1YSCA

2.8 angstroms structure of yeast serine carboxypeptidase
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
421
structure length
421
Chain Sequence
KIKDPKILGIDPNVTQYTGYLDVEDEDKHFFFWTFESRNDPAKDPVILWLNGGPGCSSLTGLFFELGPSSIGPDLKPIGNPYSWNSNATVIFLDQPVNVGFSYSGSSGVSNTVAAGKDVYNFLELFFDQFPEYVNKGQDFHIAGESYAGHYIPVFASEILSHKDRNFNLTSVLIGNGLTDPLTQYNYYEPMACGEGGEPSVLPSEECSAMEDSLERCLGLIESCYDSQSVWSCVPATIYCNNAQLAPYQRTGRNVYDIRKDCEGGNLCYPTLQDIDDYLNQDYVKEAVGAEVDHYESCNFDINRNFLFAGDWMKPYHTAVTDLLNQDLPILVYAGDKDFICNWLGNKAWTDVLPWKYDEEFASQKVRNWTASITDEVAGEVKSYKHFTYLRVFNGGHMVPFDVPENALSMVNEWIHGGFSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2.8-A structure of yeast serine carboxypeptidase
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase(carboxypeptidase)
molecule keywords SERINE CARBOXYPEPTIDASE
total genus 115
structure length 421
sequence length 421
ec nomenclature ec 3.4.16.5: Carboxypeptidase C.
pdb deposition date 1994-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00450 Peptidase_S10 Serine carboxypeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.410 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1yscA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1yscA01
1CPYA 3ZI7A 3CXUA 4NVRA 3A6ZA 3MGAA 5ALEA 5I9IA 1EXWA 4N5HX 4KE6A 2OG1A 2RI6A 4IH9A 4DGQA 2VSQA 5A7FA 1UWCA 2WHQA 5ALHA 3JWEA 3G9ZA 3GUUA 5CRIA 2CKMA 3I1IA 4LIPD 1TCBA 2G5PA 3PE6A 3WKBA 4C4XA 4QE3A 4WFKA 2QMQA 4LKOA 1ZICA 3MVEA 4B83A 2QJWA 4YASA 4KJXA 1CLEA 1JU4A 5AM5A 5JAPA 4X95A 1W1IA 3ESDA 3G9TA 1AGYA 2WLSA 2WJ3A 2DQYA 5DTIA 3C45A 3DL7A 1GGVA 5FXMA 2JIDA 4G4IA 1QIDA 5AOBA 1EDBA 4KRYA 4X90A 2UZ0A 1ZI6A 5CH5A 5K3FA 4DMCA 1W4LA 1GQSA 3DOHA 1UOOA 4Q05A 3QPAA 1IUPA 3DNMA 3I6ZA 5DJ5A 1K8QA 5K3FB 2QXTA 3LCRA 4CCWA 4H35A 1K63A 3GELA 4PSUA 2X76A 1CFJA 1DX4A 2IITA 3GFFA 2C58A 3PUIA 2HRQA 2C7BA 2O7RA 2H7CA 2GBFA 1Y7HA 4S0XA 3DKKA 2XMQA 4PO3X 4W1QA 2PSJA 1LGYA 4NMWA 5ALWA 4AO7A 5LZ8A 4C87A 2PBLA 4BYMA 5CBKA 3B5EA 3M83A 4J03A 3AUKA 5BV7A 3WZMA 3S2ZA 1A88A 4PSCA 1MN6A 3E0XA 4B85A 3H2HA 4RPCA 3R3ZA 1YB6A 4B0PA 4AO6A 4FBLA 1HPLA 1FSSA 2H9YA 3IUMA 3ILSA 1MX5A 2HA6A 4BATA 2HA3A 1IZ7A 3EQ9A 1BROA 1UOPA 4X71A 4MWSA 3E4DA 4WJLA 3H1BA 4RNCA 2WQZA 5CT6A 2ACEA 2ZYRA 1XRPA 1CEXA 5AKKA 5EIEA 2PU7A 1EVQA 4OB7A 3DCNA 1W76A 2EDCA 3I6YA 3BDIA 3ZWQA 1CUYA 3L1JA 3WWPA 5JATA 3PDCA 4U2EA 4BE9A 3ED1A 4GLBA 2DCMA 5HZGA 5HFNA 2HA7A 2ONCA 1SC9A 3QZUA 1C7IA 2I3DA 4CI9A 1C7JA 2I3ZA 3N2ZB 1TRHA 1UKBA 1ISPA 2WIDA 4UHCA 4KAAA 1ZI9A 4Y2SA 5DYTA 3WQHA 1QIGA 4G8CA 2C0PA 5ALVA 1J1IA 4N8EA 3F67A 4UPDA 4N5IX 1ODSA 5A62A 5IH7A 2XMDA 4WCVA 4A5SA 2GZSA 5IVHA 1DWOA 2VEOA 1U2EA 4J0DA 4FNMA 2HM7A 1SFRA 4BZZA 1CUXA 1R3DA 4BC1A 4JEIA 2Y2UA 3AILA 5YASA 4Y2UA 5DLPA 2XUGA 1CUSA 3QMWA 3UMJA 2WSLA 5DNUA 1B6GA 1J2EA 1VXOA 2B61A 1QIMA 1QTRA 5EIHA 1OXMA 3H2IA 4ZRDA 2PSHA 4B81A 1CUHA 2HFJA 4GHWA 5ALGA 2OAEA 3C8HA 4EZIA 4WY8A 2XUHA 1GPKA 4H7DA 2XUJA 2XQIA 1CVLA 4QDOA 5DWDA 2XUQA 3FWHA 3R3XA 1X70A 1R9NA 1BN6A 3QITA 2QKYA 1WM1A 4PF1A 1F6WA 4YK7A 2AXEA 3WWDA 4TVKA 3I2FA 3C87A 4KAFA 3WIBA 3KD2A 4N8DA 4FHZA 2WM2A 1WCYA 4U2CA 1GPNA 5AK3A 1Z68A 3WK6A 1QIKA 1H2XA 4TGLA 2B4KA 3EQ8A 5AH0A 4DSAA 3E1GA 3DYVA 1EHYA 3FCYA 1ZIXA 5C7YA 2YASA 2ZYSA 4QEKA 1WPRA 4OPMA 4WFJA 5HF9A 2JEZA 5FV4A 3RM3A 4XJVA 4FNGA 3HSSA 4OSEA 4J0CA 3W9BA 4CG2A 1ZD2P 4DNPA 1CQZA 2C4HA 3VDXA 1DWPA 1E89A 4V2IA 3ZPXA 3D3NA 1DX6A 5HQ3B 3R3YA 2Y6UA 4ARBA 3I6MA 1UXOA 3O9VA 4IO0A 3V1MA 4G1FA 4TPKA 5AKGA 4C01A 4CG1A 1UKAA 4OUKX 4UHHA 4HS9A 2JBWA 1JMKC 3BWXA 3NGMA 2H7XA 4Y2PA 1PV1A 1EK1A 5AK5A 1RP1A 4BB0A 3IBTA 4CG3A 1XLVA 2XUFA 2WTMA 3OOSA 4AQDA 1XLUA 4BTVA 5DYYA 1N8SA 5A7HA 5LIPA 3V1KA 3C6ZA 1F0NA 3H2GA 1LPAB 4LXHA 3D7RA 4E46A 3I2KA 1DT3A 5AKXA 2VF2A 4GI1A 4HTAA 1X2BA 2AJLI 4I3FA 5AHXA 1QGED 2XQKA 3OM8A 4PNZA 1P0MA 1W52X 1LPOA 2X8BA 1W75A 4H7HA 2PUJA 4QWWA 4MQMA 5JZSA 1A7UA 3AIKA 2GYWA 4X6XA 4L3WA 2W6CX 1D07A 1EB8A 3AZOA 1ZI8A 4MEBA 5ALLA 1GZ7A 2WIFA 4DTCA 1L7AA 5EHNA 3FYTA 3FLAA 3FYUB 1RWQA 2DHCA 2FUKA 3HXKA 5ALMA 4K6GA 3IIIA 4KAJA 4WFIA 4BCBA 3K6KA 4YX9A 3IVMA 3G7NA 5K3BA 4INZA 3H18A 4K6HA 1Y7IA 3WI7A 4M0MA 4EY8A 1MX1A 4RE6A 2VJDA 4FWBA 4OCZA 2YYSA 4LHEA 2AJCA 5FDFA 1MX9A 5AM3A 5JIBA 2ZVDA 2O2IA 5ALSA 3QM1A 1F8UA 1M33A 3O4IA 2V97A 4QA9A 4EB0A 1MAHA 3V48A 5HQ3A 4BAGA 2PSFA 1O6GA 3HEAA 4DMHA 3VJLA 3OPMA 2QXUA 1QIFA 4QWMA 1AQLA 2HHAA 3FBWA 4O08A 4FBMA 4W1SA 5A7GA 5A2GA 1VE7A 1KU6A 3F98A 3AJAA 2XB6A 1AZWA 5JD5A 1XZHA 4X6YA 4HRYA 1SCQA 2J3DA 3SWWA 4UFPA 1ETHA 3OC0A 4N8SA 4MJ3A 1XQYA 5EHXA 3C5WP 5AI9A 3V9AA 1N1MA 1K5PA 1BS9A 3AZQA 1E5TA 1ZIYA 3D0KA 1ACJA 1ZOIA 3LLCA 1XRNA 3WK4A 3HYSA 2HA2A 2WJ6A 3BF8A 3DKRA 1JKMA 1AC5A 3WJ2A 5I7UA 4C88A 3G0IA 4FKBA 4BRSA 2IIVA 2AJ8A 4P92A 5T4FA 5DTJA 4G8BA 4H7KA 3R41A 5FRDA 3NWOA 3C6YA 1EI9A 3I2GA 3C43A 5DNVA 4B9EA 1A8QA 3WK9A 3BE8A 3BXPA 4G4JA 2GBCA 5ALKA 1HL7A 2Z3ZA 1ACLA 3PF9A 4GXNA 1IVYA 5AM1A 3BF7A 1H2ZA 1THTA 3FSGA 1LZLA 1VZ3A 3B3QA 3HI4A 4CFSA 1T2NA 3FYUA 1CUVA 1MTZA 4W1PA 2WHPA 4HXEB 4GW3A 3ICVA 1CUJA 5AKJA 2BGRA 2QM0A 4G5XA 4DNOA 4B6GA 5D3ZA 5HKAA 5CT8A 2AJDA 4AZ0A 4QLOA 3R3UA 1JJIA 2XUOA 2WHPB 5FPPA 3QPDA 2VT7A 4UFOA 1XRRA 1WB5A 4ZXFA 2WUGA 4KE7A 4H7IA 2XQGA 3RLIA 4ITVA 3W05A 4UBJA 3WKCA 3RK4A 2XUPA 3M82A 1YCDA 2XE4A 2ACKA 2WFZA 3VXKA 4UHEA 3TGLA 5HF6A 4QDXA 2CEKA 3W04A 4Z49A 4UBOA 1FFCA 1GKLA 5SYMA 5AP9A 4B7ZA 1FFBA 1MO2A 5IVKA 2R8BA 3AIMA 3ESAA 1C4XA 2G5TA 3KWJA 3WMRA 2RIPA 5D6OA 3I2JA 3ANSA 5CT5A 1BCSA 1TAHA 4ROTA 1BU8A 1UFOA 2XMSA 3N0TA 2RONA 1JU3A 1VZ2A 4BRZA 2CUTA 1GXSA 2BAGA 2HU7A 3TJMA 3L1IA 4Q34A 4W63A 4H7JA 4W9RA 4C89A 4J0IA 4GECA 1QLWA 3M81A 4UFNA 1J07A 3KDAA 1FJ2A 1E8NA 4U2FA 3M3DA 4OD0A 2DFPA 5ALZA 1DQZA 3O0DA 4GEGA 1QO9A 5FLKA 4AN0A 3FVTA 1U8EA 2Y6VA 3C8DA 4L0CA 2J4CA 4PV7A 3R0VA 5AO9A 1VA4A 2C5GA 1CIJA 4J0KA 4KE9A 4E14A 3H2KA 3FAKA 1XZBA 1SOMA 1XZFA 3FVRA 1QFSA 3PI6A 4A16A 3WWEA 5AKHA 2VJCA 2XUIA 5T4EA 1HQDA 3V1NA 3WK8A 1U4NA 5LZ2A 4WDRA 3WA6A 2Z3WA 4DNQA 3ZLTA 1XZKA 1WB6A 2ZYIA 3DEAA 3STWA 4AZ3A 3G8YA 3WIOA 3IUNA 1JJFA 2XMBA 3D4LA 3F97A 1WPXA 3KSRA 4QLAA 3BL8A 2J3QA 1W6RA 4BP9A 2BUCA 2JF0A 1IZ8A 3AINA 1L7QA 4HRXA 5EFZA 4G8DA 3LIPA 1QIHA 1QIJA 3RARA 1YAHA 3PF8A 4UBIA 4IH4A 1XQVA 2AJBA 2Y1KA 3GA7A 1AKNA 1UZAA 4K2AA 2WJ4A 1EK2A 3O4HA 2PKYX 2OQIA 4RE5A 1MJ5A 2XUDA 2ORYA 2C5FA 4DNFA 3CCBA 3QMMA 4X3CA 3KOOA 4UBMA 1UK8A 1XZCA 4FOLA 5HF8A 4PW0A 2JGEA 1XZEA 3H1AA 1PFQA 4GBGA 1CR6A 4F0JA 1G42A 4F60A 3NUZA 1CUEA 1LPSA 3FNBA 1Q83A 2RHTA 4Y2RA 3W2TA 2VJAA 4H7EA 1U65A 4X85A 1XZDA 2JGKA 3IA2A 5EHQA 4X92A 4AB1A 4DMKA 3STUA 3WL5A 4EY4A 5AI8A 4CIBA 5HK8A 4UHBA 4KR0A 4UHDA 2QRUA 2VAXA 4U2BA 3WYNA 4FFWA 5JD4A 3T52A 1YASA 1QE3A 4J3JA 1QIIA 3U1TA 2HADA 3F9CA 3ICWA 4K5QA 3QH4A 2WG1A 5J3JA 1HKHA 3WL6A 3ZLVA 4C4ZA 2NW6A 3G02A 1B41A 5ALJA 5ESRA 2V96A 1XZGA 2CB9A 2OLEA 5AM0A 2BUBA 4JNCA 3VVLA 3A2LA 5HK9A 1P0IA 1QJ4A 2WFMA 2YXPX 1AUOA 4P08A 1BEEA 3DJYA 3EF3A 2ZJ6A 3VVMA 3WK5A 1XZAA 1YA8A 1EDDA 3A2MA 1CUBA 4K6KA 3KXPA 1H22A 3AIOA 5E4JA 1K6EA 1YS1X 2GYUA 2XUAA 5HCUA 3C5VA 3U0VA 4HXGA 4FMPA 1QO7A 1R88A 5ALTA 5JYCA 4XWGA 5JAUA 1UKCA 3P2MA 5HF5A 2LIPA 4G4GA 4I19A 2HRRA 4BP8A 3WA7A 4EY5A 4BE4A 1Q84A 3WJ1A 4QZVA 3K2IA 1FFEA 4HVTA 4UHFA 2WFLB 4H7FA 4F21A 1XRMA 2GBGA 4UBLA 5KWIA 5FPQA 2OCKA 2XMZA 2Q0XA 5C8ZA 4HZGA 5LZ5A 1XKTA 2PM8A 2WFLA 1NU8A 2WTNA 1UOQA 2G63A 1GPLA 1XKLA 4P9NA 4WY5A 3VKFA 3WK7A 4XVCA 2V9ZA 5LP1A 2XUKA 5ISMA 1TCAA 3VISA 5H3HA 3CN7A 5BWCA 1BCRA 1LPNA 1P0PA 2WUDA 2OGTA 4FTWA 5ALXA 2XLCA 5K5EA 1XQXA 4EHBA 2FJPA 3F8SA 5C8VA 1CUAA 4LXIA 2CJPA 3L1HA 2D0DA 2BFNA 4M0EA 4BAUA 4X91A 5CH8A 2I03A 5T4HA 1AURA 1L7RA 5FUMA 4H18A 5ALIA 1JI3A 4FFVA 3FCXA 2PU5A 3H04A 1GT6A 2ES4A 2JGLA 3PICA 3HACA 3LIIA 3STYA 3X3HA 3DQZA 5JARA 5JAHA 3VJKA 4QDUA 4BVKA 1LPMA 3G0DA 5A6VA 2QUBA 5AI6A 1A8UA 5EI5A 1Q0ZA 2XMCA 4AN1A 1EB9A 4W1RA 4B80A 3AFIA 1MPXA 4EY6A 5AI5A 1ZJ5A 2OCGA 5AIBA 3LP5A 4J7AA 3I2IA 2WG0A 2PSDA 1CV2A 2PX6A 5LZ4A 1DT5A 4KYVA 4HAIA 1YB7A 2EDAA 1A8SA 3QBJA 2HL6A 2VJBA 2H1IA 3PFBA 1XZIA 4FLMA 1MU0A 3G9XA 1H2WA 5AK6A 5AM2A 1YSCA 3NOXA 2ZSIA 1XRLA 3RKSA 1LBTA 4AO8A 4DLNA 5LLSA 2VAVA 4PQEA 1XRQA 2CZQA 3ESCA 5AIAA 1R50A 4DMFA 3QYJA 3BJRA 2QOEA 3BIXA 1OCEA 1LPBB 4JYPA 2HU8A 1G4HA 3OG9A 3DS8A 1TIBA 4FLEA 2HU5A 4C4YA 4ZI5A 4JYMA 2PVSA 1E3QA 3G0GA 4GDMA 4C6HA 5JALA 4MWTA 5AKZA 5K3DA 1TK3A 2VTVA 3D2AA 5DNWA 5I8PA 2JGJA 1IMJA 4BBZA 4OU4A 2E3JA 5LKRA 5JZBA 3UUFA 4FDMA 4L72A 5JANA 1ORVA 3SX4A 4Q3KA 1MNQA 1CUZA 5E4YA 3G0CA 1USWA 2ZJFA 2OCIA 2PL5A 3O4JA 1IUNA 2HA5A 5LKAA 1UT6A 3FOBA 3WL8A 4P93A 1H2YA 2JGMA 5AI0A 1IUOA 5K3EA 4EUSA 1THGA 2H7YA 1VXRA 1F0PA 3IUQA 4Q1VA 3C6XA 2WILA 5ALUA 4MXDA 3IDAA 4XX1A 4DYHA 2PPLA 2QJRA 5F4ZA 4MYDA 3MUOA 3QPCA 3SK0A 4IH1A 2I78A 3FLBA 2GBIA 4X97A 2HA0A 2XQJA 4FLFA 4MQLA 5CURA 4Q3LA 4ARAA 2V98A 4Y2VA 5LYYA 1SCKA 4BDSA 5JASA 2VQ6A 1O6FA 1Q0RA 2HDWA 2QVBA 3R3WA 2DSNA 2QTBA 1DWQA 2ROQA 5ALOA 5AOCA 2QS9A 1CUUA 1R9MA 2WIJA 3STTA 2D5LA 2WIKA 1UK6A 4Y2TA 2WG2A 3HRHA 1N5MA 4AMZA 2CBGA 3W9UA 5BWBA 1DU4A 4H77A 1AMNA 3VJMA 4G9EA 1XZMA 1VA5A 7YASA 4BCCA 4DIUA 2HIHA 1VOTA 5AI4A 1EVEA 2QUAA 3DDUA 4G9GA 4U2DA 3DYIA 4BCDA 1ZD5A 1DQYA 4Y2YA 4D9JA 4ZGBA 4GWLA 1VLQA 3YASA 1GQRA 1MAAA 5IVIA 3AZPA 3O95A 3LS2A 1X2EA 3GROA 5JAOA 1LPPA 1WB4A 4BDTA 5AICA 2RAUA 3Q0TA 4E15A 4CIAA 5IKXA 2OQVA 4X00A 4MYSA 3ESBA 1JJBA 1AX9A 1CUGA 1JT2A 2FX5A 4JUIA 2VT6A 2JGIA 3D2BA 3GZJA 4LYEA 2Y2VA 1KEZA 5SYNA 1CUIA 2Z8XA 3PFCA 3K9BA 2J4FA 2O2GA 3A70A 1J06A 1YA4A 5C81A 4MEAA 1NU6A 1CUFA 1TQHA 2Z5GA 1XFDA 5EIAA 2ZYHA 4KE8A 1CRLA 4KEAA 4BAZA 5JADA 2OGZA 5DYWA 3IULA 3D59A 1EX9A 1HDEA 1LBSA 2QT9A 4OB6A 5CW2A 4BZWA 4Y2JA 1ZGBA 4J0JA 5CTAA 3WKAA 3E3AA 3TRDA 2OGSA 1SCIA 4RGYA 5K3CA 4AMYA 2BJHA 1QTIA 1N5RA 5AKYA 1UK7A 2WKWA 3HLKA 2P8SA 3G0BA 5AKLA 3DD5A 3A2NA 3EQ7A 5CXUA 2B9VA 2OXEA 3R3VA 3FYUC 2WU3A 3QMVA 1VJ5A 1JFRA 1G66A 2PUHA 1ZD3A 1QONA 2XI4A 4WDQA 3TEJA 2XLBA 4X94A 1JMYA 5EHZA 4IHAA 4Y2QA 1ORWA 4UBKA 1I6WA 5CXXA 4I4CA 3BIWA 3DOIA 4A23A 3HC7A 4LXGA 4OU5A 5A71A 1CQWA 3WKEA 2YH2A 1T4MA 2JEYA 1E8MA 3ZV7A 5AK4A 5AOAA 1E8DA 1XZLA 1FFAA 3FLEA 5ALNA 3BDVA 3V1LA 1ZJ4A 2ZJ7A 3JYHA 1BRTA 4X6UA 4B84A 2PSEA 4LYDA 2DHDA 5AKEA 5KBYA 4X93A 3JW8A 3MUNA 4J0GA 5KREA 5ALQA 3DL4A 5ALYA 2QZPA 3EIOA 5E4TA 1VKHA 3BJMA 4YPVA 2VA9A 1R4ZA 2DR0A 1EDEA 1WOMA 4UBNA 2Z8ZA 3PUHA 6YASA 3I1YA 3WKDA 4E11A 2W22A 5D3KA 5C8XA 2BCEA 2DHEA 5D7BA 4Y9SA 5ALFA 1HLGA 4CCYA 1LZKA 5AM4A 1UK9A 1QFMA 2RHWA 5T4BA 4BVLA 1Y37A 4L9AA 3H2JA 2XDWA 3C6BA 4CCYB 4QDTA 4B9AA 3IB3A 4Q3OA 3WZLA 4EBBA 1E66A 4B0OA 5ALDA 2R11A 2OCLA 4DM7A 5LZ7A 1GKKA 3HZOA 3H0CA 1K4YA 2ECFA 2G4LA 5E2IA 3I28A 4QNNA 1S8OA 3IURA 2XT0A 2BUAA 4Y7DA 2B20A 3CN9A 2XMGA 3D5EA 1EA5A 1QIEA 4BVJA 3ANTA 5LZ9A 2O2HA 1XLWA 3OTQA 2ZSHA 1XQWA 4X7BA 4OYLA 5FP0A 4AXBA 2VATA 3HABA 5ALPA 4F5ZA 3STXA 3C70A 3FSGD 1CUCA 3H17A 1XZJA 3O4GA 5HFAA 3R40A 4EA6A 1RYYA 3H19A 4NZZA 1ODCA 4M0FA 1DTEA 4HXFB 4KACA 2DQZA 1P0QA 4B82A 5BOVA 1R1DA 1ZGCA 1PJAA 2XQFA 4Q82A 1BN7A 1QOZA 3WL7A 4ZWNA 2XMRA 5FKJA 1EINA 4AX4A 3WLAA 5CH3A 1MT3A 2BGNA 5CT9A 1H23A 3IUJA 3GBSA 5JZ9A 1CUWA 1OILA 2C0QA 5AJHA 2WU4A 1KU0A 3STVA 2BKLA 2WIGA 2WHRA 1FFDA 2FJ0A 4NS4A 4ZREA 2IX9A 1YAJA 2WUFA 1MNAA 1VE6A 2RGUA 2GYVA 4H0CA 2JGFA 1WHSA 5JD6A 2K2QB 3UUEA 5FOQA 3WWCA 4PSDA 3ZLUA 1YR2A 2CMFA 2HA4A 1WHTA 4UUQA 3Q8WA 4ZV7A 1HBJA 2X5XA 3HJUA 1ZD4A 3F96A 5CT4A 2QR5A 3SC2A 3D2CA 3CCCA 4OYYA 3OURA 2EEPA 2HFKA 2WUEA 4IQ4A 3I2HA 5K3AA 3KWFA 1NX9A 2O7VA 4EY7A 5HKBA 4QDZA 2GZRA 1G5FA 1CUDA 1QZ3A 3QVMA 3W06A 5AKIA 4BTLA 1TKRA 5KWJA 1BE0A 3WYDA 4XIIA 2OAGA 3WWOA 3O9MA 5ALRA 1TCCA 4DSZA 1LLFA 5IVDA 4ZV9A 1ODTC 1EH5A 3B12A 3G9UA 5CMLA 1DINA 2OPHA 4Y2XA 4ETWA 4JH0A 4U2GA 3T4UA 3EBLA 1YS2X 4KRXA 1BEZA 4BC0A 4OB8A 4J0HA 5EGNA 1LNSA 3S8YA 1XROA 3DLTA
chains in the Genus database with same CATH superfamily
3HP4A 2WE8A 5E95A 2GM5A 3H01A 5CBPA 4R1NA 1T2AA 4DT1A 4D45A 1T4CA 1EAYA 1V2HE 2NUTB 3A6ZA 1LS1A 3FUUA 1CR4A 5AUPB 4PI2A 4JTCB 3B1ZA 4WD3A 2L82A 4ZHQA 1TGVA 1V9PA 3MAQA 2IZ7A 2YVUA 3GDOA 3Q5GA 4JI2O 2CUZA 2I1VB 3K6JA 3FCOA 4JWKA 1U7WA 2FQWA 3LHSA 2RI6A 4IH9A 4P98A 1DXYA 4R8SA 3RTGA 4N3BA 1QF9A 3OE4A 1QCYA 5IEJA 1EKXA 1YGPA 2OWEA 2BFBA 2VSQA 1BQ0A 5HZKA 3CH5A 4PYLA 5HM6A 4RKRA 2WHQA 1I4DD 4E5KA 4WFGA 3P3NA 1W5TA 1BZYA 4C9BA 4ZCQA 5I9MA 1MP0A 2CBXA 1V2GA 3LDDA 5J2TB 2QPTA 4CJXA 3PC7A 4A6PA 1US8B 4EKEA 1ZHOA 4RD6A 4AECA 4X89A 1F4VA 1OSNA 1SKYB 4LKRA 4ZOLA 1ZMRA 2P4UA 5KNDD 4TQFA 4QULA 2RKBA 4WFKA 1RJDA 4J4TA 2EFEB 2Z9BA 3BERA 3RVQA 3BMOA 4BJ1A 3E83A 2FQQA 3FN4A 3Q2OA 4MV5A 2XCQA 2DPMA 1B93A 1UPXA 4PHTA 3ZRWA 3CBGA 5EE5B 2OXTA 3D6UA 1J20A 1GOTA 3K5LA 1X77A 2Z08A 4JVSB 2I6GA 5LVAA 4NPAA 3BABA 1T9BA 1FP2A 1CLEA 1JU4A 2Q2OA 2Q6AA 3AVWA 1NW5A 3FOFC 4FYMA 2OHIA 1W1IA 4WLUA 2C2XA 2Z4RA 3RODA 4JQOA 1U2GA 3FBTA 4B3TB 3Q6NA 4OP3A 3RFFA 5B3LA 1AGYA 2EEZA 1QH0A 1Y4AE 3VH2A 4IXNA 5L3RA 5I9LA 3DVAB 1E3SA 3OX4A 4S3MA 4HVLA 5B7PA 1QIDA 4LJLA 1Q57A 3RIXA 4FX2A 1B6SA 4KRYA 3LQRA 5EWJA 1WF3A 5IYZA 5ENDA 1RXIA 1KVRA 4DMCA 5CAEB 4EUNA 2HFEC 1GQSA 1RRVA 3K2EA 3TL3A 4CKEB 3MS4A 3TLKA 1AKMA 1HQYE 1UOOA 1PJCA 2FY8A 4Q05A 2VJMA 5DU2A 4FM9A 3JZFA 1O77A 3DNMA 1I6LA 2V9PA 3I6ZA 1P9WA 5TB5A 4CPDA 3GWOA 1K8QA 2OBBA 4E4RA 4BU1A 3FDFA 4M9QA 1YNSA 4XDJA 3EA4A 1NXXA 4IGGA 4ZKEA 1K63A 2FPPA 1L7NA 3GELA 3VR4H 4Q7QA 3AEYA 4FFNA 3E8GA 2R65A 3JD4A 4KTTE 3ZHXA 1E6CA 1KMHB 3N39C 3TB6A 5CG2A 5E0KB 2FEKA 3HXPA 1Y3CE 3EG9A 4FFKA 2BCGY 2EARA 4KXFB 4XGKA 2E74B 3AEQA 1KC8W 4ZAVA 4L5AA 3UMYA 1ZUNA 4ZYYA 4EATA 3JAWA 1Z5WA 2GBFA 2RFLA 4B4VA 4ASUD 2ITDC 2OYCA 1A1VA 2HV8A 4XGIA 5IAAA 1E62A 5KNLA 1B6QA 1Y7HA 4GX1A 5BNZA 5LXTF 1V11B 2FFHA 2Q62A 3DKKA 1C30B 2BN4A 2H0QA 2EBOA 2OFXA 1XVVA 1M6HA 2OYSA 2PSJA 2QTLA 1ZC3A 2QRVA 2XYPA 4JELA 4LBYA 4KXVA 3SSNA 4EDFA 4NCJA 1XL0A 5ALWA 2PJUA 3A4NA 2QLLA 5JPCA 4OREX 1GU7A 5LZ8A 2ZUFA 2XRMA 3K4HA 3DLAA 1SELA 4KDFA 5BN4A 4W4TA 2DQ3A 2FW7A 1R4MB 1NE2A 2HT6A 4H1HA 1RI4A 2PBLA 3SPIA 2DBRA 1Z0FA 2YW2A 2ADPA 4J03A 3AUKA 4Z86A 2NAFA 3UJ8A 4HATA 4MRSA 3WZMA 2Q67A 2ZATA 4K9DA 4NBSA 4DLVA 5DKFA 2X1VA 3SX0A 3LVFO 3MLBA 3VTKA 1BJRE 1YDHA 3CRZA 3Q3CA 4PSCA 1MN6A 5I9TA 3UWOA 3B48A 5JG7A 2GEDA 3KEQA 2H06A 2WP8J 3PU6A 1JFTA 4UHJA 5HIJA 3V80A 1CZNA 1P7ZA 2GSWA 2YWDA 1JVMA 3BWBA 1YR3A 2Q3LA 3JAMN 2BTQA 4JP3A 3N3BC 4HDKA 1J5XA 5EUMA 1KFKB 1BC5A 1V39A 4G65A 4NENA 5EKDA 3T8YA 4YQZA 3VH1A 4RA9B 1CEEA 1TL7C 1A69A 2HJSA 2SKEA 3B2EA 3GEGA 1NFQA 3CZPA 5K8VA 2IKQA 3T3OA 1DLIA 4MLZA 2ZSFA 1NLUA 2RGDA 4MS4A 4PFSA 4FGUA 3VPGA 2ZAYA 1MX5A 2HA6A 3OIVA 3RE1A 1TZMA 3QKIA 1OXXK 5B7GA 4RK5A 5EWLA 2AB0A 4UCOA 3EQ9A 4F2DA 1UOPA 2QL9A 2ZIFA 4GPIB 3NRJA 2OUKA 4RXUA 3WGJA 3L4BA 4MR8A 4ARZB 3G1UA 4CLRB 1FS4A 2FMIA 3U4IA 4NZYA 1IM8A 4B3RB 1JFVA 1HDXA 2TMKA 2OR3A 2X8JA 3HCWA 3SSOA 3UHFA 4L3VA 2P2DA 4JI1B 3H1BA 3O7MA 1JQLB 5EE3A 2ADOA 1N2EA 3BH0A 3E3MA 3G85A 5CT6A 1JG1A 4L73A 3ZDXB 3MIZA 2GPYA 3VHXA 4N0QA 3HR7A 4NU8X 4W99A 2Q3BA 5EIEA 3CW8X 1TD1A 1LI4A 4OB7A 2Q3EA 521PA 3JQGA 3DCNA 3JARB 1S8FA 2HJGA 4IV0A 4OXKA 1W76A 5CX1B 4ESOA 1GITA 2Q4BA 3U3MA 3ZX5A 3LF2A 4EW3A 3DC7A 3MTDA 2Y99A 3CH7A 3CXRA 4M9ZA 1P5RA 2OENG 3DOJA 4IGFA 5E7QA 3UMCA 3ZWQA 3N2EA 5IXJA 3ED1A 3HM9A 4K8ZA 1JG7A 5HZGA 1ISIA 3CISA 2HA7A 3NHZA 2ONCA 5HFNA 2J32A 1ZSYA 1Y8AA 1PZFA 2XCLA 3PQFA 1R8QA 3LC7O 4D43A 5H5JA 3TXQA 1C7IA 1RAEA 3Q6MA 4CI9A 2IU3A 3OPYA 4UVEA 4ZOLB 3GCZA 3WQQA 4F86A 4PVCA 1NBMD 2PXXA 4UE3S 2C1ZA 1W85A 2R44A 4LISA 4YIPA 1IEWA 1EFRA 4NBWA 4UXHA 2FUG1 4WL0A 1WNFA 1AK1A 4BBJA 1IIBA 3EZYA 1JFFB 1FUEA 1QIGA 1T9CA 1Y3AA 3K71B 4EJ6A 3KYDB 4RGBA 2GBLC 1YFKA 2AI3A 3T12A 1URFA 4PSKA 3W34A 2ZI4A 4BW9A 4O63O 1X9HA 1IOWA 2X6CA 2QR3A 4OVKA 7GPBA 2O50A 5ALVA 2IHTA 4YAEA 2X42A 4YN3A 2HLNA 2ZVQX 1DDOA 4HN2A 3U9TA 2QG9A 1SZCA 4NYIQ 3U26A 2O8DA 4LZAA 2C4UA 3UGKA 2N05A 2XAGA 2NQ2C 4CGZA 1RBYA 1U0TA 1Y34E 2G5GX 2AZMA 3DVAA 4UPDA 3SKXA 4BB5A 4EHFA 2CFIA 4N5IX 3QVUA 1JYEA 3COJA 4J16C 1L5HB 1HDJA 5CB4B 3D1LA 3DMGA 3PT5A 3TQFA 2R70A 3L0ZA 4WACA 3L8YA 3Q4HB 2GCIA 5CEJA 2FN9A 3L6DA 5ESDA 2NTNA 2GZSA 1EWVA 3K0AB 4ND8B 4OJTA 5I7EA 2AQIA 5DX0A 3NH9A 1FSFA 1SFRA 4BZZA 4HKTA 2GJ9A 3VC3A 1EWQA 1CUXA 3A8TA 1IONA 4P5PA 5H70A 2BGWA 1SUBA 4FSDA 3GV0A 4MPPA 3HA2A 1T13A 2E9SA 4PC2A 3UB3A 5FPOA 3TR0A 4EYOA 4DB2A 3ELBA 3HEBA 5THQA 3OLXA 3HXTA 3OZBA 4BNWA 1CD5A 1A9PA 4IHQA 1Z4JA 2QKSA 3M5CA 1O4WA 4LZZA 1L7XA 2LPMA 1FOEB 2NX2A 2FJUA 4L7QA 1XCPA 4P92A 3UCFA 3UFBA 3W1VA 5J23A 2R9VA 1MABG 2LW1A 2PYZA 1ZM7A 3QBVA 5GJWC 4ZZ0A 5LL6Y 2AFIA 3FCEA 3VA7A 1QIMA 1VIAA 3ZIAD 4ER5A 3OTOB 3AEKB 4U9IS 1Q21A 4ZRDA 2OK8A 2DBZA 2PSHA 3UEOA 5BQFA 2B7LA 4XM0A 4EUHA 4PNPA 2HFJA 4GHWA 4XYMA 2UU9B 3G2PA 4C7OA 3C8HA 4EZIA 4ZYLA 2DM6A 5FOVA 5E1OA 2C8VA 2RMKA 3JATB 3NP9A 4H7DA 1T6NA 5IANA 5F1KA 1NNSA 4IDNA 5TGZA 3FTPA 4DBZA 1GK9A 2F9LA 5JU6A 1IXKA 3PNBA 2R6CA 4RUKA 3KL2A 4XDYA 3ZEDA 5DWDA 1P0CA 2H65A 2EBUA 5IASA 2CCJA 2Q4TA 3R3XA 3RADC 5HKKD 4P53A 4RANA 4C2AA 4IRXA 4DQXA 3QVWA 1BN6A 5ICSA 4WCFB 1JWLA 4YDHB 5K51A 3WB0A 4FKMA 4LQCA 4L0DA 1K06A 3D8BA 5IJWA 2ZT9B 3I23A 4NENB 4QPCA 3TQHA 4R6ZA 1G7SA 1PK9A 3SJCC 3KOMA 5EHGA 4YLYA 1NPYA 2O8NA 5HX7A 3UICA 1P31A 1JB9A 2WTBA 3FFXA 2P6OA 3B9PA 4X20A 5A9SA 4HXYA 4ZJYA 4KAFA 1HT3A 3MOGA 3NIWA 3C74A 2Q5EA 4CHTA 2ZKOA 5AJVB 4IS2A 1O0SA 1LV7A 3GWGA 3V7UA 4HZIA 3MCVA 1K3UB 1HMYA 4FHZA 1LY1A 1E79A 4AUNA 4K9LA 5JQGF 4I4TF 3GB9A 1Q3EA 1MJGA 2QN8A 3FMFA 3MTGA 4MR8B 5AK3A 5H68A 3G17A 3RJMA 1KH1A 1KHHA 1PSZA 3R2JA 2GNOA 3EQ8A 1BQZA 1CX9B 3KU4A 3VTFA 4AF8A 4CS4A 4BB6A 1IBMO 2X3FA 2GO1A 3VZSA 3DOOA 3E81A 1ZIXA 3P0HA 4LRXA 1HLPA 4KPFC 3VHXB 3G2LA 2P6JA 4I50B 1VRVA 2B34A 2GERA 3M2PA 3MAJA 5CBGA 1T2FA 5HBGA 3SQNA 4TS4A 2JEZA 1YFZA 2XXJA 1E9DA 1FRFS 4H3VA 3OQNA 3B4SA 1I7QB 1M5RA 2RJNA 2OY0A 1Y67A 2ZSAA 3TXYA 3EZ9A 4BMNA 1G0OA 3UCXA 3U6BA 3K9FC 3RM3A 2SECE 4XJVA 3K6SA 3TGUH 1XHEA 4AW9A 3A27A 1VIBA 3HSSA 3ITNA 4OSEA 4AP9A 4F4CA 3QPBA 2R00A 4TYPA 2NVUA 4IPTA 2F1OA 4QD3A 4EG4A 1CZOA 1GV0A 3OCCA 3IIJA 2V4MA 4FLWA 3IIEA 4FR2A 1KNXA 4Q1CA 1ZD2P 1DZIA 2V7GA 3U1BA 4PE5B 2R97A 3ZTTA 5IDXA 2GLXA 1R15A 2OXRA 2NZVG 1SD1A 3VDXA 2Q6KA 1DWPA 5ER9A 4V2IA 3AK4A 3KR0A 3D3NA 3B6MA 3ONWA 1Y48E 2H2WA 4Q16A 1CULC 5E3HA 4F5WA 3T06B 4JLOA 4F92B 4EJMA 1M34A 1PX0A 2Y6UA 3QV1A 3T7RA 4ARBA 2DTXA 2OSVA 3KYDA 3WE7A 2O3TA 1EBBA 1UXOA 2D5IA 2HH9A 3B9BA 1WR8A 1NONA 2G08A 4MW4A 3EGEA 1M9NA 4TPKA 4MMYB 4TXJA 3JQPA 2V7VA 2JS3A 2PKQP 3UYKA 4OUKX 4UHHA 4ALKA 4ZYXA 4QXMA 4MIEA 2OORC 3OQMA 3L40A 3RU7A 3II6X 2C3PA 2XNDD 4HS9A 3ZV6A 1E1KA 3ZRSA 2FK7A 3GLVA 1F20A 2ZWMA 3JQ6A 1M3SA 3ILYA 4KSBA 1C9DB 4RLFA 4XDZA 3CXHF 3OMAB 2WF8A 1EK1A 4R7ZA 2KW5A 3FDZA 1YQDA 3HKCA 4NARA 5AK5A 2OT5A 1RM4A 1R5NA 5CXQA 1E3WB 2Q5FA 4MI6A 2HBZA 3OQJA 1K34A 3J7AU 2LRHA 3KR2A 2RC6A 4QOFA 2HREA 4CM9D 1CG6A 4OHOA 5A9TA 1II9A 2GAIA 1R6TA 4W8HA 4DJ5X 3GW8A 5TGTA 3KOXA 2J8ZA 3X2QC 3U3KA 2YR0A 4HQOA 4AQDA 1AQNA 2F64A 1U3TA 1EFTA 1XLUA 3BWCA 2G82A 1PT7A 3OFKA 1GCIA 1SRQA 3OEEA 2AS0A 2EWVA 1QFYA 2G9RA 1KZHA 2ZIOA 2G5CA 2WU1A 1VSUA 3QLVC 2FWJA 3KZVA 1M1UA 4JJ8A 4KBGA 1AKTA 2XBLA 4MW5A 4RQBA 4RZIA 4S1NA 3HCPA 4TROA 1G4AE 1L1QA 2GCEA 4AZTA 4BN0A 3P0IA 4UZSA 1JTVA 5EUQB 3Q8LA 2NU6B 2VDUE 2Z6VA 4GMHA 3H2GA 5J2UB 3ZKAA 3QJGA 1Z0JA 4CL8A 4UB8Z 3DV0A 1N8TA 3GZNB 1LPAB 3Q7RA 4RLQA 4E46A 2I71A 2ALJA 3SJAA 1Z8NA 2P2CA 3I39X 5EP2A 5EKTA 2CW5A 4B3SO 2E5FA 3DZBA 3TE7A 4DAEA 3D31A 1Z5NA 5JR3A 5IEBA 1B6TA 1XQ1A 4DO2A 4KHPB 4AY4A 4KFSA 2JPDA 3N8GA 1UJ6A 1YK0A 3PD0A 3K1AA 4NJOA 5CCBA 3K9QO 1X2BA 3VH3A 3ZVLA 4NP6A 5L45A 3C24A 2OVBA 3FIJA 1VKRA 3PDJA 4I3FA 1I3OA 4CLDA 1VL5A 3GN2A 1QHFA 1QGED 3GAFA 1XOUA 4RM3A 3A7DA 3GN1A 4ZQCB 3T54A 8LDHA 1IDN1 1BXZA 1TM2A 2FFJA 2FK8A 3NR7A 2C61A 2FEMA 2G1KA 4QU0A 3SBOA 2GVZC 4MI3A 3UQZA 1C3EA 3DEZA 3PS9A 2CDYA 3HV2A 2W0MA 1BMFA 721PA 4MSUA 3WRXA 4H7HA 4FM1A 4AKHA 2XT9A 1A7AA 2EZTA 2HPVA 2VUSA 1GA6A 5GWXA 4WQMA 1AV7A 3C3WA 3JQ7B 1N7GA 4HK4A 4MQMA 2FUG6 4LZLA 2ZBQA 1OWMA 4OKNA 3KQNA 2YN4A 1WSAA 4L6AA 2PEYA 3K1TA 4HAVA 1ONOA 3VR3D 3AG4C 3AY0A 1USUA 2P4QA 5UKDA 3UAVA 5FWDA 5HKLA 4Y2HA 2P2YA 3A4VA 5BVHB 4PDRA 1PEDA 4RFVA 4CLOA 3T1VA 2Y0IA 2BGJA 4D3DA 3ENKA 2B1GA 4BMYA 1SA0A 3ZWBA 2JA2A 2FF7A 3K03A 3D7LA 4IINA 4IY1A 3BAAA 3U3OA 1R7RA 2PUBA 2C96A 4X7RA 2EL7A 4CG0A 2AEFA 4BQFA 1KP2A 4BNXA 1WBDA 2XRYA 1YS6A 3RSHA 2R5WA 1IB0A 1Q1QA 2OXCA 2YDYA 3BFKA 1RWQA 1NJGA 4F8YA 2G07A 2DHCA 2QL5A 4HY3A 4MO2A 4K8XA 3C8ZA 1J70A 4K6GA 4PYNA 2G8NA 3IIIA 2CUGA 4KAJA 4ZO9A 4D8UA 2R2AA 2VZ9A 4EWLA 4EVRA 3O8CA 5JXIA 1F3LA 2SICE 1XMSA 3CPHA 1H9AA 3THWA 1OT5A 4MPJA 4BB9A 2WD7A 3I5XA 4PG6A 1GD1O 2X8WA 3EIHA 3G7NA 3I9OA 1BCRB 1TYDE 2ENUA 4YCBA 3H18A 1G1XB 1QDEA 1KP9A 5DCYA 1LSOA 1UODA 1VLJA 5FNVF 1Y7IA 5BQXA 1X7WB 3WI7A 2DUJA 1E2BA 4D98A 2JS5A 4M0MA 1GQQA 2Y69C 5BR8B 2ZJ8A 3KEFA 1QHSA 3I9JA 5HCNA 1YJ5A 3OQIA 3LYUA 3OPVA 2B8JA 1H2NA 1YS4A 4ILEA 3SNKA 1I30A 4LY6A 4X0EA 1M73E 3QU7A 3W5SA 8OHMA 2O8CB 9ATCA 5ALSA 1G3RA 3QM1A 2C07A 1Y6FA 3ENZA 4C7XA 2WYHA 1SESA 1YDEA 3GRPA 4DV3O 3UJBA 6REQB 3TTXA 2HVJC 1B42A 3MAGA 4CT4B 4P4SB 5ESXA 3LNNA 4DV2O 4LSWA 1Z5GA 4BN5A 2OPBA 2W2KB 3OOJA 4D9FA 3EARA 3AVYA 2XNDG 1BGVA 2IOQA 3VOUA 1RBQA 4G0QA 2ZRBA 5IXSA 4NEGA 1MD9A 2ZIEA 3WLQA 3VJLA 5C1IA 1WA8A 5LNK1 3H4VA 1C0PA 1Y3HA 4RPKA 3CJHB 5CK4A 1CF2O 2OBXA 3DG9A 4YMHA 2HHAA 1Q6ZA 5G40A 1ZL2A 4DJJA 2AV6A 3OCYA 3UKDA 3MFYA 4FBMA 1SZDA 1QG2A 2GDZA 5DXAA 1DKLA 2VYVD 3BIOA 3RIYA 4E5NA 2E6KA 4U7JA 3AUSA 2FMXA 2RGNC 2XB6A 2OZPA 4DIOA 1WSWA 1BXKA 4WFQA 2QLMA 2Q21A 4FC6A 4Y98A 3NZEA 3JTEA 3Q87B 4CS2A 1F8FA 1X59A 2XOXA 1NMEA 4KGDA 3KJNA 5EE9A 3TZCA 1P49A 4YCCA 2Q73A 5CBHA 4IJKA 4CKWA 1VL2A 3HWSA 3TAXA 2IX3A 5C34B 1JG6A 3C5WP 3OAAA 5AI9A 1VE1A 3EDYA 2RHCA 3BM5A 4IQ8A 3V9AA 1QDUA 4PX9A 2GAJA 5A3RA 3IPYA 1N6RA 3D0KA 4UEKA 1GDHA 2O3JA 4FZRA 4QGSA 1PPJH 1XRNA 1CJVC 4CE6A 1IHPA 4V0MA 5CMUA 3CTMA 5TQJA 4HADA 4RV5A 2JGRA 1IN6A 3WLKX 4EG3A 1JKMA 3WLEA 1T8UA 3I5YA 5F12A 3TR6A 2Q5CA 5I7UA 3ZD7A 1HFWA 4C88A 1W49A 4FKBA 4A8HA 4UZFA 4PO8A 5L3EA 1G8JA 1SHLA 1CNFA 1YDFA 2GSDA 2NLOA 2ZJZA 3O94A 3ZJ5A 2CDAA 2F67A 2Z30A 3A7EA 5BW8A 1PVOA 2N46A 3AL2A 2D4HA 2VXCA 3IVRA 3NRBA 3RTCA 1YCFA 5D5PA 3IBCA 4NICA 3SQMA 4KFMA 1ZOSA 2DFVA 4G8BA 2E4YA 4H7KA 1II0A 2FSSA 3R41A 4HOYA 3W3ZB 3DZDA 1P5ZB 1CR0A 3P45A 5F33A 5IJXA 5KWSA 3U4MA 4J9ZB 2CXRA 1E4YA 2R1ZA 4YMTA 4I1UA 2BHSA 3GHYA 2AW5A 1EM8A 4MGHA 1OXUA 4HDCA 3DDOA 4PDLA 1TT5A 2EIJB 1P7YA 1LW6E 3IP9A 1Q20A 3H99A 4NCIA 2A06H 3IMFA 4MV7A 2PKEA 3BE8A 5B1YA 1V8BA 3LV8A 2OBMA 4WFHA 1Z12A 3NJ4A 3VQVA 5E9WA 4DAOA 4BPBA 5EXEA 5CEFA 1ZMOA 1M74A 4I0XB 2VHCA 1KKLA 2C78A 4J94A 5I47A 3HR0A 3QEOA 4YXWG 2XAFA 3T3GA 4D74A 4B3BA 4DSTA 2PGOA 3Q3JB 3GIDA 4GXNA 4KXYA 4MS3A 1GCUA 2A0XA 5C8DA 1ULAA 3R8CA 3Q9UA 4CLOB 5BVHA 2Z5FA 5SZKB 5C8YF 1BA3A 1LZLA 3OSUA 4G1CA 3I30X 4P7BA 2R8YA 4F1KA 3TW0A 2VSFA 1JIKA 4IKPA 5I9BA 4YI3A 3DZKA 2Q9LA 1G5IA 4FIDA 4KMOA 1M0SA 2COEA 4IWNA 4BO0A 2Q2VA 1XZPA 4M1YA 1T2NA 1SVUA 3HCRA 1IL0A 1LFDB 3IP7A 3KOZA 1Y1SA 3DXZA 3M9WA 4HJXA 4UASA 4X8HA 5CUQA 1I1NA 3AB7A 2C9ZA 2GN4A 4L8VA 1T9AA 3CEPB 4CLXA 4U7OA 1SCUA 4B6OA 4YXWD 4EECA 4HXEB 4I6GA 4R2MA 5AKJA 5LOVA 3QVVA 4PGAA 1XGKA 2Q9UA 3K96A 1PQUA 2QM0A 2V1XA 1U2DA 3OEHA 3AEUA 4NPCA 1JI0A 1E7RA 3ELYA 4XSGA 5DIZA 4B6GA 5K0CA 3GLUA 3JD0A 4YJ3F 1X42A 5CT8A 5D3ZA 2AJDA 3WX0A 4EI8A 5L3SB 1VL0A 4RESA 3DZJA 2D3TA 3FJYA 4K9PA 5C93A 4QLOA 2FN4A 5DASA 5GOZA 3C4JA 4KREA 1TI7A 1CC1S 2P9EA 2WHPB 4P3NA 3CSDA 5AW9A 5AWFC 2MSKA 3IQHX 3QPDA 3QWHA 4DXAA 2VT7A 3K16A 4DJTA 1L0LH 5JH7A 4TV8A 4J1SA 2C7PA 4A6XA 4AF7A 1M90W 4HWOA 1RR6A 2FSFA 4OKIA 2P0YA 2Z2IA 1Q1GA 2X0RA 4BMXA 3DMTC 4HAYA 2TMDA 3AHJA 3PNPA 4MIKA 3M2TA 4MQBA 4XFDA 5JY6A 4ITRC 3RK4A 5IFLA 4J07A 3GLSA 4HGOA 2QZ9A 3BTUA 1KJIA 3KTAA 2GBOA 1YH3A 2C54A 4J1TA 4UHEA 5CVUA 3VYWA 1BJKA 1KYIA 1UBEA 3H9JA 3IQWA 4P4SA 3TGLA 2P5TB 5HF6A 2XXAA 5LGTA 3NVAA 3SVLA 2W2KA 3T1HB 3DAPA 3W04A 3B8NA 4TLBA 4UBOA 1WRBA 3LUCA 3K0HA 5TT1A 1GKLA 2DWPA 1TGOA 1TK9A 2D2VA 5SYMA 2W37A 5AP9A 4B7ZA 4C4TA 5I7FA 1HZJA 1B1CA 1M2VB 4MGEA 5K7SA 3VI4B 3ZIDA 2M6RA 5IVKA 3CJHA 3D6TB 1JDTA 1TVMA 4Q7LA 2YDEA 3T3HA 3T99A 3SIRA 3LA6A 1JHYA 2B1JA 5COAA 1HYHA 1TE2A 2J4DA 1NMYA 4LF4B 1E1LA 4DY4A 4ID3A 3GCXA 3LL4A 1FSPA 3O2QB 4KMMA 3UG7A 2W48A 3VPHA 3GLIA 4U5XA 1GFWA 2NP6A 2GGSA 4RJIA 1XU9A 1PTKA 2R6JA 2ZCVA 3KKLA 3CUKA 2FW0A 4LECA 3V7YA 1JQ0A 3OIUA 3TF5A 3ANSA 1OIWA 4OX9O 1E20A 2C97A 2F3PA 2EV9A 2QJOA 2R79A 2XWPA 4O4IA 3NNSA 1RPOA 3QEMA 3CWZA 1T5BA 4XYEA 5HE9A 2H1RA 2V4DA 1I9GA 2W8BA 2WAOA 5BURA 1P8JA 3KSAC 3UA3A 5P21A 3X2SA 5BNTA 4WK2B 2BFFB 3TQIA 1E4EB 3ZS8C 3LBFA 2XITA 3CCVV 3ZWMA 1JU3A 5CLQA 3VSCA 4BRZA 1FSGA 4E33A 1GXSA 2C31A 3TRJA 4Z1OA 4C0KA 2Q5QA 4FMTA 1P19A 2HU7A 2P2NA 4LYJA 1E2NA 3TJMA 5EJEA 3CNLA 3LECA 1EDOA 3NTVA 4F96A 1FLNA 4Q34A 4CQJA 1TJYA 3P2IA 4LP8A 2BMVA 2DQ0A 1GZSA 2F9MA 2J31A 3MQ4A 4HFJA 3VM6A 4C04A 1Z74A 1DO2A 4CL3A 4OBEA 1HEYA 1E1DA 3JQBA 3PC6A 4LI3X 3M81A 3AFMA 4RQAA 4WCFC 3OZ7A 2A6PA 1KH3A 2BFAA 4H4EA 4K86A 1P1HA 1PQYA 4AURA 1VP9A 4EIWA 4GRDA 1J07A 3U44B 4DV0O 3PGA1 5L7WA 4NBVA 4AI8A 2Z57A 5HS6A 9ABPA 2UXBB 1IQRA 1ZC4A 1Y33E 2X6BA 4DUYB 2JFHA 1P7GA 3BZWA 3DO5A 3L8CA 4TMTA 3M3DA 3UA4A 2ZRLA 5B7NA 5C53B 1VQ9V 4X84A 5A02A 2CHGA 1K0UA 2ID7A 2VBCA 3IOYA 2ZXEA 1BO6A 1IZYA 1NOIA 1QYVA 4A8JA 4AMBA 2CMGA 3SXPA 4E94A 2XGJA 4EF6A 1NXVA 4QM6A 1N3BA 2XHZA 3PT9A 1HM5A 3ZRVA 3G6BA 2AEEA 3VGJA 3VAZA 1NQTA 4Z0PA 5EJ9A 1DJQA 4GG1A 1U5BA 5KKAA 1CIJA 1YL5A 4J0KA 4QDJA 4F04A 2HEGA 3H2KA 4BMVA 2ZK7A 3G8DA 4K0RA 1BZKA 1Y3FE 5KSYA 1BQEA 1IZZA 1IBSA 2E48A 3M33A 3OCUA 4L15A 4O3FA 1FDUA 3DW1X 1U2SA 4LMRA 4RZSA 3IRVA 1SO8A 2FOLA 2XODA 4JT2A 1NKSA 1JQEA 1QFSA 4MS3B 3N6XA 4D56A 3MB8A 1C1YA 2DBVO 4DN6A 5KI6A 2Y0PA 4AM8A 4LY3A 4NK4A 1XR3A 2PS0A 2V8BA 1R74A 2Z2JA 5AKHA 1Z2PX 2BLLA 2R6HA 2G1JA 4MVJE 2A33A 3FR7A 4US2R 2ZVJA 3RCBA 4CC5A 2I91A 3VKGA 1I7FA 1YL6A 1J5EO 2ZZKA 4QNMA 2Y0DA 5LZ2A 4BFSA 2Z3WA 4IFEA 3TD6A 1F8XA 1SBNE 1SQSA 1WZEA 2ZRFA 1DKRA 3BJEA 4R5MA 2I67A 4V0RA 3RABA 4X8AA 2YIBA 2DKNA 1SZXA 1QPBA 4WEQA 2ODWA 2B4TO 1BKDR 1CW2B 1RYDA 2BJWA 2OO7A 3A6JA 3G8YA 4HUJA 4J2TA 4LJ7A 1L4GA 3A6FA 2HKOA 4LFCB 2C8KA 3C2QA 1JJFA 1DAEA 3CSUA 5DRTA 1UBTS 1AKRA 3BWDD 1QF6A 1KI7A 2ZJAA 2B82A 3L6BA 1OOEA 3D4LA 1W47A 2Q0QA 3WFZA 2OV6A 3MA0A 2EKDA 3H5RA 1RBMA 1KEUA 2QN9A 3NHJA 4G86A 3SXUB 2B30A 2X1LA 1WPXA 3DT6A 3X2EA 1DDIA 1LRJA 5A3QA 5EZYB 5HG0A 3WFJA 4YRBA 2BWJA 3IVGA 1YCHA 5EXTA 2XOEA 4KW7A 3CO0S 1VEWA 1X80B 2ERYA 3NEPX 4WNAB 4EB8A 4KFCA 4P0QB 3ZCRA 1DAPA 2YFKA 3GAMA 1W6RA 2UZ1A 3IQEA 3OHPA 4XEUA 1W0JG 1S96A 4L57A 5CYGA 3PENA 3DPIA 3TS1A 1NDUA 4TV8B 5CVTA 1DGSA 1Z3CA 8ADHA 3R20A 5FBHA 4NG4A 2X6RA 3UQ8A 4ZCRA 4Q93A 3EPPA 4EF4A 1NVKA 1GSAA 4NECA 1KDZA 4DV6B 1B43A 3F8WA 4MGIR 4CF7A 1WKBA 2BEKA 3HWRA 4RPGA 4YJFB 3DE5X 4UHKA 2H6EA 4NV1A 2CL6X 3LIPA 3ZRXA 3RARA 1YAHA 4IH4A 4CEJA 3IQDB 1ZQ1A 3C3CA 1C9KA 2VDNB 2Y1KA 1NAHA 3GA7A 3MJRA 4K6OA 4Q4DA 2CF5A 2HK7A 3DTVD 1R3JC 2ZYAA 2IV7A 4QRHA 1RWWA 3CG0A 2JH9A 3PSAA 4CLEA 1S9HA 1EK2A 1PG2A 3I9LA 5F51A 4KHPO 2WIBA 1UPBA 3X1ZA 2C4MA 2HHLA 1WUTA 1BFUA 2OQIA 2JHFA 2P9TA 5IK2A 1MJ5A 4EPRA 1L8AA 2ORYA 2GCOA 3K79A 1JIVA 2C5FA 3RQSA 3WLPA 4DNFA 1V37A 3CCBA 3I8OA 1IZ0A 3SZOA 3QMMA 1EYZA 4AU1A 1E99A 3FI0A 5CXSA 4K6MA 2PLNA 2ZCJA 2YIAA 4Q3AA 1TTQB 3EGCA 4DA7A 2QLNA 1Z5VA 1Z6XA 2QWRB 4KN9S 3Q3HA 3FBGA 4QBHA 4G5GA 3MTJA 2OYQA 4F3KA 4X60A 4YJGA 4C5AA 2QNIA 3UPUA 4R2JA 2HB6A 3OZRA 4L8YA 4Z9AA 2JGEA 1E2UA 4GL2A 1J09A 1SUFA 1U28A 4B76A 4CQLA 3IL2A 3H1AA 3HU3A 4MS1B 3F1KA 4UVDA 2O4UX 1PFQA 4MVJF 1G5QA 5ITZA 2FDXA 1NHWA 2FSGA 3E9MA 2DLDA 1IBLO 4JBXA 2PLAA 4F0JA 5AXDA 4EL0A 1TM7E 1IRIA 4F8JA 3NUZA 1YDGA 3UAOA 4NOMA 1TUBA 1E5XA 1LPSA 4DCGA 4O3MA 4C5CA 4BVEA 2RB5A 2JCBA 4CDRA 2YIVX 2Z1DA 3ZC3A 5IY5C 3LUBA 4WESB 2WVAA 4UPEA 3OZUA 3T1OA 1SKYE 4BFUA 4P6VF 5JXWA 1PLLA 3BHJA 1LTKA 1XK7A 2GZDA 3GMTA 4IF4A 3WV5A 3U09A 2GLTA 3K0GA 1XMOB 1NVAA 2R8ZA 1U7HA 3L82B 4E2XA 5CK5A 1SD2A 2K5UA 2VTDA 1N6KA 4DWJA 2W71A 3K70C 1XZDA 1G21A 4TKUA 4BQSA 1WD7A 2P9YA 4XIYA 4HMPA 3KETA 3QLUC 2JGKA 2I4TA 1WXDA 2FP3A 4FLXA 4H6XA 3CLSC 1WAMA 3N2IA 4FYIA 2F3RA 4O4HB 1T4GA 4U7TB 3T5CA 4MNTA 2WLHA 4OAOA 1MZVA 5CFRA 4UXNA 3ORFA 4XX0B 4LK3A 3GWKC 1MO6A 2PTHA 2VKTA 5AI8A 3LYHA 2P41A 1OLXA 3NTLA 3UJ3X 3AHCA 4IVRA 2O5EA 4UHBA 4NYJR 1V96A 1E4VA 1JDBB 2B3TA 2ZXFA 3BKXA 3I53A 2J30A 1RRCA 1KA9H 3T3EA 1XILA 1NT2A 2VAXA 3KAQA 5C8YA 1X1RA 4ND1A 4PTZA 3GFRA 3O47A 4GGPA 1MAWA 1SXJA 4V38A 4QTUB 2O8EA 4LWPA 4U2BA 1Q7TA 1KJWA 3SC4A 2CXPA 2IYTA 5G1OA 2AN4A 4EB6B 2ERXA 2PTGA 3VR6D 4NOLA 1EM6A 3WYNA 1JLRA 1XKXA 3VV3A 3T52A 3VQXA 4RIIA 1YASA 3CVOA 3EVFA 1E1CB 1QE3A 1PJ4A 2JFWA 4UVAA 1FNMA 3DE7X 4LF7B 4H4CA 4ILKA 4J3JA 4BP3A 2NACA 4HT3B 5A06A 1Z7EA 1H0KA 2BE7A 3A6PC 3LRXA 4YP7A 5TVKA 2ZYGA 4Z3DA 2UZ4A 3TKAA 5BSMA 4OP1A 5IJ0B 1ARZA 5IH3A 5KDLA 2BGKA 2XJ9A 1E0DA 5BN3B 3NHUA 2BMFA 3G02A 5AVTA 5DGXA 4TTSA 3O8OB 1B41A 5IDQA 4L5CA 3SP1A 4YUAA 1XTJA 3VAYA 1NVVQ 5FJIA 5JECA 3ZIAG 3D6AA 1XZGA 1H69A 2CB9A 2WBLC 3EFHA 3Q7SA 3G7SA 2JHCA 4QARA 2FAXA 2JIZA 5KTSA 4IV8A 2QZ4A 4RK6A 5IS2A 3DSQA 5JO9A 3LBNA 2QTFA 1U0FA 3DL2A 3IPCA 1V4NA 4IJVA 5AVJA 3NASA 3RS4A 1FX1A 1JKJB 3GGPA 4Q15A 1AUOA 1JQDA 3CH6A 4LZNA 3SOPA 3ND7A 5KJ6A 2RHRA 4EYSA 3UKOA 3ZY5A 1WCV1 1FFHA 3B85A 3EQZA 2YWRA 5FOXA 3OQVA 2BMJA 5FUVA 3SC3A 3GVCA 1CERA 1JA1A 1QQ7A 5IKPA 4HNAB 3DZIA 1SQPH 3KP1A 3UXYA 3A2MA 3A2KA 2IS1A 2JZOA 3RVSA 3TE6A 5K0LA 1EVJA 4HJRA 5FO1A 3A1DA 4P83A 1M1YE 3MYYA 3KXPA 1P81A 4I2VA 3GDWA 3NANA 4IOKA 4JP1A 3KUKA 2RE8A 4BQPA 1UKYA 3OW2U 3DEFA 4IXDA 3OMIB 3U0VA 1L5RA 3G67A 1FQKA 2XDYA 5KUTA 1UC8A 2DPGA 1GG2A 3GCWA 3LFTA 1YI0A 3DOEA 3M4ZA 1XNRO 5HIIA 5B57C 3F49S 1SK9A 4L4SA 3EC7A 3FUWA 3IKVA 4FMPA 2UAGA 1QO7A 1YT5A 5KOHB 5F35A 2RN9A 4XWGA 3RAFC 2GLUA 5ECWA 1VMEA 1AS2A 5FUQA 4M89A 2VJYA 3ETHA 2GCOB 2EVWX 2IOHA 3M8KA 5DN6G 5AFSA 2G1PA 1L9KA 3RSFA 1B0UA 1X3SA 4MYUA 1ISRA 1JYSA 2V0CA 3QXXA 4NV0A 4XCQA 1KETA 1Q84A 4Y3UA 4BP8A 1CJMA 4EY5A 3GRRA 4Y0NA 2VQSA 4DR3O 3R4CA 3ZWVA 3N5KA 5LA6A 1SVOA 1FP4B 1G3UA 1QFXA 1ZWLA 4KO4S 3ASNC 5HMLA 1F2UB 2X5NA 2CTPA 4DQLA 5FB3A 4EPWA 3UV3A 4WEOA 1XRMA 4F21A 1A9XB 4CKYA 2EP5A 2OBFA 2OCDA 2VUIB 1N2CA 4RHXA 3VX4A 4R50A 2OCKA 2XMZA 3QFFA 3TW6A 5C8ZA 4HZGA 1O9HA 5LZ5A 2PA3A 4PBSA 3K08A 1M1YA 2D00A 3O4VA 2ZR2A 1OXSC 4V03A 4EPVA 1R6BX 1DK1A 5EC8A 2ODAA 2C99A 5ITZB 1S77D 1P45A 3C6KA 3WISA 4BGEA 2K87A 1XP5A 3DFFA 4FJ0A 3IXQA 3LM8A 4HAZA 2PX3A 3QEAZ 3F71A 1SXPA 1Y6GA 2REXB 3GUVA 4QUIA 4E12A 1BXGB 1Y7TA 4X24A 3ZV4A 4LBZA 1AKVA 2GJSA 3LUHA 1FDVA 1GUBA 2BM1A 3WK7A 2FYTA 4CIYA 2CNBA 5HM8A 1JEYA 4PQRA 4BPRA 4YRMA 2XUKA 5GM2A 3FYCA 4XQEA 3ICCA 4RD4A 3CVVA 1ZUQA 3ABLC 5LMUB 1PR6A 1QRAA 5JROA 3OY7A 1NJSA 4RTKA 2AX3A 3MINA 4GZMA 1TCAA 3VISA 1QK5A 3KM0A 2G25A 3EZFA 1L5YA 2IXTA 3D8NA 5KYVA 1ETUA 1ECJA 1AKEA 4TV9F 1PNVA 4QIWF 1LX7A 3I83A 4H6VA 3M6AA 3TCUA 1K7FB 3DVSX 4L8FA 3RSCA 4HL6A 2P1ZA 4FTWA 1FTYA 4XQCA 4LF8O 3RIMA 3TEFA 3VO9A 1H8HD 4IGIA 1FCJA 3ZE1B 5G0UA 3RVOA 3EXAA 4MTFA 5F2VO 4IRUB 4LXIA 5G1PA 2Y0BA 8MHTA 2ITCC 1GPWB 4B2PA 4RV9A 3CLTD 2Q5IA 1RMYA 3HN6A 2ZI5A 4U6NA 1AA6A 1XTTA 1W4ZA 3VUEA 1ZUIA 2NLJC 1NT2B 1GCGA 1L6RA 1EAMA 1NN3A 2RI0A 2ZDHA 3AG6A 3EDRA 2FWRA 4QIHA 4MVCA 3EEQA 3K9CA 2P5YA 3BQNB 3F6EX 2I03A 4TV9B 3LDGA 3OT1B 1VF6A 1E6LA 3F6BX 4Z7JA 2ZM6B 1FMTA 2HCFA 4H18A 4YH1A 1E1CA 2IZ0A 4N5MA 2H59A 5ALIA 3VV2A 4BN4A 3RIHA 1ZK1A 2ZJYA 3NHAA 2A86A 4LOKA 3T9CA 4DIBA 4EUFA 5A3SA 1QU2A 1DXHA 4E1AA 1ZFNA 2PU5A 1EG2A 2QLBA 4EFLA 3R3SA 3AK2A 3AP1A 3FKSD 4G5YA 5K0GA 1HZZC 3U4CA 1A2QA 2JGLA 4TSKA 4FE4A 4B7UA 1HZZA 4OYRA 1IBKO 2CL7X 3ETDA 2F4NA 3WQBA 4XWOA 1EDZA 5T6MA 5EMJA 5BN3A 3NMUF 1VMDA 3N7AA 1YFJA 1Q0LA 2G77B 3B9QA 1XBTA 2J9FA 4MRVA 3X3HA 2OB1A 3UK1A 3DQZA 3EXEB 821PA 5JZMA 1LLUA 4B09A 5JARA 2ZRAA 1OLUA 3KAPA 4JGBA 1NRJB 3J7AC 3K3PA 4V0LA 3DUFA 3LY7A 3DBHB 5BSGA 3DAHA 1LPMA 1FJGO 4M86A 3RREA 5A6VA 4NCBA 4ZYZA 1NR7A 4KK3A 3GJXC 4DK0A 1RYEA 1T5HX 2P9ZA 1MUUA 4LRQA 1V8DA 3ELUA 3D1JA 2IHUA 4MAAA 1TYAE 2ZEJA 4LF9B 2JGNA 4PLYA 4PQFA 4OX9B 4YCAA 1JR3A 2XMCA 2A30A 2P7IA 4BUJA 1OASA 1X8JA 1Y81A 2OGUA 4JITA 3O8BA 4YECA 5CU7A 1EB9A 4XWAA 4BV2A 3DEJA 1SUPA 1DQSA 4HZUB 4EJFA 1N2ZA 2DTEA 2EL9A 2UYHA 4N7MA 1MPXA 3WHIA 1UBKS 5LQKA 1WEHA 4BIIA 5AI5A 4EKIA 4HNAA 3PJSK 3MK31 1DC8A 4C4PA 3A9RA 1Q74A 2I66A 4UUAA 1E0JA 2FMHA 2R1VA 4ESHA 3JQ8B 4ZEVA 3ICEA 1EGHA 2BE9A 2VWPA 2OIEA 2RCVA 1ZM3A 2WG0A 5JH7F 4X65O 1OV9A 1JLKA 1D03A 3IUEA 4LCJA 3TLCA 1TCVA 2ZRHA 4FEYA 4EGAA 1DT5A 1T34A 4KYVA 4NWIA 4HAIA 3LGAA 3VKUA 2XHEA 1YB7A 3A3OA 4DMGA 1SBIA 2AI2A 3K5PA 2SKCA 3QLTA 1P29A 4TT3A 2QA4V 2CNWA 3JQAA 2A4KA 3PFGA 1ELOA 1COZA 1Y1TA 2H92A 2ZBRA 1SUIA 3HR8A 4I0WB 3BDAA 2WQ7A 1CY1A 1HDCA 1Q7RA 2HJHA 3I9NA 1KEKA 2FX2A 4HWPA 1IHYA 1RC8A 1LVUA 2GPAA 3HVIA 3F4LA 2H1IA 3Q2IA 2TS1A 2AW9A 3PFBA 3ZJ4A 5B1OA 3OEHD 3E15A 1HF3A 1YZTA 4IV5A 1NTOA 4HH1A 4F4IA 2VLBA 4ICIA 4OXNA 4ZEOA 4OPAA 4I9NA 5E8JA 3RHZA 3NV7A 1LX6A 1KK2A 2LGWA 5AM2A 4PHFA 4RTLA 3NOXA 4X1KB 1FX0B 1KAOA 1OI3A 3WLMA 5KYWB 2HG5C 2HHCA 2ZSIA 4V0NA 1GTRA 3HRKA 1RCUA 4G0YA 4MARA 1O7JA 1A9XA 2RG1A 5IRCD 3C3PA 3GIWA 1Q77A 1VL8A 3PBKA 1QX3A 3I42A 5LLSA 3WIEA 4MJXA 1RJ9B 4CTMA 3P30A 1U90A 4LQDA 3E2MA 2NXJA 1IBRA 3GMSA 1SWVA 2BZGA 4PQEA 1UDWA 1XRQA 2CZQA 1H5QA 2VQEO 1H1LA 3ESCA 3KQOA 3O2SB 4YJ2F 2RHBA 2DFKB 3BJRA 5FQOA 3AHDA 3RUIA 3ZWYA 2YNMA 4DMFA 3ETJA 1SULA 3JZDA 4KIUA 3V2UA 4NZ9A 1CJBA 4TRMA 2QNRA 5DM4A 1YZHA 2HU8A 3EDQA 1T3ZA 3EIXA 5GJVC 2ID8A 1UT8A 4RMNA 3OEHG 2BFDA 3RSZA 4HEA6 3H6HA 4FLEA 3H42B 3KUCA 3L0PA 3UT6A 1TCUA 1ZVVA 2DOSA 3VJRA 3FNQA 2XKJE 1NL3A 221PA 2JLWA 3G0GA 3DB2A 2G1UA 3ZKWA 2ILTA 1LTHR 4V0ME 3RT9A 2PD6A 1EWTA 2VWHA 4U6SA 5JALA 1FRZA 3PXEA 2QD2A 1JJVA 1PR4A 4IVNA 1ZGJA 2W7TA 3D3WB 3U31A 4D1YA 5JCJD 3OEEG 1MZPA 1RRKA 3HVKA 1TK3A 4QUBA 1DEHA 4NEQA 4MVJG 4UDNA 5EQJB 2ERCA 5DNWA 5I8PA 2JGJA 1PJLA 2VP6A 2A9HA 3I8SA 4G07A 1IMJA 3CNBA 1V16B 1XRSB 4HVAA 3RVJA 1T3HA 1Y5NA 4OU4A 1QAQA 2WSIA 2Q4EA 4Y6OA 3BILA 4MJLA 3G23A 2LVBA 4MVJH 1MO5A 4ZT2A 4UVCA 3PXCX 4WIAA 1LLCA 4RLHA 1NVPB 2WKPA 4P4UA 3I01M 4NTYA 2PLRA 2PZLA 5JANA 2PRIA 4I55A 4WK6A 4QAJA 1RTKA 5D51S 2J33A 4Q3KA 3FH0A 1MIHA 1AUVA 1M1NA 2SHKA 3LHKA 4EW6A 5A3JA 3CVXA 1CUZA 3JS5A 4I3GA 3ZVNA 3VSBA 1YRAA 3OT1A 2GASA 2QD1A 2QN6A 4DCJA 3LUPA 3L04A 3QWBA 1PN3A 4ZU1X 3G89A 3R7FA 4G84A 1IUNA 1C7ZA 2PK3A 1T35A 1F6DA 1NXPA 3WL8A 4E08A 2GD1O 3PX7A 3HGMA 3ZXYA 1E77A 1EK5A 1NF2A 1PW5A 2HF2A 3MRVA 1SETA 4NVPA 1SCBA 4F71A 3OWXA 4FPXA 2WOJA 4B45A 1RYHA 1M75A 4L85A 2F4VO 3SQLA 4KPYA 1AP6A 2OGWA 4AROA 1TT7A 2J9FB 1AIPA 2H7YA 1UXKA 3OVMA 1VXRA 2BEVB 3WGHA 1N9GA 2QXYA 2Y1EA 3SMQA 4ERNA 1PGJA 2HIMA 7MDHA 2W6IA 5KNDH 2YMPA 4M1TA 1N0WA 2YHAA 2NQ8A 3HUEA 4JBIA 1VGVA 5TPWB 3FYDA 4E5SA 3OZIA 3C6XA 4UJ3A 4EG7A 2WF9A 4UULA 5A0FA 4OXIA 1YJNV 5TMBA 1A9SA 3U7JA 3OX2A 2PPLA 2QJRA 3PQ3A 3ROZA 1KO7A 4IGAA 4TSFD 4FD2A 2JCGA 4L5YA 4X54A 4TKZA 5LM3A 4MYDA 1ENVA 1SBYA 2QE7D 3ACCA 2YXNA 3QPCA 2L0XA 1QDLB 4HBGA 1QYIA 1VPTA 2O2YA 4NCHA 1RPTA 4RL6A 1Q0TA 3UH1A 3EMKA 3R9WA 2A5JA 1FKAO 1U8TA 2QKCA 3FLBA 4QHSA 1YC2A 1BYIA 3X1YA 4DJFC 1G20A 2EZPA 1DHTA 2ONZA 4Z7NB 1ZH6A 4EI9A 3THOA 5IAOA 4UAVA 1NJ6A 4GGOA 2XQJA 4X88A 2O3UA 1HNZO 2ASEA 2VC2B 2Y4OA 1N7JA 3V3KA 3WNCA 4GRIA 2Y66A 4Q3LA 2D0IA 2AA3A 4G97A 1BOFA 3EUFA 4PPNA 3K9LA 3BCRA 4ARAA 4DIMA 1XPOA 3GUYA 4BNDA 5BYJA 2ODBA 4TMZA 4D9EA 2VOJA 1P2FA 4FOSA 5JASA 4FB4A 4B46A 2VQ6A 2I65A 2YV3A 3JQAB 3EGXB 1Q0RA 3KLMX 2VWKA 1OXTA 3RS7A 2PGJA 2ROQA 2V7TA 4N12A 2A9RA 3BVOA 2BGLA 2QS9A 3C1AA 1N2JA 3IEPA 3PKJA 1QZZA 2EW8A 3OA2A 3SYMA 1L4BA 4PAQA 4D5EA 5ARCA 2K4MA 1LF5A 3NPMA 1ZESA 1KMNA 2D5LA 1NVTA 4JMLA 3DDSA 2P35A 4OFXA 1DAKA 1EFHA 4Y2TA 1ML3A 5JC1A 1QR8A 1BNCA 2CNNA 4AMZA 2HOQA 2ILVA 4KLRA 3F78A 2CV0A 1NY5A 5BWBA 3DFIA 3F3SA 5TT0A 3KYBA 2PFGA 3F4BA 4CNQA 4GBED 2AG5A 3L71H 2YWJA 1WW3A 4FYYA 5EZYF 1PP9H 1OLSA 2R7KA 1RJ9A 2OEPA 1FDWA 1TYEB 4YUWA 1A2OA 3ROPA 5FOSA 1U0NA 1RAAA 2XADA 3GVHA 3OP4A 4LF7O 2PANA 3P7MA 1ZSVA 2R96A 3H2SA 1NYRA 4JQCA 1JDNA 2HV9A 5EQFA 5JXHA 2EP8A 3SY8A 3HBAA 1D7AA 2XB4A 2Y0CA 1FXKC 3AHIA 3FFWA 3OU7A 4HN9A 4A5OA 3MCTA 5LP6F 5MFPA 3EHEA 2XOKA 5U9CA 3CMCO 2XBMA 1KRWA 4YCNA 3H16A 2IYYA 1UJNA 3ETLA 3RRXA 2J7PA 3FMOB 2KWIA 1OIXA 3RYFA 1ZD5A 3WS7A 4BP1A 1YA6A 1JDBC 1KYYA 1T9HA 4JUFA 3DBRA 4UTNA 4UMFA 4B71A 2EF1A 4NNOA 1GRCA 3NC1C 1NBMG 1QGAA 2I6FA 4KPGA 2AF4C 3OF2A 1LRKA 4MMZB 1O8BA 1YZ3A 3OTIA 3KOWA 1GQRA 1FRVA 5B1AB 4CM8A 4V2UA 3GLHA 5J4YA 5BQ3A 1JPJA 4O2AF 1N2XA 4N0DA 3BA9A 1GQFA 1UJ2A 4UU7A 2C2AA 3U61B 2RSLA 4EH1A 3E8XA 4DMMA 3JVEA 1ZRHA 4J49A 3JQ9C 1HLDA 5JAOA 3DMNA 2H63A 4MVUA 3D3IA 4W8OA 4II3A 3V7NA 3WLIA 1XPRA 1L6IA 3NHKA 3THXA 1T36B 3D3EA 3EGIA 3KE9A 1OT3A 5EMNA 1OFHA 1VHLA 1WB4A 3AW9A 3OOWA 4BDTA 2RAUA 5DPMA 1QZXA 2NUBA 1VMIA 4PC1A 4G01B 1Y9EA 3G5UA 1OF1A 1WU8A 2CVQA 1KZ9A 4CU2A 2IJHA 1PP4A 4N3CA 5FBKA 1AN9A 5KTMA 3HA5A 2HCRA 4ZQEA 2FVXA 3R7NA 4CQMB 1AMUA 2AN3A 3CZ5A 4KLAA 5U4QA 4IZOA 4YT5A 4CIAA 4RTNA 2OQVA 4XRGA 1RI2A 4LOIA 1KDVA 4X00A 2CXQA 4OQPA 3KZ1E 1RW4A 2AW3A 4RMJA 1X94A 2AWOA 5TDHA 1P72A 3LRTA 1ZHFA 1YJCA 5KYXB 1FF9A 5L7YA 3OEED 5FFMA 1VG8A 4M53A 3TQTA 4RS4A 4D79A 4JXKA 1X4TA 5IBPA 4L78A 1IE3A 2VT6A 2J9ZB 2WNSA 3EEBA 3INYA 5E6RA 3OJXA 5CDUA 2AG6A 2JLYA 4AQ7A 2Y69B 1DIHA 2EGHA 4F4JA 2R85A 4X1YB 3CEHA 3KS9A 3TD9A 1R0XA 1SQFA 3RQIA 1JR6A 2Y2VA 2DYKA 5H83A 3CLUD 4H17A 4MQFB 1EP9A 2Z8XA 3PFCA 3DTYA 2F6RA 4RADA 4A5UB 3PCTA 2BZ0A 4UNQA 2J0VA 1WLYA 5AW0A 1TB4A 1K5GA 1J06A 3DP9A 1N8NA 1JB1A 1P2VA 2R8PA 3QKUA 4H7PA 4V0OA 5DHQA 1JEOA 1WQ1R 1SG0A 2D1SA 3W79A 4DPKA 1K98A 5A4DA 2NADA 2UZ3A 2O59A 2XVAA 3JASA 3IXLA 1RBZA 1YR7A 2VBGA 3LU1A 4PELA 3EXIB 2AZTA 2BBSA 4Q5IA 4RCVA 2N9UA 1O95A 1XFDA 2WB4A 2GJ8A 3OTGA 1OU4A 3D0OA 3D3KA 4CMJA 1U8AA 1C3OB 3BE5A 1RKXA 2DWQA 3LOPA 4L07A 2VQDA 4KEAA 3EC2A 1T9ZA 3EEYA 3W5DA 2Q2WA 5EYPA 3A0RB 1K7DA 1UT5A 3DCYA 3PPWA 4LRUA 4QL3A 3AG1C 2XDQB 5G3ZA 3ROGA 4PC6A 4R1UA 4C1NA 1KTVA 4KIGA 2WU0A 2ZT7A 4YR7A 3FGPA 1L8XA 2R72A 1DRJA 3JRWA 3KWLA 2FR8C 3P71T 5AM1A 1ZNQO 4Q21A 2E85A 2FEOA 1UMCA 2GA9A 2JI4A 4OB6A 4QUJA 5CW2A 2NZJA 1QX4A 1TEVA 4B8WA 2IXAA 1ZGBA 4CFZA 5JVDA 1DJLA 5LMUO 1ZJJA 5E6SB 1AQ6A 2CZCA 4UU0A 3TRDA 1TAGA 1QBGA 3NXSA 2FP4B 3ZWOA 1BSMA 1SC3A 1V0JA 5DBHX 4WWHA 1Z2NX 3IO3A 3IOEA 1C7QA 4PZDA 4HB2A 3CHXA 4WOPA 1QTIA 2P1RA 1E7YA 3KEOA 4NYIR 1GZUA 1VBMA 2P9JA 3ABOB 1A5ZA 3LC1O 4A7PA 1NTZH 2RBKA 1UK7A 1AKWA 1YBMA 5GZ1A 4KQKA 4GPTA 1N1GA 1P8AA 4NFHA 4YUXA 1OTXA 3FCSB 3G88A 3DD5A 3AG3C 1R0WA 3EQ7A 4KAXA 1JR2A 3O4FA 2B9VA 4C07A 1H5NA 5LMZA 2PPVA 3V3TA 5EJFA 2C4NA 1RZRD 4C6SA 4PANA 1U02A 5G2OA 3R3VA 3RTAA 1EFVB 5E38A 5DGHA 1K8RA 4PDVA 1KD1W 1Y5RA 2ZE7A 3QQPA 4JJ7A 1OLSB 4JLJA 4RJJA 1G66A 1H8ED 2PUHA 3KYIB 3WLSA 1E2EA 5BV8A 5KOJA 3L1KA 1ZD3A 2IY9A 1OZAA 2ZM6O 2ZCEA 3ZZUA 2QLFA 3M8AA 5TS2A 3FB1A 3OMWA 4G1EB 4EFMA 1UEIA 4NZMA 2XAHA 4RORA 4X94A 1XELA 3WLTA 3RV3A 5EHZA 5NULA 1GPYA 3E03A 1YR1A 3N1UA 4IHAA 4Y2QA 1ORWA 4UBKA 2P7TC 2UXCB 1VLLA 5B58T 5IF3A 4ZVOA 2QHXA 3ER9A 3T4DA 3IEMA 1Z63A 3TK1A 4NB5A 2PT5A 1VP7A 2B1IA 3BIWA 4INOA 3DOIA 4P7JA 4D4IA 4OU5A 2IY7A 4IDAA 1P3Y1 3SM3A 1H5UA 2PT9A 3ZLBA 3PQ5A 3DBRB 2FFQA 3DL0A 4JGSA 5EIBD 3CKLA 3Q4GA 4JI3O 1BRMA 1MT0A 1BWRA 1Y3DE 4FD3A 4H16A 4X8LA 5A71A 4G28B 3IBGA 4CZ2A 3DBLB 1CS0A 1SZJG 3ZK8A 3SG0A 4FM0A 1YK1A 3OZXA 4MZDA 3FLEA 1E2QA 5AOAA 4B1FA 2C5AA 3LX4A 4MW9A 5L3CA 3H05A 5IARA 4D3YA 1RCFA 4F6LA 5BRJA 1GMGA 1GVHA 3JCZA 2PR7A 1YRWA 3V1LA 4DCOA 2EGUA 2BVNA 3QPVA 2KSQA 3JYHA 1F9AA 1SGWA 1T1SA 3NKFA 1BRTA 1X7XA 2JH3A 4WNCA 3RT1A 1C9NA 4X6UA 1T36A 3Q88A 3T95A 2DHDA 1KYZA 1O97D 2CV1A 1COWD 4BNYA 4CMCA 1DRUA 3IKLA 1QH8B 3ZWNA 2OZEA 1A9QA 1FNCA 1M5TA 3JW8A 2GPSA 2JIBA 3MUNA 4IDGA 2CLEB 1GKYA 4IWXA 5FTJA 5T3UA 2QGNA 4HUQB 3R7LA 4CF3A 2C2OA 4HLCA 1QRRA 4EVSA 2A1TS 3OETA 1CP3A 2RHGB 2OO3A 3OOYA 3H1IH 1WCXA 3ZDYB 4S1PA 5JYBA 3UHAA 3X1MA 1SKQA 4JQYA 4QUAA 4MVJI 1T9DA 1LDEA 4FLVA 5GVRA 1U2RA 1V4BA 3CCLV 2EKQA 1J7KA 1UC5B 2VXYA 4TXMA 3RUPA 4HNTA 3BJMA 2XDAA 5BORA 3BJIC 1LDBA 2VA9A 2X23A 4PZCA 2HDNB 1K7EB 2DR0A 3D3JA 5A4KA 5DN6A 2XVYA 1Q95A 3NIBA 4BO6A 4BWAA 1JG2A 5KSPA 2Z8ZA 3QWFA 4N0MA 4E3ZA 1B8VA 1KK3A 2O0JA 1R6AA 4TRJA 5FBLB 2QMZA 5FYDA 4BKPA 3B36A 4AUMA 5EY5B 3PUWA 4X1YA 1JHAA 2WDZA 3Q3EA 3AFOA 5KX5A 4FGWA 4GVXA 5ES4B 5C8XA 2BCEA 5JFGA 3FR8A 4EO9A 4ZVMA 4MQFA 3RK0A 2I7TA 2I7CA 4KZKA 3IAYA 2IOFK 1DJMA 4CR7A 3MWDA 1HLGA 1TYZA 2BEJA 1W44A 3IV9A 1LZKA 4FW8A 1WVMA 4P38A 4S1WA 1E9BA 3VR6H 3ORQA 4YV1A 1FNDA 2JLBA 3IV6A 4CM8B 2WU8A 3OCJA 1GPAA 4JROA 4TMVA 5BSRA 3O7WA 3K94A 1SVWA 3L7LA 4A92A 1YQGA 1GN3A 1ZM9A 3GJ4A 3KYCB 4BVLA 4JLPA 4V1CB 2GCGA 3QELB 4A27A 1N0NA 1UPGA 2W6QA 3AF5A 1GA4A 1Z6ZA 1ZUWA 3I5MA 4WW0A 1XL1A 4OGQB 1UBFA 5DYGA 6GPBA 4XWKA 5LMNB 4JBYA 2L42A 5JRZA 4JU9A 1E1RG 1SQ0A 2R87A 4CEIB 4AWBA 3O84A 4YAFA 1E66A 4DCNA 4HQNA 4FUQA 4JVNA 2R11A 1R5BA 3T7IA 2OCLA 3E5RA 1NIPA 4DM7A 4O4LB 3PEWA 4XD7A 4OHWA 2B2CA 4N3NA 1Z2DA 1OUMA 1Z34A 1MZEA 2EIJC 1NWCA 2G4LA 1YUNA 1ZH4A 2HSWA 3EN0A 3I28A 3QKSA 5HE8A 4NONA 3E0QA 3ABIA 2ZUWA 5IDJA 4LXXA 4NXMB 1KB9F 3HY6A 4FU0A 3RVNA 1NBOA 1NRIA 2WPNA 2XT6A 2GAFA 1T1IA 2KQUA 3KV1A 1T6ZA 4P5EA 1Z8HA 4WX2B 4QQFA 4BLQA 2Z6QA 1F7VA 5KHKA 4LRYA 3KDPA 1TADA 1HNXB 1W9HA 1XREA 1WZIA 1BVYF 2IA5A 2KBFA 3AP3A 5EVCA 3ZIUA 4CM5A 4F4UA 2P4HX 4OYLA 5L4LA 1NMZA 4IILA 4B5KA 3NONA 1WV0A 2I2XB 2VN8A 3NJRA 4NR0A 4F91B 1JZQA 1C29B 1Z18A 2KM1A 5JCOC 3F9IA 3LX6A 5ALPA 1QWOA 2G0NA 1AUPA 3ASOC 4JEHA 4A6DA 1KKUA 2QU7A 4PCLA 2VRNA 1K4KA 2JIMA 3M4NA 4RBNA 2GVNA 1RJGA 3C70A 3GH1A <