1YSCA

2.8 angstroms structure of yeast serine carboxypeptidase
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
421
structure length
421
Chain Sequence
KIKDPKILGIDPNVTQYTGYLDVEDEDKHFFFWTFESRNDPAKDPVILWLNGGPGCSSLTGLFFELGPSSIGPDLKPIGNPYSWNSNATVIFLDQPVNVGFSYSGSSGVSNTVAAGKDVYNFLELFFDQFPEYVNKGQDFHIAGESYAGHYIPVFASEILSHKDRNFNLTSVLIGNGLTDPLTQYNYYEPMACGEGGEPSVLPSEECSAMEDSLERCLGLIESCYDSQSVWSCVPATIYCNNAQLAPYQRTGRNVYDIRKDCEGGNLCYPTLQDIDDYLNQDYVKEAVGAEVDHYESCNFDINRNFLFAGDWMKPYHTAVTDLLNQDLPILVYAGDKDFICNWLGNKAWTDVLPWKYDEEFASQKVRNWTASITDEVAGEVKSYKHFTYLRVFNGGHMVPFDVPENALSMVNEWIHGGFSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2.8-A structure of yeast serine carboxypeptidase
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase(carboxypeptidase)
molecule keywords SERINE CARBOXYPEPTIDASE
total genus 115
structure length 421
sequence length 421
ec nomenclature ec 3.4.16.5: Carboxypeptidase C.
pdb deposition date 1994-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00450 Peptidase_S10 Serine carboxypeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.410 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1yscA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1yscA01
2EDAA 4X71A 3Q0TA 4MYDA 3HXKA 1SCQA 3BXPA 2FJPA 2WJ6A 5EIHA 4G9GA 4CIAA 5ALTA 3CCCA 2XMGA 4L9AA 2HA4A 3SK0A 2GYUA 4NZZA 1IUOA 3STWA 3DYIA 1YA8A 2IIVA 3ZV7A 1L7QA 4CI9A 1MN6A 3W9UA 1GGVA 5JAUA 4B80A 4H7IA 1CRLA 5AKGA 1K8QA 1FFDA 3WKBA 2XUPA 4BC1A 4PV7A 3QVMA 5DWDA 2XQIA 3WZMA 4FBLA 3D2CA 5E4TA 1EDEA 4C6HA 1ZJ4A 5HF8A 1BCRA 2QUAA 1DT5A 3WK4A 2X76A 3H2JA 1DU4A 1CPYA 1XZIA 5JAOA 4AZ0A 3DKRA 5HK9A 3KDAA 5AKZA 1FFAA 5EHZA 4G9EA 1MNAA 2G4LA 5C81A 1N8SA 2B9VA 3VJLA 1VE6A 2WIKA 4EY6A 3GBSA 1THGA 4PSCA 1BN7A 4A23A 2I78A 4IQ4A 5LZ4A 1GPKA 5JD6A 2GBIA 5YASA 1VXRA 3NUZA 1KU0A 5AKHA 1X70A 4FNGA 4Y2RA 5LYYA 3VJKA 3AFIA 1S8OA 4X85A 1XLUA 3VVMA 4P9NA 1EDBA 4FBMA 5DJ5A 3QM1A 1MAAA 3OC0A 1JI3A 5EI5A 4KE7A 1EVEA 1UOPA 4G4JA 4Y2UA 4M0MA 1J1IA 2C0QA 3EBLA 3HRHA 2XI4A 7YASA 4QWMA 1JMKC 1VE7A 3PFCA 2Y1KA 3PDCA 1CFJA 1XZAA 2XUKA 1AC5A 4OB8A 3EQ7A 5CT6A 3WYNA 1PV1A 2RHTA 4BCBA 5FPPA 4RGYA 3SX4A 3FYTA 5T4EA 5C8XA 1CUSA 2CKMA 1JJBA 4X3CA 4YPVA 5EHNA 4PSDA 3V1NA 3BF8A 5CT8A 2D5LA 1IZ8A 2HA7A 3ESDA 1MT3A 3MGAA 3O9MA 3OOSA 4W9RA 4ZV7A 4L3WA 2CEKA 2VTVA 1EK2A 2O2GA 2RAUA 4P92A 5K3FB 3U1TA 4O08A 2C58A 5D3ZA 2VF2A 5BV7A 1JJIA 4WJLA 3IA2A 2I3DA 5IVIA 4BCCA 4DYHA 2JGKA 3WL6A 3G9ZA 4AX4A 1R9NA 2CBGA 2FX5A 3BJRA 3QMVA 2CMFA 3U0VA 1TRHA 4OB7A 5DTJA 1DQYA 1F6WA 1NU6A 4N8DA 4W1PA 1UXOA 2PSFA 1CVLA 1XQXA 1XZMA 1BEZA 3FBWA 4F21A 4BE9A 4AMYA 3M81A 3B5EA 1XKTA 3ESAA 1PJAA 5DNUA 4QDOA 2ZYHA 2JEZA 3HI4A 4Y2SA 3UMJA 1MX5A 3D59A 1TK3A 1P0MA 3FSGA 1O6GA 2DR0A 5AM1A 1VKHA 2WJ4A 3HACA 3AZQA 5AKJA 1XZGA 5CH8A 4QA9A 4LKOA 4LXGA 1MX1A 3O9VA 3KSRA 2ZVDA 4B83A 3MVEA 5AIBA 4N5IX 5EFZA 5AP9A 3LCRA 2PL5A 2CUTA 1E89A 3T4UA 1W4LA 4QLOA 3H1BA 3BIXA 4RE5A 2VA9A 2OAEA 5CXXA 1ETHA 3D0KA 3UUFA 2QXUA 4CG1A 3C87A 5AOCA 3IURA 4ARBA 1A7UA 4MWSA 4A16A 2BGRA 4RE6A 1JU3A 2J4FA 4KEAA 4U2EA 5LZ2A 4FLEA 1R9MA 1ZD5A 5FLKA 5ALRA 2WHPB 2VJAA 3ZI7A 5E4JA 4ITVA 1CR6A 4Y2XA 4QEKA 5CH5A 1W76A 5DNVA 5I9IA 1UK9A 3G02A 2VATA 5AI9A 4U2FA 2GBCA 5ALYA 3G0GA 4BTVA 5LKRA 3ICWA 3RKSA 1QO7A 3ILSA 4IHAA 4DSAA 1IUNA 1D07A 1WB4A 2C5GA 5ALZA 5ISMA 2G5TA 2QOEA 1UK6A 4MXDA 4Y2TA 2E3JA 3DYVA 4W1RA 5J3JA 1MNQA 2PVSA 4ROTA 2I03A 4BBZA 5LKAA 4X7BA 5C8VA 1GQSA 5ALMA 1OCEA 1CUHA 1Q83A 3HLKA 1LBSA 5AKXA 5HZGA 2V98A 5AO9A 2OLEA 1AQLA 5CURA 4CG2A 4EY7A 1U4NA 1RP1A 4GLBA 1QFMA 1TCBA 3WK8A 4B85A 4UHDA 3B3QA 2YYSA 1CUEA 3HSSA 4BCDA 2XQFA 1CEXA 3QITA 5T4FA 4UBJA 4EY8A 3WK5A 1WB6A 4I3FA 5A7FA 2ZSIA 3GFFA 3D4LA 3R3XA 3ZPXA 2QS9A 2H7XA 1YS2X 1LPPA 1QTRA 2XLCA 5FOQA 5D7BA 2WG1A 2B20A 4BAUA 3BE8A 5JZ9A 5LZ8A 1LPNA 1QIEA 5ALXA 3JWEA 1P0IA 4MEAA 2C7BA 1QIMA 2RGUA 3STYA 3A2MA 2AJDA 3I6YA 1CQZA 1LZLA 2HADA 2CJPA 2AJ8A 4Y9SA 3C8DA 3ED1A 1HPLA 4QZVA 4E14A 4ZI5A 3GROA 5HF6A 3CN7A 3FNBA 3I2HA 2WFMA 3IVMA 3LIIA 4WDQA 4K6KA 4UBKA 3LIPA 2ZYSA 2WUEA 4FOLA 5D6OA 4G8DA 2DCMA 1ZGCA 4BVJA 3VISA 1YAHA 2J4CA 5AOAA 2O7RA 2WHRA 1K4YA 3G8YA 1U8EA 1WCYA 1WOMA 3PUHA 2Y6VA 4Q34A 2IITA 4J0JA 4NVRA 2BAGA 3H17A 5KREA 4KAJA 5SYMA 1X2BA 5A7HA 2DHDA 4E46A 1AZWA 5HF9A 1VA4A 1VOTA 2R11A 1TKRA 1QLWA 1ZOIA 1CUYA 5IH7A 2PSHA 4JH0A 4AO8A 3PE6A 4AO7A 3QH4A 2WFLA 1XZKA 1VLQA 2ACKA 3IB3A 1SOMA 2JGLA 1CV2A 1WHTA 3DLTA 4LHEA 3WI7A 2Y2VA 6YASA 4FFVA 4QWWA 1ISPA 1WPRA 4J0DA 1ACLA 4DLNA 4E11A 3ZLTA 1HBJA 4KE6A 3DQZA 3STUA 2Y2UA 3ANSA 3DDUA 3I2FA 3WWOA 2ZSHA 1ZD4A 1G5FA 4AN0A 2WG2A 2JGMA 1U2EA 4Y7DA 4DNFA 3GA7A 5AKIA 4BRZA 1LPOA 2D0DA 1GT6A 4PO3X 3R3VA 3RK4A 5ALWA 4WY5A 1QE3A 4W1QA 1MJ5A 3BDIA 3H18A 5AM2A 1XLVA 3HZOA 2JGJA 4OYLA 2EDCA 2UZ0A 5EHQA 5CTAA 4X6XA 1LZKA 1T4MA 4OYYA 5AOBA 1XRLA 4BP8A 1QZ3A 2PM8A 5DNWA 4BRSA 2RONA 4DSZA 3ZLUA 3L1IA 1Z68A 1JT2A 4GEGA 1XZHA 4L72A 3EF3A 3H2KA 3H2HA 3FYUA 5KBYA 3KWJA 4G4GA 2JF0A 4G5XA 1VZ2A 1AGYA 2WIFA 1CUWA 4X6UA 3A6ZA 5AKEA 4BAZA 3PF8A 4G8BA 4QDUA 3G9TA 2Q0XA 2ORYA 2HM7A 3QPDA 5ALDA 4FHZA 4RNCA 4UBMA 1W75A 1HL7A 1C7JA 2QR5A 2QUBA 3MUOA 4XJVA 3B12A 5CT9A 4HAIA 1T2NA 4OSEA 3C6YA 2XUDA 2WTNA 1GPLA 4CCYB 4Y2PA 2WU4A 4UFNA 5AM5A 2QTBA 3BDVA 2DHCA 3STVA 4J0HA 3ESCA 5AI0A 4HXEB 2V9ZA 2ZJ6A 1YR2A 1U65A 2VT6A 2VJDA 2R8BA 1QGED 3C6ZA 3WKEA 4LXIA 1GQRA 3G9UA 1BCSA 5K5EA 5CBKA 4TPKA 2WHPA 2VJBA 1CUBA 3PF9A 5JD4A 1MAHA 2DQZA 1EB8A 4KACA 4CCYA 3R3WA 2WG0A 4N8SA 4IH1A 1DX6A 2XUQA 2YXPX 4H7JA 4UBLA 4OPMA 1EK1A 5AI8A 1GKLA 5EGNA 5AK4A 1GKKA 4BDTA 4BE4A 1C7IA 3DOIA 4KJXA 1H2ZA 1R4ZA 4Z49A 3G0IA 1USWA 3R3ZA 3RARA 4J3JA 3WIOA 4X90A 3BIWA 4DGQA 3NOXA 1HKHA 3H2GA 1F0PA 1LNSA 3I6ZA 4ZRDA 3WWCA 1XQYA 4AMZA 3O4GA 1ZI8A 3E4DA 1WB5A 2QVBA 5I8PA 1CUAA 5ALEA 5ALJA 2X5XA 3WL7A 1O6FA 4X97A 2Z8ZA 1KEZA 4MWTA 4P93A 2XUAA 3WIBA 5K3CA 1E5TA 3KOOA 5HQ3A 3A2NA 4B9AA 3WWPA 1QTIA 5FPQA 1KU6A 3I2KA 2WSLA 1QIFA 2QXTA 1Y7HA 4Y2YA 4YK7A 4KE9A 1XFDA 3G0CA 4H7FA 1ODCA 4DMKA 1A8SA 4B7ZA 4B81A 2OGZA 1UK7A 4TVKA 2GBGA 4XIIA 4EY5A 2JEYA 2BFNA 4WFJA 3K2IA 3STTA 1Y7IA 5A71A 5EIEA 2OQIA 3BL8A 5HFAA 5IVKA 2G63A 5BOVA 1XQVA 5AM4A 3H04A 3E3AA 3G7NA 3RLIA 5BWBA 2QJRA 1K5PA 4FLFA 5HK8A 5ALGA 3NWOA 5D3KA 5T4BA 1ZIXA 1HDEA 1QOZA 4ETWA 2XUFA 1UOOA 1P0QA 3HC7A 3I1IA 3WL8A 4KRYA 4H18A 2XMQA 1MO2A 3QPAA 4CFSA 3VXKA 2OGTA 1H22A 4ZGBA 3PI6A 1J07A 1AUOA 1BN6A 2OAGA 3BF7A 4H35A 5HKAA 3FCYA 3IBTA 4J0KA 4Q1VA 3CCBA 2QZPA 5IVHA 2H7YA 2B4KA 4ZREA 4IO0A 3D7RA 4EZIA 3FAKA 1AX9A 4GW3A 3QZUA 4C4YA 1R1DA 4EBBA 4KE8A 1DWPA 4FLMA 5JARA 3WKAA 1R88A 2IX9A 4FMPA 5LZ5A 3UUEA 3IDAA 4Q3OA 4EHBA 1FFCA 2JGIA 4KYVA 3QPCA 2HA6A 4B6GA 2HU8A 3WK6A 1YSCA 4IH9A 3V1KA 2GYWA 4W1SA 1W1IA 3ANTA 4YX9A 1Q84A 1YCDA 3RM3A 5FP0A 2Y6UA 1EA5A 1OXMA 4HXFB 2ZYIA 5H3HA 4OB6A 1XZFA 1AKNA 4Q3LA 4EUSA 3AIOA 2C4HA 3F97A 4H77A 4UHEA 4GDMA 2PSJA 3G9XA 1TCAA 3WA6A 3D5EA 5AK3A 3R41A 4LYDA 2YH2A 4MQLA 2Z3ZA 2XMDA 2FUKA 3PICA 2BKLA 2WLSA 2ZJ7A 3WKDA 1CIJA 2PPLA 2JBWA 1GPNA 4DMFA 2AJCA 3PFBA 2HRRA 4TGLA 5ALQA 3F96A 4FTWA 1QIGA 4DNQA 4FNMA 1EX9A 1DINA 1W6RA 1K6EA 5CT5A 2JIDA 4PSUA 1BS9A 2I3ZA 4OUKX 5AKYA 3C5VA 5ALNA 5JD5A 1LPAB 1SCIA 2QM0A 1JU4A 2HHAA 3V1MA 3V48A 4BTLA 3YASA 2HU7A 1YS1X 4QE3A 1XZJA 2WFZA 2WIGA 4WY8A 2VJCA 2XMZA 4F5ZA 3TGLA 3QYJA 3E0XA 1ACJA 4JYPA 3DNMA 2HA5A 3O4IA 3H1AA 1DQZA 2XMSA 4H7KA 2O2HA 5HQ3B 4HS9A 4RPCA 3F67A 1EB9A 2XE4A 1UT6A 3CXUA 1SCKA 2BUAA 4K6GA 2RI6A 4PF1A 1XRRA 4G4IA 2QKYA 4GXNA 1IMJA 4C4XA 3ICVA 5AICA 5JYCA 5I7UA 3M82A 3GUUA 4GI1A 1B6GA 1J2EA 1ODTC 4MQMA 1H2WA 3FYUC 1ORWA 3IUQA 3EQ9A 3GZJA 5DTIA 4J03A 1ZGBA 2DFPA 2XUIA 5SYNA 3AIMA 1FSSA 2PU5A 3KXPA 4J0CA 5LLSA 2PKYX 3WA7A 5LP1A 1XZLA 5FXMA 4M0EA 2QMQA 4HRXA 4FDMA 4BP9A 1CLEA 2XQJA 5IVDA 5KWIA 3TJMA 3BJMA 3WL5A 3C6BA 4LXHA 1QIHA 2CB9A 1YASA 4DMCA 5C7YA 5AHXA 2XMRA 4UPDA 4H7DA 3FLBA 5KWJA 3I2GA 4MJ3A 1X2EA 5HKBA 2XMCA 2H1IA 1CUZA 2JGFA 3ESBA 3Q8WA 2PUHA 4DMHA 2OXEA 5FDFA 3PUIA 4B0PA 1TCCA 3R40A 4XVCA 3WWEA 5ALPA 1GXSA 3N2ZB 2AXEA 4KR0A 2W6CX 3HJUA 1THTA 1E8MA 3CN9A 1W52X 3AZPA 2J3QA 3DS8A 1UKAA 5CMLA 4Q05A 4LIPD 4IH4A 4OU4A 3D2AA 2WM2A 4HRYA 1XRMA 5JAHA 3BWXA 3TRDA 1NU8A 3VDXA 1MU0A 5HCUA 4Y2JA 1EH5A 4N8EA 4HXGA 1YB7A 2O7VA 2ROQA 3D3NA 4MEBA 2WTMA 3JYHA 4H7EA 3IUNA 2AJBA 1JJFA 2OG1A 1UKBA 2V96A 1QONA 2Z3WA 1AMNA 2P8SA 3P2MA 4C89A 4WFIA 5JZBA 3FYUB 4KAFA 5A2GA 1F8UA 4XWGA 2XLBA 2HRQA 4UBNA 4AQDA 3GELA 1ZD2P 2WFLB 4WFKA 3L1JA 4DNOA 4QDTA 3AJAA 2XDWA 2ZJFA 1FFEA 1J06A 4KAAA 1I6WA 5AK5A 2WUGA 5EHXA 3QMWA 5JALA 4DTCA 4C01A 2ES4A 2C5FA 2XUGA 2WU3A 1VXOA 4JUIA 1YAJA 1BRTA 4FKBA 5A62A 4Q3KA 4XX1A 1DWOA 3R3YA 4WCVA 1DT3A 3IULA 3W9BA 3NGMA 1CUJA 3FVTA 4HZGA 4KRXA 4M0FA 5ALKA 1ORVA 2VQ6A 4X00A 4UFPA 3C8HA 4DNPA 4OU5A 4B84A 2PX6A 2O2IA 1Q0ZA 4HVTA 1E8DA 2YASA 4PNZA 5AK6A 3W04A 5AI6A 5ALSA 5AM3A 4CG3A 5ALOA 3C43A 4DIUA 5JADA 3W06A 1CQWA 4CIBA 2OGSA 1YB6A 1UZAA 5K3DA 1VZ3A 4BC0A 5FV4A 2H7CA 3S2ZA 4BZZA 3F98A 2WKWA 4AB1A 1RWQA 4X91A 2VSQA 5AI4A 1DX4A 5E2IA 5ALUA 2HA0A 3IUMA 1DTEA 1IUPA 2XQGA 2J3DA 1G42A 5AJHA 2W22A 1UOQA 4BYMA 3MUNA 2OCLA 4H7HA 1ODSA 5ALFA 4C4ZA 1Q0RA 3O4HA 3WK9A 2XUOA 1BU8A 1N1MA 5ALHA 3VJMA 2ONCA 3TEJA 5F4ZA 4BDSA 4F0JA 2HU5A 5IKXA 4UFOA 5JAPA 2XT0A 1E8NA 5T4HA 2XUHA 1EINA 1ZIYA 1QFSA 3WJ2A 5DLPA 2DSNA 3DKKA 5CT4A 4C87A 5DYTA 4V2IA 1CUFA 1QIKA 2BGNA 2WQZA 1CUGA 4EY4A 1Y37A 4G8CA 5JATA 2ACEA 4FFWA 3FSGD 1H23A 1MPXA 1A88A 5ALIA 1XRNA 3F9CA 4J0GA 2BCEA 1CUUA 5LIPA 1UK8A 3V1LA 1QIIA 1JFRA 4J0IA 4B0OA 2WUDA 4S0XA 3R3UA 2RHWA 3M3DA 3FWHA 4B9EA 4MYSA 1C4XA 1CUVA 2HA3A 5CW2A 1OILA 2PUJA 3EIOA 1EHYA 2BUCA 3OURA 3DJYA 5ALLA 3OTQA 3M83A 3EQ8A 1XZEA 2QJWA 4QLAA 3DD5A 2GZSA 4GHWA 3WMRA 5AI5A 4I4CA 4UUQA 1ZD3A 4Q82A 2QT9A 1L7AA 5AKLA 4X93A 2VT7A 2QRUA 5EIAA 4AZ3A 3DEAA 3C45A 4PQEA 2ZYRA 1SC9A 5DYYA 2XB6A 2VAXA 4CCWA 4AO6A 3G0DA 2OPHA 3LLCA 1SFRA 5K3AA 2OCGA 1G4HA 3H0CA 3W05A 5ESRA 4HTAA 3FLEA 1WPXA 1VJ5A 3QBJA 3QMMA 4QDXA 2G5PA 5JZSA 1YA4A 4BVKA 3WYDA 1GZ7A 3DL4A 1IVYA 2BUBA 5AIAA 3DL7A 3O0DA 4BZWA 4GWLA 3A70A 1LPSA 3I2IA 2PBLA 4ARAA 1AURA 4U2BA 1EXWA 3AINA 5JANA 1H2YA 1UKCA 4YASA 3VKFA 3WQHA 1JMYA 2AJLI 3WJ1A 5CXUA 4ZV9A 3I28A 3KD2A 4ZWNA 3FOBA 4ZXFA 4AXBA 1TAHA 2X8BA 4BB0A 4UHCA 1ZJ5A 3C5WP 4UBOA 2ECFA 4X95A 3K6KA 5HF5A 1K63A 1DWQA 1HLGA 3FCXA 2HDWA 4UHFA 4UHBA 3DCNA 1QO9A 1UWCA 4F60A 5K3EA 2XQKA 3LS2A 1A8UA 1XZBA 4Y2VA 4L0CA 4E15A 2V97A 2HFKA 3W2TA 4QNNA 3I2JA 1XZDA 1NX9A 3A2LA 5ALVA 5LZ9A 2H9YA 1A8QA 2DHEA 3HYSA 1FFBA 1CUCA 1CUIA 1E3QA 1XRPA 3G0BA 4GBGA 4GECA 4X92A 1XRQA 3SWWA 1LPMA 3K9BA 1LPBB 4BVLA 4OCZA 1H2XA 1VA5A 1ZICA 4B82A 1JKMA 4BAGA 3D2BA 1IZ7A 2XUJA 3L1HA 2WIDA 1E66A 3ZLVA 1LBTA 1EDDA 2HFJA 1CUDA 1MTZA 2OCKA 3FVRA 2HIHA 3OG9A 3DOHA 1HQDA 3C70A 1PFQA 3STXA 2C0PA 3HABA 2RIPA 4J7AA 1WHSA 3T52A 1G66A 1P0PA 3AILA 2WIJA 2PSDA 5A6VA 1BEEA 5JASA 1WM1A 4EB0A 1XQWA 4U2GA 1EVQA 1L7RA 2K2QB 3OPMA 3I1YA 4NS4A 2GBFA 5C8ZA 2OQVA 3C6XA 1CUXA 3WLAA 1TQHA 1UFOA 3AZOA 1XKLA 5E4YA 3AIKA 4PW0A 3IIIA 1N5MA 5A7GA 5K3BA 1BE0A 3WZLA 2DQYA 4I19A 3OM8A 1QIDA 4WDRA 3IUJA 2VAVA 1R3DA 4A5SA 3WKCA 2PSEA 5BWCA 1EI9A 3O4JA 5FRDA 5K3FA 2CZQA 2WUFA 2WJ3A 5AH0A 2GZRA 4EA6A 1LGYA 4K5QA 3VVLA 2OCIA 4JNCA 2WHQA 1LLFA 2PU7A 4P08A 3LP5A 2Z5GA 4K2AA 4LYEA 1ZI6A 4X6YA 4DM7A 3HEAA 1M33A 3I6MA 2NW6A 3X3HA 1R50A 4JYMA 3WWDA 5DYWA 4N5HX 3R0VA 1XROA 1RYYA 1FJ2A 4FWBA 3ZWQA 5LZ7A 4H0CA 4K6HA 4W63A 5FKJA 1QJ4A 2BJHA 3FLAA 1N5RA 2XMBA 4BATA 3O95A 3JW8A 4U2DA 2LIPA 3H19A 1QIJA 2Z8XA 4D9JA 3AUKA 1B41A 3S8YA 4G1FA 4QDZA 1F0NA 1TIBA 5JIBA 5HFNA 5FUMA 1XZCA 1XLWA 2WILA 4C88A 3KWFA 4UHHA 4JEIA 3SC2A 3V9AA 3N0TA 2GYVA 4NMWA 3H2IA 5CRIA 2FJ0A 2JGEA 1BROA 4U2CA 1ZI9A 3F8SA 5AKKA 4AN1A 5AM0A 4UBIA 2VEOA 4X94A 4Y2QA 3WK7A 2B61A 1MX9A 4OD0A 2EEPA 3E1GA 5CH3A 4INZA 2HA2A 2HL6A
chains in the Genus database with same CATH superfamily
3QFSA 3LPMA 2P9GA 3R5FA 1NATA 1TJ3A 3HXKA 5CU7A 5EIHA 2FJPA 3KJQA 4KXQA 1U0HC 5EZ6B 1AS0A 2O8CA 2NXWA 2JJ1A 5F9FA 3O83A 2NTEA 4O6VA 2KKWA 4AICA 5A0FA 1HETA 3SYLA 5SZKB 4LSMA 1NF9A 1VJTA 4WV3A 4YB8A 3IC7A 1HNXO 2WJHA 2H4ZA 2WWTA 3P3NA 4JBHA 3AFOA 1AKTA 1HYHA 1CR4A 4MTXA 1MG0A 1OX4A 3DYIA 2IE8A 3NYWA 4K9OA 3S8MA 1XCOA 3UFXA 3ZV7A 4PR3A 4CI9A 5KQPA 5ER9A 4XR4A 2P5OA 3GFQA 4Y6PA 3MTJA 5JAUA 3NS7A 4ESHA 1U90A 4CHGA 3G7SA 4H7IA 3MFQA 1E1RD 1EXNA 2HCTA 1D2DA 1CRLA 1K8QA 1FFDA 2C2ZA 1AR1B 3RTGA 2XUPA 3F3YA 5JRJA 3MCAA 4TYNA 3EPJA 4EFMA 3KTAA 3OLXA 3SCZA 3CF2A 4PV7A 3UKDA 5JD3A 3LYAA 2OENG 2O2JA 3ZQKA 2BGUA 3E58A 3RJ9A 3M4YA 5IJZA 5AW2A 2XQIA 3B1KA 3FMFA 3I4CA 1X7WA 3PD7A 4IW3B 4CS2A 4ILEA 4LE0A 4PC1A 4R01A 4W5QA 3SC6A 3TD9A 2ZUEA 1KZYC 2ZVJA 3E9QA 4KVAA 5A3RA 4DCSA 4RL4A 3ZJUA 3H5VA 3PFGA 1EZVH 4X0EA 2H1OA 2N74A 2WLIA 1P1CA 1BCRA 1HORA 1DT5A 2ZRNA 3R0XA 2XYGA 5EJ4A 3A4VA 4H6XA 4AP6A 3IC9A 1O5TA 4WZBA 5IVPA 4TWZA 5FNVA 2JARA 1SESA 4PYMA 2V0NA 2E7ZA 3U4GA 3I8SA 1TK2A 3SR3A 4CCSA 5BSWA 4N40A 3W7BA 2R6AA 2YJ4A 2PRYA 5B1IA 3FYCA 3BXEA 1TAUA 5AKZA 5D84A 3EC1A 3I5UA 4YP0A 2VCEA 3ND7A 1FFAA 5IC4A 1IVNA 1FD9A 4GLLA 2W43A 3GGSA 4GR4A 3EFEA 5EHZA 1KKDA 1ZL0A 3P0RA 4LZJA 4MCHA 2G1AA 2OK8A 4XYBA 3EJWA 3IQXA 2FAXA 2QU7A 2Q6LA 4MMYB 2I3BA 2Z2KA 3I8XA 4MH0R 4HWOA 5EWJB 2WIKA 4BNMA 1YUBA 4HYEA 5DK4A 1KEKA 1W581 1K3UB 1E4EB 1CQIA 4JV5B 4Y1EA 1UBGA 1J56A 1BN7A 1J6UA 2QHXA 4PSCA 3SYKA 1OH8A 2G9QA 2I78A 4FWTA 1M74A 2HG5C 3EW7A 1GOTA 3HV0A 2O7NA 1GPKA 4YRDA 2GBIA 2F8TA 1QCYA 2PH7A 5DM2A 3BAFA 3USCS 3V1TC 4MB0A 3VHXB 4G0WA 4DR3B 1SCJA 5CDFA 1X70A 3ZWYA 5CEJA 3ELYA 3AFIA 3OOHA 4YRAA 3NBQA 2QTRA 1GEGA 5DSZA 3VVMA 1NJ1A 2ZT6A 3D0RA 3ZU3A 1D6SA 3ZTTA 5DJ5A 2WR8A 2HHCA 1PT5A 1NTZH 1A4IA 1FYWA 1SMKA 4PQRA 5C1DA 3A1DA 1YZTA 1GZ5A 1MAAA 3OC0A 3QM1A 4F72A 1GGJA 1SVNA 4L5BA 5LQRA 1C9DB 5KQGA 2GSMB 5EI5A 1G2PA 4B34A 5AR1A 3T1YB 4KQHA 4Q16A 1V1MB 3ZRWB 3H5TA 1OUMA 1YIDA 4N3AA 1VQKV 2Q1YA 2I5PO 3CLSD 3I9MA 4XVUA 1H69A 1UOPA 3KUCA 1OBOA 4NTWA 1Z4NA 2Q6KA 4Y2UA 5C9ZA 4M0MA 3IL2A 1BGWA 1XDUA 3CY6A 3HRHA 2ISQA 3EDOA 4TMXA 3X2SA 2CLHB 4QWMA 3U4AA 3PFKA 3I58A 1IN5A 5LQUA 1GFSA 1X80B 1VE7A 4EELA 2BMDA 3CRZA 2Y1KA 1MVNA 2M6LA 2AEFA 2CFRA 2P40A 1KECA 2EKLA 4LZPA 4AS3A 1GTJ1 1QUFA 2VOJA 3GFRA 2H1HA 2EZOA 4C05A 4EABA 3BFJA 1ZK2A 1PV1A 2RHTA 1WDKA 3JWHA 1XJ5A 2G0NA 3OF2A 4G2TA 4TS3A 4ZO7A 5FPPA 3SM3A 3VZRA 5BT8A 1B6SA 1C2YA 1J9EA 3NFRA 4RGYA 3RYHB 1Z7WA 4XWTA 3T7JA 3TJZA 1UJCA 3DFZA 2XECA 3FYTA 1K2WA 1PJBA 3L04A 3S81A 4X3CA 3ETHA 1YONA 1SKQA 1PFYA 4YPVA 2XOKA 3QWAA 1E7WA 3VR6H 2QQ5A 2GVDC 1L0BA 2F9LA 2DFLA 2ZAMA 5I45A 1YFZA 4PSDA 5JXGA 3G0HA 1IH8A 4S05A 5IKOA 1NM5C 1TC2A 3MCZA 2H1SA 3HVIA 3AU8A 4UAJA 1OLSB 3HN6A 3C8ZA 3MUFA 4UVBA 1YIAA 1AQUA 3KZMA 4D3ZA 1ZA1A 4ALMA 1YVDA 1P1JA 2ANBA 2EARA 1O95D 3QKRA 5E9JA 4D9HA 3LLVA 3N8NA 3I53A 3QHPA 3EGXA 3QPWA 3WOHA 4L50A 3W7UA 2O2YA 1VKRA 2VP2A 2X4GA 3HYNA 3MGAA 4PXYA 1Z7BA 2QE6A 5IRCD 1FMCA 2XNDD 3D36A 3I09A 1VHJA 3GDGA 4FILA 4KDRA 2EIMB 2IM9A 1WG8A 1T8UA 2JAOA 1SOAA 2OSVA 2MIIA 2WC1A 3QXGA 4B40A 2F17A 3HFRA 4QFMA 4P92A 3V2IA 4CNQA 3RADC 3KE9A 3WBKA 2J6CA 1WD7A 3B7GA 4MPRA 4O08A 3ABUA 2W7TA 4HN4B 3TTWA 2G07A 2K6GA 1TQ4A 3ASNB 1EFRD 4FEYA 2VF2A 5FNZA 5BV7A 4F56A 2A57A 4KYIB 4WNAA 1LW6E 3X2FA 1LUAA 3VOBA 3GFBA 2OHIA 2I3DA 3BORA 3IA2A 7REQA 3T5DA 1TGYA 5I9IA 2AMJA 2JEUA 4FGZA 4IMJB 1GAXA 4L3OA 4BCCA 2ZIXB 1F5SA 5BMVF 3L6CA 1SCBA 3OX4A 1GCUA 1PV2A 3HCEA 2VRZA 3V1UA 3WL6A 5K4HA 4E51A 3NHYA 4DQKA 3ZLJA 1D2AA 1R9NA 4KNVA 4MUJA 4QGGA 1QBGA 2R44A 2PH5A 3QMVA 1QLJA 4IFTA 1C30B 1G7TA 1WX1A 2ON6A 4AKIA 5J1TB 2YV5A 4D8TA 3U56A 1R66A 3IGAC 1OCCB 2ZE5A 4II2A 1QRSA 2H5JA 3VNAA 4F3RA 1F6WA 3BWVA 3CTPA 4MQFA 3FNRA 1Q0UA 1Y5IA 1DEHA 3IOYA 5CG2A 5K0FA 1DE0A 1GFIA 1D03A 1XZMA 5C3MA 2R9AA 1WUTA 3K8QA 4D8WA 4YH1A 2H59A 1TUEB 2IZ7A 3ZC3A 3M1IA 1IMOA 2BM8A 2JZNA 4N3BA 1ZXXA 2VK4A 3TCUA 1ADYA 3M81A 3SLKA 1Z12A 2EZ9A 3RIEA 4ER3A 3ER9A 5TS2A 3SLRA 4D82A 3HO1A 2HDNB 3Q15C 4A36A 5B36A 4OQPA 3GPBA 1Q81W 2JEZA 4QDOA 4Y2SA 1T8PA 3UPDA 3VX4A 1ZJ6A 3CRVA 4FEEA 1MX5A 3WLMA 1M8KA 1IM8A 3MPOA 4ZAZA 3U3DA 4BKQA 1RP7A 1RMYA 2AXNA 3D59A 5FFFA 4Z7JA 3A26A 3NHAA 4YT4A 4QPCA 5TQ0A 1Y6JA 4K88A 1MJFA 3E0QA 4P3YA 3FSGA 4G2NA 4JI1B 3P19A 3NTXA 4HEJA 3GLFB 4P7FA 1OR8A 2VHQA 1TU0A 1SIBE 4JJZA 2FKXA 2V7QG 1ZMOA 4MKXA 2W48A 4HVAA 1RJ9B 3Q2KA 4PY2A 3S68A 4CMIA 4LNAA 5LWQA 5L6LB 4F46A 1E0AA 3UJBA 2DYRB 4LKOA 3KJNA 3SJZA 3PEYA 2R8OA 4Q4HB 4L3VA 5HSGA 1RS0A 3WLHA 2ZVDA 5FX2A 3QW2A 1XMVA 2CUKA 3MVEA 3UCEA 1X87A 3KPWA 5BT9A 3H97A 3HN2A 3NIFB 4NYIR 3OCJA 3SSOA 3ZWKA 4RQEA 2XCRB 1Q6UA 1VYTA 4WFBV 4IGIA 4LFCB 1N5JA 2EG9A 2Q2QA 2YJ5A 3K5IA 3LCRA 1AKVA 4HH3C 1G98A 1Z26A 3FMPB 3IHTA 1S5HC 1CNFA 1ZESA 1Y8QA 1EA7A 4IDOA 4DR5O 4OV6B 4E0BA 3MWLA 3Q1KA 4N48A 5JT1A 5KHIA 3CLRC 3DMYA 4YRTA 5EZYB 3KT3A 4BRUA 4YV7A 4JZYA 5BSFA 5ARDA 3LWZA 2JLRA 2RHHA 5D1HA 4C3ZA 4EH1A 2QRVB 4MIEA 4QUGA 2QG9A 4I9GA 2VA9A 4CR6A 4J1SA 4PGGA 1HE2A 1M1YA 2RAFA 2VHXA 4JX9A 3CSXA 5CXXA 1L7NA 1Z45A 3V34A 1W4AA 1OT3A 2DPLA 1YR8A 4RKQA 3UUFA 3BEOA 3IXMA 4A0FA 1C4WA 2PLWA 1O6ZA 2PO7A 2ZAOA 4KVZA 3RYIB 3KEFA 2C2GA 4LK3A 3F6CA 1EQ2A 3E48A 1TTHA 4JPRA 1FYDA 3OQBA 1OPRA 3VOSA 3JD1A 1QK4A 1YBHA 2WD8A 1K66A 2VWJA 3KZCA 3MAJA 4HH1A 4P3PA 3EAGA 5DRTA 3SC3A 1D5WA 1N78A 1BH2A 5J2UF 4DV7B 2BGRA 2ZS8A 4ZU3A 3UC5A 5ER6A 1XGKA 2DQ0A 3DXRB 1EHCA 4NBTA 1L1FA 1NOJA 3DF9A 4N9WA 4UASA 1IPEA 5C3UA 3ETCA 2DR2A 1Z5OA 1OWMA 4MUIA 1CZKA 5HFLA 3AHFA 4U2EA 4Z5XA 1P6UA 3RS9A 3E9DA 2DTDA 4U8HA 2PIDA 4QGSA 2CEAA 3H9VA 1Z4LA 3CZPA 3W9YA 1UKYA 4NQZA 3WSVA 5BWLA 3ZDBA 2WHPB 1WTAA 1GIAA 1LX6A 1G6UA 1RPJA 1U9ZA 4ZANA 4QEKA 3AB8A 4FLYA 1KAMA 1OC4A 3ORRA 1COWA 3DLIA 3OF3A 3U3ZA 4DRYA 3IMKA 3A1CA 4OOFA 4Q3DA 4MUAA 1LCIA 2P4UA 1T9HA 4HMPA 2GBCA 1R6VA 3BE6A 2P3LA 2LIVA 3UBMA 2GKGA 1JDPA 3IUBA 1VQLV 2HC9A 1G8SA 3DMFA 1GPUA 1T6YA 2H31A 3LT2A 4DUYB 3OEWA 2PIAA 2Q0SA 3JZIA 3WLNA 2EBHX 4AP5A 3O31A 3R65A 3WG7B 3ICEA 2FCRA 1ST3A 2CWWA 4W4KA 1NYTA 4LR3A 3LKVA 1IY0A 2RAVA 4RF2A 3ICWA 1P5JA 1V26A 1DXQA 2B82A 2HRBA 1C29B 4JI1O 1KEEB 2WTAA 3CKKA 3F4LA 3H8SA 2ZVPX 4H2DA 1KJYA 5DXFA 4HTFB 1IUNA 3RF7A 3UK2A 2C5GA 4EBFA 4DSAA 1YR7A 3EVDA 3AG1B 3PXXA 3G79A 4YDHB 3IYLW 3ZQJA 3U4MA 1SHZA 1A77A 1KIFA 1MZVA 4D4HA 4D80A 3CJQA 2AS0A 3RK1A 3WRWA 2J87A 1QNMA 3CNLA 4W1RA 3EOBI 4CVNA 1PK9A 2GJAA 3DAGA 1SCUB 4AKEA 1OJLA 2C9OA 2Z56A 2PVSA 9ATCA 4AVYA 2DBQA 7MHTA 3OFKA 5HILA 3SZRA 2AN5A 2FSPA 2UUBO 1RPNA 1ZIPA 2Q8VA 2AOTA 2QSYA 5KTMA 1JKJB 1FNNA 1DC5A 2BW0A 2P1ZA 3A06A 5C8VA 4G5QA 2C4KA 5ALMA 4ZT4A 2LNDA 1T9GS 4OX9Y 2WMOB 4NBRA 5KOIA 2BMVA 3TFQA 3ER8A 4JHXA 2JFUA 3PVSA 4EO7A 2R5FA 1LBSA 1I3MA 1IJBA 3F78A 2P78A 4LZOA 5HZGA 3GAAA 1OXBB 4GT1A 2OBBA 2PMDA 2OLEA 2A7WA 1AQLA 3DE6X 3TZKA 2O2DA 2VWGA 3RSCA 2EIJB 1RP1A 1EGQA 3GT0A 3L01A 2Q2OA 3JQBC 4GMFA 2JVDA 4GLBA 4HUTA 5LOVF 2ZUWA 3AUFA 3DDNA 2CFTA 4FEGA 1W6UA 4PZCA 3P9CA 2F8MA 4B85A 4UHDA 5KTPA 3PJSK 3ADOA 1DFGA 1K7YA 1J4AA 2MYNA 2WLKA 2V7WA 3KVOA 2I2BA 4C30A 3TB6A 1J20A 5DSTA 2D7JA 1G38A 4N49A 1QR2A 4ZZ2A 2ZBVA 4XLLA 1RBQA 4WWHA 2JFZA 3ZJVA 1GPAA 2LQTA 4WJKB 3CZMA 3ND8A 2H8PC 1DRVA 4N9QA 5DASA 2A5YB 3E5NA 3B89A 3RYFB 3RYCB 1DSSG 3A36A 3GB9A 3QITA 2B7CA 4A6DA 4UBJA 2PZMA 4EY8A 4K8ZA 2OCHA 4WKBA 4F12A 1WB6A 3V7FA 1RNLA 3RYIA 2V74B 3PDIA 2BGJA 4BWYA 4RC9A 1C80A 4BO1A 4JL6A 4F3NA 4LGYA 4QBGB 3GFFA 5A7FA 1M56B 4XX0B 5TQJA 2L17A 4HQ0A 1PT8A 4HC4A 1FS6A 1FXUA 4ZCLA 3O8CA 1XEFA 4PZDA 1LPPA 2Q3DA 3AB3A 3L6EA 3BILA 1CZHA 2GT1A 3HR8A 4NZNA 3UFXB 3VM6A 1TM4E 2C88A 3J7AU 5CBPA 1WXHA 1BSVA 2DPGA 2PXXA 4I50F 4I6JA 3RSHA 2HUPA 4B2PA 2RHOA 3BE8A 1XZPA 3DC2A 1CDEA 3CX3A 3KRTA 4K1LA 5LZ8A 2CD7A 1Q8IA 5JZ9A 2XNCA 1QIEA 2IW1A 3OZ7A 3Q7EA 5IH3A 4JYYA 1VMIA 2C7BA 1VE9A 3BJZA 4CETA 3ZMSA 4OFXA 1XU7A 1ZJYA 1ODKA 4MUHA 3STYA 1CLUA 1MZEA 1N2GA 4GXQA 2ZWAA 2AJDA 1ORDA 1A7AA 1U2DC 1ILEA 1LA2A 3E35A 3WHLA 4WUTA 2UAGA 4Z7QB 4AWBA 3BQNB 3SS8A 3ECAA 3WYCA 1QR9A 2EEZA 2QBYA 1WDMA 3C8DA 3WMEA 2XGJA 3K0SA 3KDPA 3TR0A 2Q49A 4QZVA 4HAYA 2QLMA 1J39A 1MA1A 4UCTA 1DARA 1PS8A 2J5BA 4TT8A 4YONB 2NLOA 1DBWA 3CN7A 3HCNA 4NYJQ 3NIBA 2HQBA 3G13A 4RFSA 5HJEA 2R7AA 2WFMA 3IVMA 3LIIA 1E0KA 3OZDA 4IUBS 4Q12A 2I8AA 5T3UA 3S99A 4WDQA 1I10A 3KQMA 1WQ3A 3ED5A 1Z2AA 4RK5A 1G7SA 4D46A 2V6JA 1E3MA 1MB3A 4KJZA 2R1UA 1OXSC 2IFTA 4JKYA 1RXIA 3DVLA 1BYUA 4B87A 1UM9B 4FOLA 4AQYB 1H5QA 4E31A 5H0IA 5D6OA 2QD4A 4XYLA 2PL9A 4PDMA 1QGYA 1T15A 1FPMA 1Q15A 2Q3HA 1MDBA 1PAUA 2OFFA 4BP1A 4EFDA 1N1EA 2DUWA 4N82A 3VISA 4TLMB 3NHWA 1MBZA 1CJBA 1UBTS 3JQPA 4M1TA 3D43A 1T2UA 3K59A 4RQTA 4X8OA 3ADCA 4DDKA 4TV8A 1TO1E 4MVJI 4FGLA 2J4CA 3HCPA 4EKWA 2O7RA 1P74A 3R5JA 4DBZA 4B79A 1ELOA 1U1IA 4UD2A 5K9ZA 1G2OA 2DFTA 2XNHA 3AF4A 3G8YA 1BJRE 1H2FA 4B45A 1WOMA 1QX3A 2PUAA 3SPJA 3T06B 3PUHA 4NENB 2FSUA 1L6RA 2I3AA 3DBOB 5KSPA 3SEFA 1X9IA 4Q34A 3VHXA 4AF8A 3DDZX 1LX7A 3EAQA 2QL9A 4JT2A 1ZUWA 4PZ0A 4D4GA 1WAMA 1Z7YA 2JJ8A 2ORVA 3SNHA 4J29A 2TYSB 3PLAE 1DMRA 5AVSA 2GNPA 2WWFA 5GV8A 3BYZA 1A82A 2AWNA 4D2IA 4I0XB 2WJZB 3LQ1A 2QWNB 3ELWA 3TSOA 4ROSA 1W59A 3A9CA 4XIJA 2A94A 2VZ8A 3OQMA 1T5TA 4V3CA 3R7SA 1PWZA 2QIOA 3UCFA 5HQTA 3ZTYA 3K1AB 4KL1A 2H5EA 3JY6A 1K08A 2IH3C 1AZWA 2J41A 3MTDA 3SPHA 2ZRPA 4DLPA 1GN9A 3CVUA 2FNAA 3B2EE 2A9QA 1ZGHA 1WPGA 4QHYA 4MS2A 2PSHA 3U4HA 4CL0A 5IKPA 2GXUA 2VUHB 1ND6A 2OYQA 3DBRB 3OCYA 5BYJA 5KTNA 3QVXA 2FMIA 1CF2O 3TZ6A 3AEXA 3DBLA 3G2IA 1XZKA 5ESXA 1Q86W 4B3SB 1GUBA 5KQSA 1IJKA 2ACKA 2XUMA 3NASA 4ZP1A 5TPWA 2DWUA 1K7XB 2HGZA 2JGLA 4YA6A 3E6AA 3GIWA 4BS9A 4XYEA 4BQQA 3NV9A 5C5CA 1JHQA 3GLHB 2Q45A 2W6IA 1QVZA 2Y2VA 3DEHA 4JSYA 3WI7A 3DTYA 3ZWOA 1DXOA 5GZ6A 4KXFB 3A9UA 3EMKA 4CEHB 5LQJA 4KRGA 2O8DB 5IYCO 3Q6NA 4P38A 4QXOA 4EHAA 4GPD1 2YINC 4YP9A 1L5HA 1ACLA 1BH6A 1HSZA 2J0UA 4KI7A 4DS3A 3D81A 4B75A 3ZIDA 2FZLA 1J0DA 5BW6B 3TGWA 1SH7A 2CDCA 2DWEC 2P2SA 5EMLA 4BW5A 1TVKA 5EBMC 4OXNA 1P3DA 1RZVA 2Y2UA 4U3JA 3ZEDA 2ZWVA 4LTDA 3STUA 4LX0A 3WWOA 1MJHA 3A1EA 5LFAA 1WP9A 4JCCA 2UUPA 3GDHA 1UFVA 5FFNA 2ZSHA 4EG3A 3FCEA 4ENQA 3B6MA 1SKYB 4G5HA 1KS9A 4P83A 4TRNA 4JBNA 2WG2A 2ZXUA 1IK6A 3PR1A 3IAS1 4YLGA 1WKVA 3L8FA 3THYA 4U9HS 4DCTA 3O8OB 3OKPA 4G86A 1U2EA 1BE6A 3G3EA 1MAWA 4E2LA 5AKIA 2RDCA 4YMWA 3WB2A 1OFIA 4EB3A 4MW4A 4A73A 3NC0C 3I30X 3A05A 4OP1A 2Y0DA 3TM5A 1E69A 3DOJA 2ZR2A 5JCJA 1F60A 4DREA 2F3PA 3H9JA 3V8RA 2VLIA 3V7NA 1S9HA 2BOBC 5KAMA 2GPJA 1GH6A 1P7ZA 4IF6A 4IGEA 2X6AA 1WKCA 3KVNA 3R3HA 4KPGA 5H59A 1NN0A 1RSOA 1S7GA 4ZGWA 4RZ2A 3UG6A 2Q5IA 3H18A 4DCVA 5FLXA 2A79B 1UJWB 3FYIB 2ZKOA 4UEQA 3UIEA 3FOZA 2ENWA 2WTBA 1HXHA 1HO3A 2WT9A 1NJSA 4OYLA 3VU0A 4RPLA 1H94A 2P22C 3QKSB 3O26A 5EHQA 4U7NA 1QYDA 4X6XA 3ZCCA 2XGOA 2CYCA 2HDHA 2QUKA 5FTWA 6NULA 5TMBA 5JROA 2HJGA 5KYYB 4MDFA 1SU7A 2WTXA 4EG0A 2QRNA 4EQ6A 2XJ9A 5ECWA 1XRLA 1QCZA 1TUEA 2SCUA 3FSEA 4BP8A 1U28A 1AKUA 3GCDA 1BDHA 1JG7A 2RONA 2X2EA 4DSZA 3S28A 4GKJO 4MA4A 3FPJA 4X1IA 3IQEA 4IEFB 2EG5A 1UJ5A 4AIRA 1WCV1 4W82A 4B4UA 3A6FA 4FIDA 4BMPB 4IHJB 2NNWB 4B3JA 1CF9A 4KCGA 1MR3F 1QGUB 2Y92A 3H2KA 4L72A 4CN8A 3H2HA 3IP6A 5KBYA 4QM6A 4LYAA 5KHKA 2EKBA 5IWCA 3T3EA 4GZ6A 4ND8B 2GILA 3FB5C 2ZQ5A 1OFUA 4J8PA 1JHVA 4DVGA 2YL2A 1AGYA 5HZHA 2VDMB 4OHYA 2O06A 4JI2O 2CBXA 2IDZA 3ASVA 2ZGVA 3DQPA 1X7XA 4JJ8A 2V1XA 1URPA 3A6ZA 5AKEA 2PVPA 4S24A 4X66B 3UGQA 1VIMA 3CE6A 3BVOA 2BFFA 3H0EA 2YI9A 4KZKA 1XV5A 2WSSA 4N5DA 3NAZA 4CKXA 3VZPA 5KHLB 4D6YA 2IQ5A 3LGXA 4HQFA 3FNHA 3ET5A 5TRTA 5IM4F 5J40A 2BR3A 1ESMA 1EXMA 2ORYA 3ZDXB 1W7AA 1QF7A 3FUUA 4MB6A 3QNMA 1C3OA 2WDZA 1LC3A 1LBIA 4N0MA 4FN5A 2NXJA 1WU8A 2AHRA 2MR6A 2XMPA 4OMFG 3QVVA 4MGEA 1HL7A 4F3CA 1C7JA 2O8BB 2QUBA 2VNAA 2Y1WA 3OTFA 2RGBA 2VQEB 2IIQA 3BPSA 3KVRA 4F2HA 2ZEJA 4Y18A 4BGIA 1VYHA 4M98A 2RGCA 4TKVB 2MSKA 4OSEA 1W44A 3T9BA 4DIOA 3QE4A 2Q4EA 4F6EA 1QVFU 1OE0A 2OBFA 2H1VA 4AXXA 1UXJA 2DJ5A 1GMGA 4HRAA 1KZGB 3UJCA 2X3FA 2WWWA 3I45A 3W79A 4K6MA 1Y3HA 4Q1BA 4NCAA 3H13A 4QARA 4MW0A 5KPDA 1DQRA 3B13B 3OFSA 2NO5A 3MMZA 5LMZA 1H4QA 2PD6A 2PUSA 1MZFA 4DVJA 2JIMA 4D0SA 1PHPA 2FW9A 1G19A 2P5SA 1K75A 3AUAA 3ESQA 4RZXA 3STVA 5TDHA 4HH4A 3AQ4A 1K33A 3H83A 3VR2D 1U9IC 1SZTA 3EEBA 2F8LA 2Q9UA 3L70H 5AI0A 1RBMA 4K8RB 1PZXA 4MVJG 4D97A 4YV0A 3BT7A 5LNK6 3OTIA 2J4DA 2L2QA 3AG5A 3GJSA 2E89A 3S5UA 1UANA 3F1KA 3RJTA 4GPIB 3HXQA 1IHOA 3SPXA 3W34A 1I9CA 1V5FA 4J1TA 1Q0HA 3U39A 1NI3A 3OIWA 2O3SA 3H42B 4X65B 4Q4JA 2R8BA 3CLUD 1W0JA 1B93A 4KQXA 4BO8A 3NATA 3EOZA 4PC7A 3URKA 1I5OA 1RHKA 3R2JA 3VH4A 2MCFA 1NSTA 3GEMA 1O0SA 2HJSA 1JX9A 1U2GA 1QG4A 2HSWA 3AUJB 3IBCA 1VL2A 3Q9LA 2A9OA 5JCOA 4JZ2A 5CBKA 5J4YA 1CD5A 1A4RA 1JHUA 5JJCA 4ZVLA 4JIGA 1BWQA 2WHPA 2JS5A 2NNUA 2G17A 1NNI1 1CUBA 1M6VB 4JMPA 3QHQA 3VAYA 4F4LA 2R2AA 3EX7C 3Q7SA 1OJ7A 3FAZA 4LY6A 3TS1A 1SHTX 4BNYA 2B6NA 2BH9A 3QQ5A 4HAVA 4KACA 1T1SA 5DN6A 4CCYA 3LW7A 3L0CA 4TYQA 2FA9A 4AMGA 2CNWA 2G1PA 1GSHA 1VE3A 2M6YA 5PNTA 3RFCA 4HEQA 3IH5A 3TLKA 2HWWA 1DX6A 2WNSA 1VF6A 5AVJA 4H9GA 1ID1A 1GXSB 3U49A 3K8YA 2E76B 5COBA 3VTAA 3RKUA 3NDBB 2G7MC 4UBLA 6LDHA 2OZPA 1VQMV 1GUYA 2NQTA 1TI7A 3ANNA 2IYQA 1CZLA 1QHSA 4AI8A 1VIVA 3KZOA 4TWBA 5B7QA 2VS0A 2BM9A 3A58B 4J07A 4BNLA 2HUNA 3HJAA 3LECA 3OLWA 1ZVVA 1SQSA 2AB0A 3ZWVA 5AG2A 1X1DA 5AESA 5HVNA 4FYKA 3OAAD 2YXBA 2C7OA 1GKKA 1KYXA 1OCRC 1YQQA 4BE4A 4A82A 2GNOA 5K6RA 1ZHOA 2RHCA 2NIPA 4UDXX 3T3DA 3WGOA 4AW9A 2I0FA 3TEMA 1E6EA 1RWWA 4M7WA 1TFUA 3ZW9A 4OIFA 5GONA 3L4BA 5LQAA 1YDWA 3WWYA 4QKQA 3ROXA 1ZOOA 4JZGA 2IYNA 3L7MA 4J3JA 2BFAA 1K06A 3IQZA 1I5EA 4RS3A 3HKBA 5HA5A 4YLYA 3BK7A 3K8OE 4TSFD 5KA5A 3MRXA 3NOXA 2OYRA 2D1TA 1KQNA 1RADA 3RSZA 4DGQA 9LDBA 5B12A 5CCEA 1D0VA 3B77A 4PELA 3I6ZA 4FC6A 1U3GA 3CJTA 4LWPA 5HDBB 4A9AA 4IJQA 3T99A 5FPHA 2NO9A 2FZVA 3V7UA 1A9YA 1XQYA 3PPIA 4XGQA 2EZ8A 1I9GA 1ZI8A 3OZIA 3PGA1 4WNAB 1GDTA 5I8PA 1TLFA 1HYQA 2HKOA 2W11A 1SA0A 2X4IA 3WL7A 4PHCA 4QATA 3ZHQA 4H60A 5COQA 4H3KB 4MT8A 3ZE8A 3ZEAA 2BLLA 4OLHA 2JFWA 3OICA 2XUAA 2D62A 1HDZA 4OHCA 1D1SA 2QTSA 3U3XA 3WIBA 1MB2A 1V7ZA 5K3CA 2DQSA 3L0DA 3O74A 1ISFA 5HQ3A 2LGWA 2PWAA 4NE2A 4N6NA 4XM0A 4KN8A 4MS3A 3WWPA 1QPBA 1N7HA 3EQ6A 4ZQEA 1Q57A 1K92A 2LPMA 3EMVA 5I9BA 1KKLA 5A03A 3LFHA 3I55V 5M3BA 3DWEX 1Z2GA 2FCAA 1S2GA 1ZUHA 3MHPA 1E2KA 1D0SA 4LF4O 1KARA 4EPTA 5TPWB 2PQMA 1Z06A 1V55B 3CRQA 1IOVA 3DZDA 4ITUA 2ZR9A 3Q8KA 1I2CA 4LMRA 4TZ6A 3OO1A 3DPIA 4NEGA 3EH1A 4H7FA 4CMIB 4EHIA 3Q7TA 4GIBA 3QTLA 5JG7A 3CVWA 1VSBA 1S2OA 2L42A 2N42A 4B7KA 1CC1S 1A8SA 1ESDA 1JJVA 2H6EA 2HQSA 1Z74A 3Q85A 3Q9SA 2SCUB 4MV7A 1CG6A 4BB6A 1ABBA 4GKKB 1E1RA 2W71A 5B2EA 3NDJA 2EW1A 3OM9A 4JXKA 2B3TA 2VZ9A 3ZHOA 3L7KA 3S2UA 3ML1A 4LF8B 4BWAA 3WRXA 4A10A 4LRWA 3DNFA 5E1OA 2X1LA 2D4AA 2DGDA 2QYTA 2OGZA 4HX2A 5FF9A 2ZRFA 2Q5QA 3KB1A 4MTFA 1UK7A 4KXUA 1QP8A 2ODPA 1SKUA 5KSWB 1Z0ZA 2AK2A 4JAVA 2AN3A 2GBGA 3O2JA 1FNCA 4G24A 4O33A 3L7OA 3MS7A 4PCUA 1SHJA 5CG1A 2ERXA 5DN6G 4RV5A 5FJIA 4CV1A 1JTEA 4EY5A 4XVHA 4W5NA 3I01A 3K2IA 5ILQA 4US1R 5LR6A 4G4SP 1H2NA 5A71A 3VAAA 3PB3A 7REQB 5EIEA 2OQIA 1AQYA 4M1MA 4TTTS 1NF3A 3MWEB 3BL8A 4NY1A 1JR3A 3QWHA 4DLWA 3U3RA 3MQ2A 1OAKA 3OZBA 1FJGB 3SEQA 1YQTA 3K9LA 1QQTA 2PZSA 1N75A 1ZX3A 4IEIA 4LVOA 1DELA 1KK2A 2Q50A 2X0IA 3TTSA 1ONPA 1JFFB 1RZRD 1J24A 1PSZA 2EJVA 3HEMA 5TPZA 4DJFC 2G82A 4RX1A 1RPTA 1VIAA 2NQ8A 2P65A 5IN4A 3ACDA 4WCEV 1M75A 3OA0A 4CEJB 4RZSA 2IELA 3VR1A 1OV6A 4JJ4A 4QHTA 4D6TH 2QSAA 2GZ1A 4KV9A 3D4OA 4AY3A 4ETWA 1QVRA 1KI7A 1RTKA 3ILVA 2FSIA 4MV0A 5BP7A 3ZDYB 5MN6A 1UOOA 4B4KA 2VLBA 4CMGA 1GM8A 3VA7A 4Z53A 3ZBQA 4XB2A 3GLGA 2WIBA 1M1KW 4XAQA 4K9QA 4XDZA 4YCBA 1UXGA 3IHWA 2O0LA 2EBFX 5GJVC 4N0QA 4DAOA 1AV6A 4JLAA 1P4SA 4LRYA 2HNAA 1OMOA 1VQ7V 2O8NA 3CWQA 3LOQA 3JAMA 1U2ZA 1TRKA 1MO2A 2O8CB 3QPAA 4CFSA 3VXKA 2HLDD 3TL3A 1X0XA 1RHQA 2OGTA 4TXLA 1X39A 5E3IA 5JY6A 3GJTA 1A9QA 1OKKD 3JQFC 3L9XA 3M6LA 4H1HA 5EWMB 1E6WA 4XWAA 3EY4A 4ZGBA 1RCFA 5M04A 1YJCA 2DOKA 2VHCA 1YRAA 2FWBA 3NG1A 4WKOA 4WK4B 3PI6A 3KTFA 3L8ZA 1D3AA 2JA2A 4N4AA 1BVRA 4NOLA 1OAOC 4ZDKA 2P77A 4QIWF 4DFDA 2W6JG 2VNKA 3EZ9A 3RREA 2ZYVX 1NZDA 4ZOQI 3KVYA 1JGTA 1H8EA 2OAGA 4H35A 3P7MA 3QLUC 4XASA 3HZRA 3OJCA 3FCYA 2P67A 1X1RA 2GRUA 2C42A 3AR6A 4KQ1A 3L43A 1FYXA 3PC7A 4LPSA 5B1EA 2J3HA 3I4FA 2X19A 4UUJC 4IL6Z 2BZSA 4ZEXA 2UXDO 2QZPA 1O5OA 1T1JA 3EPRA 1L5SA 3M9LA 4KO3S 3I9V1 2B4KA 2P7HA 6ADHA 3EDQA 3KL4A 1UBEA 3EXEA 4JLMA 1OFHA 1RKUA 4JTDB 4WKNA 4M1YA 2QWPB 1A5SB 1QO0D 4QU0A 3Q4GA 4GW3A 5LGTA 4C4YA 1SQPH 3QVWA 1XVTA 1RI3A 3ABMC 5A1JA 2IZ6A 3SHTA 1XU4A 3C3XA 4I55A 4TWAA 2AG0A 3WHKA 5JARA 4MS4B 2QB5A 1R3IC 1C3XA 1JLRA 2E6UX 2WA4A 3J81A 1HE4A 1GN3A 3AP2A 2B1GA 4Q0MA 3VQVA 3X1ZA 1C0IA 2IQIA 3MCUA 1DIAA 5EMHA 1JYSA 2IX9A 4AP9A 3UUEA 4F6RB 4AG6A 3K32A 3KXDA 2C4TA 3DDWA 2VWPA 5ERXA 1VLMA 4OG2A 4AJ9A 4JBLA 3HPRA 3PGVA 1KVTA 3GJQA 4G37A 3RVMA 1O9BA 5M5BA 1YF3A 2A0WA 3IODA 2QPTA 5G40A 1ULHA 2V5UA 3ENVA 2HU8A 3AVOA 4OK3A 1RWKA 4C0BA 1U2RA 1TQ2A 3WK6A 1WU7A 1YSCA 2R6ZA 3V8VA 5AW8A 1PDVA 2BSKA 5DFAA 1SIWA 2R8PA 3V1KA 2FRVA 4CUJA 2GYWA 1VLVA 4QTTB 8OHMA 4ID3A 2Q41A 1NG9A 1PFKA 3DE7X 4UD6A 4DR4B 3VQTA 4RTLA 2P27A 3MB8A 1H5NA 4FMDB 3T15A 2EC5A 2Y6UA 4DKJA 4OX9B 4INAA 4DW1A 2KB1A 9MHTA 5A0VA 5H3HA 3O8LA 4MUMA 1ZVQA 2Q2VA 3MJ4A 4JBGA 4QTZA 3ZJ5A 4NV1A 4Q3LA 2D1RA 2MR5A 4M9XA 3VR4A 3WYBA 3BXGA 2YZNA 3F97A 3PFIA 5FTMA 3RTCA 4XQ0A 1MMFB 1BKYA 3G9XA 3IPXA 1SHKA 4M9CA 4ALNA 4B71A 4ZTUB 5ANRB 4FM1A 1E0DA 4HFMA 1TA4A 1E6UA 3ZEIA 1IWBB 1JQKA 3R41A 4RTQA 3T1HB 2K4MA 5LIRA 3KHSA 2HMTA 1KZ4A 2OZKA 3V4OA 4HNSA 2XHZA 3OEHA 4AJIA 1M83A 1S01A 2BFEB 3EZ7A 4XI9A 2FUKA 3DMRA 2C1XA 3RVNA 2WLSA 3TIFA 3FMOB 4ZI7B 2AE2A 1J42A 2GERA 1CIJA 2HHJA 4XM2A 3RHFA 2UZAA 4JAAA 2IUTA 2JBWA 4FYYA 4DMFA 2IYVA 3NAGA 3PFBA 1G5HA 4RV9A 4D3SA 1EFRG 2HRRA 3H2ZA 1VJDA 1KWKA 4YAJA 5K2MA 1YZVA 3KUXA 2B9ZA 1JA1A 1ZOPA 2GXSA 4FJ0A 3BE5A 4KLNA 3VPCA 3VR3D 4WK2B 1W29A 1QIGA 4DNQA 3IUYA 4W4LA 3AVTA 1NMXA 2W83A 4ZARA 2PX0A 2QLJA 2WSIA 1WLYA 4FNMA 3AB7A 4YRIA 2FL4A 2X8JA 4CKYA 3QQPA 5KX5F 2W2NA 3BS4A 2OFWA 3MTAA 1PS0A 4K3UA 1H38A 4A8TA 4Q93A 3R77A 5JJ5A 1UDBA 4J2HA 3VKGA 1UPGA 1XF1A 5EIWA 5IU6A 1HLFA 1T0HB 2O6HA 4DEVA 3QNUA 4K9RA 3R9XB 2E49A 3KJZA 5J1SB 4NOKA 4I50B 1U5BA 2NV2B 3DDSA 2V3WA 3C5VA 3JWJA 3R20A 4OUKX 5AKYA 4UMFA 5JH7F 1V45E 3EULA 2MMCA 3OC6A 4G1BA 4A3SA 4TTSA 2P35A 2OR3A 1E6MA 5B5SA 4XWKA 3LUBA 1TJ4A 4KGZA 5BOSA 1A8PA 2PUBA 1BJKA 1JSCA 5KYWA 1P1RA 2PGJA 4MRMA 2O54A 3SR0A 2IS4A 2W2LD 2HF9A 5IDWA 3RS7A 2R96A 1CNEA 4I5GA 2VCHA 5DSXA 4CEIA 4C4TA 3B8EA 1OLOA 1DFIA 2WIGA 2NVBA 4LXYA 4WY8A 2GNAA 2JJ2G 4ASUG 3ZRSA 1U2QA 3CEJA 3T3GA 3VPGA 1XMJA 3GHHA 1NP7A 1E6LA 2F1KA 2VJCA 4KQMA 4GS5A 1RM5A 3EXG1 4F5ZA 1KMIY 2ZZMA 4NQRA 4RHCA 1K6XA 1NJFA 2I62A 2Z4SA 3E0XA 3L0OA 5DE3A 3ZDEA 4EHJA 2D2CB 1MEOA 2HA5A 3AK1A 3LHDA 1J0CA 1W96A 4BE7B 3GJ0A 1XAJA 2B8EA 3PX3A 2WYUA 4IUDS 1GITA 4MS1B 2ZITA 3WU2Z 5C5EA 1B06A 4J9ZB 1Y9DA 3I0ZA 3KZNA 3O1LA 4HDSA 4MV1A 4DSUA 1DQZA 3IEPA 4BNIA 1N5LA 1NXTA 2IBSA 2ZB7A 1E7YA 1DCKA 2XAHA 1SQ0A 2VCYA 2EV9A 2R65A 2RQ6A 2PYLA 1RDFA 1NW4A 1OT5A 1DOHA 3C97A 3PRHA 1Z8HA 1L4KA 1PJ4A 4TLCA 3T61A 1KOGA 4YJ3B 2GZMA 3E18A 3GLKA 1TZBA 2ATCA 3RWBA 3GDWA 2R8ZA 1BSMA 1L8AA 2AW5A 3BD8A 5TC4A 2RGRA 1EUDA 3L1KA 5TGDA 3OQJA 1HGXA 1YUNA 3RVSA 1AROP 3QXXA 1Z5WA 1PRYA 2NU9A 4JA2A 5DHQA 2P4HX 1H5UA 3I9NA 2SHKA 2ZR0A 1G1XB 3WB0A 3AUSA 3FE2A 3K5HA 3M34A 3IR5A 2C84A 4MWBA 3N0XA 3EXHA 4EVIA 5IKMA 3KR9A 5AICA 5JYCA 3HR7A 5I6DA 5I7UA 1CHNA 4MRNA 1OX4B 1Y7PA 2YNMC 1J7JA 2QDXA 1F3OA 3C3BA 5TNXA 3TB4A 4C7MA 3OTWA 4FYMA 3GA5A 2ZYUX 5D00A 3T1NA 3LU1A 2XKKA 5LA6B 3AEUA 3IRUA 2GRAA 4DGSA 1H42A 1L5VA 2YEVB 4S1PA 2UUOA 4WXHA 4XDHA 3ZQ6A 4PRYA 4RGQA 3JASA 1H2WA 4RZQA 4TUYF 4NYKA 4EYQA 2OFXA 3DVRX 3MPUA 2NACA 4HQKA 3EDYA 2LGQA 2J3KA 3E84A 3FYUC 4BKUA 9GPBA 2BF7A 1YK0A 3AVWA 3W7AA 1M5UA 1LFAA 1A5ZA 3IPLA 1JS1X 3IT2A 5T64A 2CF6A 1II0A 4RPKA 3AIMA 1XEXA 4FSHA 1BQEA 4PI2A 2Q28A 5CVCA 3ZUGA 4J0CA 1W2WB 4A0QA 4F3YA 1GAJA 3DWIA 3AEIA 5LLSA 4FXOA 3H1HH 5F3DA 3C85A 1XKQA 1EDOA 3GZ4A 2DBVO 5BUCA 4F96A 2ZDIA 3AM5A 3HQ4O 2DBYA 2PKYX 3HGQA 5JBQA 1A9XA 4JY7A 1ZW1A 2EJUA 2R1ZA 3WA7A 3D7SA 1N34B 2EFDB 1WSDA 2P1RA 3WQQA 4MVUA 2X40A 3BB4A 1FJXA 4QYIB 3UHOA 3BULA 1IZ3A 2IHJA 4DV5O 5T57A 5EJEA 1DX9A 3ZGXA 2FPSA 4O2RA 5F78A 4DKXA 5KWIA 2BE3A 2JFFA 3LCVB 3RS0A 4PJ0Z 4DWVA 4AUMA 4WAUA 5DGCA 3TM4A 1WUKS 4LXHA 2IUUA 2FSVA 3I8OA 1U8XX 2WWVD 2G6BA 3OZUA 4UVCA 3W78A 3HKBB 3EVEA 1E9EA 3EXHC 3JR7A 3BMOB 5FLXN 3KFVA 4MEJA 4GOXA 4MR9A 3UV3A 1OTXA 2QP4A 4MSWC 5HIAA 4G1MB 2P6RA 5IT5A 1UEXC 5DV9A 5EIBD 4LF9B 1VE5A 2PV0A 1Q0TA 3HJFA 1PBNA 3AEUB 4FYHA 3DHNA 1CY6A 1X2EA 3VQWA 3AG3C 1IXKA 1DV2A 1DKPA 2GI4A 2AZ0A 2H1IA 2OGWA 3CSUA 1AGNA 2QWRB 4EB6B 3TTUA 2E5LO 1I32A 4M4SA 5CVTA 2IGTA 3U17A 3A6KA 1P2BA 3U3KA 4JNKA 3TLBA 1K3FA 1WOYA 2PUHA 2P7IA 3HWSA 2C8LA 4JROA 3KYCA 3RPEA 4DMHA 3SQWA 2Q5CA 4RDXA 3KSAC 3QVSA 1J8YF 5FDFA 1ISSA 1Y6XA 2KG7B 2QTCA 1TCCA 1PJ2A 3M0EA 3O4FA 3B8MA 2Q62A 5FO0A 1L5GB 1CJMA 1WUJS 3HKEB 1OVMA 1KO1A 3MM4A 1ZX1A 2FDRA 4QICA 2XGSA 1W88A 2C9ZA 1UMCB 3GRKA 5ALPA 1GXSA 4CF6A 2ZDIC 3MDSA 1Z6AA 2FEKA 1XFAA 3DV2A 2FK7A 3N2ZB 4KR0A 5TARA 5AQ1A 4YRPA 3HJUA 4JKIA 4U6QA 1SZCA 1WUHS 4XOIA 1CP9A 3W8NA 3H84A 3JZAA 4QPZA 1I4OA 1R74A 4HQOA 1XMSA 3DE1X 3GPIA 2H4WA 4IOKA 3ZBTA 3ZWWA 1JLSA 1DAHA 1QFJA 3IDFA 4IZHA 3RCBA 4DIKA 1G7RA 1WHSB 3LJKA 1MC5A 4IOMA 1N8RW 1GQ2A 3GP3A 4IFIA 2AUTA 2WYOA 4WN3A 1R15A 3IOMA 3RS8A 5HTOA 4ZOLA 1NY6A 3OT4A 4MQFB 5LYJB 3GJZA 1OBVA 2OIEA 2ZFUA 4LIPD 1E59A 3IP9A 1UXIA 2AYYA 3H86A 2O0HA 4M9ZA 4NZOA 1U1GA 3EW9A 1VQNV 2FMUA 3BK1A 4GRAA 4LF5O 3H4VA 4U1RA 3CC7V 3TNDA 3WFIA 2JJ2A 4ASUA 3F8WA 4MYRA 4E5PA 2NWQA 4EZBA 1K3EA 4H44B 2IP4A 3WB1A 3HG7A 4QBTA 5C18A 3D2AA 2ZPUA 1CQJA 4BFTA 3V2HA 1GCOA 2WM2A 3W3AD 4YJ2B 2YZKA 3BIOA 1ZU4A 1BW9A 4FB4A 1NDHA 3CQ9A 2VYCA 4MVJA 1NC3A 1ZNWA 4OGKA 5JAHA 5CFOA 2IH1C 4X20A 3N27A 4YIPA 1QYCA 3TQRA 5CCBA 4ZOAA 1PQYA 1VP3A 3KQYA 4CIVA 5MN4A 1Y1TA 1Z15A 1Y4SA 2R1TA 4UATA 3DGFC 3ZGZA 1FDUA 2ECQA 2P9YA 1ZGGA 5HCUA 4NECA 1BVHA 4Y30A 3T3NA 1GT91 4M1WA 4Y2JA 1DLBA 1E1QA 1JNXX 3L06A 5EQTA 5F1KA 2YVKA 1L5WA 5JXIA 4WUVA 4ICGA 1O2DA 1M8FA 1Y4MA 2QN8A 3P0EA 3N2KB 1J8MF 4D1YA 3A3NA 4MQBA 5IS2A 1R8XA 1YB7A 4US2R 3VYVA 1QWOA 1ADFA 5BN5B 4ZC1A 1E3JA 3DDOA 3NGXA 4CV3A 2YMMA 1OZHA 3CPHA 4RJKA 3EEYA 1SUIA 1ZL8B 2WTMA 4OTZA 1TYBE 1RLOA 3F8TA 1Y9EA 4Y1RB 1TT7A 3RASA 4R8LA 3JYHA 3T4XA 1OFGA 2N46A 4M54A 2FPUA 4XWYA 1JJFA 2UUAO 3C3DA 3PSAA 3MS4A 1E1KA 5E1DA 2GPSA 3LOPA 4Y6LA 4AJOA 4DCPA 3R23A 3TQCA 1D8AA 4DCNA 1UJBA 4DA8A 3TNLA 3V2UA 4C89A 1YVRA 5JI3E 3OWOA 4HPWA 3RTEA 2PYIA 2ZI4A 5B66Z 3G6BA 1Q19A 1A5AB 1H2MA 5ELLA 1ZNZA 4CKEA 4QVIA 1NZFA 1O97D 2XLBA 4Y9DA 2Q2WA 2NXCA 5CFQA 2UVQA 4Y98A 2Z2ZA 3I6BA 3E22A 1ZKDA 2DU8A 4LEIA 4UVIA 5J43A 2BP7A 2FDXA 2I1WA 3OVMA 2L35A 4P33A 1Z4OA 3JWIA 4WERA 1NL3A 4DNXA 4RS4A 3TQTA 4CZZA 4RW0A 1XK7A 2DLDA 1RJWA 4LI3X 1GN4A 3WNDA 2JCGA 1MAUA 1T2AA 3B5IA 2JGNA 3AG6A 3FIUA 2A5GA 3NETA 4H1VA 2NSDA 2XAQA 4LF8O 1HH4A 4QO8A 2EZ4A 1JQ0A 2MT9A 5HMMA 3RIHA 1FFHA 1ZN2A 1FFEA 1J06A 3VR5H 4DJDC 4GKKO 2ZSBA 1I33A 5AK5A 2IZ0A 3UOAB 4IQ8A 5BSTA 4URVR 5F52A 2W2PA 3SVTA 1W85A 4HWPA 4TVBA 2X8AA 3IQIX 1XNHA 3HPLC 5JQWA 1N36B 2ES4A 3FGPA 1QQAA 3GR6A 2B36A 2NYAA 2XUGA 3DAHA 2NO7A 2WU3A 3IBGA 1Y6QA 4JUIA 5G0WA 2VQ3A 1U3UA 3UZUA 1Y7LA 4MYHA 2JIQA 3VOAA 1F6BA 2AQKA 4JXXA 1WPBA 1EUDB 2FTKE 4P3KA 1XMXA 4JI7B 2IBZH 3ZIAD 3W2EA 4AJEA 2XWJI 3R5XA 4MIOA 1QDUA 3OCWA 3H9EO 3QVLA 2J7KA 1GPDG 4Q3KA 3JVVA 1N5IA 4WCVA 3GG9A 3SOPA 2HQOA 3PHIA 1RI4A 1AVMA 5E95A 2ZJAA 4NAUA 3L72H 4M46A 3NGMA 4RQUA 4LGVA 4MVJD 3MSXA 3O1HB 1CUJA 5ADWA 4CU2A 2KW5A 2F3RA 4KPUA 1HG1A 2GN8A 1MSWD 1EBUA 1V5WA 3QYPA 4HZGA 1RM3A 2FPPA 2QRHA 1KFJB 5IZCA 3HA3A 1LWNA 4N03A 4WZAE 2FH5B 1K5DA 3LK6A 2PGGA 5LNK1 1ZH4A 3I9JA 1IX9A 4I4LA 2Y4UA 1HOTA 2CZGA 4OXQA 1WXFA 1H93A 2LV8A 3G4SV 4GBJA 4GXRA 3PYMA 1FYEA 3ZDZB 2KBEA 1RSOB 1ORVA 4ABMA 2VFAA 1C1YA 1RQRA 4RTRA 4IIJA 3MYYA 1JLKA 3PZBA 4MJ7A 4MQEA 4RCZA 3WYGA 4UFPA 5JHGB 3UKMA 1WN7A 2GN2A 3LBAA 1UAAA 5AVWA 1JHPA 4ZO4A 4B84A 1T5EA 1PK7A 2PCLA 4IM7A 5TX7A 3ROMA 2PX6A 1OCCC 3EIFA 2H11A 4C6SA 1E8DA 3CCVV 2YASA 4IJVA 4ZTBA 5IF3A 2AG5A 2J48A 1WMDA 5AK6A 3TLZA 3GLHA 2PWYA 5JSUA 5JMWA 1O89A 2CE2X 4XQCA 4LYHA 3JCUZ 3DTUB 3O6VA 4NR0A 2AC7A 1SK8A 1ZC3A 3C43A 4GMKA 4DIUA 2IDJA 2AJTA 4JLSA 4TKLA 2C2HA 2YIJA 3COWA 4CIBA 1RPZA 1QG2A 4K6OA 2O8EB 4JLKA 4QOEA 1W9MA 2IWHA 3HADA 3I3SR 2VH1A 5BNZA 1H8EG 3QPVA 1AGPA 1OBCA 2FXVA 4BC0A 3AKZA 3ZTWA 2H7CA 4KFMA 3IV7A 3AHHA 4ZMRA 2DSTA 2ITDC 2V4DA 2PSSA 4JWKA 2Q6VA 3FWKA 4GU5A 2NV0A 4D9GA 3IVCA 4RIIA 2Q8QA 3OE1A 5IT9N 4LYYA 1E4VA 1X7GA 3DTTA 1BYIA 2D06A 3IKVA 4Z4IA 1EFVB 3ZMZA 1YFKA 5D87A 4C6RA 1EFTA 2BM0A 1RKQA 5E2IA 5KAPA 4GE3A 3NP9A 4IDDA 4BU1A 3ITEA 5AW3A 2CJYA 1GGNA 5FOWA 2YV3A 5K8TA 2O4CA 1PL7A 5EHGA 1E3IA 2PZJA 3LSUA 4NFSA 2BEWA 1OWOA 3IUMA 1EP9A 2Q69A 1IUPA 2W37A 3QX8A 4DTIA 2XQGA 2J3DA 4UMEA 4ZICA 4PLFA 1UZNA 4JD5A 5FPTA 5K0GA 1SKVA 2MSLA 2FKAA 1KL7A 1Q43A 1QYRA 1Z8FA 1JPVA 2JI4A 2F43B 2W22A 1FXWA 2YHIB 4MR8B 2NUAB 3FUTA 1S72V 1HM5A 1S3GA 1JIXA 3DZKA 3OPYA 3H9BA 3DXYA 4HD8A 3RROA 3ZU6A 4C0HA 2CLFB 4M7RA 5IBCA 2JIBA 2PI5A 1RJDA 4NKRA 3W6OA 3MUNA 1DOAA 1U28C 1ZS9A 4H7HA 1BMFG 1P81A 3R7FA 4EPWA 3T1HO 5DM70 3O4HA 2VPWA 1U3WA 2XUOA 3F7VC 1BU8A 3OOWA 4JIMA 3WK9A 2OV6A 4ES6A 1GN2A 2R6FA 3ITKA 2RJ3A 5FHQA 1HKUA 2XTNA 4IPTA 2ZIEA 3AUUA 1KRWA 3QUQA 3VJMA 2ZSJA 4YHHO 4K2HA 1GV0A 1RC0A 2AG6A 2C7GA 3IEXA 4PFQA 2PG3A 5EIOA 3TEJA 4F2DA 2DWDC 3OD4A 2A1IA 2CVOA 1Y0BA 1IHYA 1Q7BA 3N0WA 3BFRA 3CZCA 2WJPA 1C3LA 1YQEA 5CFPA 3KJXA 4QG7A 1OH6A 1X59A 4DO2A 2JRIA 1NOIA 4S35A 4G56A 4U5XA 1F2DA 3RGWS 2FRDA 4UCUA 2RBKA 5IKXA 3ZS8A 3ZCPA 4J49A 1BAPA 3TEFA 4D9CA 1Z2NX 3B6EA 3PVZA 1K6IA 2E4WA 1ZIYA 1QFSA 1OWLA 4IDHA 3RU2A 3WJ2A 2HZBA 4LRQA 2DSNA 1QP4A 1HNWB 1IN6A 1E62A 3D3KA 4FKZA 4PX9A 2H65A 2R79A 2ZOSA 5FQOA 4EY3A 1CUGA 1CZUA 2Q0OC 2BSAA 2J3EA 3CR7A 3G5MA 3OO0A 4JFAA 3K9WA 5LBQA 1SXJC 4YAIA 4JEUA 4P80A 5DI3B 2ACEA 2JI9A 1KFBB 1JR6A 1FCJA 1G17A 1WZEA 3PYLA 4FFWA 4ZAGA 5I9SA 4BBPA 5K45A 3PC2A 5CNMA 1MPXA 1RHMA 1YJBA 5ALIA 5BN3A 4RMHA 1UAYA 1OLXB 4RVSA 5DLDA 3OF5A 2B30A 3NWJA 5CNIA 2GEDA 2C57A 1V7PC 1NNUA 4BVBA 3KAPA 4CMEA 1YWGO 3AI7A 5EVCA 1QIIA 3N2LA 3VDQA 1PTJC 1QH0A 3JYOA 4J0IA 1ZKMA 1JZTA 2WUDA 3N7AA 4C06A 3ABKC 4S0XA 3R3UA 3Q3JB 1QTQA 3QG5A 1S2MA 3OTOO 1YB5A 2RK6A 1WB7A 1VGRA 1KJ9A 2J59A 2R8RA 3B6ZA 1CCWA 4D5GA 4YJDA 3OFND 1KETA 3ZZNA 2H18A 4MYSA 2OD2A 4KQ2A 3IA7A 1ND5A 4RGBA 2WF9A 3T7EA 2X6RA 5AD1A 3BXFA 3ZZMA 3WL4A 1QRUA 1S8FA 1VG1A 3FF4A 2YS8A 4PBRA 3RH0A 3Q7PA 4GO1A 4YJFB 4CQNA 3HL4A 1Q20A 2GD2A 4PLCA 5EJ2A 2BUCA 2ILMA 5ALLA 3PL5A 2LVBA 4J4HA 3OQIB 2EATA 4FIPC 5IYZB 2H2WA 3DLBA 2WLMA 1I51A 2V3VA 1WJZA 3F6BX 4ED9A 2A7QA 1NLYA 3BSSA 1UP6A 4B32A 4FBGA 3I39X 1JIIA 4R54A 2ZQMA 1Z2DA 4O3FA 4C3OB 4BB9A 2C00A 2G9VA 3M9XA 2ZYWX 4TV9A 3DHEA 4OGLA 1NI5A 2QM3A 2W5UA 3P71T 4I5IA 4JT8A 5LBUA 2YRXA 3UATA 5L7WA 4IRUB 4BV3A 4C0XA 1N9KA 4EENA 2WRZA 5I01A 1P1IA 4Q82A 3ZQUA 5EXXA 3L6DA 3ZMVA 3O5AA 5BW8A 2ARHA 4MTOA 3W1EA 3Q5EA 5F7JA 1FYJA 4R2WA 4C0SA 4X93A 5C32A 4PLTA 3T5PA 4P0QB 4YGXB 3RTDA 3UNXA 1J0EA 4QSMA 4EMTA 4YR9A 1W35A 4F8YA 1M10A 4TLAA 4IF4A 2HQ1A 4R2HA 2D2XA 4ZRNA 4IGGA 4YIKA 2EWWA 4BZQA 2W93A 4MIYA 2EOAA 1F4VA 4ZI3A 3OM1A 2VKQA 3CF4A 3FGNA 4NG4A 4RVCA 4JLUA 5DYYA 1U3TA 3AI1A 3DONA 5BQ5A 5TPZD 1Z4IA 3IR6A 1E18A 4RKWA 4INJA 2OMEA 1V54C 1R0RE 2QX4A 1CY8A 5DP1A 1NXOA 3IPRA 3WIDA 3TKAA 4OQDA 5TQVA 1HFJA 1YCGA 1A50B 4RH0A 1UKEA 1Z18A 1GKIA 2BY4A 4G63A 3FRHA 1HW7A 2C3UA 4HN2A 5BN5A 3V5NA 1UEIA 5HIKA 1O94D 3QMMA 4L16A 5TMPA 3S2GA 1JJAA 1HE8B 1R3UA 1TL7C 4ZVTA 4MDEA 5AW5A 5HCIA 1Z29A 1SHUX 2E1PA 1NUTA 1DQPA 3JQAB 4L8YA 3REQA 1TIKA 4L73A 4MR9B 1YJNV 3EIUA 3TRKA 1XEQA 3DL4A 1TAQA 1V16A 1IVYA 1DKRA 1T1EA 5KYUB 1TF7A 2GN9A 2ZRCA 4ZMSA 2C2MA 1GA4A 2O20A 4DV6O 3DL7A 3HU1A 1AGXA 5AWFC 1IWPB 3G89A 4GWLA 1ICIA 1IL0A 1YL7A 2NAFA 2NUPA 2ZIGA 4K9KA 4ZYUA 1XTQA 5B3JA 5A3JA 3G1TA 3NALA 3I6IA 4NE7A 1MORA 1UMCA 2BVNA 4C3UA 5K6AC 1AN9A 4GQIA 5DNYB 2XRZA 1EXWA 2D7CA 3AINA 5JANA 2B34A 1FK8A 1H2YA 4YASA 4DL9A 1IEWA 2JFBA 2HJDA 4CIYA 5JU6A 1B1AA 3M1AA 4WH0A 2IJJA 1ODJA 4E6PA 2RCNA 4JI5O 1GPJA 1QVVA 2XTZA 2OHOA 3I28A 1I01A 1Z0KA 3FOBA 4PTYA 4AXBA 1PT6A 4O4LB 2F43G 3MZ0A 3RKRA 2KHZA 4MVRA 1GYQA 3C5WP 3L6OO 1IULA 2X0FA 4HAUA 1R10A 3OWHA 5IARA 3ZJZA 1SZDA 3GMTA 4WBSA 4Q7KA 2XZDA 1ZXBA 1YCHA 5HF5A 3ESRA 1DWQA 1UMDA 4AYXA 2ID4A 4M49A 2YMLA 1M57C 1TQ8A 1XCGB 3VSEA 4UHFA 4ENTA 5EE9A 1EFUA 3HXMA 3LS2A 5EYPB 1VJCA 3ZHYA 1A8UA 1XZBA 3CH7A 1UADA 3WV4A 4GICA 5K4GA 3W2TA 2KYRA 4EHDA 5CIWA 4GGOA 3BJEA 1EZ4A 1T4CA 4DW0A 4NS1A 4YCJA 5IJ9B 2H9YA 5HGJA 2DHEA 2W2MA 2Z83A 4QAQA 3HYSA 4HDKB 3KG2A 5J2TF 1J5PA 5JNRA 1JFTA 2AGAA 1UH5A 2G3YA 3N7TA 3CG4A 2IYSA 2PT5A 1EXVA 2FMTA 2GQ0A 2DB3A 1RMTA 3C5EA 3TH5A 3G0BA 1RRGA 1E79D 4R5MA 1TAEA 4X92A 4LDAA 4K0KO 4WLFA 2EQ5A 4FOTA 2A14A 5F1YA 3SKVA 1LEHA 2FPIB 2GUGA 2WDPA 1EM6A 3HUFA 2I2WA 3TOZA 5L3ZA 2PUDA 4A27A 3FR8A 4GOOD 2DBRA 4CF5A 4NB5A 2Y71A 4OCZA 1VMAA 1F23A 1YULA 3OIDA 4D81A 1NN5A 1ITZA 2DULA 1AKQA 2C3YA 2WE7A 4KXLA 4TTVA 2ZRAA 2X4DA 4QRHA 5H83A 4A0HA 1ESZA 4M7PA 3UOWA 3AC0A 1JQDA 1QZTA 4KWEA 1A9ZA 1NQXA 3IEUA 2AI3A 2BOCC 3L1HA 3PQ7A 2Q0HA 3OU6A 3APOA 3PWZA 1NTRA 1SUCA 3LDAA 1SZJG 4FHCA 4NZ9A 3RUAA 1LBTA 1AR4A 2HFJA 2NUBA 3FJOA 4EDFA 4LOLA 4HQNA 4UOEA 5KWEA 4D45A 3TZHA 3M8AA 2PT9A 4FFMA 2QDOA 5KSZA 4I5FA 3DOHA 3UMCA 4F6LA 1TW2A 3NKFA 5JJJB 2EWVA 2D5AA 3BCRA 3C3JA 4MTLA 1L5ZA 2GA8A 5ETJA 4WNIA 3NHLA 1IBRA 3RRFA 1DEAA 5JXJA 1M34B 3QTBA 3STXA 1RWXA 2IY9A 2Z09A 4DEXA 4J7AA 1S4MA 3ZNPA 1C8BA 3LBYA 3T52A 3G80A 3LNCA 4MV4A 3EZXA 5T3YA 3NYRA 2IEIA <