1YSCA

2.8 angstroms structure of yeast serine carboxypeptidase
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
421
structure length
421
Chain Sequence
KIKDPKILGIDPNVTQYTGYLDVEDEDKHFFFWTFESRNDPAKDPVILWLNGGPGCSSLTGLFFELGPSSIGPDLKPIGNPYSWNSNATVIFLDQPVNVGFSYSGSSGVSNTVAAGKDVYNFLELFFDQFPEYVNKGQDFHIAGESYAGHYIPVFASEILSHKDRNFNLTSVLIGNGLTDPLTQYNYYEPMACGEGGEPSVLPSEECSAMEDSLERCLGLIESCYDSQSVWSCVPATIYCNNAQLAPYQRTGRNVYDIRKDCEGGNLCYPTLQDIDDYLNQDYVKEAVGAEVDHYESCNFDINRNFLFAGDWMKPYHTAVTDLLNQDLPILVYAGDKDFICNWLGNKAWTDVLPWKYDEEFASQKVRNWTASITDEVAGEVKSYKHFTYLRVFNGGHMVPFDVPENALSMVNEWIHGGFSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2.8-A structure of yeast serine carboxypeptidase
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase(carboxypeptidase)
molecule keywords SERINE CARBOXYPEPTIDASE
total genus 115
structure length 421
sequence length 421
ec nomenclature ec 3.4.16.5: Carboxypeptidase C.
pdb deposition date 1994-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00450 Peptidase_S10 Serine carboxypeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.410 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1yscA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1yscA01
4UBKA 3FCYA 4C4YA 2WG0A 1H2YA 1GPNA 2Z3ZA 5DTIA 3AJAA 4E46A 4M0FA 1THGA 3DYVA 4PNZA 2ACKA 3H18A 4Q3KA 1R4ZA 5ALDA 3QBJA 3HJUA 2OXEA 1UKCA 1R3DA 1QFMA 4E15A 3FLAA 2XMCA 1CUEA 4CFSA 1XQWA 1JJBA 3PICA 5T4FA 4W63A 1CQZA 4FBMA 2DQYA 4ROTA 1LPBB 2VQ6A 1K6EA 3Q8WA 1TCBA 4DMHA 1CLEA 1QOZA 1XZEA 2BAGA 1ISPA 2QJRA 2XLCA 3PFCA 2JIDA 2J4FA 5DNUA 5AIAA 4AMZA 3PF8A 2YXPX 5ALQA 4M0MA 1ODTC 2HFJA 4BVJA 4F5ZA 4G8DA 5AM1A 2BJHA 1R9NA 2WTNA 1CIJA 5FKJA 3VXKA 1ZGBA 7YASA 4AMYA 4DSAA 3R3VA 5I7UA 4UBJA 1XQXA 3AZPA 4DSZA 5EHZA 1VJ5A 5LZ5A 5HF6A 3L1IA 4BE9A 2CMFA 4WJLA 1DU4A 4U2FA 5LZ7A 3DLTA 1XZCA 4H35A 2I03A 1LGYA 2YYSA 5AOBA 2DHDA 4B9EA 3WWDA 1XZHA 4X6YA 3I1YA 1QFSA 4WFIA 1AURA 2ZYIA 2DFPA 3MGAA 4LIPD 4FMPA 2WHQA 1J06A 2XQIA 3IURA 4NZZA 4LXGA 1Q84A 3ICVA 3HACA 3HLKA 3RKSA 5AK4A 2B20A 5C8VA 1XZIA 4DGQA 3GZJA 1MPXA 1Y7IA 4NS4A 5LZ8A 1W1IA 1GPKA 4TGLA 5AKLA 4Q3LA 3R3UA 3BF8A 4B84A 4I19A 2FX5A 1P0QA 3D0KA 4AB1A 2ZSIA 4FDMA 3PE6A 1QIGA 3RK4A 5IH7A 5HFAA 1IUNA 5AKYA 2JEYA 1TCAA 3SX4A 1VZ3A 5IVHA 2BGNA 4B9AA 5FPQA 4Y2SA 4BZWA 4INZA 5AI5A 3A6ZA 3R41A 5K3CA 4J3JA 3WWEA 4OSEA 4LYDA 4MQLA 1E8NA 5DNVA 3EIOA 3H1BA 5CH5A 2JF0A 2OCKA 4ZWNA 5LZ2A 1OCEA 4BCCA 2QT9A 1WOMA 1EI9A 1GKLA 4G4IA 1HLGA 3GELA 4DMCA 2CZQA 5LZ4A 3DL7A 3IUMA 5JATA 3H17A 4FBLA 1C7IA 3CXUA 3ZV7A 4GHWA 5DYTA 5FRDA 4IH9A 1XZGA 1DT5A 4UBLA 5EIEA 2CEKA 3KSRA 1UFOA 2VJCA 5CMLA 2XB6A 2XE4A 2ZSHA 5C8XA 1B6GA 3CN7A 3STUA 1YSCA 3QMMA 1A8UA 3FYTA 1XZLA 2OGZA 5AO9A 5BOVA 1H2ZA 5JAHA 2QMQA 3G0IA 1LPMA 1A8SA 2JGLA 5AKJA 3QMVA 1U8EA 5AI4A 2XUFA 4I4CA 1PFQA 1G5FA 5A7FA 3LIIA 5JZSA 1TK3A 4FTWA 2ONCA 4X92A 2C58A 2ZJ7A 4E14A 1WB4A 4KE8A 1YAHA 5IVIA 1ORVA 1J07A 3ANTA 4CIBA 4OPMA 4CG1A 2XI4A 2XMBA 4BTLA 3ICWA 3TEJA 1PJAA 1E8MA 1DWQA 2XLBA 2OG1A 3K9BA 4OU5A 2BKLA 3WL6A 1HQDA 4P08A 4X97A 4YX9A 5E2IA 3HEAA 5AKHA 3M81A 4IHAA 1D07A 1WPXA 3QVMA 2VT6A 4Z49A 3OG9A 1R88A 4N8DA 4D9JA 5HFNA 5A2GA 3FYUA 4MXDA 3GBSA 2RIPA 4MJ3A 3WJ2A 2OPHA 5IVDA 3R3XA 3AINA 1CUAA 5BWBA 3D2BA 4JH0A 4QDUA 2QUAA 5AJHA 1IUOA 4U2DA 4UBOA 1LBSA 1K4YA 3EBLA 1H2WA 2XMSA 3DOHA 4X6XA 5CT9A 3FVRA 1XZJA 1XRPA 3WKCA 5A6VA 5AKGA 2BUBA 4HVTA 3S2ZA 2H9YA 2FUKA 3OC0A 1ZJ4A 1UOOA 2VEOA 1Z68A 1MN6A 1A8QA 4W9RA 4DNOA 5AI6A 1FSSA 2ZJ6A 5ALKA 1DINA 4P9NA 3VJKA 4QEKA 2RHWA 2PL5A 4WY5A 4AZ0A 3WK7A 5EFZA 3K2IA 4FLFA 3FOBA 5FP0A 1RWQA 3WKEA 4XIIA 3F98A 2GYVA 3MVEA 1BN6A 3R40A 1EVQA 1QTRA 1YA4A 5FXMA 1NU8A 3IUNA 2GBIA 1WHSA 4LXIA 3O95A 3V1KA 3KDAA 2HA5A 1GPLA 3H19A 4ITVA 4DNQA 4J7AA 1ODSA 3D2AA 3I6MA 3G0GA 1BRTA 3EQ7A 1F0PA 1QIHA 3IDAA 1ACLA 3O4IA 3WWCA 1EVEA 4Y2PA 2WIGA 1DTEA 3X3HA 1XRQA 1ACJA 4O08A 2XUKA 2WHPB 4GDMA 1T4MA 2HDWA 3BF7A 4C88A 3E0XA 5AKZA 2WIKA 3B3QA 2B9VA 4B6GA 5C81A 3DEAA 1QIIA 4HZGA 4WDQA 1XRRA 2ROQA 1UZAA 4JUIA 2JGFA 5ALOA 1TCCA 4GBGA 4H7KA 3D59A 1VKHA 1YASA 3ZWQA 4H7FA 4IO0A 2BUCA 5ALMA 4UFPA 2IITA 1W76A 1UK7A 4MWSA 2XUPA 4H18A 4J0IA 2G4LA 2DHEA 1AZWA 1VA4A 3C5WP 4KEAA 3BDIA 5JIBA 3DJYA 2PM8A 4X93A 4GWLA 4IH4A 5DJ5A 2WM2A 4H7EA 2K2QB 3WK9A 4AO8A 3AIMA 3ESCA 1IZ8A 2G5TA 4TPKA 3SWWA 3JYHA 3I2JA 1YA8A 3KXPA 4AO6A 4J0DA 1VA5A 5ESRA 1P0PA 1VLQA 4H77A 1K63A 4K6HA 2E3JA 3DQZA 5ALEA 4QWMA 2WU3A 5K3AA 1E3QA 1TIBA 4KR0A 2PSDA 1E5TA 5EGNA 2GBCA 1XKTA 1C7JA 4X85A 4FKBA 1GXSA 2C0PA 3C6YA 1CUCA 5JALA 4KAFA 2PUHA 1ZJ5A 3U1TA 1GZ7A 4BDSA 2XMZA 3GA7A 2OCLA 3FAKA 4MYSA 1W6RA 1MU0A 1ZD5A 5LKAA 1QO7A 5LP1A 1L7RA 2VATA 3C43A 1XKLA 1AGYA 3WYNA 5ALHA 5J3JA 3A70A 4N8EA 1CFJA 3BE8A 5ALVA 1QZ3A 1RP1A 1A88A 5CURA 1L7AA 2VJDA 1ZI8A 4HTAA 3H2GA 4ZGBA 4FNMA 3STYA 2OGTA 3WZMA 3HC7A 3AIKA 4B81A 2C7BA 4UBIA 4Y9SA 2VAXA 1SOMA 2R11A 4RE6A 4C4ZA 3R3WA 3LIPA 3A2LA 3NUZA 5K3FA 1LPNA 2VTVA 1VE7A 3F96A 3GUUA 3I2KA 2V97A 4WY8A 3QH4A 4G8CA 4N5HX 5JYCA 3FBWA 5A62A 2O2IA 3HABA 2Y2VA 4UUQA 4LHEA 3PFBA 4QZVA 5HF9A 2V9ZA 4FLEA 1CRLA 4BATA 1TAHA 4BBZA 5HF8A 1J2EA 1VXRA 3C87A 5IVKA 3QPCA 4QDZA 5LKRA 4BRZA 4Q1VA 1CUYA 2GYWA 3E1GA 1XQVA 4G4JA 1GGVA 3STXA 1IUPA 1XZAA 4Y2JA 4DM7A 3KOOA 4B80A 1BROA 4Q34A 5AOAA 3GFFA 5AKEA 2RONA 1JJFA 1A7UA 5ISMA 3ED1A 2JGKA 4X3CA 2WFZA 3I2GA 3W04A 3CCCA 2CUTA 5ALPA 5KBYA 1GQSA 1HPLA 4ZREA 5LZ9A 2Y6VA 3FYUC 5AM5A 3SK0A 3PI6A 2PUJA 3F8SA 4IH1A 4J0JA 3L1HA 4RPCA 2OGSA 3D4LA 4KRXA 2WFMA 4J03A 5H3HA 1E89A 1XLVA 1SCKA 3MUOA 3W05A 4X6UA 3ZLVA 1QIMA 1CVLA 2WTMA 3DKRA 1BCRA 4U2EA 5CH3A 1MJ5A 3DYIA 1LZKA 5AOCA 5ALSA 3NOXA 2JGEA 5AICA 1HDEA 3M3DA 1P0MA 5DYYA 3V1MA 1VE6A 2X8BA 2LIPA 2VJBA 4OB6A 4X7BA 3WK8A 4J0KA 4UHCA 1R1DA 4FWBA 2C5FA 3K6KA 3A2NA 3M83A 1LPOA 2PSJA 1EB9A 4RNCA 1QIEA 5I8PA 4IQ4A 4ETWA 1USWA 5AK6A 4KE6A 1DWPA 1BEEA 5T4BA 2ZYHA 1XZFA 2PBLA 4AN0A 5A7GA 4K6GA 2XDWA 1LPSA 1YCDA 3I6YA 1CQWA 2I3ZA 2J3DA 4JEIA 5EHNA 2OQVA 3G9ZA 1E8DA 4I3FA 4X91A 2WG1A 3D3NA 1JMKC 1N1MA 5CT6A 5T4EA 3H1AA 1KEZA 5K3EA 2YASA 5AH0A 4HXGA 4FHZA 5EHQA 1W4LA 3O9VA 4BAZA 1GQRA 5HQ3B 5KWJA 5ALZA 2J3QA 1XLUA 2XUIA 5BV7A 2VT7A 1L7QA 2WLSA 5E4YA 2C5GA 1BEZA 1XZDA 4OD0A 2HIHA 1OILA 2JGIA 3WI7A 5KREA 3ILSA 4LKOA 1VZ2A 4KACA 1THTA 3UMJA 1ODCA 4HXFB 4JYMA 1YS2X 2QJWA 1JU4A 1IMJA 3O4GA 1UKAA 1TRHA 2CJPA 4EY7A 3ANSA 1JT2A 2I78A 5CW2A 1EDBA 3CCBA 4YASA 2V98A 4GECA 5CT4A 2DR0A 5DNWA 1QE3A 5CXXA 2HHAA 3STVA 4Y2YA 1EXWA 5AI8A 2WQZA 1AKNA 2B4KA 4WDRA 1XRLA 4QDTA 3W06A 1Q0ZA 2BFNA 3WMRA 3DD5A 3QPAA 4EHBA 1G42A 1SCQA 2HA0A 3HRHA 4Q05A 4Y2UA 1ORWA 1EX9A 3BDVA 3G8YA 1WM1A 2PSEA 3OOSA 2HA6A 1ZIYA 4DNPA 2HA3A 1UOPA 5ALXA 1AQLA 4WFJA 2HU5A 2J4CA 3QITA 3VISA 1PV1A 4L9AA 2RI6A 3BXPA 3W2TA 4BVLA 3ESAA 3WWPA 1XROA 1QTIA 3BJMA 1G66A 5JARA 1W52X 3LLCA 2BGRA 3WQHA 1W75A 4BDTA 5D3KA 1MNQA 3ZPXA 5FDFA 3WL7A 1EA5A 2O2HA 3VJLA 2WFLB 1EHYA 1BU8A 4DYHA 5ALGA 5DWDA 4OU4A 4M0EA 4BAUA 2HU8A 1CUSA 4ZXFA 2FJ0A 4BB0A 3FLBA 2PKYX 2ZYRA 2XUAA 4BAGA 5EI5A 2QKYA 1XRNA 3G7NA 3G9TA 5KWIA 2EEPA 2QM0A 3I1IA 1CUHA 2XUJA 1BS9A 1Q83A 2EDCA 4B82A 4OYYA 1DQYA 4PQEA 2WJ6A 2Y2UA 4X90A 4P92A 4PV7A 2AJ8A 3DDUA 3HZOA 1CUDA 2RGUA 2QS9A 5AP9A 5ALRA 5D6OA 4C89A 2QUBA 3Q0TA 2C0QA 3VJMA 4YK7A 1CUUA 1VXOA 2BUAA 4OYLA 2EDAA 1UK6A 2Z5GA 3HYSA 5IKXA 3JWEA 3I28A 1LZLA 2NW6A 3V1NA 2AJBA 3AZQA 4AN1A 5FOQA 4BC1A 5CT5A 5HCUA 1K5PA 3OTQA 1QIJA 3LP5A 1FFEA 1HKHA 1QIFA 5JASA 4UFNA 1CEXA 2H7CA 1Q0RA 3IBTA 3WK6A 4W1QA 1S8OA 3G9UA 3WJ1A 4L72A 3DOIA 3V1LA 3DS8A 1QONA 5E4TA 4G8BA 4CCYB 4FFWA 3FSGA 2DHCA 2XMQA 3R3ZA 4AO7A 1XLWA 4EY6A 4KE7A 5BWCA 3RLIA 2IIVA 2OLEA 3EF3A 5ALJA 2PSHA 3OM8A 2G63A 3EQ8A 4AZ3A 3LCRA 1C4XA 3RARA 1CUVA 1LBTA 3DCNA 4DMKA 2WFLA 4MEAA 4Y2VA 1YAJA 3BIXA 1UKBA 5JZBA 1EK2A 1DT3A 4H7DA 3O4JA 4QNNA 3S8YA 4GLBA 2O7VA 2QXTA 3AILA 3C6ZA 3ESBA 3I2IA 3OURA 3QPDA 3WKAA 2GZSA 4TVKA 4HRXA 4EB0A 3IUJA 4DLNA 1SFRA 4UBMA 1NU6A 3N2ZB 1AC5A 4GEGA 4L3WA 4RGYA 1CUGA 5SYMA 3QMWA 1CPYA 4Q82A 4BE4A 4UHFA 4CG2A 5HF5A 4XJVA 1ZI6A 5AM2A 3F67A 2WUEA 1MX1A 4J0HA 4BVKA 1CR6A 5HZGA 1AUOA 1H22A 3H0CA 2XUHA 5AI9A 5LIPA 4EY5A 1J1IA 3AFIA 4BP9A 3T52A 3IUQA 1I6WA 5LYYA 3IB3A 2VJAA 1U2EA 3HI4A 5SYNA 3STTA 3QM1A 2I3DA 3I2FA 3WL8A 4C87A 4F0JA 4Y7DA 2HA7A 3WIOA 5A7HA 4H7IA 1HBJA 2XUQA 4NVRA 1N5MA 2PU7A 2WIDA 4G9GA 2GZRA 3AIOA 2QXUA 2WSLA 4JYPA 4ZI5A 3GROA 2HU7A 3PDCA 2HL6A 4J0CA 5AKKA 3BWXA 3R0VA 3C8DA 3NGMA 4UHHA 2RAUA 1TQHA 5DLPA 3CN9A 2ECFA 5JANA 4K6KA 3FCXA 1H23A 2W6CX 2VSQA 3ZLTA 3E4DA 1WB5A 3I6ZA 3WA7A 5AK3A 4HS9A 4AXBA 1CUFA 2DCMA 4HAIA 1AX9A 3STWA 3DNMA 3C8HA 1UWCA 3C6BA 1JMYA 5K3BA 3WLAA 2OCGA 2YH2A 4MWTA 4KJXA 4WFKA 5AKIA 3QZUA 3C70A 1RYYA 2WUGA 1XZMA 2IX9A 1JI3A 1DQZA 1QJ4A 4ZV9A 1ZOIA 5D3ZA 4OCZA 1CUWA 3FNBA 2JGMA 3W9BA 3KWJA 2HA4A 1XZKA 1YB7A 1B41A 5I9IA 2QTBA 1GKKA 1FFDA 4EY4A 1WCYA 1ZGCA 4L0CA 3EQ9A 3KD2A 4J0GA 2UZ0A 6YASA 3PUIA 3F9CA 5F4ZA 3BJRA 2QRUA 3UUEA 2ZVDA 3R3YA 4BRSA 4U2GA 1ZD4A 4G9EA 1KU6A 4W1PA 4CCYA 4B83A 4QWWA 4X71A 1FFAA 1Y7HA 4A5SA 5HQ3A 1EINA 1T2NA 2QOEA 1G4HA 2B61A 2ES4A 5EHXA 1JJIA 1U4NA 2OQIA 2PSFA 2OAEA 4BP8A 4FLMA 3I2HA 3DKKA 4Q3OA 3QYJA 4K2AA 4WCVA 3O4HA 1MX5A 1FFCA 5EIAA 1DWOA 1XQYA 2AXEA 2JEZA 2WKWA 1IZ7A 3AUKA 4PF1A 4Y2TA 4Y2XA 1X70A 4KAAA 2Z8XA 3H2HA 4ZRDA 3FWHA 2HRQA 5C8ZA 1FJ2A 2W22A 1K8QA 2WHRA 4UHDA 2WUDA 2WIFA 3HXKA 5CH8A 5DYWA 1CUXA 5AM3A 3PF9A 4A23A 1BCSA 3FLEA 4PO3X 2WUFA 5HKBA 4F60A 1F0NA 4HXEB 4KRYA 2FJPA 5JAPA 4PSCA 4Y2QA 2QVBA 3VKFA 1DX6A 5K3FB 3W9UA 5HK9A 5CBKA 1O6FA 4Y2RA 3G9XA 5AM4A 2ORYA 4K5QA 1MNAA 1ZD3A 1LPAB 4W1SA 4KAJA 2XMDA 4X00A 4UHEA 1CUJA 4B85A 1EB8A 4KE9A 2XUGA 4PSUA 2D0DA 1F8UA 1MAAA 1EK1A 2Q0XA 2WU4A 2OCIA 2OAGA 4A16A 1CUZA 1ZICA 5AI0A 1IVYA 4C4XA 3PUHA 3O0DA 2GYUA 5DTJA 3NWOA 3WKBA 1YS1X 1UT6A 2PPLA 1QGED 1JKMA 5ALLA 3IVMA 3TRDA 2BCEA 2DQZA 3G0CA 5JADA 3P2MA 1HL7A 3BIWA 3H2KA 4YPVA 2D5LA 4OB7A 2VA9A 4X95A 2XUOA 2XT0A 5K3DA 2C4HA 5T4HA 4CIAA 3FVTA 4DTCA 5LLSA 2PX6A 1UK8A 1LLFA 1N8SA 4QE3A 4UBNA 5HKAA 4EUSA 2PVSA 1XFDA 5HK8A 5AHXA 2XQKA 4B0OA 1JFRA 2Z3WA 3WWOA 2AJDA 5AKXA 4NMWA 3U0VA 3WL5A 1NX9A 2O2GA 2VF2A 3ZLUA 3WIBA 5ALUA 3HSSA 4U2CA 1OXMA 1XRMA 3G0DA 4ARAA 1GT6A 4P93A 1YR2A 3O9MA 3OPMA 2Z8ZA 4PSDA 5ALNA 3D2CA 4LXHA 4C6HA 3UUFA 4F21A 4LYEA 4GW3A 3KWFA 3IIIA 2ACEA 4QLAA 1R50A 3AZOA 2XQFA 1MAHA 3C6XA 3FSGD 1CUIA 4KYVA 3V9AA 5AIBA 3N0TA 2H1IA 2HA2A 4U2BA 5AM0A 5FPPA 4AQDA 2WHPA 3BL8A 1YB6A 4N8SA 4ZV7A 1UOQA 5FLKA 1ETHA 2WILA 4FOLA 2O7RA 1H2XA 1P0IA 1WHTA 5E4JA 1AMNA 2ZYSA 2CB9A 2JGJA 2XQJA 5FUMA 4EY8A 1LPPA 1TKRA 2G5PA 1QIDA 2Y6UA 1MTZA 1N5RA 5CRIA 1VOTA 4B0PA 1X2EA 4N5IX 4QDOA 5JAOA 1FFBA 4XVCA 1MO2A 1U65A 2PU5A 4W1RA 2H7YA 1O6GA 4DNFA 1ZIXA 2VAVA 4QLOA 5AK5A 1CUBA 3LS2A 5D7BA 2DSNA 4HRYA 3IA2A 4DIUA 4H0CA 3RM3A 4MYDA 1LNSA 3MUNA 3ZI7A 1UK9A 2QR5A 2R8BA 3H04A 1WPRA 4G4GA 1BN7A 4GXNA 1SC9A 2JBWA 3DL4A 5EIHA 3WKDA 4QDXA 4EZIA 2RHTA 3WK5A 5CTAA 4BZZA 4QA9A 3IULA 3G02A 3VDXA 4UHBA 2WIJA 1BE0A 3C5VA 1M33A 5JZ9A 5JAUA 4RE5A 1JU3A 3WYDA 5ALIA 5ALYA 4EA6A 3VVLA 3M82A 2CBGA 4G5XA 1ZD2P 1X2BA 4EBBA 4BYMA 2WJ3A 4BTVA 4UFOA 1QIKA 4CCWA 2HFKA 2HADA 3C45A 2XMGA 5A71A 4BCDA 5ALWA 2V96A 4XWGA 2WJ4A 4GI1A 2HRRA 4UPDA 4BC0A 5ALFA 1XZBA 3H2IA 1EDEA 4MQMA 4E11A 1SCIA 3FYUB 4FNGA 4ARBA 1WB6A 3YASA 3WK4A 3WZLA 4V2IA 2GBFA 1CV2A 5K5EA 5JD6A 2HM7A 3TGLA 1MX9A 4MEBA 3SC2A 1QO9A 3D7RA 4CI9A 5C7YA 2GBGA 1KU0A 4X94A 3B5EA 2XUDA 2H7XA 1F6WA 3V48A 3VVMA 1MT3A 2AJLI 5CT8A 5FV4A 3JW8A 1ZI9A 3E3AA 2ZJFA 4H7JA 3WA6A 1EH5A 5YASA 4OB8A 4C01A 3H2JA 3D5EA 5JD4A 1DX4A 3F97A 2WG2A 1QLWA 2XMRA 2P8SA 3B12A 2CKMA 3G0BA 4H7HA 1UXOA 2Y1KA 5ALTA 2XQGA 4PW0A 4AX4A 5JD5A 3TJMA 2X5XA 4XX1A 3L1JA 4OUKX 4G1FA 1R9MA 4FFVA 4CG3A 4DMFA 2X76A 2AJCA 4JNCA 1EDDA 3A2MA 4BCBA 2QZPA 1E66A 3T4UA 4S0XA 4B7ZA 3ESDA 1Y37A 5CXUA
chains in the Genus database with same CATH superfamily
1OU0A 2YN4A 1SHLA 4C43A 1XX6A 4FHDA 2DSTA 2WJIA 4PHCA 4RADA 4W7IA 3SBXA 3H1JH 1RSOA 1Q2XA 5KJEA 5GIPE 3BREA 3WGJA 4V0MA 3LUCA 3LNCA 3I61A 2VRZA 3G6KA 5CNMA 2IHVA 1GAQA 1QNFA 2WUVA 2PGOA 3L7AA 5EKDA 1GPNA 3OLCX 5IM4A 4J4BA 1OXUA 3IBFA 1QR2A 3OGCC 3E15A 3ZE2B 1JFTA 2HBYA 3AJAA 4TV8B 1KK0A 3CRVA 3IV7A 4M0FA 1THGA 2Y1EA 3ABMC 3DYVA 1Q82W 4IVPA 4PNZA 4TLBA 2D4AA 3U4CA 4F2PA 1IOLA 2FEMA 3CCRV 2ACKA 2OSVA 2DPXA 4MLPA 3E7FA 4J9VA 5C1DA 3K16A 4AMUA 3ZCRA 3EEFA 5BUQA 4J1QA 3VZDA 1M6YA 4YIKA 1IHOA 1QHYA 3HJUA 4H6VA 4YTEA 4DARA 6REQB 4RCVA 1Z25A 3UEOA 2Y05A 2H4XA 1NNI1 3FLAA 4MHSA 3T9AA 4AFNA 1XA4A 3SGIA 4AROA 4L4SA 4CUKA 2XH8A 2G80A 3VR4A 1XQWA 2FB9A 2GJ8A 5DMHA 1VYUA 4ZT3A 5IN5A 3SEZA 1T6XA 5FUBA 1T43A 2VYCA 4GC9A 1P84F 2Z3YA 1T8RA 2A9OA 4UXJA 4YI3A 3H9QA 3J7TA 5JWHA 1NZFA 4B3RB 3T8YA 3KM0A 1EVKA 3A4MA 3K1AA 2HAEA 2WLLA 3GFPA 3LY9A 3Q88A 4DZZA 2XCUA 2R8OA 4XSGA 1CHNA 4RWZA 4FZ3A 4FBMA 3GGJA 3COPA 4L4ZA 2XE8A 2QWQB 4Z4HA 1JHYA 3NHUA 2X23A 3MT7A 4XFJA 1GUBA 3R5HA 4IQ8A 3P2OA 5F73A 1B8UA 5H7XA 3WFIA 1FRVA 1RCFA 3TNDA 1J0XO 2RI0A 1UBMS 3B9QA 3Q8WA 4C0JA 1XCJA 3QVWA 3SYCA 4ARSA 3LBNA 1I4DD 3H8VA 3ETHA 2DC1A 3TS1A 4BMOB 4DMHA 3O8OB 3HYLA 1P1RA 1XZEA 1ABEA 3OF2A 5IMBA 1U7XA 1PGJA 3VA7A 3UXHA 1SPBS 4N0DA 1EXMA 2XLCA 5DSTA 4CLRB 1E98A 3WP1B 2IHBA 2GUGA 1P1HA 2GB4A 5IDJA 3GYGA 4LI3X 2QORA 2ATKC 1M2OB 4XYMA 2QY9A 4DLLA 1BH6A 8GPBA 5FYQA 1SZCA 2HIMA 1ATZA 1BOOA 1YB2A 2BFEA 2I2XB 4TV9F 4G2TA 4MITA 2ZITA 1F2TB 1EWTA 1QNLA 2NSYA 1LDGA 4L8FA 5T67A 3VDNB 4B3XA 1HL3A 4IW3B 4I6GA 3RVQA 5P21A 2HEPA 2PF4E 1K33A 1GWNA 2F43A 2Z04A 1CRWG 4PTZA 3EFOB 3RS4A 1ODTC 3D6MA 3ZCSA 5CA3A 4QM6A 2WLMA 4PU0A 1CJVC 2VRCD 4G2KA 4BAYA 3GJ3A 4H1HA 5G3ZA 4XCQA 1M83A 3SC4A 5KYTA 4Q4AB 3OMWA 3L7CA 4QLBA 4RPIA 1GGFA 1IC6A 3MWKA 2CE7A 2BJHA 1UP7A 5BMVF 3NYWA 2ZTUA 1R37A 2A0LA 1SULA 5H6RA 2V7VA 1A9PA 1Y1PA 2CL0X 3R0QA 4FNOA 5TF0A 4ZHQA 5IBRA 4ESEA 4LECA 4DADA 1FXHA 3U3MA 5IJAA 2B4TO 3HUUA 1ZVJA 3AHFA 4RQAA 3WADA 1NW9B 3DBVO 4DSAA 3D9QX 4CV1A 2QT0A 1YCIA 3MHSC 3C1AA 5KNCD 5AVOA 2FWIA 2I67A 5HM8A 3AVWA 1PZXA 4D99A 4Z4FA 4QQKA 2IVFA 4MAFA 1IM2A 4MAAA 1DU4A 3VHRA 4WJLA 4DV5O 3WBBA 2JLYA 5LZ7A 1NJ8A 3DLTA 1XZCA 1NY5A 3NAGA 5KO2A 2X3YA 1X13A 3HJBA 4OY3A 5H0IA 3DAYA 3QUAA 3OZDA 5JE8A 4OHPA 2C2AA 4WASA 4MYHA 4Q6GA 1QYCA 1UMDB 1XZHA 1LEHA 4NXNB 1QRAA 1OCCC 1EAYA 1OBOA 2GI4A 2A1IA 3ZU6A 3NJ8A 2ZYIA 2WV9A 1VM6A 4HUQB 2DXIA 1CZNA 4BGIA 4HZUB 4BX0A 1G7SA 4RU1A 3HVHA 4C14A 1DKRA 2Q8VA 3Q7TA 2YX1A 2OMKA 3BFRA 2PN1A 4ILEA 1FLNA 2XQIA 2ZRAA 2QE7A 3MOGA 5KX5B 1NXVA 3E53A 4LXGA 3RH0A 4OXNA 3L8HA 2IUYA 3AK3A 5J2TA 2O3SA 1GRJA 5GTIZ 1C1DA 1TYBE 4G4SP 1CK4A 3C3EA 2B20A 2XRMA 1Q74A 9ABPA 4PDLA 5LL6Y 4FMCF 4ZDJA 5C8VA 1XEAA 3AF4A 4M8KA 2DX7A 1SBQA 2NUAA 5EZYF 5JZMA 2OHHA 2J0VA 3F9IA 3MQ2A 5LZ8A 3S3XA 4Z4CA 1GPKA 2BKAA 1KI4A 2Q1YA 3H2BA 4FYKA 4D0GA 2HT1A 2GN2A 4WFAV 3IE2A 4IMRA 2OFXA 4V3BA 4WEOA 3B48A 1BMFD 4A8TA 3A2KA 3D8HA 5MFZA 2FEAA 3CQ9A 3NHMA 2H06A 4OHRA 4F8JA 4ZEXA 4F3TA 1N2GA 1Q44A 3DLPX 4I19A 4UCFA 1KEPA 1M6HA 2P5YA 1EE9A 3SBEA 3T95A 3VDMA 3K70D 1OJ7A 4KP7A 2FX5A 3VU8A 3CCLV 3RIHA 3D0KA 3NHSA 1KO5A 1AROP 3MBKA 4AB1A 1ZVQA 3AF5A 2L17A 1QKJA 4Y6OA 5B3JC 2D54A 3BTUA 3F3KA 1AZLA 4DREA 2JLVA 3W5UA 5T3YA 2Q3FA 2ZRGA 3LAWA 1NW3A 2OFFA 3I72A 1N5LA 1O97D 1WX1A 2PUSA 3HKBA 1ODIA 3RK4A 5HUQA 3VHLB 5IS2A 2FSFA 2WKSA 4MQEA 2NU8B 3UQ8A 3L1KA 4EIWA 1RPZA 1QRRA 3HKBB 3L1UA 4N3NA 3AX6A 5C8YA 4HGPA 2Y1OA 2F3RA 4N0QA 4TXHA 4Y1RA 3SC3A 4E07A 4NB5A 3EWIA 4R51A 5IUJC 3KB2A 3R7FA 4PSVA 3A36A 3GMTA 4M9ZA 5FPQA 4H31A 2EYUA 4NCIA 3TGUH 3IJ5A 1HE5A 4EMTA 3KXIA 4ZALA 3A6ZA 4ZBMA 4DCOA 2ZJ8A 5K3CA 3MTDA 4WTOA 2E4WA 2IWHA 4QPJA 3FI9A 3EIQA 2AUNA 1Z6QA 3L2OB 2EJRA 3O2JA 4IFBA 3VR6D 2BEJA 3UXEA 1LI4A 1XVTA 1K97A 1QO0D 2I7TA 3PQ4A 3G2KA 4B2YA 3U11A 2AZTA 4AXXA 3RN4A 1QH9A 1U1IA 5JJCA 1H66A 2R72A 2CLSA 4AJ9A 3TCKA 1Z6XA 2Q8NA 4N9WA 3HVIA 5E6RB 2GJ4A 2UUAB 1SU6A 3DXXA 4NYMR 1P1CA 2ODQA 1HTWA 4YT8A 1DTOA 2X0JA 4B3CA 1GKLA 1Y3IA 1NJ5A 1EP2B 4MKXA 2K87A 4ND8A 1IH8A 1T3SA 2C83A 2XVXA 1C41A 3SOPA 4UUAA 3ZHSA 1WNTA 2C4TA 1LB1B 4ENSA 3GELA 3PQ7A 1SUEA 2GLXA 5EBMC 3R24A 4QTYA 4W7HA 2D00A 1QCZA 2K2WA 3L75H 3WG7B 3N86A 4QYIB 1QV9A 4KWIA 3IPYA 3RSFA 4DA7A 5JATA 3FKSA 1XJ0A 3FTNA 5JOQA 5JMTA 2DY1A 1DRKA 1ORDA 5TJHA 4CMEA 3GQBA 1VQ5V 2CL7X 4LXQA 4OP3A 5LFAA 3CLTC 2WM9B 5DYTA 2FPSA 3PDJA 3STZC 5HCIA 4JU8A 1GCGA 3IPAA 3RG2A 2BMVA 3QUSA 2XGSA 4I9UA 3MJSA 4RTPA 1T9BA 1ATIA 1W34A 3CKLA 4O29A 3AG7A 4UBLA 2VF8A 1SQVH 2CEKA 3PNPA 1CETA 4QXOA 4US2R 2EZ8A 2NIPA 4WXPA 1Y66A 2RSLA 1KR5A 1U5CA 2Q3CA 1DG3A 2VJCA 4ZI3A 3N0RA 1YJ5A 1NW7A 2VNAA 2P5SA 3QOYA 4HPWA 1OI2A 4MW3A 4O63O 3TI9A 3OA2A 2XE4A 5B2EA 5KQGA 3WLSA 1EXDA 2R3SA 5JXIA 3K57A 3PGJA 5J43A 2YR0A 4WD3A 3STUA 5A4FS 1YIDA 2FZLA 2AHZA 2V7UA 1E9DA 1O8CA 2C1EA 2Y27A 3H1EA 1R8XA 2X7HA 3AP3A 1E2FA 4OAQA 4TSFA 3FDXA 5K0EA 1T5BA 1XL0A 4F2DA 2W0XA 1VL8A 1IN5A 2QMQA 4IJKA 5JAHA 4TRNA 1N7GA 3EXHC 1LPMA 2EILB 1A8SA 3DW1X 1JPNA 2N46A 1D4FA 1U8EA 3WYEA 5BWOA 3JD3A 1HFEL 1MOSA 4YRCA 3CUUA 1EVZA 2PYJA 4MR8A 1M2VB 4MTXA 1ULTA 3HEBA 4LOLA 3AFMA 4LVCA 1G5FA 4E30A 4ZZ1A 5A7FA 3LIIA 4QHSA 4PHHA 3HXLA 4AS3A 1OB5A 3KEQA 1TK3A 2J32A 3O93A 1IXYA 4FTWA 4PAMA 5LGNA 3EWSA 5EWLB 2R85A 1YZTA 3W5JA 2AF3C 1QRUA 1HG0A 3CXRA 3RODA 4F1KA 2Q69A 1BQ3A 1FXVA 1GIAA 2E48A 1NQXA 1KMHA 2HBZA 2HK8A 2P9CA 1NULA 2J67A 3RK1A 4GOOD 3TSOA 4A03A 3R75A 4NE2A 3E5HA 3KIPA 1H2NA 4RK1A 1ABFA 1NMXA 1ZRSA 3ANTA 2RJZA 3H3XA 3N6RA 1X3LA 3OE7A 3P0HA 4FFOA 4FGWA 4EPRA 3CC4V 1FQKA 2YJTD 3NIBA 1ZNXA 2DY0A 3KXDA 3PI7A 2XMBA 5ADHA 3TEJA 1YRWA 3FCEA 4OXSA 3LFTA 4PAQA 5FI3A 2XLBA 4Z3DA 1OLOA 2EJUA 4CM6A 2H1OA 4KGVA 1FDRA 3E89A 3WNVA 4BQQA 5IULC 4XUDA 4CMKA 5KYKA 5IJ0B 3OLWA 3RROA 1Y8ZA 1TF2A 1GLVA 2BKLA 4OU5A 4J3FA 5JHHB 2QL9A 1HQDA 4B3RO 2EZUA 2L69A 2Z1NA 4X97A 3AUUA 2JDID 5JI3E 2HB6A 1YDGA 3L6EA 4IOMA 3LDCA 1V3QE 2D59A 4IICA 4OK6A 5JJJB 1E3TA 5AKHA 2ORIA 3ZQJA 4YPOA 1B76A 1IRXA 2EQBA 1C0LA 2HRBA 2VCEA 3DMYA 4KK3A 4ADSG 1EFRG 2Q0AA 3W7XA 2I2WA 5SYAA 3AG4B 5IKPA 1NI4B 3TO5A 2W8ZA 4OBBA 1WPXA 4DDWA 4EW3A 2Q50A 3TUJC 2D8AA 4KI7A 4E08A 2FCRA 1LFAA 2O5CA 1Z7GA 4JGBA 4Z49A 3OG9A 1P6XA 1ZVKA 3DFIA 4MW4A 3HI6A 2VYQA 1AF7A 3T9FA 3HJAA 3ZE8A 3OJOA 4YS6A 3QRWA 3H2YA 3ZC3A 1TJ4A 1XF1A 4GQAA 3S44A 4BEJA 4J3NA 5LB4A 1PEYA 5BQFA 2TMKA 3TDMA 4PA7A 4AMVA 2NZVG 3F3YA 1XMJA 1HQCA 2YIVX 4IM7A 3GNTA 4MJ3A 5IZ4A 4BTEA 4FN5A 1LFDB 2W2LA 2Q62A 5H70A 5CDFA 3R3XA 1IG3A 2IUTA 2YW9A 4FYWA 2X1HA 2P11A 4PPFA 1CUAA 4U9HS 4OX9O 1AR1B 2V4DA 4WXEA 2NTEA 3BKXA 3LVBA 4OHMA 5AJHA 1X42A 1TTPB 4TUYF 4C3ZA 5HWSA 1ZR4A 1J39A 2AN9A 4MIKA 5COBA 2B4QA 5BP7A 2ABWA 3MRXA 4Y30A 1ZNZA 2F17A 1AK2A 3AW8A 2CYAA 3QXXA 1AT1A 2NQ8A 5H59A 1K4YA 3SXPA 3EBLA 1OGJA 3KPYA 1P91A 4WZBA 1H2WA 1SQFA 1T6YA 1GNRA 1S4QA 1VMAA 2BHRA 5CXSA 1MDFA 4LOKA 4PBTA 4X6XA 3BMNB 2QMZA 1E9VA 3NG1A 4ISBA 5CT9A 1CY1A 3RAGA 4WVFA 1YFKA 3O4FA 5DTRA 1A9RA 2QP4A 1XRPA 2BVNA 5A6VA 1KQPA 1XZNA 3OIDA 3QLUA 1EVYA 3WBFA 4B79A 2IYFA 1XAJA 1J2JA 4FINA 1QGAA 2BMWA 4R2IA 3HVRA 2BGTA 3LVRE 1L3IA 4CEJA 4FOPA 4QU8A 2JIBA 1AS2A 5FOTA 4TKMA 5F52A 1WP8A 3K9AA 4O2BA 3OC0A 1C8KA 2FG6C 4I5GA 1UOOA 3I9OA 1D0VA 4WOJA 4E5YA 3EISA 1NNUA 1ZUD1 1TVKB 2RARA 3HJRA 1Z68A 1H8HG 1LXCA 1WIWA 5BN3B 1A8QA 4W9RA 1X8LA 5AESA 2XASA 6AT1A 2PUBA 2NXWA 4JXZA 3Q85A 3EZGA 3K05A 2YNMD 4LW8A 1FSSA 3PA6A 1Q0QA 2JJ1A 3N2IA 2DCUA 3UJ7A 2FPRA 1FDVA 1W581 3QWFA 4FIZA 2B7LA 1AN9A 4IVNA 5A5EA 1DINA 2R97A 4R2LA 2Y69C 1WUHS 4E22A 2CLHB 3ZV5A 4IDAA 4QEKA 3JQCA 3RTBA 2OQ2A 1FMFA 1KRWA 1ODLA 1RJWA 3RVRA 3FHCB 2XGGA 1XD8A 3I76A 5FWAA 5GZ1A 5K03A 2SECE 3W1WA 1GR0A 1U7DA 4GZMA 1KKDA 3IBGA 4X62B 4NFHA 1FFGA 5CPFA 2ZDIA 5EFZA 3TLXA 3K2IA 3NXKA 2RHDA 2RAFA 1VARA 5KDDA 2YJ6A 3DGEC 3PUJA 4ZOLF 4JT2A 4JVLA 3EB9A 3FOBA 4MUYA 3V4FA 2P9JA 1ZNQO 2YYZA 4N3AA 3VZRA 6PFKA 3FZGA 1JIXA 1P3DA 4G0UA 2PGXA 3KK0A 2ERYA 1KBZA 2OYCA 3WKEA 4JCOA 3WB1A 4XIIA 4K40A 4G1MB 1C4OA 4UM8B 1YTFD 2NACA 3RFVA 1MFPA 2GYVA 3DE6X 1NDQA 3I1JA 3T3DA 3ABTA 2LKDA 5C8YF 1KB9F 3QOWA 1KDOA 3FYEB 2YWGA 3DBLA 2DTEA 3HY3A 1NU8A 4MGEA 5FXMA 5CA1F 2LCQA 2FEWB 1KS2A 3TF5A 4JU9A 4JR0A 3IEMA 1U9JA 4GNRA 5KOJB 1WHSA 1Y6QA 1U1CA 5FTJA 1BHAA 2IHZA 3HDYA 5BRAA 1ZK2A 2BI7A 1R3KC 3U5ZB 1X7ZB 1EFVA 1JH8A 1G5RA 1XTIA 3IJEB 3NHLA 3D2AA 1C1DB 4HV4A 2DUJA 3N8GA 5D84A 4MOWA 2B78A 1Q7YW 1NMZA 1J9ZA 4FHFA 4TKUB 1T9HA 2X6TA 3QP9A 1E99A 5HMLA 4JLOA 3CBGA 3IDAA 4X62O 4LRQA 4MUHA 1SIWA 3AHCA 3BK7A 4QPJC 4YJHA 4RS4A 1UEJA 4A27A 2P41A 2W0MA 5KSOA 4JI4B 2P4KA 1KGSA 1IATA 2MMGA 2BFMA 3F3MA 3GX1A 3I04M 1O94A 3KQWA 5DKFA 3BIJA 2VUSA 1CDEA 1F4MA 1G7CA 3W2IA 1G8YA 3NBMA 3BL6A 4ALJA 1OYOA 2XODA 1TC1A 4ZZ0A 2XADA 3NV7A 4GVPA 3UC9A 2OUKA 1ACJA 1SIUA 2WD8A 4O4JB 1C0EA 4O08A 1JKIA 3LJKA 3LUGA 5CIWA 3KQKA 3N2KA 3AONB 1QO0A 2FSGA 2QQ0A 3DLCA 4R3NA 4RHEA 4YBZA 5HRAA 5HGXA 1YQDA 3LBHA 2AF4C 1RBZA 1W96A 1JQEA 3BWBA 1V54B 1TEZA 5GJBA 4KFMA 3BF7A 5H1YA 4C88A 1NV8A 1F4VA 2ZB2A 4CDNA 5HKKA 4RH1A 5AJTA 1VE3A 3U81A 3LU1A 3LQ1A 3EW9A 3SQXA 1YQEA 5FHRA 1NF8A 3AR3A 3PE3A 5HX7A 2R7LA 1F3OA 2O1EA 3L0ZA 1TM3E 2XAGA 4H0NA 2XECA 3R6WA 4N47A 5EIOA 4BNXA 4D3DA 4D3SA 5JTTA 1N36O 1HFWA 1KO8A 2Q27A 3TMAA 4A92A 4H3VA 5IKEA 3KL2A 3MTIA 3VC7A 4HQ0A 4AUMA 4EWLA 1NLMA 2QW0X 1GAJA 3V1UA 1IBLO 3G5UA 3LKDA 1WW8A 4GE0A 5ALOA 5LQKA 3NB0A 2O8DB 2BM1A 2ONYA 3H87A 2E2WA 2VQ3A 3WGVA 5IJ9A 1NFFA 2GJSA 4LF4B 1FFSA 2YWHA 3HA5A 3RIXA 5CDYA 2CSXA 4JZGA 1CG6A 3CZ9A 1BE1A 4BVAA 1U0HC 5GJWC 1CDDA 5IK2A 4TS3A 3ZE6A 2VDMB 3VSDA 1DMSA 2RNBA 1KJNA 2R1TB 5ALMA 3F49S 5B6JA 2M2IA 3AK1A 1OVGA 4PO1A 1C4WA 3WO1A 2Y4TA 3CSDA 1AV6A 3URMA 2P77A 3EVZA 3DA8A 4TYPA 3OEHG 2CCKA 3AG2B 1GUAA 1OT3A 4H37A 4H18A 4LTDA 2HQOA 4BX3A 4MW7A 3TLAA 3QPWA 2VLBA 3EC2A 2CDCA 3G5TA 3KHTA 2YEVB 4WZAB 4FZ5A 3TX6A 3SVTA 3T5MA 4JMPA 3CV3A 3ZNOA 5JQGF 1EIWA 4FI3F 2J48A 4MKIA 2IF0A 1J23A 1FNNA 1YGYA 2NU6A 4GWLA 1U3TA 4X93A 1XD9A 2GCPA 5CVJA 3NM4A 3HKDB 3N27A 1RHMA 2ZPUA 4UCXA 4IGAA 4UOZA 2VA8A 4BEWA 3QE9Y 1N36B 4J16A 3GRKA 4YJGA 2ZSUA 4CLOA 1YA6A 1GSOA 2FF7A 4NBNA 3U31A 3A0BZ 2AJTA 2CJWB 5I8ZA 4MDFA 3ICPA 3EDYA 4E1AA 5JPIA 1YIJV 4DIMA 1W5BA 1JLLA 3CVVA 3OIWA 1TXGA 1Q14A 4LV6A 1RS0A 3JYHA 3K8OE 3ND8A 3SYMA 1YA8A 3K2BA 1DIGA 3L6CA 3IUPA 3WR5A 4AO6A 1XOUA 4EYOA 4BBPA 3DL2A 3UJHA 1RPTA 4ZO9A 5JPCA 2V6IA 4H77A 4HYQA 2IIPA 3CPSA 3ECSA 4M98A 3TGWA 1JR6A 3NVAA 1W4AA 5EE1A 1CJKC 3F74A 3Q4HB 2ZWPA 3EWAA 2HWKA 1Z16A 4WZAA 4ZQBA 2E74B 4FD2A 1X7YA 3HCPA 4K6HA 1AKVA 4DR6B 2E3JA 3DQZA 5TQVA 4PX3A 1R0RE 2B30A 3TPFA 3D6JA 3UO8B 1TIBA 4KR0A 3O1HB 6REQA 4QPDA 3LTNC 3E22B 3L01A 2QKAA 1SIOA 1NYRA 2ANBA 2HF2A 1CE8A 3CBQA 4FKBA 2A86A 4JNKA 4K05A 4K9KA 1GXSA 1X1QA 4X85A 4LYHA 1CUCA 2JIQA 2CVFA 2ZIAA 3UENA 3RYHA 3VQXA 1A96A 2NSLA 4C2UA 2GAOA 4NXMB 1N2JA 1X7ZA 4FHCA 4JXKA 4QYSA 4XEUA 2CVQA 1B43A 3EGWA 3PQFA 4Y3UA 3HKCB 2YIBA 2QNBA 3AXTA 1GZ7A 4BFUA 4BDSA 4CKCB 1TEXA 3GA7A 4F6RB 2OCLA 3QVXA 1XNGA 1XC7A 4ZVMA 3LF1A 1W6RA 3IB6A 4EG6A 2VRNA 3KDPA 4RF5A 5TMPA 1EBFA 1O95C 3AVPA 1RSOB 3PQ5A 5E7JA 4OJTA 3UKMA 1S72V 2FPMA 1QO7A 2IRWA 4NFLA 3EQ2A 3G5AA 4MS2A 1NUQA 4FM1A 1M66A 1L7RA 1D4OA 3C43A 1Q1QA 2FXIA 1MC5A 2NO4A 4P38A 3GIWA 2HCRA 3R44A 3SFVA 3WYNA 5KJ6A 5ICSA 1NZ6A 3CEAA 5BR8B 3NT5A 4P80A 3TFWA 4AJOA 4EHHA 4JP5A 4U39A 3ABUA 4BMPB 2RHGB 3RIYA 1J6UA 2FRXA 2G9RA 4MMXB 1YZFA 3G2LA 1JOYA 4YXWG 1QZ3A 1RP1A 4CKXA 3CHXA 1KYVA 5BN4A 3L9DA 2PDAA 3KB6A 3PFNA 5BVHB 3DZGA 1PFUA 5FFMA 2OHXA 4RIIA 3I6BA 2VPXA 1D1PA 4ID3A 4ZGBA 1JSRA 4JVMA 2XNDD 5EMMA 1WMFA 2WLKA 3T1YB 2I62A 3CUWA 1P2FA 3FZYA 3W2HA 1FQWA 1NT2B 1XN1A 4I1OA 4HDSB 1JDJA 4QL3A 4OQMA 3SPHA 2GEUA 5DP1A 3GR6A 4YRZA 3AIKA 3SGLA 2DG2A 2PQMA 4JJ4A 5HOEA 1V6AA 2C7BA 1QTNA 2YV1A 3NAMA 2VAXA 1SOMA 3AB7A 5BN3A 1EP9A 4UVAA 2R11A 2W11A 2X0IA 2G04A 3NH6A 2BLLA 4C4ZA 2NO7A 4OX9B 1FLVA 1X8JA 3L4SO 3L7BA 3WB9A 1ADBA 2GCOA 3DLBA 1PBNA 3L4EA 3GK3A 3HU3A 5KOJA 4UNSA 4IJQA 4FXOA 3U44A 3VOAA 2TS1A 2O5VA 5SZJA 3DMNA 2Q2NA 3TM4A 2QU8A 4M1QA 1QLEC 1C50A 2LUOA 3F96A 4LNHA 5FBKA 3MSCA 3UKJA 5B3KA 3GJ4A 3V6MA 2N1MA 4K9RA 3K6SB 2NLOA 1L5LA 5HIMA 2B2CA 3JPYA 3AVVA 2P3OA 3PA8A 3EMVA 2EZOA 3PHIA 2ZXWC 4G8CA 4H7PA 4D9GA 3JAKA 1DXHA 4DCSA 3C3SA 4WX2B 1B3BA 1IY9A 2WLHA 1PL4A 5BY1A 1NOJA 1EAMA 2PG3A 1CEQA 4OHFA 5L7YA 5JYCA 5JS1A 5IAAA 2QI9C 1KSJA 5H2FZ 2EIMC 5KDLA 4FR2A 1RM0A 5A62A 3GDGA 4Y18A 5JS8A 2FETA 3K0SA 4B3IA 1OBHA 4AI6A 4Q9HA 4GM1A 1SC1A 1JKJA 3U0ZA 5TRTA 1DE0A 1U9IC 3QFCA 3IDOA 4MVJI 1PAUA 1S02A 1D6JA 2J7PD 3HNPA 4JA2A 4BASA 5IFKA 1SQPH 3F90A 1SESA 2E1RA 4H27A 2O8BA 3I4CA 2D1QA 2OVFA 2UZAA 3KVNA 2Z9BA 4LJ9A 4B09A 1IWBB 1J2EA 3LBAA 1YEWA 4R8RA 3TZHA 1ZMOA 2C3UA 2KHZA 5JEEA 5ITWA 1MGOA 3F7OA 3TJRA 3QPCA 3GT4A 4RAQA 4QDZA 3BGSA 1A5TA 1DIOB 1FYWA 1PW7A 1HTTA 3JQ7A 3TRKA 4MVUA 4B7AA 4CEIB 1K3EA 1CW2B 2OOKA 4N82A 1USIA 3E1GA 2O9JA 1PNMA 3STXA 4CKWA 2GCEA 3U4QA 1IUPA 4MCIA 1UAYA 3T7KA 2OFPA 4DM7A 4BLVA 2VQDA 2LIVA 5F2EA 1J25A 2FP4A 4X7RA 5HBGA 3SHTA 1SVOA 1HOXA 2O2DA 3MT9A 4N3GA 3OTOO 3O3NB 3N0VA 3O9ZA 4FQ5A 3PR3A 1BYUA 3JCUZ 2MYTA 5CYGA 3O47A 2KB0A 2C8KA 4AL4A 2X2EA 5DB4A 2HZ7A 4JV5B 5DW0A 3FPSA 4QYXA 3PBKA 4X3CA 4MH0R 3W5VA 1SHTX 4QGFA 2R1VB 1YXBA 1EGAA 2WFZA 3G2PA 3I5UA 1P7BA 1FZQA 2BTQA 2AHRA 3LUDA 4N5MA 1WE2A 2GEBA 4Q7EA 4QBIA 5ALPA 2V6BA 4B74A 5IT9A 2LTAA 2Q2QA 1EM8A 2XCRB 3CS3A 3EVEA 4PELA 3ANMA 4IHJA 4BNVA 1L4EA 2D74A 4P2BA 2EJWA 2GCOB 2J41A 3F8SA 3QLTA 4RH0A 5TXGA 2VO1A 4I9NA 4AYTA 4B73A 4Z1MD 1E20A 4QTTB 4IEFB 1PYDA 2IEIA 4EI2A 2QNIA 1J4AA 4RXMA 2J3MA 5F9MA 1NY6A 2PQ2A 1FXSA 2IHJA 1SCKA 4QXQA 5KCMA 2DH5A 4ZO6A 1ISSA 1UBFA 5I01A 1QKIA 3MEQA 4FILA 4RORA 3AL2A 1CVLA 1OXBB 2AA3A 3K4PA 4PGFA 3V8EA 1UPUA 3CH7A 4M89A 4RAOA 2Y0EA 2X8AA 1K5GA 3FTQA 4HFRA 4U2EA 5E6UA 1RXYA 2ZTVA 5FL7A 4MROA 1B6RA 5C5EA 1ORIA 2R00A 4DXAA 1LZKA 5ALSA 5CLLA 1OAOA 1FLDA 1E58A 1Y3DE 2Q6LA 2OCHA 1OV4A 5B1OA 1PS0A 2VK4A 3BUSA 3N8DA 4OAPA 3ZXUB 3A3PA 4ZICA 1E3DA 1Z6ZA 5DHRA 2M7WA 4NMLA 2X7JA 3IC7A 3KCNA 3KQQA 4G4SO 4NE7A 1EP3B 1CJBA 2HWUA 2X8BA 5C18A 2BGJA 1RE1A 2LIPA 2QN9A 1QQCA 4OB6A 4Q48A 1RYMA 3NTLA 4C1NA 4ISCA 5IT5A 2GAJA 5JCJD 5MF6A 1ISRA 1U94A 3DFMA 3A9WA 3OJEA 4UHCA 1D2AA 3RFUA 1E61A 1R1DA 1EFRD 4GLJA 3CD6V 3AEQB 2QE7G 2A5LA 1DOAA 2Q7XA 1YVWA 2QTRA 3QFTA 3VHQA 2TSYB 3DTNA 3A2NA 3FJYA 5K7SA 4BV2A 5EYPB 1O03A 2QN6A 4C20A 4P7JA 5EINA 1JAIA 5DK4A 3GFQA 2JDIG 4NECA 5JAMA 2OHFA 5DXJA 1ADCA 2AG8A 2ZTHA 2UVPB 5LQDA 2NO9A 1P4RA 3C5HA 3FVWA 3TSWA 1UFKA 3I32A 1NTOA 4OLFA 1I6LA 4E31A 3SJCC 1YDHA 2H4WA 3VBEA 2EVWX 4FSHA 1JMVA 2WWXA 3PD1A 2OCPA 4NPAA 4BFSA 3NBXX 4DLUA 2DQSA 3QJ5A 3PCXA 2VQFB 3I55V 1DWPA 2CYBA 4INOA 4LRXA 4N41A 3W5AA 3LQKA 3ORRA 3CRCA 3TD9A 3TOVA 1KI6B 2PBLA 1DRWA 1KNXA 3L0SA 4KGXA 3R66A 4PCLA 4KHPB 3U7JA 1W36C 1D5NA 1ZLZA 3AEYA 3K09A 4K6GA 1X7HA 2XDWA 5CHYA 3C7TA 3ZDQA 1W85A 4NX2A 4A2WA 2H08A 4BFVA 5IT4A 3B8NA 4RD3A 3GVPA 4B6RA 3HXOA 2GPWA 2HO4A 3E4CA 2TECE 4IV8A 3A25A 3NIWA 2P79A 1RWMA 4TKVA 1I24A 3FUXA 4X91A 5FA6A 1COWG 2C9ZA 2LR0A 5C46F 1VQKV 3CMCO 4WA8A 1D3AA 4MPRA 2XBUA 1P4HA 2WG1A 4R98A 1Z63A 3IAYA 1CZUA 2VCYA 4EG4A 1JMKC 1SERA 1EXVA 1REQA 1BS3A 4LSMA 1PSZA 1G0NA 2WOOA 2IUSA 3K5LA 4W5WA 3Q5GA 1AK9A 3THYA 1G8HA 3A6DA 2UU9B 1W29A 4OJKA 5EP2A 4FHZA 4JBWA 3MRSA 1VPDA 1QBGA 2CDNA 2H17A 1P9LA 2P69A 3EGDA 4G0PA 4KXQA 4ZARA 3SZMA 2XEDA 4KYTA 3CFYA 4BAZA 3GD5A 2BIFA 5IAOA 3UZUA 1O7JA 3ZBHA 4KWHA 4QECA 5TPZD 3BGOS 4FDTA 5HZHA 5EA2A 4OHKA 1G8GA 2J3QA 4CM1A 4V1CA 1XLUA 3OBIA 5IC6A 1ZRNA 3FRIA 2AGAA 2EBWA 5IASA 2B94A 5BV7A 5LOVF 1ZIOA 1GYQA 1VQ6V 3DOEA 1ECPA 3E3LA 4OGWA 4UARA 2H1HA 3TIGA 1L8DA 3C3JA 3TE7A 9ATCA 1V4VA 2ZSAA 4QJBA 3D4IA 1I5YA 3IA7A 3GLGE 1I3MA 4FCCA 3WTBA 2WLSA 2QBYB 4N7MA 2JFOA 1BEZA 2PQ6A 4LCJA 1XZDA 3ZHTA 4A26A 1EBOA 3CJHB 1IBRA 1TZ2A 4OD0A 4LFAO 4YY3O 3N74A 5G02A 4DQXA 3KOXA 5DHQA 3GV0A 3V34A 4AJ2A 1FDUA 3G5LA 3G89A 3JQAB 5CEFA 1VZ2A 3ASZA 2Q99A 3PCTA 1ZHOA 4LJYA 4I1IA 1BJRE 1ODCA 4LC1A 3KT0A 1N6NA 1KJQA 1ZMXA 2HYDA 2EZ9A 3M4ZA 3FTDA 3ZRSA 3N59A 2P6OA 4HXFB 2VJOA 3AM3A 2FWPA 1XO1A 1R0BA 3B6EA 4QT0A 4BFWA 3ZHXA 1Z5PA 5FBQB 4EQZA 3LGXA 2EEZA 1IMJA 2V74B 5J2TB 1SQ6A 1CP3A 3ELYA 2A58A 3Q72A 3QBTA 2DZDA 2XCTB 1ORTA 1HNWO 4EUFA 1TRHA 2NADA 3TTWA 2P22C 2MSEB 2UZ3A 3EHEA 4B71A 4EA8A 2I78A 1UBOS 2YZ7A 3X1XA 1EDBA 4GEKA 4QSHA 3CCBA 5EJIA 4BB5A 1IDN1 4LZOA 2FW1A 2V98A 1M34A 3CKYA 2OBFA 4RHUA 1SUIA 2HF8A 2G28A 1YS4A 1Z2DA 4Z9YA 1DKUA 2CVHA 1QRTA 2D0OB 2BONA 2I91A 4DUZB 3OZSA 4JI0O 3QPVA 4F2HA 4ENRA 5BRNA 5JNTA 1NQTA 2CDBA 2HV8A 5GP1A 3V42A 4X3PA 1V1RA 4NXMO 2P4UA 1XRLA 2ZRIA 1C7RA 1JZSA 3FR8A 4QDTA 3QU4A 4GM0A 4HDMA 4LFAB 5H3LA 2R8XA 1YE8A 2VBFA 3REGA 3W06A 3ZU4A 3ZZTA 1U0LA 3FNFA 3BIFA 4J16C 3W9SA 3TNJA 3LXMA 4LF7O 2JKVA 4URHA 1Z22A 5CA0A 1SCBA 4N54A 1P39A 4YB8A 3MWGA 3T7AA 3TXXA 3WJ7A 3GEPA 5L53A 3A1EA 1IEWA 3O9OA 2QRJA 5ED4A 3MCWA 2PS3A 4M8NE 2QTTA 3TX2A 4QPKA 2QUJA 3O83A 1V7PC 4Y2UA 3EMKA 1A04A 3N6XA 3MJTA 3QFHA 3TYXA 4AKIA 2FQYA 3GZTB 3C6KA 4UJ3A 2Z5UA 1ESZA 4BB6A 3VQYA 3I73A 1VSUA 1Z3CA 2C3YA 4JWTA 4F4UA 2R5NA 5C1PA 3KEOA 1PD3A 3E61A 4AJLA 1OU4A 4AN4A 1G3MA 4HPXB 4TMFA 5FFFA 1G59A 2ZBQA 4QASA 2HA3A 2LGQA 1TIKA 3FGNA 4KIUA 4UMVA 3IKVA 2GKSA 2UAGA 5JWOA 1WLEA 4KXUA 3EA5A 3WGQA 2J4CA 1Q3HA 1Q6HA 1T1EA 1JYEA 1MOQA 3QITA 2I2BA 1V3VA 2QZSA 2V7XA 2ZJ3A 2A30A 4GICA 1ICEA 1G21A 4HLQB 4BMVA 4OGQB 3RI3A 3KUDA 3ZQ4A 4RMHA 4D81A 2EFDB 5TPWA 4CL8A 1TJ3A 3IO5A 3OZUA 4N12A 1SQGA 2I2AA 4OQDA 5CW1A 3B51X 1FAFA 2G5GX 4XWKA 1A8PA 1DJOA 2WKQA 3FYIB 2E4YA 1QTIA 1SCUA 1VMGA 1K5DA 1OSNA 2AE2A 3BJMA 5EHIA 4YMLA 1WABA 2YUTA 2OCYC 2X5OA 2UZ4A 3B3GA 2FTKE 1UMDA 1J20A 1E6UA 5FA8A 2JS5A 2QI9F 2IYWA 2YY7A 4D8YA 5KVSA 1XCBA 2W8BA 3LBYA 2JLWA 2R751 5AYVA 1TU0A 5GONA 2WYUA 4DIKA 2CLEB 2F1OA 2QTFA 4HDKA 3VJLA 3AGQA 3VFDA 3E86A 1MH9A 1EHYA 1QX4A 2N75A 3FTEA 5FPOA 4XWOA 2VJYA 4R2JA 1QSGA 1I80A 2G9QA 3OD1A 5DWDA 4O2BB 1WHSB 2HU8A 3K59A 4ZXFA 3RF6A 1JQKA 1RBQA 5BMVA 4BPBA 1A0OA 5ADWA 3P7MA 2B9ZA 1PNQA 3H3FA 1AA6A 1P6QA 2QUIA 1RKXA 3EXG2 3B9BA 3CR3C 1PJZA 1Z06A 3FFAA 1Z2NX 1LSUA 2ZIVB 3PSHA 4WERA 2N42A 2PKYX 3S99A 1EN5A 3VX3A 4ALKA 5JXWA 3N1UA 2GARA 4G5HA 4N5LA 4D4HA 3T2MA 1Z8HA 3DPIA 3IEPA 2QKYA 3HY6A 1YD7A 4D26A 1SHKA 4OOEA 1J33A 2B34A 2Z2JA 2H3OA 3D3KA 1WG8A 4MS1B 4YCDA 2ZRMA 1VRCA 1ZL2A 3FCCA 5D5PA 4DO2A 4UU1A 1OWNA 4R1OA 3H1PA 4FD3A 5A03A 1PUIA 2Z4TA 3RW9A 3D3JA 4ILKA 1J70A 1GUFA 1Y98A 2EDCA 2ID8A 2R8EA 2IU6A 1DQYA 4IGEA 1DAFA 2VF7A 4ODIA 1KF0A 2ZS8A 2BH9A 3BFKA 4PQEA 3U7QB 2WJ6A 4K9MA 2AZ4A 1MQ9A 2W2TA 3BWYA 4N7BA 2WVAA 3RW0A 1M10A 1Y8AA 4LA4A 2Q7EA 4HWPA 4N40A 4P92A 1S2OA 1RZUA 4PV7A 4ZVRA 3HR4A 1R6UA 3NOOA 4HNAA 1JEEA 2N0SA 2QTHA 4IINA 4MX8A 1PNKA 3BXGA 4BNIA 2B82A 1PG2A 2DBRA 2QHXA 3HZOA 4I5EA 4J90A 1EJBA 3LKVA 3DXFA 3RYCA 3DXRA 1NJSA 2PGJA 1I4EB 2RGUA 4N1AA 4CYMA 2QS9A 4IG4A 5IANA 4TT3G 4JN6B 5DGXA 2GHTA 1Y42X 1GZDA 1S2LA 1ZMBA 3GFGA 3BGDA 4QXMA 4FKZA 4LF9B 2OORA 3WQQA 2OLJA 2QUBA 3K1AB 5K0TA 2BGGA 2BSKB 1OLUA 3O1LA 3TLJA 2C0QA 2B69A 4HT3B 3ZWXA 3HN6A 2JJQA 3HB0A 3QVOA 3G0OA 2RK6A 3RT1A 3IV6A 3CE2A 1JAHA 3D8CA 1IOVA 1I2DA 1Z4IA 5G1NA 4UPEA 1HZJA 1XB2A 3HYSA 4NLLA 5JG7A 2PUTA 3I28A 3RAEC 3ETEA 3B1XA 3WX0A 5K8VA 1NXOA 1NHGA 2ZM5A 2VK8A 4F9GA 1O9BA 3SPCA 5LMNO 5IJ0A 5J4YA 3S70A 2LJ2A 3RJMA 3OFND 4D3ZA 5CT5A 4YV7A 1U99A 4W4KA 1CF2O 1NKTA 1X80A 4MRRA 3BMOA 5KPJA 1J8YF 3TFOA 1LY1A 4MVRA 4MV9A 4NQZA 1W4RA 4UQOA 1FFEA 2DLNA 5IJZA 2G8LA 3GPBA 2JLXA 1IURA 2H7CA 3AFHA 1GFSA 3G88A 4JEHA 4MV7A 1KK2A 3WK6A 1VJTA 1S8OA 4CC5A 3P9PA 1VIDA 3HJGA 2ZNJA 5HXAA 4DB4A 1UPCA 1E9SA 2FR8C 3N5CA 4HQOA 4PIPA 1SK9A 3DBHB 3AJ8A 1JZQA 2RN9A 4CT5A 4EF4A 5CFZA 4D9HA 4IMJB 4RPHA 5E4TA 3RUFA 1HSOA 2QX9A 3DE0X 3BRQA 4UHKA 3CEIA 2NZXA 4EUNA 3T38A 2C2OA 4BBJA 4K0KB 2MSKA 2F95B 2F4VO 1WXXA 5DSZA 7ADHA 5BQ5A 1WKCA 1RHRA 3C1TA 2R1ZA 2ZEJA 3L5KA 5FFNA 1B04A 1MIOB 1O9HA 4JQOA 1XLWA 4BKQA 3NJRA 5AW8A 1BZYA 3WYBA 4E33A 2IH5A 3ER6A 4KBFA 5CK4A 1JDVA 3NYIA 2AG0A 2CK3G 3H6GA 5ENVA 3EASA 5F78A 3KV3O 5DEIA 2ZJZA 2APJA 3EUEA 2WMDA 5BUSA 1SG9A 3PUXA 2A9KA 1YVRA 3H0KA 1H2LA 1P74A 3HDGA 4MS3B 1LLUA 1JIKA 3K53A 4RS3A 1KSGA 3RARA 4C03A 1LBTA 3OAAG 2OOSA 3DCNA 1KZYC 3Q2OA 1LJ8A 1PG0A 2WR8A 4IXTA 4EB6A 1HM5A 2X9LA 4JC0A 4MWEA 3ODGA 3UYLA 2IUFA 1YAJA 2H94A 1GZ4A 3FZQA 2OV8A 4ZIBA 1WXIA 2PSSA 3LQRA 1Q0SA 3BIXA 2DWUA 3RJ9A 4ZI7B 5LMZA 5MHTA 1JF8A 3FCOA 5I5GA 1M57B 1YTFB 3DTTA 1VMKA 3F6BX 1C7EA 2M6KA 4DV0B 5KYVA 5BWLA 1Y5IA 4MVOA 4XDZA 1MVOA 2X22A 3DP9A 4FPPA 3O4JA 1DK1A 3AI2A 1RVV1 2B92A 1DJLA 4H7DA 4MNTA 3S27A 2OC4A 3W7WA 2FFBA 2UV8A 1G41A 3FFTA 1A9ZA 3OU6A 4B2IA 2A78A 4QNNA 5H81A 4I55B 4AICA 2QRHA 2WI8A 3BQNB 4A8JC 4GLBA 2O7VA 5FWYA 3AILA 4G86A 3SP1A 3ESBA 4Q7QA 5JLAA 3V3TA 1VYVA 4OOFA 3TCXB 5CN0A 4AVYA 1L5RA 1M74A 2QG6A 4QATA 4XDGA 3WDSA 1T0JB 4PVDA 3EEBA 4MJXA 2O20A 4V0QA 3CF4G 1QCYA 3IALA 2C4NA 4HLUC 2HHHO 1P5RA 4TVKA 5BSHA 5LQJA 4TUYB 5K3SA 2IA5A 2X6CA 3X44A 1Q7GA 3HB4X 1GR1A 2LPMA 4WT7A 1JI0A 1Y80A 3R6GA 4K9QA 3S2FA 3K9SA 1G20E 1L4FA 3R5FA 3GLIB 4NCJA 4QNRA 4JPRA 3KAKA 4MGYR 4UBMA 2JFXA 4GX2A 1S3JA 3FUVA 3A4LA 1ZMTA 2GLUA 1ANKA 5DNCA 1TYDE 3O1JC 1QS0B 2VRWA 4EG3A 2QVZX 1URFA 2PK3A 1CJCA 1PL8A 5AVXA 3TGPA 1Q1AA 4WRRA 1AC5A 4FYIA 3PLNA 3DTVA 3DZIA 4GEGA 1NONA 4KTTE 4LJ4A 3MAJA 2H8GA 1QDLB 5DHTA 5AVQA 2RHOA 2IV2X 3QQ5A 3Q5DA 4D9KA 4CL2A 2VKTA 4XUCA 1VRVA 2GVDC 3LPMA 3VR6H 3TQOA 4REQB 1O77A 4QUIA 3A2FA 4TYNA 4ZC8A 2FDCA 4PZEA 3DXRB 1FY2A 1G4AE 1BEUB 2GGSA 2F3UA 4DVJA 1JLSA 1PV2A 3QMWA 4DC0A 1WSDA 3KKMA 2JH9A 4CM8A 3ZS8A 4A8JB 3GNLA 4NTXA 4Z86A 2WAOA 1KDTA 2ATIA 4LZAA 1HYQA 3HB5X 4CG2A 1ITZA 4HGNA 4E7PA 5AW6A 3F5MA 2PJUA 4WESA 3SZ3A 2YOFA 1YB4A 1QQBA 3TBFA 1MX1A 1CZLA 1XTBA 3OCZA 1AUOA 3VGJA 2FPXA 3NDRA 4FFBB 4KUHA 1IIBA 3M99B 2AMFA 2IP1A 5DHFA 1VC2A 2XUHA 3LT5A 4ZDKA 2RGAA 3F0TA 1YK0A 3AFIA 3RSZA 4C2BA 1V1MB 1DC8A 3JD0A 5EZSA 1OPRA 2A94A 2CJYA 3P71T 2QTOA 1PZGA 4WSOA 5LYYA 3KHKA 4Z3OA 1L4BA 1ZH4A 3HVUA 3H5TA 1AV7A 1V9CA 3EVGA 4Q1DA 5FH9A 4YMIA 3RVLA 2P0YA 5KTMA 1D2HA 4QFMA 5KQSA 2NZYA 3FDZA 3QELA 3I9LA 3ESYA 1FUUA 2YQ5A 3L04A 1NF9A 3FF4A 3QELB 1W2HA 3HI4A 2FPIB 5C34B 3CRNA 5LM3A 1EJ2A 1M8KA 2QX8A 1POXA 3PVSA 3A1UA 4JLVA 3STTA 3QM1A 1PEKE 2OHGA 4F0JA 5K0FA 2YMLA 4YJ2B 2HA7A 5JO0A 4MPPA 4XTCS 5A7HA 3ADOA 3D0OA 3ZZUA 2A8YA 4FJ1A 4HDKB 4R1UA 4UTPA 3OUSA 2XUQA 1BC5A 3LY8A 3NGLA 1PFGA 1TEVA 3T3OA 4FE3A 2PU7A 1KNQA 1ADYA 1UKZA 4G9GA 4HDSA 2EYQA 2N3ZA 3UGJA 5A4JA 1G2OA 2ERCA 1R3IC 3MDSA 5BW8A 4MICA 4W7SA 2P2NA 4YT2A 3GLIE 2C98A 1N0IA 2DBZA 2VDOB 3EGDB 1IPEA 3OEHD 1CZRA 1G3QA 2GRUA 1OUMA 3M6LA 3PDCA 1CLUA 3D6TB 5B37A 4ZT4A 3ZVRA 3C24A 4N21A 1EEHA 1ENZA 1O95A 1WCWA 2HL6A 3LDGA 5AKKA 5LJIA 1R6DA 2DPLA 2YN2A 4FFKA 1DS6A 2IELA 3C8DA 4LJ7A 5TPWB 4FGKA 3ND7A 5HG0A 1SA0B 4IIEA 4O4JF 1XCPA 2WT9A 4IDGA 3J80A 3UANA 3B82A 1TUEA 1ZEJA 1UQTA 3H84A 3KDSE 5JSKA 1H23A 2XCIA 3HM2A 1PYOA 3C14C 3KYIB 1PQUA 1KWGA 1SF9A 5C52B 4JD5A 4Y1EA 4FMDB 2QTNA 3E4DA 4BNDA 1OKKA 2I34A 4MKGA 1WB5A 4UV8A 1YR9A 3D3WA 2IYNA 2G5CA 4M8SA 5CAEB 5KI6A 2IBZH 3BN3A 4HS9A 5D87A 5AK3A 2G0TA 3K0FA 4O3MA 3LE8A 5FTLA 1BD3A 1P31A 1F17A 2GBLC 2HQBA 3K9LA 4TRJA 1UR5A 1F7UA 3T1QA 1N33B 4R3WA 5DTEA 3L02A 1G3UA 4Z5XA 1AX9A 4YRBA 1I1HA 2A3RA 2V7QA 3OZ7A 5HNKA 3D6VA 3ID6C 4DRXB 3KTAB 2I1LA 3B6IA 1GCIA 5C1BA 4LF8O 4QPCA 3ZHZA 5L3QB 4EGAA 3OD4A 5CGZA 2Y1XA 4JYAO 1JMYA 2ZYWX 5K3BA 1ETUA 3VPDA 3WLAA 4KSBA 4FQ8A 3K2QA 2AVNA 5BUZA 4KJXA 1M3SA 1WVGA 1ZAYA 1Z5ZA 4UVCA 4HN4B 5AKIA 5K05A 2XB2A 4MP3A 2JLSA 5EN4A 3F6SA 3H5LA 2EIXA 5EKUA 2A4KA 4BV8A 3KCQA 4NZPA 4KHZA 2DU8A 4XRGA 3UCSC 4K88A 1QJ4A 1AQYA 4QO7A 4XQGA 4KREA 4D6TH 3BCSA 3QVJA 4U5XA 1WRBA 5NULA 1ZOIA 2G38A 3IOCA 1ZDMA 4JIMA 2HIGA 2IQIA 1JPVA 3OKPA 3W9BA 3WJAA 3GVXA 2VP4A 1YHNA 5DU2A 4BNTA 3WB0A 2F55A 1AP5A 3T5DA 1JHPA 1XZKA 7AT1A 2WJVA 3OUZA 4Q5IA 1JLLB 1MO4A 1R5JA 4HO1X 5KS2A 1I9CA 3MAAC 2UUAO 1KVQA 2OBXA 1L4NA 4P86A 5TEWA 3K20A 5FOXA 4D3FA 4R71A 4EB6B 2B5WA 3EFEA 3VR2A 5KNDA 4DEXA 3LVQE 1ZRMA 4EZEA 1GNPA 4L0CA 2FSIA 5KMGA 4W8GA 3KC2A 4XPZA 3CB4A 1HMYA 4GSYA 2XB4A 5J5AA 1U6JA 2WPNA 3A6GA 2Q3MA 1B16A 1WP4A 2P78A 1XUQA 3ZH2A 5BURA 5J2UF 1JG2A 3JQAA 1N4AA 3EE6A 5TC4A 3PUIA 2JRIA 3F5QA 5ITSA 3OF5A 1E32A 4FZRA 5F4ZA 1YR7A 4HP8A 1T0IA 4ZVSA 4CJXA 5BOSB 3NWPA 4V0OA 2FN7A 4Q16A 5CXQA 4R8SA 2GK3A 4OG2A 4EFDA 9MHTA 5CX1B 3FRHA 1NRIA 3GVMA 1DHTA 4DIFA 4ZOQI 4Q3CA 3BHPA 3CPEA 1HQYE 3FMOB 4W1PA 5C7IO 1PLJA 1N5JA 2YHUA 4YRPA 4B83A 2C94A 1A76A 1M1YB 5BYAA 2ZIWB 3SYAA 4BKMA 2C9OA 4V38A 3TOSA 2NUTA 3IEVA 3FY4A 3O03A 1B6TA 4TXNA 5DBHX 4DC9A 5HQ3A 2VPIA 4GQBA 3T4EA 2IV3A 5FD8A 2QSYA 3OTWA 1JR9A 4N6GA 1G4HA 5DM70 4CE6A 4G0ZA 2E87A 3DT9A 4J7UA 2OVBA 3FHLA 4DA0A 3P4YA 2Q2OA 1LH0A 2IY9A 2P7IA 4KYIB 4UEOA 4QFBA 2RBEA 3ZHCA 2JATA 3DSRA 3LC0A 3OTIA 3AUJB 5L4SA 2KJQA 2XYRA 3W7BA 1AZSC 3LQYA 3U2QA 3VR5A 3I2HA 2QRVA 3QIAA 4IQ0A 1IYZA 3DKKA 2XOKA 1ZUQA 3W5HA 2ZCJA 4LQCA 1ECBA 1EFLA 3BABA 4WCVA 2LE0A 1U3WA 3O4HA 5L95A 3QXJA 4YJFB 1FFCA 1CFZA 5EIAA 1SUWA 5C5CA 1ZINA 1DWOA 3KFLA 2PRIA 5AVZA 3U13A 3V7NA 2YFYA 1TAEA 2AXEA 4MW8A 4EQ6A 3T1TA 3C3YA 5GWXA 1IZ7A 4Q21A 2KG7A 2H52A 4KFSA 5JS7A 4LWSB 1CBUA 1E9AA 2PT5A 3TQCA 3VSBA 2GJAA 2WYHA 5F2KA 3TQRA 4PZCA 1T2CA 4KYUA 1JFVA 1BDBA 2JFHA 3MAGA 4ZRDA 1FEZA 2HRQA 4LQDA 4UNQA 4WCEV 3TVTA 5CLHA 4K9OA 2A5JA 1NBEA 2HSGA 3C6QA 3ME5A 3QKRA 1MV5A 4M22A 1W46A 1W4ZA 4P5DA 4RPJA 1U3VA 1C3VA 1L5HB 5CX4A 4Z9FA 2WJJA 3K70C 2QP3A 1UBSB 1KMMA 3BYZA 3AY6A 5CH8A 3NLLA 2FPGB 3D0RA 4H3KB 1V6CA 4CV2A 1FUYB 1T24A 3D64A 3KOYA 4IXMA 2AEJA 4ZCRA 1CUXA 1MHPA 3ASNC 1JHMA 2X7XA 4OHCA 2LCIA 1R64A 4K2HA 2IOFK 1JKJB 1HGXA 4WZAE 3DGEA 2FW6A 1OE0A 4A23A 4D9FA 1U5BA 3FLEA 3UICA 3DHYA 2W2LD 3VR3D 2AEEA 3X1ZA 4TXLA 2ZDIC 1VQPV 2ZLBA 5DHSA 2C5HA 4JZ2A 1F0NA 2HQ1A 5DW3A 3DBRB 1W88A 1B0ZA 1SXJC 1FTWA 3CZPA 4KRYA 2WVGA 3M8KA 2OECA 1O96A 1XLTC 2GN9A 3H86A 3A0RA 1LWNA 1LTHR 3O26A 3P9CA 4GWGA 4KO4S 4PSCA 1XGKA 2VWGA 1SBNE 2JGAA 1THZA 3BOSA 2R87A 1P7ZA 2GD0A 1P8AA 2JIZD 3P1JA 4HB3A 3EK2A 4L9WA 1Z08A 4MPDA 3OTOB 1DX6A 2ZJAA 2EWVA 1UFQA 1HY3A 4IEEA 3A06A 4Q7KA 1O95D 3UIEA 4KQ9A 3TJTA 1S8FA 1V1JA 2NO1A 3A9SA 1K4MA 5HMMA 1Q11A 2D3WA 4EO4A 3LGAA 3W9UA 1A27A 3OEHA 3DE5X 2C0CA 3LBIA 3WV4A 4J9ZB 3G68A 3PD7A 4KX3A 4ONEA 1C0KA 4Y2RA 4AF7A 3Q3JB 4REOA 3RSQA 3QLVA 4EVSA 4K5QA 2ZYVX 1TAUA 2VZ8A 4Z1VA 3FFBA 2A5FA 2BYTA 3CCSV 3MHPA 4J7XA 4X00A 5JTUA 4LX8A 3BJZA 1EFDN 1NVPB 2HRCA 2YWJA 2QSAA 3RFFA 2PX0A 4IUCS 4PSUA 1LC0A 1JP7A 3PC4A 4R31A 2P9TA 1DOZA 1I0LA 5CFRA 1U2ZA 5FADA 3MGKA 1MAAA 1FOEB 3NHWA 4Z8YA 1SCUB 1I7FA 5LBQA 4U0JA 4IT5A 1MBZA 4D4IA 2ZVJA 4AJNA 1J95A 4M9CA 2X0RA 2H6EA 4EQ6B 2H2DA 3WSTA 1KJ9A 1LV7A 1C9KA 2OCXA 3DV0B 1I4LD 1UDXA 1RRKA 1ULHA 1P5ZB 3MJEA 3URKA 4A16A 1CUZA 1SB9A 3DMGA 2O8EB 1SZTA 2W2KB 5AI0A 4B7XA 5F3DA 4YQEA 1IVYA 3IYLW 1JR3A 1UJMA 3PUHA 5FO0A 2Q6VA 3T7EA 3ZWAA 1H2RS 2QTLA 5DN6A 3UJPA 4C7OA 1GPDG 3GLHE 4BIUA 3CNQS 2Z2XA 1NE2A 4E4YA 3SZGA 4CR6A 3T3GA 1EZ1A 1ZMRA 1YS1X 4WCFA 2E82A 1XL1A 2HGZA 2V0GA 3T3PB 1EFKA 3U1BA 1SQQH 3FX2A 2W4QA 4IIVA 2PPLA 3PGA1 2NTYC 5LDDC 1DG9A 1M8PA 2VBIA 1MO5A 1BDIA 4MUEA 4FLXA 1CP2A 1RJ9A 4C08A 3V33A 4P35A 3IVMA 2NSDA 2WNSA 3TRDA 1L5FA 1F2DA 2BCEA 2DQZA 2VUHB 2Z30A 3IKMB 1FYDA 5AW3A 1TTTA 2JLRA 3BIWA 3O8BA 3I01A 1RYNA 1JNYA 3W2TA 5D1HA 5T57A 4YPVA 4J7ZA 2WYOA 3B7PA 3MWJA 4HDMB 1WXHA 5KJ1A 1C1XA 3WAGA 1X1DA 1UF9A 2J5KA 3L4BC 1LSOA 1N6PA 3PNYA 1NNEA 1KP9A 1NMYA 4X95A 4G6ZA 1DAIA 4MVJF 2IYQA 2XUOA 2XT0A 3T41A 4LH6A 1DAKA 2C4HA 3I05A 3L8EA 4HWRA 1GTRA 4BB9A 2VPWA 2F3TA 4H4DA 1CRZA 2OBBA 4DTCA 3A3NA 3OP4A 1KTIA 3OQMA 3BXOA 1ZL8B 2PX6A 4ND6A 3W5BA 1BH2A 3O5AA 1TA8A 1BYIA 1IHPA 3GGGA 2AR0A 2ZXEA 1OAKA 3MF4A 3QUQA 4GOXA 1AKYA 4DR5B 2DTXA 2JLQA 1VP7A 4JOQA 1S2GA 2K7ZA 2QM7A 4FS8A 1T9ZA 2XOXA 1ZM4A 1J1ZA 4DK0A 2ZB3A 3OCVA 4N49A 2PVSA 4BLUA 2JNWA 3H4VA 1QU3A 2CL6X 3NBFA 2BEVB 2CN1A 1AO0A 1Y1TA 2D06A 1JDBC 2XE7A 4IQFA 4IGGA 3DCJA 2ET6A 4JLAA 2E9SA 3NZEA 1JFRA 1ST3A 2Z3WA 3E9EA 4N39A 4TQ9A 2J4DA 3R76A 3ZDFA 3LHDA 4E6PA 1VSBA 2QE6A 3TG8A 3H1HH 1AOXA 3DEYX 4NMWA 1PWZA 5JSZA 3U0VA 1JE0A 1VJ0A 3WL5A 2CFTA 2I6QA 1EBBA 5BNZA 1X4TA 1C8BA 4FOSA 1GTZA 2JJ1G 4GG1A 4MQ4A 1HLPA 1OZFA 1Q7BA 2JRLA 5E2AA 5BSRA 1ZK1A 3TLBA 3U9LA 1L7NA 4NMXB 5KYGA 4X84A 4EHDA 1IM5A 4EMBA 2GILA 3Q10A 1IONA 3RS5A 3AW9A 3G0DA 4ARAA 4NK5A 3RK0A 3TEMA 1I0IA 1RC0A 1IHYA 2YY5A 2KSDA 2X13A 4P30A 1QOQB 1R4NB 3OPMA 4WVLA 1CR2A 3PFHA 1BGXT 1TMGE 1H1LB 1D1TA 1P7CA 2ASEA 2Z8ZA 3DBIA 4G9BA 2O2ZA 4D02A 4DR6O 2O0LA 3MS7A 4GBED 1FSFA 4HMQA 4HDCA 4BNNA 3T5CA 2E75B 3ESQA 2GQ0A 3X1MA 1GPWB 3LSYA 1EFHA 4EARA 3JAWA 2WWYA 1NXWA 5JBNA 3S6JA 5CNIA 2MYNA 2BFWA 1Y4UA 4NKGB 1EFUA 4NOLA 1N57A 1A5ZA 3IVRA 5KHGA 1IY0A 4MGZR 4DKJA 1XDGA 4RD2A 3T7DA 4E2LA 1KY5A 2NPOA 3NGXA 2Q07A 1F4LA 3HL0A 3C6XA 3Q1KA 4P34A 4R9VA 1XAHA 1UINA 1CUIA 3EAGA 4G65A 2FUG1 5TDHA 1N2SA 1P2BA 4LRUA 1XMIA 3PN1A 1JEDA 1EA7A 2H1IA 3AM4A 1S0VA 1CWUA 1H0HA 4TKVB 3HEMA 4U2BA 2C7RA 4LV8B 1WDWB 1MB9A 2WHPA 2ZXUA 3BL8A 3HM9A 4P4LA 1DIAA 2Z3VA 4M9SA 1CX9B 1UOQA 1Z33A 4PBRA 4QBFA 2VN8A 1ZH0A 4KQCA 4LUCA 4UASA 3WTCA 5B57C 1AXEA 2OK8A 4WOKA 2WWFA 5AW9A 4Z2WA 1TX4B 3NJ4A 1WHTA 2HK9A 2ODPA 4M8IA 4PG4A 1QF7A 5E4JA 2ZYSA 3OQBA 1AMNA 1HYEA 1L9KA 2C2YA 2PFKA 1SBHA 3FVVA 4M55A 5FORA 3PDIA 2QGNA 2EIHA 5FUMA 2HTEA 4OHVA 4F2GA 1F7YA 3RBAA 4AECA 1AHNA 4UVIA 2ONKA 4YRRA 2Y6UA 3HPRA 3B6JA 3FB7C 5JJNB 2P75A 3PJDA 1P4SA 4K6MA 5CRIA 5EE3A 1NI5A 4JI0B 3AQIA 4DY4A 3WNZA 1BO6A 4DR1O 1RJEA 1BT8A 2OHIA 4QDOA 1FFBA 4LK3A 4HWKA 1U65A 3OMXA 1PX0A 3CW9A 3C3WA 4JYYA 3E3NA 4XYBA 5BT8A 4I08A 5LYJF 3ROEA 2J5QA 4LSWA 2H7YA 2NTVA 2ZE7A 4NWIA 4PXSA 1O6GA 2AWNA 4J10A 4LF7B 4IKPA 5E6RA 5GV8A 2RGNC 3DVLA 3VOSA 4BWFB 1WB7A 3QX8A 5EQJB 1TMOA 1LK0A <