 2GA9A 2XQFA 5IU6A 1QNMA 3TJZA 3V9AA 4AN4A 4EUNA 4F6CA 4PRKA 3E9YA 3UW1A 3HYTA 2O19A 3SR4A 3A2NA 3F1KA 1R4MA 3N0WA 1IOLA 2QUJA 4EJ2A 4F93B 2HW8A 4NLLA 1ISIA 2C2OA 1DJPA 2HL6A 3KOXA 2LBPA 1P4AA 1Q1QA 3TXYA 2CB9A 1Z74A 4HB4A 2WZCA 3RQSA 4CH5A 3K06A 3N28A 4QYXA 4PZLA 2PUDA 3YASA 4Z86A 4DMCA 4F6EA 5DJ5A 2F23A 1RVDA 2R7AA 1YI1A 2QVYX 4LF4B 1NYTA 4RHYA 1ATIA 2PMKA 3H0EA 4ADSG 1SKAA 3PKJA 1NW3A 3O73A 3STXA 3RREA 1TTHA 1GG5A 3CSDA 2FUEA 4DLNA 2XY4A 4BC1A 1WA8A 3MQFA 1PR1A 3WYFA 2Q4OA 3D64A 2VAVA 4IQ0A 2IYYA 5T4HA 4MLCA 3PHIA 4URZR 2QVXX 1ODTC 2ODNA 4DY6A 3K2EA 1W59A 5A5EA 3EF0A 3PNMA 4PWYA 3I9JA 2LFSA 2OE2A 4RXUA 2XXAB 4DR4B 1U0HC 4BZQA 1XTTA 4OBWA 1P1IA 4MHTA 4MS1B 2YRFA 3AG2B 2NO5A 4JJAA 3ZN0A 5KQGA 1PZMA 2HG5C 4MV8A 5IJZA 4OREX 4Q7EA 4KDCA 3L06A 4G67A 1U7TA 1MABB 1GLVA 5LQJA 4CIXA 3RWOA 4KB5A 1VL2A 1D2CA 2WA2A 1XCJA 4MVJF 2ADQB 4BL5A 3QFSA 2O52A 3X2FA 4PBRA 3NS7A 4IEFB 3IJRA 5BN3B 3MT8A 4WCVA 4UNPA 1HDRA 4EFBA 2J9GA 3CJTA 5F23A 1I2DA 1KK2A 5HKOA 2W93A 3PYLA 1LPAB 5T4BA 1V7QA 3PL1A 4O4LA 3EIXA 4U0KA 1W93A 3CEPB 1S2NA 1E5QA 4CL2A 5KQMA 1MX3A 3SR3A 5IAGA 4PR0A 3W7AA 3OTGA 3B2EA 4U2GA 1Z26A 4G5HA 3LP5A 2RN9A 4X91A 3SYCA 1SO8A 3D5QA 3V7UA 5HE8A 1CUAA 4RK0A 5E2IA 5IUJC 1H6DA 4ZOLB 4Q3CA 4RYDA 3QU5A 3S3TA 2PKCA 1J1UA 3OZWA 1VPLA 1JG1A 2GV9A 3HI6A 4QU9A 4M8LA 1RPTA 3KYCA 1KR5A 2Z6VA 3BBPA 3ZWWA 1I4WA 4UTPA 1JHAA 4JP5A 3MPOA 1FTWA 1U1EA 1UZMA 4AURA 4CNBA 5JNVA 1D5WA 4YRRA 3Q9NA 1EHCA 4UUQA 1NPTO 4DT1B 5G41A 2P9BA 2ZTLA 5ERYA 4BNYA 1ZGHA 4V2IA 3ZXIA 4JASB 3CVVA 2TSYB 2COKA 3PC6A 3SZ3A 1HDEA 4NMXB 2G4CA 1EUCA 1UJ5A 2IYFA 5KOYA 2AYYA 4ZD6A 3SC6A 5LJIA 2PD6A 2XSZD 3OCWA 1P1JA 1YZNA 4IIJB 2Q6VA 3ZE6A 5IHXA 1T4BA 4UHHA 5KTSA 2BHRA 2YZNA 2N46A 1Q14A 2VPPA 4B33A 5JH7A 4R0MA 3B7GA 1F51A 3NRBA 1CIVA 2ZT5A 3T9AA 4FFWA 2XJ4A 1VLMA 2BEUB 1YB7A 3CZCA 1OIVA 2QNBA 4YMWA 3SC2B 1AI4A 4ZVQA 3WNCA 1EP3B 5LCXA 4YY3O 5IC6A 5EXDA 4TRMA 5L6MB 4QO8A 3BXGA 5KBYA 4N5LA 1NRIA 2QZ9A 2MSDB 4CM8B 3GLGE 5FO1A 4CRWB 1FPQA 2IDKA 2XMSA 4PC7A 2HBRA 1VG1A 1W1UA 4UW9A 1HEIA 1YVDA 3ETEA 2JIOA 1KKMA 4CF7A 2B1RA 4P31A 1QWOA 4X1OA 5IFLA 3LWBA 5JNLA 5GONF 1B3QA 4TXHA 1N32O 2KWIA 3HYSA 1YMUA 3U62A 3EQ9A 3G2IA 3DO8A 5K8VA 3K8QA 5GZ6A 1HSZA 1L8OA 3QHAA 4M0DA 3TD2A 1DUSA 4XSVA 4LF8O 4I1RA 3K0AA 1UMDA 1E0KA 2LCIA 1J0AA 3T5BA 5TARA 4POOA 1MDBA 1P91A 2A57A 5CBPB 4MO2A 3QI7A 2PKQO 1P2GA 1RPZA 2FJUA 4I4TA 4C7XA 2O0MA 4Q3KA 3IRUA 3WGTA 3O8LA 3HB0A 3AOEC 2VJCA 1IJEA 5L3SB 4I3HA 3ZZ1A 5AW8A 3BDVA 2XAGA 2QXUA 3M9LA 4Q19A 4URFA 5CVCA 1WXFA 1M6VB 3HLKA 3ZVKA 3TFOA 1UXHA 1I13A 1ND5A 4CKBB 4BBPA 2TECE 3LJKA 2P9TA 1RM1B 2AC2A 3RFVA 1OWLA 3GD5A 4WFBV 4PG8A 1KAHA 3CHYA 4K7JA 3R24A 3KC2A 1KDOA 2C2WA 2RGDA 1QE5A 1NWHA 3CJQA 5CPFA 1ECLA 4X45A 5SZIA 3BRQA 4DE5A 4PQGA 3L70H 3JYQA 3GNSA 3X44A 1G60A 1KWKA 2XVZA 4H7HA 5EBMC 2W6ID 2YTZA 1E7QA 1AQUA 1THGA 4M36A 2Q5ZA 4ND2A 1Q17A 1CBUA 2H9YA 1JQEA 1LS1A 3KQNA 4LTDA 3T4ZA 1OJ7A 3T5DA 4ZTUB 2PAAA 4GP7A 4EB6A 3ZHRA 2YICA 3I30X 3EEYA 3MOIA 1OHHD 2OLEA 4UB8Z 5K51A 2FWPA 4CEHB 1RSOB 4N7BA 5D00A 1ZNYA 4M9ZA 4DIEA 1PF7E 4QNNA 2GDZA 4U6NA 2DR3A 2CKMA 1T0JB 1V1MA 2IOFK 1MXHA 2P91A 2E49A 1QKJA 4N39A 2B4YA 1DSSG 1Y7TA 1AE1A 4E08A 2JI9A 2WT4A 3BK7A 1E2EA 1URPA 2BDEA 1DDOA 3D6VA 3A31A 1YR7A 3B5IA 3RD5A 1V9PA 5IJAA 4BWGA 1VGVA 1KZ1A 1RSZA 1MMMA 4CM6A 4PG5A 4E13A 4JXXA 2FR0A 1Q0LA 4TZTA 1JLMA 3P45A 5AJXA 4WKGA 2DR0A 1C1DA 1H2SB 2EIMB 1CP3A 1E18A 4FZ5A 3ASYA 3DLAA 2HFJA 1JTEA 3BWEA 3RC7A 1OZHA 3EVFA 2UYOA 4PW0A 1S7CA 1NH2D 2ZUWA 5JU6A 4HAYA 5IT9A 5TJHA 1YRAA 3HB7A 3ERCA 3UAOA 3GARA 3OMAB 3CCUV 4NCXA 3BTSA 4YDHB 5EMKA 1QIGA 1U6IA 4E1VA 1OE0A 1Z6TA 3ZWCA 4OXSA 3W77A 2RH9B 4EFLA 3ZXUB 1DX6A 4I5EA 3DMHA 3H7IA 1UBMS 1UDBA 4KQEA 3COPA 3LT4A 3MAGA 4FW9A 2D62A 1E6KA 4E3WA 3Q10A 4CC5A 5BR1A 4CS4A 3ESBA 4ENUA 3PR2B 4W1RA 5GINE 3WMGA 4QOGA 1MB3A 4TQ9A 3TN7A 1ENVA 1QQTA 4ZCMA 4DQVA 4MOWA 8MHTA 3TLZA 1TL7C 1EFPA 3DTTA 1N75A 3Q3HA 2NVUB 3CCVV 4BMZA 1Y4MA 3W3AH 3HUEA 3C3WA 1X7XB 4I5DA 3BA6A 3DOEA 2ZRIA 2Y4UA 1ZAYA 4PCAA 1XJ5A 1A50B 1FUYB 1WMSA 1LV8A 5LB4A 1EBOA 1Y8RA 4YH1A 2WUEA 1V3UA 1SCUA 3O47A 5CVJA 5JFGA 2G0TA 1HNXO 2NYVA 1ZJWA 4RZHA 1FNBA 1UPBA 1GARA 4RDIA 4DSZA 2VI5A 2FFBA 4EDFA 2NO4A 2BEKA 3OF3A 2G25A 1BS2A 1HYHA 1Q3KA 2OHFA 1TIKA 3VPXA 1GDTA 3BREA 2Q5OA 4GWKA 2WU8A 5CB4B 1YJCA 5K5EA 2ZG6A 1PZHA 1RHQA 4RVCA 1HFJA 3M6AA 1Z38A 3B6MA 4M9CA 1JIIA 1AF7A 4Q9KA 2MYPA 4QX6A 4KVGA 1X7DA 4JYZA 5AVXA 1AI5A 2HPVA 1TYZA 4BQRA 5NULA 1DG1G 5AD1A 4PLWA 3VC7A 4HO1X 4UD2A 3R1IA 2JJ8A 3VYRB 1W0KA 2ONYA 3QP9A 2BI8A 2GJ9A 3BEOA 4N9WA 5KNLA 2OGZA 1R0SA 4K8ZA 4CMKA 5BW8A 1M0EA 3VDRA 1NE2A 1I6KA 4H0NA 3W7VA 1U2SA 1MH1A 2HVKC 1FDVA 2HMWA 4UQLA 2WTAA 1A9RA 3KXLA 4A8JB 4EB3A 1QQAA 1RAIA 2W6JA 3PTZA 3TSWA 2BJVA 2VTDA 4MV0A 1GY8A 3CPJB 4OV6B 1GCAA 2HRCA 1SCKA 1WN7A 5C93A 2C0CA 2H2AA 3W7TA 2ZBRA 3UAXA 2FB5A 4RTRA 3IFSA 2ZUUA 3E05A 5I4BA 4E30A 3C6KA 3T95A 4F45A 3ZJ5A 3AINA 4B6SA 2JLCA 2BFEA 3A1DA 4GRAA 3OIVA 4RESA 2VJLA 5CB0A 1TZKA 2I65A 1RKXA 4LYJA 2A2ZA 3ZWVA 5F52A 3C7CB 4M21A 5FPKA 1XUOA 1CS0A 3QQ5A 3QVKA 5K1XA 2XW6A 5JSZB 1CZKA 2XE7A 3ZIDA 5LQDA 4XDYA 4ZHQB 1WO8A 3WWCA 2JJQA 3R0ZA 3UXHA 4TMKA 1NX9A 2XTMA 4NU8X 1RQLA 1BE0A 3QVLA 4Q4HB 2EIJC 6AT1A 1XZCA 1P72A 4P2BA 2EYUA 1M56B 2EL7A 3GK3A 2MSLA 5C18A 3IAM6 1VPEA 2HKOA 3A4TA 4CM1A 4CPDA 2QLFA 3NI2A 1IB0A 4YCMA 2B21A 1T29A 4K3UA 2D2IA 4UU1A 1EE1A 1X0VA 5SZHB 2DLNA 2IW1A 4BO1A 2GDJA 1P9NA 2XAJA 4IFTA 4LZLA 3FIJA 1VFPA 5LN1A 5KOHA 2DM6A 2NYUA 3KHUA 1U90A 5HQ3B 2D8MA 3CEJA 1PDOA 4RTNA 1ZOIA 4MS3A 2RH5A 3E2EA 3CNQS 4DWVA 5KTPA 4KEAA 2D2EA 5HCIA 5CB6A 3FSGA 3E8GA 4RZ3A 4E5DA 4CMIB 3RC1A 2K6GA 5IKXA 2V6BA 1XEWX 1WY7A 2XD4A 4DLUA 5EUCA 1ZVJA 4TZ0A 2ECFA 3I92A 3DBHB 2AH5A 3I6IA 1IHOA 4UFOA 3WLTA 2H1LA 4NYJQ 3JPWA 2V9ZA 4OI1A 4Q9LA 3IB3A 1OLSA 2QT9A 5FOSA 1LA2A 5H7XA 4EG5A 4JA0A 3UMCA 4WBNF 2E82A 3N8HA 2DJVA 2FG7C 1R9NA 2WUGA 3QFRA 1UKBA 1M67A 1H4VB 1XRJA 3Q6NA 5BP7A 1QHXA 3OZRA 1NZFA 3JRWA 2BEWA 2PLAA 2BFDB 3Q5GA 4URYR 4A0HA 3RTDA 1Z5VA 1TIBA 3PXEA 3FW1A 1P0IA 3S2EA 5A7HA 2CV0A 2CXUA 5IF9A 2VJBA 1BWSA 1HI9A 1JNXX 3U7FB 2C20A 1T6YA 2WOJA 3Q3VA 2CSUA 4LYYA 4GZRB 4YCSA 1HETA 3ASNC 3HJBA 4CQLA 1NATA 3TMAA 4YXWD 2FH5B 1XAHA 4QRDA 2O8EA 3ZPXA 4B6GA 2YNMA 4FR2A 1IFXA 1NVEA 5DVZA 4XTRA 2QL6A 3WU2Z 3HGMA 3WGVA 4EI7A 1TC1A 2ODWA 3ZXSA 4R71A 1P18A 2ZIOA 3R7BA 4BKRA 1KVSA 2RGGA 4NCAA 1CY1A 2PL9A 1L7XA 1YZVA 1KRHA 1N2EA 3ZWOA 2QGNA 1LDGA 1N5RA 4HK4A 2B36A 2NQ8A 5IY5B 3NCHA 5E4FA 5J2UB 1M6YA 2EJRA 1YOVA 1P33A 4PGMA 2FSGA 2PLFA 4HPWA 4JLSA 4AUKA 2PYZA 3E0QA 5JJBA 4EMUA 4RJJA 3JQAB 1GPDG 1XDBA 1AP6A 4B7ZA 1QCYA 2IXDA 1XDZA 1BS1A 4Y3UA 1ODFA 4OMCA 3VGJA 1VRCA 4A26A 1QP8A 4NG4A 4IIVA 5A04A 1BVYF 1EVYA 1OVGA 3H1HH 4RLFA 4KZPA 3D7NA 4L8FA 5EKTA 2JLVA 2MSCB 4GXNA 5AKXA 3THYA 2ZUTA 3OX3A 4LEIA 2FSPA 3QA3E 3KQSA 3G79A 1YE3A 1DCTA 3K8OE 3IE2A 2GUZA 2AW3A 1NBHA 2C9OA 3APQA 2PT9A 4RD2A 1WE2A 2IUTA 1GA4A 2Q50A 5LU9A 3CYFA 1N2OA 3O1LA 3JSLA 4GS5A 3TGUH 3FMOB 4BMPB 1OGJA 3AYZB 3ETJA 1GKFA 5K6AC 1QGYA 2WT9A 1FX1A 4QD3A 1ZINA 2EP7A 2CEKA 1Z8NA 4J7CA 4NBLA 1S1MA 3TK1A 4J7UA 3EXIB 3BXXA 4DY4A 4KHPB 4KOAA 4NESA 4LF5O 1YJBA 3OJFA 2QTTA 1D8TA 3BMQA 4WCDA 2IH5A 1KQOA 1KQSU 1CDDA 3KWMA 3BA1A 3PXUA 1OYYA 2IDJA 4KXFB 4S24A 3H2YA 2GTSA 1CUHA 4XR9A 3HFJA 1VSTA 2QHXA 1CNEA 2VSFA 1O87A 4S35A 3K0FB 3CTPA 2O1EA 2GZSA 4Z9XA 3ZI4A 5B3KA 5LQNA 3IT2A 1Y5LA 1G9TA 4JBYA 3S2SA 5JROA 2H11A 3FLEA 1E99A 1OWOA 4ENTA 1CIJA 1IHUA 1ZJJA 2BP7A 2WM9B 1JGTA 1U7PA 5MFZA 4KOEC 3FOZA 3BULA 3PEUA 4CM4A 5L3DA 5CT5A 3MMNA 1RLUA 1AG9A 3PQEA 4E5NA 5CCDA 4BNIA 4QUJA 4UQPA 5LBQA 1Q86W 6GPBA 4WCEV 3AUXA 2N04A 5AKIA 3FI9A 3ITNA 2HK6A 4K46A 2J31A 1XSEA 3NIDB 4PZ0A 4GZ5A 1QHYA 4U7NA 3LYUA 2DPXA 3VOUA 3L7CA 4N4AA 4QWWA 4GI7A 4N7RA 3IMKA 1R5NA 4IKEA 3OFJA 1V5IA 4DIMA 1VE1A 3P0HA 1NKDA 5C3UA 4B17A 1A9PA 3TQIA 2QE7A 3HBNA 3RFRA 3NHBA 2YFYA 2QG4A 1QGUA 3ZBHA 2CJYA 3WIBA 3NYIA 4EHKA 1YB1A 1PD0A 1SCAA 4IXTA 4Z2WA 1R15A 2C58A 1NP6A 3VR6D 5HX7A 3ZV3A 3TM5A 3U60B 1AGYA 4HDKB 4QGBA 1TZMA 1XZPA 1ZZGA 3ZMZA 3E8BA 4TXJA 1XPRA 4RAIA 4FDUA 1EFRA 2J8ZA 3MZ0A 3BHNA 3SDSA 5DP2A 1BXRB 2AOWA 1DKNA 1HFKA 2ZOSA 1EESA 2HU5A 4U3FH 4CQMA 4NOLA 4QGAA 4F60A 4RZUA 1KVUA 1T5TA 3K9FC 2HCTA 1MTOA 2QM8A 1AROP 5BUSA 3LA6A 1V43A 1H8HG 1CDEA 4L4ZA 2EP8A 1OW3B 3CMMA 2DX7A 3QMPA 4RPKA 1ZA1A 2QI9C 3DAHA 4KWIA 3MGKA 5A02A 5EEGA 2XDQA 4JI5O 2Q62A 3FAZA 2O2YA 1PQ4A 1B0UA 1M66A 5A1JA 4QFDA 3QXSA 2X2EA 3C8DA 3H5NA 2C92A 1MJGA 3DH0A 3PQ7A 3LPAA 3V1LA 1DZ3A 3RS2A 4JJKA 3WBJA 1D7OA 3QUQA 4QEDA 4D92A 3VU0A 3L6DA 1JDZA 2QLTA 1F5SA 1RBZA 3EVNA 2GXSA 2C8VA 4MR8B 1G8KA 2K87A 2B1QA 3HH8A 1R9GA 1N5DA 4LGYA 3RLFA 2EERA 1A2OA 2N0SA 1QOZA 2QMYA 1VM6A 3ZWXA 4KLNA 2CL0X 1P84F 3SYQA 1ZZEA 3GLHE 1N2IA 2PGGA 3EBPA 3PDWA 2OPBA 5ELMA 3VBEA 3CWCA 4PZPA 4R41A 4PZ9A 2JAUA 3U1BA 3HK2A 4Q7MB 3SM3A 1A88A 2GCNA 3KOOA 3S4YA 2JD1A 1JVNA 2QN3A 1ULTA 5I5GA 4UVDA 3I0MA 3DP7A 4L27A 1DLIA 2FW0A 1Q2UA 1Y33E 1KYOF 3FHCB 1NF8A 1M72A 1AKVA 4MWGA 2BCGY 1SUWA 2H5LA 1CUUA 2GJKA 1EINA 2X7HA 4EHBA 4U2FA 2Z8XA 5AKJA 1M5UA 2O8FB 2YJGA 1FVHA 1IYZA 3DCYA 5M2QA 4MUGA 4R1SA 4ZYZA 5CFMA 1Y8QA 4TSFA 2O1XA 4N0MA 1CC1S 1CUBA 4YQEA 1BCCH 5ALDA 1FDRA 1G20B 3EYAA 2QB5A 4R16A 5AIAA 4M22A 4QHTA 2C0PA 1B73A 4EHDA 3LX8A 4GKJB 2HRQA 2VJMA 1F2TA 1OIWA 5ABPA 1T8PA 1UBNA 3QY0A 4E6PA 2C00A 1T9BA 4MARA 3QY9A 1QAOA 3D9QX 3IMEA 1H22A 3EH2A 4UZSA 5I9SA 4ED9A 3OAAG 4YT5A 3NT5A 2O20A 3SZMA 4L7QA 2QUHA 4CUJA 2QVLA 2X41A 4IO1A 2WLJA 2IHUA 2OP0A 4KACA 3SFTA 3KDPA 3I34X 4L0QA 4DIBA 3GEPA 3H9UA 1K3EA 1KJIA 2GCOB 3N5KA 4IHJB 2O3UA 2QMUA 3ICWA 3UT5B 2PIDA 1Q90D 4M7PA 5J2TF 4J80A 2DWPA 2MTBA 4EUKA 4O08A 2PX5A 3HU5A 3WGLA 3DZFA 5JASA 4FILA 5CXUA 4LVUA 3V42A 3K04A 1H3FA 3F4BA 1N5MA 1VQKV 3I2FA 1EMDA 5I9LA 4KSBA 1XOIA 1V47A 1F6DA 1V41E 1XVLA 1HX7A 5L7YA 5JYEA 4I9WA 2DQSA 3BSFA 1R7RA 2FHSA 3K5MA 3V8EA 2PX3A 1RI5A 1L5LA 4B7EA 3AF1A 3HU3A 3HADA 4PPYA 3ZX6A 3ZXXA 2PCJA 2NZJA 3IQHX 3OZXA 2I62A 1ZLXA 1CJTC 2IKSA 3KKKA 4R3UC 5LBIA 3AC0A 1V9LA 5I48A 2QENA 1NT2A 1TI7A 3U19A 2GETA 4GF5A 1V35A 3WK8A 3F67A 4LHZA 1I7QB 2D1RA 3RSFA 1KAGA 1EWQA 2UVPA 4TS9A 4BP1A 5IXYA 5DBOA 4V0LA 4KN9S 1FY2A 2P6RA 1VF6A 5JDCC 4DO2A 3EA4A 1ND6A 3H11A 2UXNA 4EI8A 4I81A 3PG5A 4MW1A 2XDWA 4TV8F 1Z4KA 4ZVMA 2GPJA 2XB4A 2EBHX 3DV9A 1JIUA 1ODIA 5EQDA 4P9PA 5JCXA 3D8SA 3TX6A 3JALB 4OXRA 1M90W 3OECA 5KNBH 3NRJA 4YUYA 1J2RA 4CMBA 1C30B 5TDHA 3W8EA 3GUCA 2G6BA 4BO4A 1HZZA 3RR2A 4U7JA 1Z6XA 4PAOA 4B40A 4Q7QA 2FA9A 4INZA 3H9VA 5HKLA 3VQVA 3OO1A 1L7AA 4QNMA 1XCOA 3V4ZA 1OV4A 4NC9A 3MFYA 2EHJA 5IHPA 5BSRA 4OXIA 1N5IA 2WAAA 5A5VA 2UXBB 3KBOA 1XDGA 1TZJA 4RK1A 4MVUA 1G1MA 2JAWA 4N6GA 3FHJA 3TJRA 3ER9A 5CGQB 2H3HA 2ODPA 1W0JG 4Y1EA 1ZRSA 3DV0A 1O0BA 3D59A 1N2XA 4M1OA 1WUIS 4DV5O 3SQXA 4UARA 3UAVA 1ZFNA 4DUGA 5ANRB 3F74A 3HR0A 3LHIA 1E59A 3T7TA 5CIWA 2HKIA 1CQJB 3KAKA 2LW1A 4LZAA 2GBLC 2GAOA 4JZYA 5DK4A 5ADWA 3PNBA 3LDGA 4AM8A 1J2TA 2GXQA 1P6XA 3RK1A 3KSAC 3GQBB 1E4YA 3ZV7A 3L73H 4OHWA 4GC9A 1PR6A 3WXBA 1XZLA 4UC0A 4ZYLA 1EBUA 3FTPA 4PE5B 4LA4A 2F9LA 2PQMA 3KJQA 4IJ5A 3TW0A 3J81k 1PEAA 4JCCA 2YXNA 2F48A 1NZDA 1P8JA 5ADVA 1JFFA 2YW9A 1NTKH 4QJBA 3AK2A 2WF8A 2NQTA 3JYOA 2FPLA 3QVWA 4KIGA 1PWZA 4PVDA 3G1UA 3H2BA 1E3WA 4C08A 1K4CC 1KS9A 1C0EA 5JJCA 1QFMA 2VHJA 3KXDA 3DBOB 1K7XB 2YJ6A 3WLAA 4ZMBA 3P2KA 5EUMA 2E1PA 3AYXB 4OGWA 3I83A 5D86A 1Z8HA 1RYMA 2CYBA 1YBVA 2V6GA 4FMTA 4JAVC 3B38A 3Q4HA 1GRJA 3T7RA 2ACEA 3KYIB 5JCOA 5FADA 1THMA 4IZOA 1C9JA 4CBCA 3IVGA 5ER6A 3USCS 2IQ5A 4P93A 4RO0A 4DMFA 2F95B 3U7EB 3CMAV 1PGQA 3T3IA 3QU4A 3WFJA 2I6SA 4LY0A 3DXFA 1XZFA 1RCUA 2P5UA 5DP1A 4D45A 1EDZA 3EA5A 3V6LA 1H2YA 3S2FA 5B1DA 3B7PA 4FM1A 4RMJA 2BBOA 1ONNA 3ZZNA 4HVCA 4RKEA 2QY9A 4UCWA 4WJZA 3RUEA 2D2FA 3I1IA 3BHMA 1PG0A 3Q5EA 2I3GA 4D4HA 3D3NA 2PUWA 5HA5A 1GV0A 4B8YA 3RC3A 1AMOA 1XLVA 3ILVA 4NYMQ 4YP7A 3DC2A 5B1IA 1JEQA 1S6YA 3JD4A 1ZDMA 1KMHA 4L0MA 1GTVA 1H8ED 1FRNA 2IU4A 4DAEA 3BMOB 5JS7A 4RHCA 1MHTA 1NVBA 2I8LA 3KV1A 4O0LA 1YWGO 1GGHA 1RNLA 5DE3A 5AM4A 4E94A 1X9IA 5KA5A 3G1TA 4HUTA 4WBSA 4YRJA 3UF0A 5KC8A 2Q7XA 4MVXA 2RDMA 1SB9A 3LOQA 1IIRA 2A59A 1P77A 4M7RA 1BYIA 3QNUA 3FNGA 3OE1A 1XDUA 2PKWA 1AKQA 1AKMA 3LVFO 4JN6B 1HZJA 1K9MW 3IEVA 3DE2X 4OSOA 1H5NA 5KLVH 1W0KD 2ZK7A 4BE4A 1EVJA 5GJBA 1P3JA 1QQ6A 4XYLA 3T52A 3D1LA 1ZGGA 1TJYA 2J3IA 4J8PA 4RD0A 4F4IA 4C0BA 3IRVA 1U0RA 2QVCA 3IAS6 2O8BA 3V3TA 2BHSA 4EDHA 1PL0A 3C3DA 1SVWA 3NUZA 3I9FA 5TMPA 4DZTA 2W6JD 3I32A 1GN2A 3AF2A 1EGAA 4Q9NA 2GSWA 2IH1C 3KSUA 4ETIA 4QE9A 4W99A 3FFTA 1VL0A 3W6NA 4FHDA 3TYXA 5FLYA 3FUUA 4OTZA 1RRKA 3PJSK 3QKSB 2D1YA 4L75A 2FMIA 4N03A 3C43A 1GZDA 1XBTA 4ZQGA 3KZOA 3ZZMA 4U2KA 2QKAA 1N3YA 3TIVA 1X1BA 1QBZA 3A1TA 2EKDA 1PJ4A 4MVQA 4B44A 1T9HA 1DBQA 4FYYA 2JFNA 3DQQA 4RD4A 5LB2A 1UOQA 1E64A 1EFTA 4QGGA 3L1KA 2EW8A 4U2BA 2FMUA 4QODA 1ZS9A 4I8DA 4WFQA 5F2KA 2XBMA 1EP9A 1VC2A 4GVPA 1GCIA 4BGVA 2ZNIA 1FSSA 3EGOA 2XDAA 2Q5IA 3MMPA 4V0RA 4F4UA 4GLXA 5KVSA 1G5IA 3PGXA 2VTBB 2C7PA 4L4SA 5AKLA 4B6JA 1MSDA 3GV0A 2AI1A 3CH6A 3HKEA 4F21A 1R6XA 3T1QA 2FQYA 4V1CI 4ABYA 4C1NA 2YS6A 4ABMA 4B80A 3CF2A 3GJ6A 3H65A 4G4JA 2BOCC 1YRYE 1JR9A 2DYSB 4X89A 2RC6A 5IX8A 3O8OB 4J94A 5M5BA 1PHRA 4TZKA 2R4UA 2B1IA 3WYDA 4K0RA 3L2OB 4UCTA 3EWSA 5ICMA 4JYCA 2ZQMA 3C6ZA 2HPAA 4QT0A 3BQ9A 2CDBA 5FEUA 1OBVA 4MRPA 3R77A 1Z5WA 4AKGA 1EFVB 5ECDA 3EFOB 3ND8A 2ZWOA 3V55A 3VI4B 1NBME 2YHIB 2BC9A 3FSGD 4B3TB 1PO7A 3AVYA 3OCJA 5BNTA 1A77A 4NR1A 2J6HA 2OOKA 3K3WA 3SKXA 3RROA 4BVAA 2YOGA 1NY6A 1TE2A 2NADA 2WWWA 2GEDA 2Q5LA 4LY6A 2PKXA 1C7EA 5C1IA 4DCCA 3C4JA 3EODA 4MW3A 4ZXFA 1JDUA 4OHVA 3C7AA 1MJ5A 4GYWA 3BD8A 1IQPA 1UEJA 3E9DA 1A5SB 4ZBMA 1XD2B 2QKSA 3TR5A 2D1FA 1PUIA 4OA8A 5GIOE 2ENWA 3BCSA 4E07A 1PGOA 2HQOA 2W6IG 4QJ3A 3QVNA 3AEUB 3I2YX 3A2MA 4Y2TA 1ZGBA 5IJWA 3D31A 3T9BA 5IZCA 2BMWA 4GI1A 2OWDA 1ESEA 4LRQA 1O95A 4Z4IA 4E11A 3H1TA 1YCDA 1OHHG 2PL3A 3TRFA 3QLVA 4M98A 2HWWA 2DOKA 2EF0A 4BB9A 1MAHA 1FZQA 3ONEA 4H7JA 3IUSA 3FVTA 4BB6A 4DCVA 1MOZA 3QE4A 1MRNA 2HLDA 3VPDA 4NZPA 3OZEA 1W75A 1DWUA 3VR5A 5BMVA 4P2GA 4MVMA 5JNUA 2IEBA 2WA3A 3QOFA 1IM8A 3IV7A 4FC7A 3U40A 3OTHA 3ZGOA 2VSYA 1KE2A 2KLHA 3OM0A 1GL3A 1PBTA 4NAVA 3L77A 2OQRA 1XKTA 3N39C 1E3SA 4PFJA 1W6RA 4UJ3A 3FZQA 1I94O 1C2YA 1GAQA 1P9WA 4K8XA 5TLSA 1OXVA 4Q7JB 4FYWA 4C0JA 4DLTA 3HR8A 1WDTA 2Q4PA 4CS3A 3TEMA 1WV1A 2Z95A 3TR0A 3UWOA 3VZSA 3ZNQA 1LLQA 5BQPA 3ZU3A 3QWIA 4PLVA 4TLEA 2WW8A 4CT5A 2I7DA 1QH1A 5ALIA 3LDCA 2H9IA 4HLNA 3PGLA 2JAQA 4NE7A 3ITEA 1MO4A 2VTVA 4JI1O 2WU3A 1XAIA 2YVLA 2PUHA 5AHWA 1JAZA 1AQIA 3ETNA 4QOJA 3G6EV 2ZYAA 5K45A 4B3IA 4BFSA 4U3JA 1N2CE 1WCIA 2VRBA 2WSYB 5LYYA 3GP5A 4UXJA 5CBFA 4ZVKA 4KQ2A 3ETGA 1KOGA 1RC8A 1GR1A 3WA7A 5JI2E 5KQLA 2WUWE 1XWWA 5DH9A 1G3QA 2WZQA 3K6SA 1CX9B 5BNFA 3BFPA 5C7OO 1Z88A 3G13A 1A7JA 4OQNA 1COZA 4DIFA 1B0AA 2JGIA 2G83A 5L53A 4BRUA 3CF4G 5IULC 2PFKA 1T91A 3WOHA 4KWCA 4NJMA 4MA0A 1IG3A 3SNHA 3WB1A 1FDWA 3HTXA 1OGIA 4GE3A 2RARA 1Q81W 3N8DA 2O8CA 3I52A 1MB2A 1Z16A 5GY7A 1GAXA 3QFHA 1PD3A 2OCCC 3ONVA 1N5OX 2R8RA 3CZ9A 1SXPA 2EFDB 1T5EA 4NYKA 3RC8A 1HQKA 1BHAA 4PZYA 1JHDA 1UMBA 2GNAA 3PITA 2B37A 2JHAA 1XRMA 5AKKA 1A9QA 4A1FA 1EJ0A 3LVQE 3CFYA 4FEGA 2FPPA 3TW4A 1GITA 2PZSA 1E94E 4JQOA 4G28B 2DY0A 5JNWA 2NU6A 1KPGA 4KQ1A 1VL8A 2JFVA 4X9QA 4EGQA 3WLIA 5AKYA 4BOYA 4I46A 4PZZA 4OU4A 5JFOA 5ILGA 2ZKLA 3ANLA 2VDNB 1ZXBA 2D0DA 2N05A 3I5XA 2P1RA 1EUQA 3IP6A 3Q4GA 2GXUA 5A3SA 1H5QA 4GZ3A 1HE3A 2YS8A 5BVGB 3WRXA 4EPYA 3NTUA 4WNCA 4BTEA 5B1AB 3TIXB 3MAQA 5B1BC 4GPD1 2E55A 2ZIAA 4RGQA 3TSOA 2GM5A 2OFOA 3AUFA 4DIUA 2GYWA 2JJ1A 3RVLA 1BHJA 4DAOA 1M2GA 1E8DA 1K7YA 5KWJA 3KQYA 3V8MA 2OXRA 1R8XA 3TDMA 2UXDO 1EQUA 4MWTA 1MEOA 1SG6A 3IMCA 1KYQA 3ROZA 3FPBA 1QFSA 4DJDC 2YVAA 4MPJA 1SIWA 4BO3A 3RKSA 3ICCA 1PSZA 1J9GA 3GEDA 2BSKB 2M7WA 1FXKB 5H68A 2BIFA 2DPGA 1V1JA 4GKAA 2CBGA 1YVEI 2BUBA 4X60A 1C8LA 3M5WA 4RQUA 1QVRA 4DC0A 1HTTA 5B3AA 2WAOA 1A0OA 5LUAA 3CXHF 3TI9A 4MVZA 1R3UA 2PT7A 2ZJ5A 5EA2A 5JANA 2UUAO 4BEJA 2EARA 3OJEA 3MEQA 1ZD4A 1E60A 2C1XA 1IOWA 3B3GA 3CY6A 4X64B 3F9CA 4ER5A 2BRUA 2B35A 1D2EA 2CLOB 1TPYA 5EZYB 1JWAB 2I5PO 4FLTA 1TADA 1WDWB 4L5IA 3EMDA 5BSWA 4JI3O 3UUWA 4JB3A 1I3LA 1KBOA 3TXSA 1OV6A 4NCHA 3FOEC 2BEVA 4RIIA 1Q91A 1SBTA 1BHO1 1CJBA 1X1QA 2IOHA 10MHA 2F3SA 5FWXA 3OPXA 3STUA 3K0DA 2B94A 2AMYA 1RI2A 4NL4H 3K5IA 1Y1KE 1Q15A 2QYSA 2E5WA 2VP9A 4QVIA 4JFAA 5KPDA 1IXRC 4WEOA 1JPVA 1Q3HA 4Y1RA 4YUZA 4URUR 1VXRA 2CUKA 3AEQA 1ILWA 3OCZA 3DE5X 5FUWA 4DUYO 3IKLA 3WL4A 3HFSA 3F4KA 4OSPA 1ISJA 5KHHA 2TMYA 2WDPA 1UPFA 1NKTA 4Z4FA 3L05A 3RUDA 1K9SA 5FTKA 2IXEA 4TUYA 4YJ2A 1Y7LA 2FWAA 4O2AB 3P2JA 4ZDIA 2Q6TA 1GGNA 3B6IA 3QYFA 4ZV7A 1A69A 4PRYA 1R66A 3WMRA 5TT0A 4UUAA 1T9GR 2OBLA 3JZIA 1SMKA 3CNNA 5IRCD 3TBFA 3Q5DA 4TSFD 3ROXA 1U80A 3SIRA 1QXSA 1M2EA 2CSXA 1COWA 3SZLA 4HNTA 4F06A 1DFGA 2QQEA 1EAYA 4X1YA 2VNHA 1PZFA 2FUG6 5B53A 1VL6A 3ABSB 4J4TA 2AW5A 5L7TA 1RE0A 2BUAA 5I8PA 2ZE5A 2VJAA 2O7NA 4GSKA 1NSYA 5LP6C 4YXWG 4UKDA 1YZUA 2WVAA 3H2GA 3TMYA 3NC4A 1KC3A 4X71A 4XYGA 2ZSDA 2Y4TA 1AK1A 1VMDA 4NKRA 3RC9A 3SJCA 1ZM4A 4ZEWA 5CITA 3VYTB 2LTAA 3B89A 3CJRA 1NQWA 3NATA 1V9SA 1D8AA 4DC1A 3HG7A 2QJTA 4ARIA 4IJKA 2HJ9A 2I55A 4JYPA 3EUFA 2X9NA 2G1KA 3CEHA 2JEUA 4JIGA 5E6UB 1ESDA 4OXQA 4F5ZA 1D6NA 5F7XA 3ML1A 5K09A 1W4ZA 3O90A 4MPRA 2JLQA 3GJ5A 4KAXA 2A3QA 5EXXA 3FNEA 4Z1MD 1GKYA 5K0NA 1KMQA 3CE2A 4ICIA 4DR6O 4JVMA 1PQUA 1FJHA 3WISA 4HDSB 3DTVD 3BCHA 4YFVA 3W4JA 4K88A 1R4ZA 3SXUB 2VDPB 3FUVA 4M1ZA 1NXSA 1QLEC 2RK3A 3MWDA 4KR0A 1LNSA 4OHKA 5K3CA 4TTAA 4I6JA 3WGMA 8GPBA 2DFVA 1SZTA 3OJWA 5I7HA 3TKLA 5DTMA 1V5FA 4OFWA 2H1HA 3I5YA 2QR3A 4L0DA 5CT9A 2RJ3A 2QROA 4YXFA 4DR3O 4WESA 4DXHA 4RL6A 1U2GA 2AMFA 1T4DA 5FUBA 1ZVVA 2BTQA 2PTHA 4IVNA 5AVZA 4FYPA 3CZ4A 3OFNA 4LFAB 3A9RA 4BWYA 3A06A 2FFAA 4W5JA 2OBMA 1ML4A 2BGUA 4RSMA 4JI0B 3T5PA 1EVKA 1PI3A 1W2GA 1YS7A 3F8TA 1E3DA 4LI0A 3L02A 1PTJA 3Q2IA 1UXIA 4JU9A 1L7EA 3PPVA 3EMKA 2EBFX 2Z83A 3GZJA 3CX3A 3E7XA 4ABTA 1YR9A 2OFXA 2G0AA 3GLSA 3BRSA 4FB4A 5AMXA 3G2MA 4DR1O 4H1UA 4DDWA 3MBKA 1US8B 1MG5A 5CNMA 3K4HA 5EWLB 2CLIB 3F3SA 3T3NA 4O4JA 2ICAA 4H18A 1D03A 2JFFA 3WWOA 1AJNA 4BQFA 1YB5A 4OQ4A 3JVUA 1ENPA 3OPYA 3LRXA 1AB5A 3W79A 3K20A 4D4GA 2YZGA 2O3TA 3MJDA 1ROPA 5JS8A 5L51A 1IBMO 1O4WA 3MTIA 1P2BA 2X2PA 3NX4A 1G66A 3JWJA 2X8BA 4LX0A 4HTFA 3L9DA 1Z8FA 4DN6A 1Z8DA 4O0MA 4ASUD 5B64A 1Z56C 5KHKA 1WSAA 4ACBA 3G9TA 4O2BF 2J0UB 3M3DA 1UP4A 5J58A 1Z4IA 4BQPA 5HKAA 3CH5A 3RIEA 2ZIXA 3G02A 5CH5A 4PHHA 1IBLO 4YRQA 3OO0A 4ZARA 1KYYA 2FAXA 4OOEA 5L7WA 2A35A 2WJ3A 4I5SA 5I7OA 5IW8A 2FEWB 3F49S 2F1OA 3CKYA 2XASA 1N6RA 4CETA 4DUGD 4OO3A 3HDJA 1KXJA 4G9EA 4EG3A 1VSUA 1J07A 1JXQA 2SKEA 4XGQA 2LO1A 3S29A 2X8JB 4Z9AA 2GRJA 3C7KA 1KPIA 1V55B 5ALXA 2QUIA 3R7AA 1JLLA 4YASA 1V1RA 1PRYA 2IA5A 1E1MA 1A2KC 3NIBA 4CV2A 2AJTA 1ELOA 4UTNA 3WQRA 1V11B 1L8LA 4ETWA 4NTWA 1QV6A 3AESB 5TQ2B 4PCVA 3MTJA 5G1NA 3T9DA 3A9TA 3B6KA 4QJFB 2QXYA 4F7DA 2WWIA 3O4FA 2VIIA 1AGRA 1QLWA 1OXBB 4B83A 1RLOA 3FYUC 3V1MA 4PA4A 5M29A 4P0PB 1D1QA 1EGHA 3V2IA 1FVOA 1K89A 2EAUA 2MSKA 4HNUA 3UM7A 2Y4OA 4KH0A 2UUCO 4MLZA 3TRIA 3GRZA 4EJSB 3I64A 5AUOB 3LTNC 2GUGA 4O59O 2GPTA 3UJ3X 2FV8A 1ZW6A 4Z8YA 4AMZA 3A2LA 4HAXA 3WLHA 5AI6A 2YEVB 1KKCA 1MX1A 1II8A 1NVVQ 4BNUA 1G19A 1GRNA 3DZBA 1BIFA 2D7DA 5FR1A 4X54A 2YYSA 2OYSA 4BTVA 3EXEA 4AJKA 3JQ9C 4DV7B 3UAZA 3VZRA 4BMSA 5HJ2A 1GL9B 5KYYB 4ZAVA 2JLZA 2ARHA 2R48A 3AEKA 3EXG2 4BGUA 2ZITA 3WG9A 3P96A 4LRTB 4BAYA 2RG1A 3BY6A 1B42A 2I3BA 3I4FA 5A62A 3DYBA 1ZOLA 1M5IA 4C4ZA 4BY9E 4F9TA 2CXPA 1Y3FE 4M38A 2FFHA 3I6MA 2UUBB 5IASA 4WA7A 3VAYA 2VCYA 2BKUA 1U9JA 4LBWA 1H4SA 3GWKC 1BGXT 3PUXA 1GRCA 1QK3A 3MYYA 1SXJE 5FWAA 3R5JA 1VQ4V 3ZJ4A 2FP4A 1OD6A 3ISJA 4BX9A 2YI8A 1R9MA 4RA9A 1YULA 1S1CA 3KXKA 3KUXA 3SCZA 2H2WA 2HQSA 2IV2X 4TMXA 1CULC 3ABQB 2REQB 1MU0A 3K0EA 3PEVA 1P0FA 3IGFA 1I6LA 4D9GA 3BCCH 1L9KA 1V7PC 8OHMA 1WB5A 1T5BA 3JYLA 4IXDA 2AFIA 3R09A 5DM6V 3AVPA 2YWRA 1PDWA 4Z1VA 2O2XA 5JCZA 1OCEA 2YV1A 1BXGA 3NDBB 4G1CA 1DPGA 3T1VA 1BT8A 1IXZA 4KQXA 5I4CA 5IMSA 1KO7A 4LY9A 4DQDA 4D9JA 2Y05A 5DGCA 4ESVA 2R8BA 4LKRA 1BRMA 2BJHA 1MN6A 3OT1B 3OP4A 1NUUA 5F35A 3WWEA 2NO0A 2DWOA 2AE2A 2XADA 3L6UA 1B8OA 5A4DA 1M1YA 2J6BA 4BO9A 2XTZA 3PXXA 4PU0A 2BGMA 4KJXA 1KKUA 1D2NA 4TRNA 4X66O 1T43A 2VDLB 4RDXA 4QBFA 3OOEA 3MSXA 2XA1A 1UDWA 1U3WA 3KHTA 3EGCA 2QLJA 1G8HA 5DHAA 1SQPH 3V1UA 2EGHA 1O5OA 3AI3A 1EE9A 1AH2A 4HCJA 3RAJA 2O8DA 2VAPA 3HCCA 1KI6B 1J9EA 1IE3A 1QS0B 4TMVA 1SC4A 4BMCA 5K8JB 3SIWA 3H2KA 1NMQA 1U1FA 3NONA 3OZIA 3GP8A 1F4MA 3KO8A 4C43A 4LAFA 1N5KA 3FFWA 3Q1LA 4YONB 4BX8A 4JL5A 2IBSA 1T5DX 3IHKA 2IS4A 1P4RA 4LBYA 2AZTA 1RJ9B 4KO1S 3SWWA 1YR1A 3WSWA 3ITDA 5FV4A 1G8FA 2LRHA 2FPGB 4J3JA 3SEZA 2IV3A 2QMZA 3ND6A 3KWJA 3CR7A 1KO4A 4BXOB 1G18A 5KX5F 2CLFB 4D0NA 4S2UA 1Q7CA 2R9AA 2QQFA 1FTGA 4BPRA 1WMFA 1I32A 2R6FA 4EEQA 3S68A 1TUEB 1AN9A 3C6XA 4C5CA 2V03A 5KUTA 2VXBA 4P4NA 5ALKA 3SJUA 3L07A 1MIOB 4O5AA 4CODB 3IJ4A 4JLKA 5PNTA 3VO9A 2VDWA 3TSCA 5DGDA 2ZU6A 5EVCA 3EAQA 3CCQV 3DEYX 4PIPA 5INTA 2X9GA 5HRUA 1IU9A 2PLRA 4LBVA 2OCLA 4DBLE 4N65A 2ASEA 3LY8A 3FZEA 4MRAA 3L92A 2ZI3A 1EFCA 3CEIA 4M46A 4O4HF 1KHTA 6PFKA 1OV9A 1FVFA 1XDCA 3UMFA 2AL7A 3H99A 1AS0A 2AOXA 4UUNA 4B8ZA 1EXNA 4M0MA 2P4SA 3GMDA 2NTVA 3C1UA 4AKEA 1QO7A 1QGZA 3RVOA 3GXBA 2AC4A 5GJCA 1XDDA 5HKKD 3OQPA 1O95D 4G41A 4F1JA 1JXMA 1H0HA 1SPXA 2XYRA 2O0HA 4A03A 5M04A 4ZEVA 4U7HA 4A0QA 4LWSB 3JR7A 1YS4A 2HLDD 1JHUA 4I1PA 1AS2A 4V03A 1T3ZA 2P0AA 3VR5D 2R2AA 1RI1A 4WZBA 4TQAA 1ZM9A 2Q0AA 1KI1A 1UJMA 2PUAA 3GLFB 5BSGA 2QM7A 3OESA 3Q3GE 3IVRA 1NF9A 1G63A 4XLZA 3VX4A 3OTOO 5DZSA 2V7VA 3KOMA 3PV0A 2FZ5A 3EEBA 3K9WA 4WZAE 2IXBA 2OHIA 3AEIA 1H2FA 1V3VA 5BN4A 1BVUA 3PX2A 1QC5A 3H16A 2JKZA 1R10A 2OPHA 2LZ0A 3UGKA 5KIAA 3BSYA 5DM0A 3F5FA 1NLFA 5F9HA 1SHUX 2B3TA 2YL2A 5IMBA 3HV0A 3MXTA 2Q7EA 1NUHA 3X2EA 4L8YA 4MYSA 2XHZA 2HHLA 3U80A 4KVFA 5CX1B 2BBSA 5BQ5A 5I3CA 3VNRA 3LNTA 1B6TA 4CMAA 2LPMA 1NFFA 3S1AB 3WA6A 1H5UA 4Q82A 1OI3A 1U1CA 1ZWLA 1R0KA 1GG2A 2XUOA 5JXGA 2IPXA 4QAQA 1NVAA 3OTQA 1B1AA 5CRIA 4UNIA 4D9HA 1Y81A 1PJ8A 2VA8A 3GDOA 1XVTA 4B5LA 2WJJA 4LSWA 5GIPE 2FWRA 4Q21A 1NOJA 3CO5A 4C6TA 2R7MA 2GFHA 3FB7C 3Q8MA 2DMXA 4CIYA 3O82A 1V5WA 3PNKA 3U48A 2H06A 3M2TA 1YL5A 5AI9A 4WCFC 2GN2A 3FNQA 4Z2AA 4G25A 2H16A 3H5OA 1XFAA 3RBVA 2DTDA 1VE7A 4RLQA 1NX6A 3QEBZ 1KYZA 2P62A 4RF5A 3AB7A 3SSAA 1NM5A 5JQGF 4YJGA 4C06A 5JJIA 1TM7E 4GX5A 2YUTA 2KBEA 5DLDA 3UUGA 2C5AA 4EO7A 3DYIA 1BEEA 3DFMA 4JI4B 3NWBA 5DIFA 1NNUA 4AQYO 1FRFS 2IDMA 3F3MA 4MCJA 1ZCFA 4UMDA 4FZ3A 2GBOA 1QQ5A 4BCCA 3P2MA 3SX4A 4WQMA 1K6XA 3GFRA 3RRJA 2YJZA 1RADA 2V0CA 1NQAO 3ZQ6A 3A1CA 2JEXA 4YWHA 3JQPA 3G0CA 1MT3A 1U0SY 1F60A 3HZZA 1H8EG 5CFZA 4NJEA 5CXXA 3P26A 5YASA 2AHYA 5IYZA 4FMBB 2JBAA 1V8DA 3LT0A 3B3AA 2W2NA 4QU5A 4GECA 4L08A 3ST7A 4DSNA 2HGZA 2SHKA 3HXOA 4GXRA 4AKSA 4Z2YA 4BLOA 2JBWA 4LHYA 1Z29A 2X40A 1YBMA 2ZB4A 1RLMA 3EVGA 4KLAA 4RUKA 2ZPAA 2VJQA 2G1JA 5U9CA 5DK6A 4YCBA 4FSHA 2LKCA 4KUHA 3R5SA 3SG0A 1NR1A 5HGXA 2GDSA 4JKOA 1W0KG 2J5RA 1EWTA 5IWAB 4HUJA 3QU2A 4AJ2A 3A70A 4I7ZB 4A2QA 4M1YA 4R2KA 4CIWA 1FUKA 2WB2A 2GRUA 2RBGA 2YASA 5TMDA 3OEEA 4NI5A 3SVLA 1X8XA 3E48A 3DUFB 2JJ1D 3L0SA 2QRVA 2GUWA 1XXHE 2F55A 3IC7A 1Q1AA 3L84A 3K35A 1JHXA 2NSLA 5IC5A 2HRRA 2QR4A 1HMPA 1PJAA 4OHCA 1Q3TA 1OBHA 3W8FA 2VJYA 3K9NA 3PU6A 4CTKA 1ZL8B 3FFAA 1UMKA 4D2IA 2ZYSA 4MZXA 3AHHA 3UH1A 1T8UA 1CEXA 3CLTD 3OGIB 3PI6A 3RT1A 5AOAA 3B2QA 3AR6A 1VLVA 4WLNA 1N0UA 4RKRA 5KTKA 1CZRA 1C9EA 1O4VA 2IW5A 4MW7A 4HKTA 4UNRA 4CEJA 3CRAA 2QTCA 4C6RA 1FX0A 5JXWA 2FMXA 2QM4A 2G17A 2PGIA 1WXWA 1P1RA 3DS8A 2NSDA 3MIIA 3MUEA 1QNFA 2P40A 4OY3A 3HWX1 3DMTC 3M3HA 4IR7A 3OIGA 1DRKA 1NTOA 1UM8A 3UK1A 3LE8A 4OAOA 2AOUA 2KG7B 1YBHA 4LRSB 4RIHA 4M7WA 2OENG 3MUFA 2BR4A 3LV8A 3UHOA 3R23A 3A3YA 3RRYA 2UUPA 2ALJA 1V48A 5A6VA 4PFQA 3FLMA 2VN8A 3PNQA 3AY0A 3C5HA 2IY8A 4DJAA 2FPRA 4A8TA 3U26A 4EF4A 4ZO9A 3OQIB 1P2SA 1F17A 2R96A 5CBKA 2O3RA 4B3BA 5JYBA 1XGKA 2C7OA 2ZANA 2WLNA 4F2HA 3VPBA 1V2HE 4OGKA 3PVSA 5KSPA 4G5OA 4JI7B 2ZE8A 2C03A 1L1QA 4RDCA 3E8MA 4NS4A 1OA1A 3AMVA 2PE5A 1W87A 3K9AA 1TYAE 4I2VA 4DGQA 2PSJA 1B23P 3A9CA 2AHZA 3D5EA 1DQRA 4CLEA 2GLTA 2PLWA 2G5GX 2HHAA 1SVKA 4F46A 3BTOA 4NJOA 4RVHA 4ZDJA 2ZAIA 2FSIA 3FPLA 3K8YA 4TXNA 4LCBA 1G3MA 4BZZA 5HHTA 1HTWA 3AU9A 6ADHA 3W5HA 4GCZA 1EGMB 4ZJUA 1UZNA 2ZULA 1COWD 5HCNA 4UHJA 4K9SA 2GEJA 3KEGA 1EFUA 1CQIA 4CLOA 2I1VB 1NJGA 1GFIA 5FOTA 4PFSA 4FDTA 3BXEA 2P67A 3ZWBA 2QL9A 5JNSA 3C3KA 4YVFA 4IQ8A 1OCCC 2VBFA 3CEMA 3TTUA 4W5RA 1EEXB 2AFHA 1YD7A 4JQZA 2QUBA 2ZAOA 3WHKA 3MB5A 5ESXA 4TVBA 1O6GA 3KZXA 4BQSA 2AX4A 2G9RA 1WXIA 5KMGB 4WMLA 2FOIA 4BW5A 1GUYA 2ZUEA 5L4LA 1FXUA 4E4RA 3ZU6A 5I9BA 5FXMA 1UF9A 3X1DA 4B71A 1XPOA 4FDAA 4HT3B 4J1TC 5JC8A 1SCQA 3TTTA 3FFQA 3N87A 5JAZA 2GLXA 1D07A 2OORC 1L4YA 2PRZA 4QOIA 4IRMA 1XROA 4GAEA 3AO0B 1T8YA 2DFKB 3SKYA 1AM4D 1PEDA 5B55A 3Q3IA 4FBLA 1PUJA 4BO8A 3VKFA 2BZSA 4LVOA 2W11A 3ZWPA 1YQEA 5HQTA 3BF8A 4HGPA 4RXTA 2V4DA 5C8YF 1FMTA 5MHTA 4AQ7A 3EZYA 5FB3A 4NOMA 3MJSA 1ZGJA 5GW7A 2XJ9A 4OMFG 1H3EA 1CUDA 1U1GA 4JJEA 4GDMA 4X5OA 4NENB 3ZMVA 1H0RA 5HK9A 3C90A 2OHVA 1NI4B 4FN4A 2YWXA 1U0JA 4IWXA 1LQ2A 1URFA 2D4HA 1I3OA 1QUEA 4K87A 4LOLA 1M2JA 4YDQA 5ICGA 3CLSD 5B1OA 1GZ6A 5BXYA 3AJ8A 2EV9A 4LXQA 1FC0A 4V0NA 4M0PA 2WV9A 1QAQA 1XHLA 1HGXA 3FPFA 1TCUA 4LHVA 1Z5UA 3LBIA 3MTDA 2XMGA 4EYSA 2JHGA 2D3WA 1KY5A 3JD1A 5ALYA 3DBIA 3VZPA 3RGWS 4G5RA 5LA6A 4LIPD 3A1FA 2ZUCA 2R70A 3J7AC 2CHVA 4B32A 3VNUA 1I7LA 4JLOA 2Q5EA 2ZREA 2WM3A 4B8WA 1C3VA 3BK1A 3G0IA 3WGYA 3AG3C 4YECA 1F8XA 4L95C 1JBQA 3T1HB 3HQ4O 1CNMA 3DBLA 2CNLA 1B8NA 2BISA 4YC7A 2WLMA 4IDGA 1MAAA 2YHSA 4BKUA 2B5OA 3FUWA 4A2WA 4LKOA 2CD7A 3IVAA 4QECA 2JRIA 5HTKA 4LHSA 4H4DA 3N2KA 2FG5A 3OTWA 3V7YA 3SDZA 4R9UC 1X3SA 1EB8A 1NAIA 3IR7A 4LC0A 4MI1A 4V1CB 1M0WA 4MI3A 5GQSA 3TQCA 1W4RA 3G49A 2P68A 1FUUA 1EG7A 3VDMA 1NJ6A 5IZCC 4GLOA 5FULA 3S5JA 5ESWA 2DHRA 4B3MO 4B34A 1P8AA 4I9HA 2YXYA 1FQWA 3G0GA 2KB1A 1EH5A 3QLTA 4K3AA 3NOOA 5C4IA 4L9SA 1JG6A 2IZ0A 1IATA 4FFVA 3E9NA 3Q11A 2UXCB 2O48X 4OQEA 4KKVA 2O5VA 3AFGA 3M89A 5CA0A 3B7WA 3CRZA 5G2OA 3OZVA 3A0RA 3TJMA 3MRVA 2JH8A 4RTOA 4J6EA 3IDZA 1LH0A 2OA0A 4MVJE 2QI9F 4DR2B 1HT3A 3FOBA 1P9RA 2A06H 2QTZA 2AG1A 4FMCB 4YO7A 3SQLA 2VPXA 6LDHA 3J7TA 1Q1GA 3H17A 3H1JH 4A10A 2D59A 3R9XA 3NW9A 1L5VA 5F76A 1U97A 3Q41A 1OCOC 4W5QA 4UMEA 1QMPA 1Q0UA 5ARDA 3CGGA 2CTRA 4H6XA 1H4QA 4YRKA 4MKIA 3EGEA 2X42A 3G1WA 3H01A 1ZWIC 1L5YA 3EGXA 3WTCA 1YHZA 1T8TA 1H2BA 2V98A 4MPTA 4U9HS 4O3FA 3UOGA 2G36A 1Q57A 4DFDA 3BAZA 4ZV9A 3LLCA 1T35A 2X4GA 2PJZA 1Y4SA 1RQNA 3HXKA 4DV1O 2IEZA 3DDWA 1BWRA 3ZRXA 3FMPB 1G6KA 1U3DA 4ZCQA 3VU9B 4IV8A 5KSZA 2ZUBA 4M0LA 1D3AA 2QZJA 5FFMA 1EP2B 5EJMA 1XVIA 5H3HA 5HUQA 5IDJA 3KQOA 1S2OA 1C7RA 4DNOA 4XKJA 4NY1A 3EPPA 2F90A 1ZSPA 4CM3A 4FFLA 4M1MA 1ECBA 4DL9A 3IERA 2ORVA 3SJBA 3L1HA 5KU1A 4GPEA 2EJBA 5JPDA 1SCDA 1TA8A 1BC5A 3KKNA 5E1BA 3ASOB 2G8NA 3ZXYA 5TF0A 3JRXA 4OH1A 4Y2QA 2BE3A 5LYJB 1TJ5A 3ZV4A 3WKBA 4CMHA 1ZJYA 1SWVA 3LSSA 3BB4A 5GJWC 5FRDA 1UBOS 3HKCB 5JSKA 1Q6ZA 1H1LB 4D9EA 4PYJA 2ONJA 4FMDB 1AOXA 4HY3A 1L7NA 3ZHOA 2XAAA 2YZ7A 1WXDA 9GPBA 1TX4B 5M34A 5A4JA 4B3SB 4PF1A 3U7RA 4LSZA 3T6KA 4FIDA 3ZDXB 2PYJA 1MJFA 4JENA 4YCNA 2MK3A 3HCFA 2JIMA 1G8PA 4PC2A 4Q4LA 3WRXC 4L8LA 4FDMA 4I50F 4C1BA 2O0KA 5EIFA 1G2OA 3IALA 3BL5A 4KHZA 1NP3A 4ZI7B 4ARSA 4C5BA 5ALPA 2QK4A 3VH4A 1XB2A 2ZTSA 2XUZA 4EPTA 5F7OA 1Y3HA 2YNMD 5CDFE 2DCMA 5AW0A 1PNTA 3T3GA 2NO6A 3A58B 4C2AA 2HA6A 3DMGA 2FE1A 2NG1A 3NAZA 1DBWA 2Z98A 1FIUA 1JFLA 1WAMA 3ZWAA 1KDPA 3A37A 2ODEA 1ZH8A 4RTLA 4RJ2A 4Z1MG 3TOVA 4Z4HA 1I7PA 4LC1A 1PT7A 4N3AA 5A5GA 3RBZA 4NMMA 2JGDB 3VMFA 2OZKA 2PH5A 4NFYA 2DPYA 1G7CA 1ID1A 3IBGA 1DKUA 2NXCA 4JITA 5BQXA 2HJHA 1N6NA 1NN1A 2DQYA 2PH7A 1GN6A 2XGJA 2R6HA 2ZJYA 2IVFA 1RWMA 3VISA 2A6PA 1U3CA 3NBXX 2AB0A 2Q4TA 3WYEA 5FR2A 3DT8A 1SD1A 1G7SA 1L5SA 2XTAA 1X0XA 3LCUA 4A23A 4I1OA 1TF7A 3JVDA 3QKRA 5E7IA 4KYIB 2ZETA 3VRHA 3F8WA 4EY6A 5KQPA 1FDIA 3IPXA 3NBUA 1E9BA 4DNFA 1MP0A 4ROSA 2WJIA 2QWNB 5CIQA 1K8RA 2NX2A 3D7KA 1LK5A 1HR0B 1DIGA 4HI0E 3ZE8A 3FPCA 1MA1A 1OROA 3IAM1 2A1UB 2IPMA 4D3XA 4PO3X 5KAPA 2IE8A 3A36A 3M8AA 4QVKA 4C7OA 4TWZA 3K1AB 1IDN1 1F14A 3OQ1A 3HU2A 5ICCA 1ZAUA 1X94A 5K0CA 1NVXQ 3RT3C 1YONA 2X19A 2HFEC 2X0EA 3N86A 4J07A 1JQJC 1R37A 3AG1C 1AA9A 1JIJA 4JYMA 3SI7A 1EP1B 4YFYA 5FH9A 1U1IA 4FGUA 1RQ7A 3LUAA 2VH5R 1G5TA 1BFKA 5HXAA 3U4GA 3P9RA 2NVBA 2X8LA 4MIKA 1QFJA 5E2BA 3ESQA 1PJ3A 4RMNA 4J11A 3B52X 5H6QA 5SZKB 2CNDA 3WYAA 5DCUA 3IIEA 1VQ6V 4I5IA 2PGNA 1DT3A 3T9FA 1N9GA 1SQXH 4D4JA 2WJYA 1XZBA 2H8GA 4F5DA 3V8PA 3SGLA 4EKEA 2PDAA 2UAGA 3NKFA 3PA8A 4ASUG 1KU0A 3VDXA 4X1KB 4YJFA 4IX9A 3OOYA 2NTJA 3SE0A 3P2EA 1NYLA 2IXGA 4KQGA 3MLAA 5DSXA 4DCMA 4F8EA 2VK8A 4ITUA 3E82A 1CT9A 2OQVA 4FC6A 1VDMA 4UFPA 2PXXA 5C1PA 1JQAA 1AY0A 1A95A 2CLEB 2WIBA 2YFHA 4B0PA 5JXJA 1U3VA 1VSQA 5HQJA 2XOKA 3ILHA 1YDMA 1HE8B 1OX4A 3F6CA 4QXOA 4PQFA 2DJIA 3R0QA 1WCWA 2QE7D 4P7BA 5L3RA 1UANA 2EZPA 3EC1A 4W5OA 4DM4A 1HE1C 1Z7BA 4JR0A 3I9LA 3EZNA 2CHFA 4OFBA 5TQ0A 4KRFA 1KNXA 4DRXB 2WICA 1KBZA 3N2LA 1IHYA 1KY4A 2OCDA 5REQA 3FD8A 2ZM6O 4HJXA 3L9WA 2A88A 4L28A 1JG7A 5HF9A 3AG5A 3WQBA 3IUQA 1QX4A 3FROA 5CA3A 1QCEA 1EFRD 1JDPA 2GS9A 4ZMSA 1C80A 3KZNA 1KSFX 5TGTA 1QQ7A 2YWBA 1FNMA 1T36B 3EVEA 4OX9O 1QONA 3U9LA 1J6UA 1A9SA 4CLRA 3PRKE 4I55B 4CQMD 4EKNB 4OFXA 2FG6C 4LG1A 5JVDA 2W70A 2X6TA 2JHFA 1Z5ZA 3OLVA 4QL3A