1YSCA

2.8 angstroms structure of yeast serine carboxypeptidase
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
421
structure length
421
Chain Sequence
KIKDPKILGIDPNVTQYTGYLDVEDEDKHFFFWTFESRNDPAKDPVILWLNGGPGCSSLTGLFFELGPSSIGPDLKPIGNPYSWNSNATVIFLDQPVNVGFSYSGSSGVSNTVAAGKDVYNFLELFFDQFPEYVNKGQDFHIAGESYAGHYIPVFASEILSHKDRNFNLTSVLIGNGLTDPLTQYNYYEPMACGEGGEPSVLPSEECSAMEDSLERCLGLIESCYDSQSVWSCVPATIYCNNAQLAPYQRTGRNVYDIRKDCEGGNLCYPTLQDIDDYLNQDYVKEAVGAEVDHYESCNFDINRNFLFAGDWMKPYHTAVTDLLNQDLPILVYAGDKDFICNWLGNKAWTDVLPWKYDEEFASQKVRNWTASITDEVAGEVKSYKHFTYLRVFNGGHMVPFDVPENALSMVNEWIHGGFSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE CARBOXYPEPTIDASE
publication title 2.8-A structure of yeast serine carboxypeptidase
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase(carboxypeptidase)
total genus 115
structure length 421
sequence length 421
ec nomenclature ec 3.4.16.5: Carboxypeptidase C.
pdb deposition date 1994-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00450 Peptidase_S10 Serine carboxypeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.410 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1yscA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1yscA01
3IUNA 1CFJA 2H1IA 3M81A 1D07A 3BF8A 4LXGA 5KBYA 4AZ0A 3L1IA 1EDBA 3PF8A 3FYUA 4OYYA 5HZGA 4OD0A 4BZZA 1QIEA 2BAGA 2C7BA 2XUAA 4AZ3A 3G02A 3G0CA 2AXEA 5AICA 2XLBA 2QXUA 2QT9A 3U1TA 1JT2A 4BYMA 5JATA 4WJLA 5C81A 4PSDA 5I7UA 2JGLA 4G4JA 4QWMA 2VTVA 5IVHA 1R88A 4XWGA 1TK3A 3V1NA 3N2ZB 4UFNA 2C5FA 3FAKA 2VF2A 2WTNA 4ZREA 3DDUA 2JGEA 5K3CA 4G1FA 1CUCA 5AOAA 1QFSA 1SC9A 3FLEA 4EBBA 3TJMA 5T4BA 4B6GA 2OLEA 1BRTA 3BL8A 2XUOA 3C8HA 3H19A 2DHDA 1UOQA 3VXKA 3WQHA 2V9ZA 2V96A 1QE3A 2OCKA 1IMJA 4ZXFA 3WKCA 1M33A 2B61A 4L9AA 3FVTA 3DYVA 1O6FA 2HFKA 3WWPA 2WG1A 3B3QA 3V1KA 2B4KA 5AI5A 1DWPA 1TAHA 3HXKA 1DT5A 2WFLB 1XRMA 3JW8A 1QJ4A 4AX4A 3PICA 5DNVA 4EY4A 4CCYA 4BC1A 1K8QA 3F98A 1CUGA 3D4LA 3FYTA 3Q0TA 1XZEA 4E14A 1DINA 4X71A 5AI6A 2VJDA 3K6KA 5ALKA 1J06A 4XJVA 5AH0A 1B41A 2PSEA 1VE6A 1VLQA 4KAJA 2WQZA 3V9AA 4Q1VA 1MAAA 5LZ2A 4Q05A 1F6WA 1T4MA 4NZZA 3GZJA 1HQDA 3ESBA 4G4IA 5ALZA 5JAUA 3IVMA 4INZA 4A16A 1MNQA 3WA7A 4P08A 5EHNA 1EDEA 4DSZA 1CRLA 4P93A 5AKGA 1CLEA 3H0CA 3A2NA 4OB7A 3H2IA 3ZLVA 2C58A 1CUUA 4EY7A 4Q3KA 4KE8A 1JI3A 5KREA 2HU7A 5ALOA 3AILA 2Z3WA 5BV7A 3HSSA 3FCXA 5AKEA 3KD2A 4BBZA 4H7DA 1BU8A 4HVTA 2B9VA 1N1MA 1VZ2A 2I3ZA 4DTCA 4J03A 4CIAA 3STYA 1ZD4A 1GKLA 5HFAA 2Z5GA 4MJ3A 2XQJA 4MYSA 1ZJ5A 4H7EA 4IH1A 4B85A 3OTQA 1ZGCA 1BCRA 5T4FA 2ES4A 1XQYA 4AO6A 1TIBA 5FXMA 4FLMA 4J0DA 1FFDA 3IUMA 4ZI5A 1E8NA 4X97A 1YS2X 2WJ3A 3DL7A 2XMRA 1Y7IA 4ZV9A 1YB7A 3KSRA 2JGKA 1HL7A 5CBKA 3RLIA 5JANA 1CVLA 4PSCA 4X91A 1IUNA 3WYDA 1EINA 2DQZA 2RAUA 2ECFA 2XQGA 3B5EA 4ARAA 5LIPA 1GPKA 4PNZA 1C4XA 1RYYA 2QUAA 2YYSA 1A8UA 2PVSA 2J4CA 3IUJA 1A8SA 3QVMA 4FLFA 5DJ5A 2RHWA 3QPDA 3R3XA 1YA8A 3OM8A 5IVKA 4J7AA 4W63A 4UHEA 4BDSA 1CV2A 4H7JA 4E11A 3G9UA 1VE7A 3WA6A 2ZYRA 3WK7A 5AKZA 5CH5A 4CCWA 4KE9A 1G4HA 4BC0A 2AJDA 1EX9A 4DNPA 5A2GA 5JAHA 5AK4A 3WIOA 4BAZA 2H9YA 5AOCA 5J3JA 1R1DA 1ACJA 4FKBA 3R3UA 2Y1KA 3CN9A 4B81A 1LZKA 2Y2VA 2FX5A 3LCRA 3O4JA 4UBNA 4EB0A 3R3VA 4LYEA 1UOOA 2VSQA 2XMBA 5AKHA 5CXXA 3F96A 3CCCA 4WDRA 5A62A 3VVLA 4WDQA 3HEAA 4RPCA 5ALYA 3SWWA 2BCEA 1CUBA 5ALNA 1ETHA 4CFSA 2BUBA 4HXEB 3FNBA 1C7IA 1X2BA 1G42A 4FFWA 5AM4A 1QIDA 1FFCA 1Z68A 1EA5A 2XE4A 1A88A 2HA7A 5LZ4A 2AJ8A 4GWLA 1IZ7A 5CT5A 2QRUA 1CUSA 4UHFA 3X3HA 1E89A 4BE4A 2WIDA 5ALJA 1BN7A 2G5TA 2G5PA 3KDAA 5F4ZA 4NMWA 5I9IA 2V97A 4N8SA 4MEBA 5FPQA 4UHDA 1ZGBA 1W6RA 2WILA 1F0NA 2WU4A 2WFZA 4Z49A 3FWHA 1THGA 1GGVA 4JUIA 3F67A 2ZSIA 2XQKA 3O9VA 1DU4A 2VAXA 4ARBA 1AUOA 2VEOA 5LZ8A 4DMCA 1Y37A 1XQVA 2BFNA 4KR0A 4K6GA 5ALQA 4PO3X 3DD5A 4CI9A 5AJHA 3L1HA 4DLNA 2WHQA 2R8BA 5AIBA 3DYIA 4BP8A 5JD6A 2OGTA 1HBJA 4YX9A 1JJFA 3H04A 3WJ2A 1FFAA 1VXRA 1R3DA 4G9GA 1H2ZA 2XUHA 4JNCA 5HQ3B 4X6YA 4U2CA 4AB1A 2JEYA 1CIJA 3ZV7A 1THTA 4N5HX 1U8EA 2PBLA 3NOXA 4FBMA 3DL4A 4DMFA 2PPLA 2RIPA 4UBMA 5CURA 1CEXA 3PF9A 1WPRA 1O6GA 4Q82A 3P2MA 2OXEA 2CMFA 4MQMA 1EK2A 3SK0A 1WB5A 4QDTA 5FLKA 4B80A 4W1PA 1R50A 4Y7DA 3BWXA 3R40A 3AIKA 5FKJA 1EHYA 1MX9A 1UK8A 1N5RA 1X70A 2HHAA 4JEIA 4OSEA 4X94A 3STTA 1W52X 4A23A 1BS9A 4IO0A 1J1IA 4O08A 4EHBA 1IUOA 3ILSA 1MX5A 2D0DA 3B12A 5FV4A 2Z8XA 4NVRA 2QMQA 3M83A 5C8VA 5CXUA 3S2ZA 4F0JA 3A70A 1UZAA 5EIHA 3IURA 2WUFA 2WHPA 4MQLA 4LHEA 1KEZA 5AKLA 2WJ6A 3GUUA 1ZOIA 4RNCA 1CUFA 4BTVA 1E66A 4GW3A 3PUHA 1NU6A 3MGAA 5C7YA 3M3DA 5K3EA 1DT3A 3JWEA 1E8DA 1RWQA 4GI1A 2XUJA 3FLBA 4U2BA 3G7NA 3E4DA 1QFMA 2X76A 2HL6A 1P0PA 4FWBA 5A7GA 2WG2A 2WIKA 1ZICA 1HLGA 3I1YA 5BWBA 1EB8A 1GKKA 5D3KA 2WFLA 2G4LA 4IH4A 4HS9A 1BN6A 4D9JA 1UKAA 2QR5A 1AC5A 2VQ6A 3WK6A 5DWDA 2JIDA 1YR2A 2IIVA 1QIGA 2HRRA 4H77A 1FJ2A 3BXPA 4HXFB 3D2AA 3RM3A 2O7RA 2IX9A 2XMSA 4JYPA 1XZIA 2HA6A 3LS2A 4Y2PA 5ALHA 3IB3A 3R3YA 2G63A 3WKDA 3A2LA 1PJAA 5EHXA 1TCBA 3WWOA 4G4GA 3RKSA 3STWA 5ALMA 2XMQA 3IA2A 1AX9A 1QIFA 1HDEA 2XUGA 4HZGA 1S8OA 4LXIA 1PV1A 1GZ7A 1OILA 2R11A 5JALA 5LP1A 4DYHA 3E3AA 3ZLUA 5AKYA 4X95A 3I2GA 4I4CA 3WK9A 5C8XA 3WK5A 4DNFA 3ANSA 1X2EA 1AMNA 5HK8A 3WKAA 2K2QB 1ODTC 4DM7A 4AMYA 2H7YA 2XI4A 2WHPB 4QA9A 5T4EA 1CUWA 3ICWA 3FBWA 4CG3A 5CMLA 4W1SA 3AZPA 1UK7A 3AZOA 5K3BA 1G66A 4X6XA 5BWCA 1MN6A 1XZGA 2I03A 3I2KA 2DFPA 2VATA 3HRHA 5LYYA 4Y2QA 5JD4A 3C6XA 2CUTA 4GLBA 2ROQA 4EZIA 2O7VA 2XUIA 4PQEA 1UT6A 5EFZA 5AO9A 3DEAA 3ICVA 2BUAA 2Z3ZA 2WIGA 3OC0A 3M82A 5JZBA 5ALVA 2W6CX 2I3DA 5AP9A 2I78A 1U4NA 3ESCA 2WUDA 2GZRA 5E4YA 2OG1A 3QZUA 4ITVA 4DMKA 2HA4A 3D3NA 1QIJA 3D59A 2PSDA 1CUHA 1FSSA 1L7QA 3CXUA 2WUEA 1CR6A 4EA6A 3WJ1A 1XRPA 5FOQA 4ETWA 2QOEA 2AJCA 2FJ0A 3WIBA 1WM1A 5AI4A 3NWOA 4TPKA 1XZDA 3I2IA 5EI5A 4H35A 4UBJA 3WKEA 1ZIYA 4Q3LA 2ACKA 1H2YA 4F5ZA 4BVKA 3WKBA 1XZBA 2CBGA 1EXWA 4PSUA 2QZPA 3OG9A 5ESRA 2XUPA 3PFBA 2W22A 1JFRA 3C43A 2XMCA 2OAEA 1OCEA 1QIKA 5LZ5A 5HKAA 4BATA 4BTLA 3Q8WA 4UHBA 1Q84A 1CUEA 1F8UA 4ZWNA 1P0MA 2WIJA 4MYDA 2OCIA 2H7CA 2BGRA 1DWOA 3HJUA 1E8MA 1VKHA 5ALRA 4U2EA 4M0MA 1ZI8A 2BJHA 5CT9A 4HXGA 4EY5A 3DQZA 3EQ9A 2ONCA 1K5PA 3IULA 3PFCA 4KACA 1GPLA 1VZ3A 1XQXA 3PDCA 1B6GA 3G9XA 3O4HA 2XUQA 1CQWA 1L7AA 4DNQA 4EY6A 1WHSA 2JEZA 1VA4A 1KU0A 1DQYA 1ODSA 1VXOA 2OGZA 1BROA 3C8DA 3OURA 2JF0A 2WJ4A 2OQIA 1XZHA 2Z8ZA 1CUDA 5EHZA 4AQDA 1CQZA 3G9TA 1XRQA 2JGJA 1EDDA 4Q34A 4Y2RA 4FFVA 4K2AA 3FYUC 2GBFA 3QMVA 1EK1A 1XZJA 4J0KA 4Y2VA 3D5EA 1EVQA 2PKYX 3I2FA 4L0CA 1XZAA 2XUFA 5AIAA 2DCMA 4WFJA 1EB9A 4X92A 4H7HA 1YAHA 3HYSA 5ALEA 1SCQA 2JBWA 3RK4A 3D7RA 3VVMA 4OB8A 4HRXA 4C6HA 3E1GA 1YAJA 3QM1A 5AI0A 3V1LA 5K5EA 2OGSA 2OPHA 1WHTA 3OPMA 1YCDA 3KWJA 5IVIA 4PV7A 4AMZA 5AM2A 4MWTA 3GBSA 4X93A 1MO2A 5HF9A 5HQ3A 4DSAA 1VJ5A 1LPBB 3C87A 4A5SA 3EIOA 2HU5A 3AFIA 1LBTA 1EH5A 2GBCA 5JARA 3I6YA 2CEKA 5AHXA 1EVEA 3QBJA 1LLFA 4EUSA 4MWSA 1SOMA 5LZ7A 1YASA 3H2KA 3D0KA 3DKKA 3SC2A 3C6ZA 5ALXA 5D7BA 3WLAA 5C8ZA 3WL7A 4G8DA 5FUMA 3HLKA 4MEAA 1ZD2P 1QOZA 3ZLTA 1YA4A 3R41A 3VISA 2VA9A 5IVDA 1XKTA 3G9ZA 4OCZA 1Q0RA 1U65A 1MNAA 3AZQA 3TRDA 1QIHA 1P0QA 4B7ZA 4XIIA 1C7JA 5DYWA 5FPPA 3K2IA 1QLWA 4OUKX 3UMJA 1H23A 1JU3A 4GBGA 5LKRA 3S8YA 2DR0A 4AO7A 2WFMA 3KWFA 3MVEA 1AKNA 1LPSA 4WFKA 2QS9A 2BGNA 1LPNA 1TKRA 2X5XA 4BAGA 2GZSA 2YXPX 3D2BA 5CH8A 5ALWA 3UUFA 4K6KA 5AK3A 1QO9A 3F8SA 2WG0A 2GBGA 4ZV7A 1XROA 1QTIA 1E3QA 2D5LA 5AM5A 1ZI9A 5KWJA 2PSJA 3WWDA 4LXHA 1A8QA 5CW2A 1NU8A 5A6VA 4P9NA 5JD5A 5AK6A 2O2IA 2ORYA 4KRXA 4CIBA 4OB6A 3MUNA 1E5TA 4FBLA 2WHRA 1XLUA 3HABA 4JYMA 1DQZA 4W1RA 3G0BA 3W05A 5CT8A 1J2EA 1ISPA 2QKYA 4FHZA 4W1QA 4Y2JA 1MTZA 3F97A 3I1IA 4UFOA 3VKFA 2XT0A 3WK8A 4KJXA 3DLTA 4FNGA 5FDFA 3VDXA 4Y2SA 6YASA 1UWCA 4FLEA 3G0IA 4J0JA 4C4ZA 5AM3A 2VT6A 4CG1A 2WKWA 2PL5A 4N8DA 4FDMA 4X6UA 3K9BA 2EEPA 2QJWA 1H2WA 3YASA 2OAGA 5CTAA 1JU4A 3O9MA 2WU3A 4X90A 4MXDA 2PSFA 3BDIA 4L3WA 1BEEA 3WYNA 1T2NA 1UXOA 3QPAA 1XLVA 2RONA 1YS1X 3FVRA 4BCBA 5CT4A 2PU7A 4KE6A 1W1IA 1JMYA 3E0XA 2ZYIA 4BDTA 2GYVA 2JGFA 3WWCA 3OOSA 4RGYA 1HKHA 1QZ3A 4F60A 4KAFA 4KRYA 4QNNA 3TGLA 2RI6A 3H17A 4TGLA 3IIIA 4GECA 4UBLA 4OPMA 2GBIA 5EIAA 4H7IA 2CJPA 4YASA 4S0XA 2DSNA 4Y2XA 5FRDA 2VAVA 1R9NA 4LIPD 2WTMA 3ZI7A 1K4YA 3WZLA 2Y6VA 1H22A 3N0TA 1A7UA 1XRRA 5ALUA 5AK5A 2Q0XA 1ODCA 4H0CA 1AGYA 2H7XA 3C45A 4YK7A 5AKKA 5LZ9A 3LIPA 4Y2TA 4C01A 2WSLA 4OU5A 3C5WP 4QE3A 1TQHA 5LKAA 4FNMA 1HPLA 3O4GA 1ZIXA 3MUOA 1CUJA 3C6YA 2HIHA 3A6ZA 3QITA 2XQIA 2C0PA 5DYTA 5T4HA 4P92A 1GQSA 1UFOA 3ZPXA 3U0VA 3HC7A 5DYYA 3C6BA 4OYLA 3T4UA 2B20A 3EQ7A 4BZWA 4BRSA 5CH3A 1CUIA 2PUHA 5HKBA 1LPMA 1FFBA 1MJ5A 4G8BA 3LLCA 1FFEA 3H2GA 1MU0A 5BOVA 2LIPA 4G5XA 4E46A 3O4IA 1U2EA 2CZQA 2ZYSA 3G8YA 1GT6A 1ORVA 2FUKA 1LPPA 2ZVDA 4I19A 1VA5A 2E3JA 5JAPA 1QTRA 2ZJ7A 4Q3OA 2CB9A 2VJBA 2VJCA 4I3FA 2WLSA 1XQWA 3IBTA 4WCVA 1DWQA 3QMMA 5HF5A 2RGUA 2AJBA 5JAOA 5JYCA 4DMHA 1USWA 1MT3A 1AQLA 3F9CA 4U2FA 2EDAA 3EQ8A 2J4FA 1TCCA 1CUZA 3PUIA 5HCUA 2NW6A 2HADA 2PM8A 5K3DA 4FTWA 1SCIA 5ALIA 3IUQA 4QEKA 4X00A 1K63A 2XB6A 3AJAA 3BJMA 4ROTA 1BE0A 4G8CA 1EI9A 3BE8A 1TRHA 5LLSA 2QJRA 4UPDA 3STVA 2C0QA 2ZYHA 1UK6A 2UZ0A 1W75A 4XVCA 3W06A 5ALPA 1CUVA 1UK9A 5K3FA 2O2GA 1GQRA 1CUXA 2WIFA 3O95A 4C89A 1QONA 4UFPA 4UBOA 4QDZA 4X85A 1CPYA 1N8SA 3NUZA 3CN7A 2IITA 5E4JA 3VJMA 1QGED 4ZRDA 3BIXA 4QDOA 2QM0A 3QMWA 4B9EA 4HRYA 3UUEA 4QZVA 1GXSA 1ZD5A 3FOBA 4UUQA 4E15A 3PI6A 4GDMA 4M0EA 3DOHA 3L1JA 2DHEA 4B82A 4ZGBA 4M0FA 4BVJA 2QTBA 3FYUB 2Y6UA 1LPOA 2PUJA 3SX4A 3QH4A 3DS8A 2HFJA 4DNOA 2C4HA 3IDAA 5JASA 1CUYA 3I6ZA 3H18A 2PU5A 4BVLA 5AKIA 2GYUA 4GEGA 5H3HA 1Q0ZA 3G0GA 5A7HA 3D2CA 3W9UA 1XZCA 2BKLA 3WI7A 4W9RA 1OXMA 3HACA 1LBSA 5SYNA 3H1AA 1DX6A 3A2MA 5CT6A 4NS4A 3WL6A 4PW0A 1Y7HA 4J0IA 2HA3A 4GHWA 1VOTA 4X3CA 4TVKA 4N5IX 5D6OA 3DKRA 1RP1A 5ALFA 3DOIA 3VJKA 4CG2A 3AIMA 4J0GA 3W9BA 4QDXA 4AXBA 4Y9SA 5K3AA 4V2IA 3WMRA 1XZFA 3ESDA 1BCSA 3AUKA 4XX1A 5IH7A 1UKBA 2HM7A 5K3FB 4UHCA 3T52A 3TEJA 3NGMA 1LPAB 4AN1A 4BP9A 1G5FA 4CCYB 3W2TA 3I28A 1QIIA 4IH9A 1UOPA 3I2JA 3GFFA 2ZSHA 4LYDA 4C4XA 4B0OA 3WL8A 7YASA 3STUA 3R3ZA 2OCGA 3PE6A 3R0VA 1WB6A 2OQVA 2J3DA 4H7KA 2J3QA 3LIIA 4J3JA 1P0IA 1WOMA 5HK9A 2ZJFA 4QDUA 3FLAA 2XMDA 2BUCA 5JZ9A 5AI8A 1XKLA 5ALSA 1XFDA 2HA2A 3KOOA 4LKOA 1XZLA 4PF1A 4B83A 1SCKA 1YSCA 5SYMA 2ACEA 4F21A 1JKMA 4BAUA 4H18A 1UKCA 3WK4A 3G0DA 3BF7A 3I2HA 4WY5A 5DTIA 2YASA 4RE6A 5HFNA 3BIWA 5E4TA 1MAHA 5I8PA 4WY8A 4B0PA 1ACLA 1XZMA 3AIOA 3JYHA 2X8BA 1R4ZA 3WZMA 3EF3A 4UBKA 5D3ZA 1WPXA 4B9AA 1WB4A 5DNUA 1CUAA 2HRQA 3DNMA 4U2GA 5HF6A 2QXTA 1R9MA 2PSHA 2C5GA 3KXPA 1JJIA 3WWEA 2EDCA 4C4YA 5ALGA 5AKJA 3GA7A 4N8EA 1QO7A 4K5QA 1MX1A 4YPVA 3BDVA 3DCNA 4X7BA 3DJYA 2XDWA 4UHHA 5EHQA 2Y2UA 1W76A 2AJLI 1XRLA 1NX9A 1KU6A 4U2DA 1AURA 3V48A 5KWIA 5A7FA 2HU8A 3AINA 4Y2UA 2VJAA 1L7RA 1YB6A 4J0HA 5HF8A 1ZI6A 4KYVA 1Q83A 4KAAA 3FSGD 3R3WA 1TCAA 4H7FA 1W4LA 3EBLA 3ED1A 2WM2A 3GROA 2XLCA 5AM1A 2YH2A 1PFQA 5ALLA 3QPCA 5E2IA 1DTEA 5EGNA 4AO8A 2PX6A 5JIBA 1N5MA 1JMKC 1XRNA 1XZKA 4FOLA 4BCCA 1WCYA 4KEAA 4DGQA 5EIEA 3QYJA 4QLAA 2GYWA 5YASA 4C88A 2OCLA 1H2XA 3CCBA 1QIMA 2HA5A 2RHTA 4BCDA 4FMPA 2JGMA 3C5VA 3O0DA 5DLPA 3HI4A 2QUBA 2WUGA 4DIUA 2DHCA 4QLOA 3V1MA 5ALDA 5JADA 3WL5A 3H2JA 4Y2YA 5ISMA 1F0PA 4RE5A 2DQYA 4GXNA 3HZOA 4BE9A 3FCYA 4JH0A 3I6MA 1K6EA 3RARA 2JGIA 5AM0A 1IVYA 1LNSA 3ESAA 4J0CA 1XLWA 2XUDA 4BRZA 1ORWA 4UBIA 5A71A 4KE7A 2CKMA 2FJPA 3W04A 3ANTA 1LZLA 2QVBA 3STXA 1GPNA 1IUPA 2XUKA 4IQ4A 5AKXA 4OU4A 5ALTA 3VJLA 2HA0A 1DX4A 5DTJA 1I6WA 2ZJ6A 5FP0A 4G9EA 2V98A 4QWWA 4HTAA 2P8SA 1AZWA 1ZJ4A 5IKXA 4B84A 1LGYA 4IHAA 4AN0A 2O2HA 4EY8A 5DNWA 1MPXA 3BJRA 3ZWQA 3H2HA 2XQFA 1JJBA 3LP5A 1J07A 4K6HA 2XMGA 4WFIA 4HAIA 1SFRA 4L72A 4C87A 5AOBA 3H1BA 4BB0A 5AI9A 3FSGA 1ZD3A 2HDWA 3GELA 5CRIA 1IZ8A 2XMZA 3C70A 2VT7A 1BEZA 5JZSA
chains in the Genus database with same CATH superfamily
3E03A 1I6KA 1TAGA 3B48A 1D07A 3NONA 4QBIA 1ND6A 1UKVY 3FYUA 3V4VB 4RM2A 2G67A 2ZNJA 2VF4X 4BZZA 2QU7A 3ZK7A 1PJ2A 4EYGA 1YJNV 3JATA 3SZLA 3WGJA 4CEIB 4DLWA 3INTA 4WJLA 3CPHA 3CF2A 1PS8A 1K6JA 1E77A 4UNSA 2B9ZA 1GNSA 2GJSA 4ZN6A 2C5FA 2WTNA 5FWNA 1NMZA 5AOAA 1EFAA 3VR1A 1NU1H 2DHDA 5DP2A 3MLAA 2HSGA 3RK0A 2GZMA 2Y9PB 2B99A 1FE8A 1YI8A 2EBUA 2VUHB 3WMEA 1ZHFA 2WJAA 4OF4A 5BRAA 4BUZA 5JU6A 4QU9A 3PFGA 4BN4A 2AUNA 1S2IA 2EBWA 5JE8A 1Z2EA 3RWBA 1RM0A 5IXSA 3SY8A 1EFCA 1OBOA 2HJVA 3DVQX 2ATXA 3A05A 3SLKA 2V6GA 3B3JA 1FRNA 2IY8A 3DAOA 1F3LA 1F6WA 4FDTA 5DCYA 4PFJA 2G1PA 1JR6A 2PEZA 1KMCA 1ZZEA 3D0OA 2B1IA 1YBFA 3CRW1 2B98A 2ODNA 5K45A 2B6NA 3EFHA 4FWIB 4J3FA 3KD2A 5JNWA 1QR2A 3SPJA 3UVEA 2ZW9A 4Y6GB 1D09A 3SVZA 4BFTA 4L5IA 5FPHA 2R8RA 3ZCQA 4D8WA 3KBOA 5AR1A 1ZZGA 4IV5A 2VDLB 3N8NA 2GRAA 4HSEA 3BFJA 2UXCB 1W2HA 4POOA 3K8ZA 1UP7A 1H65A 4PLZA 4B76A 1X94A 4JC0A 3ZNNA 5C5CA 1RWMA 1RJWA 3OD5A 1VLLA 2GFHA 5HGXA 1QHGA 1CU1A 2RAUA 3UW3A 5CDUA 1A8UA 2PVSA 1M10A 3OTOO 2ZBUA 4YYEA 5H9CA 4RK5A 2W4MA 4C4PA 3KQYA 3W77A 4F4UA 4DBZA 2QR3A 1NMSA 2XHEA 4CN9A 3LY8A 5ULLA 1TUBB 2AGVA 5BURA 4XWYA 4CCWA 3ZMUA 1ADBA 3DMGA 4BC0A 5DXFA 1JNYA 4R8CA 3K9AA 5A2GA 4H17A 3TSCA 1ACJA 1GP2A 1VL6A 4JYZA 4FKBA 1D4OA 3H3FA 3WS7A 5B1NA 3CV3A 3TCXB 2XQVA 1NW3A 1VSUA 1IE3A 3R3VA 1UOOA 3C98A 3QI2A 4RVGA 1EVYA 4PYLA 3O2QB 1T34A 3WRWA 1ZCJA 3IOYA 5B7GA 3FNBA 4FSHA 2F1MA 5BV2P 1EUZA 3PS9A 2B4TO 4UVGA 3ABLB 5DI9A 2J08A 4QDKA 3AESA 2IV7A 2DWQA 1IZ7A 3UJPA 3K0GA 4HWSA 1E2BA 4BE4A 3ZLJA 4NNOA 5E2BA 3RREA 3JSXA 3KDAA 2A67A 2IJGX 2E48A 4QYIB 4HNAB 1UMKA 1MVOA 2OBXA 4NZMA 3G2HA 2XNKA 2WFZA 4IDOA 5EJ9A 2Q4OA 4P7FA 2XQKA 1KP2A 1AA9A 1F2VA 3K2BA 3IAM6 2HCJB 2HKOA 3KELA 3ZJ4A 1E5LA 3QWBA 2XCUA 4PX5A 4D97A 3HCNA 5IYDO 4P7KA 3Q11A 5LMCA 1KI6A 1GPJA 3GRCA 5CFPA 1VBKA 1Z82A 2ADOA 4AB1A 4BNMA 4OI2A 3H11B 2A9FA 1R0SA 4DMFA 4ZYTA 1ML3A 4DV4O 4RQTA 1L7EA 2E2WA 1O6GA 3MWDB 5IWAO 3V9PA 4MV4A 3DKPA 1QK4A 1Q7YW 3FSJX 1TKCA 2P62A 5IM4F 4ABMA 3QVVA 3UPUA 4G1UC 2EFDB 4C6TB 2XVYA 1YXMA 3IRUA 3ZVNA 5EVCA 1Y3BE 1C7QA 2QMQA 2P5OA 3CZ9A 3TNJA 3IMCA 2PUAA 3WB0A 3IURA 2WUFA 4BIUA 3ROPA 5AUNB 3P9PA 3CR8A 4NAHA 4PZPA 1ZOIA 1R0CA 3CQ9A 2PBZA 3V8EA 3UCXA 3N58A 2PUDA 3G5AA 3EQ2A 1OA1A 3FNHA 2Q62A 4ZVMA 3FPEA 3E4DA 4PXAA 3KZVA 4NJEA 4IUCS 3TSYA 3HEBA 4G0QA 2GD6A 3AHCA 4ER7A 3FCEA 4EQZA 2XCRB 3LO5A 1EM8A 2F3UA 4O59O 4IDQA 4ZU6X 3BXPA 3OX2A 2FMIA 1K68A 4ESEA 2ISQA 2GB4A 3BDAA 4TXHA 1V1RA 4WXHA 1Z8HA 4RESA 1PR4A 1MJNA 1IBKB 5DGHA 1FUYB 1HK7A 3NATA 4PLCA 1OXKB 4TMKA 2NUPB 4AUNA 2XMQA 2FEPA 4LSGA 5IK2A 4L4SA 4DL9A 2GZDA 2OB2A 2IU0A 5GAJA 5JALA 2CV2A 1SUWA 2CLDX 4W4KA 3PC4A 4BFLA 3I2GA 3VMMA 3WK9A 5C8XA 5CNKA 3OGCC 2GN1A 2WE7A 2VPQA 2GN0A 2F90A 2YUIA 2VDJA 4IX1A 2C54A 1WB7A 3BD8A 1S4MA 2O8BB 4E4EA 2H2HA 3AZPA 4DV7O 2YJ3A 1G66A 2FQQA 4N01A 4CDNA 2IODA 5LYYA 2PD4A 2OZLB 4NCKA 4G41A 4KMSA 3DHNA 1CQJB 2O7VA 4FDVA 4Q9JA 2PGAA 4FYHA 3JYLA 1D1PA 2QTMA 4D9CA 3RHTA 1CP2A 2AWOA 5ALVA 2JH9A 2WJIA 2W6CX 4WXPA 4U7TB 3ECSA 5NLLA 2HLPA 2Q1WA 4WCFB 1ONSA 4Z6KA 3SZRA 1DAFA 2IHKA 5KKCA 1QVGU 1Y80A 5AYVA 4MPJA 3QLVC 5SZHB 4U2KA 2DERA 4MEJA 1N5KA 5A0FA 3OICA 4D3XA 3KJXA 3JZAA 3LSSA 2CHVA 1TM5E 5A0VA 1YV9A 3O8NA 1ROPA 2H48A 5IAGA 2W0XA 3UGTA 4A8PA 4FGWA 3WKEA 5J5AA 1EFLA 2QRHA 3IERA 2H29A 1I3LA 3CZQA 1EXWA 4KVZA 2W22A 4CIXA 4KUGA 4ZT3A 2XTAA 4NBKA 3ENKA 1F8UA 3GZNB 4XM2A 5BN1A 1KOJA 3EIUA 4R9RA 4NATA 1SQXH 3QVKA 1F6BA 1XAIA 4K9OA 5BORA 2PAFA 1SQ5A 2VJPA 3KZ1E 4HH4A 1FL9A 2EW1A 1RS0A 2CJXA 5AVVA 4I99A 4M0PA 2AD5A 4LXQA 3CPJB 3CJHA 3QFCA 2DPLA 3OBBA 3PNBA 4OJKA 3D8UA 3GLVA 1CQZA 5F3WB 1XF1A 1US6A 3IEVA 4K2AA 3FYUC 2FJUA 5ELMA 4HHEA 1N3LA 4MGEA 2Q4DA 1TUEB 4ASUA 3BJEA 4W5RA 2VP3A 2JBWA 4M36A 4E07A 1TZBA 1WIWA 4R1UA 1N5IA 1RRVA 3SKXA 1M73E 1TW2A 4FDLA 3IAXA 3LO8A 3EH2A 2IE0A 3ZVRA 3BWCA 2PGXA 5HQ3A 4QGGA 2B8EA 3IOCA 4B8YA 3ZX6A 2V0NA 1XCBA 2AXQA 4UM5A 1W8DA 4DADA 4N40A 3BVPA 1AI5A 1SQGA 5EP4A 1WXDA 1L5OA 2BFEA 2JDID 1XJ0A 5TJHA 2R86A 4MVMA 5JJCA 3IQGX 1VP9A 5EAIA 5AXBA 1VB5A 3VISA 2OC4A 4L50A 3H13A 1GPYA 1M1XB 5AUQA 1RWKA 3H5IA 3A1WA 2HJHA 4CKWA 3MPUA 2JGRA 4OUKX 1YZQA 2W2LD 3L84A 1JE0A 4DUGA 3T0GA 2RARA 4AO7A 2WFMA 5WRFA 2PZMA 1AKNA 4F4IA 3CE9A 2ZB3A 3F78A 2ZJ5A 2VTKA 4CZZA 4RAQA 5CH8A 1UOEA 2ZAMA 2ZSFA 5JPDA 2E82A 4KFTA 1IN8A 4WNCA 2N46A 3RFFA 3DHYA 3QKWA 4LXHA 4JENA 2F7SA 3W6ZA 2EW2A 4F11A 5K0EA 4P4NA 3H8SA 3QV2A 3HXQA 8ABPA 4NOKA 5JXJA 1Y1QA 4RV4A 2P4VA 2AMVA 5CCDA 1RTKA 4QREA 1IZZA 4BECA 1M6WA 4V2UA 4CN8A 1ISPA 1RPTA 4LHWA 2SCUB 4X1KA 4YGYA 5K0CA 4H1WA 1NTRA 5D6NA 1IY9A 5TVGA 4OHYA 1P9RA 1L4NA 1JW9B 4OLHA 4Y2SA 3LG2A 3NHUA 1JFFA 4G0UA 3MRXA 3SVTA 1N1EA 4QPDA 3J7TA 2WKWA 4CF3A 2BHLA 1NBOA 3ZN0A 1JQLB 1KVSA 3QVNA 4N0MA 1H6CA 1T4DA 3ADBA 2W6ID 1AV6A 3FZGA 4ZVUA 4L3WA 1JEQA 4I5GA 4WLNA 1TU4A 1KQSU 3H1EA 1B0AA 3FZNA 2FDXA 5BXZA 3CR3C 2QROA 4YCNA 2FRVA 3D3KA 4TQUS 2HGZA 2E5LB 2BGKA 3L2OB 2YIDA 2ISCA 1G8PA 1S2GA 2IELA 2NSDA 2XKKA 2BKEA 3UOWA 2AF3C 3LUGA 1M34E 2WFAA 2R7LA 3EIWA 4LIPD 2PZKA 1JHRA 4PTZA 3R75A 3WZLA 1PJCA 4G89A 1ESZA 1NV9A 2RFLA 4BN0A 3OH8A 4UJ3A 4JITA 2W6ZA 1HNZB 3PUYA 3I37X 1JA0A 1GAQA 1II8A 1QLEB 5FPSA 2WSLA 5LOVA 2JJ1G 1GUFA 1CUJA 1VL1A 4LTDA 1R5JA 2XQIA 5DYTA 2IL1A 3UV6A 2V0CA 1GKYA 4TZ6A 1M8JA 3C6BA 5TS2A 3T4UA 1NBME 3UAYA 1PFWA 4WN3A 5IWCA 3GLRA 3ZHTA 3NTQA 3E8SA 1U1IA 2NVOA 3BCCH 4FZJA 1YVWA 4L0DA 2PL1A 4Q03A 1RU3A 2VJBA 3OTIA 5H3CA 3P71T 4L0QA 5EVJA 2EL7A 2NV0A 3K3PA 1PJ4A 1N6PA 2G72A 3TQTA 1JILA 4HH3C 2EDAA 2FZVA 2HMYB 3HY3A 5HCUA 2H31A 4CKCB 3R8CA 2R79A 5A6SB 1SPXA 1JB9A 4ROTA 5LLTA 2X4DA 2EZTA 3EA5A 1VGQA 2IXTA 4NTYA 3AYXB 1EA7A 3I5DA 4M99A 3RKUA 4TWZA 5CLIA 1UK9A 3CX3A 3SXPA 1ZWLA 1AUPA 4EQ6B 3FTQA 1WA8A 2FPGB 1XTIA 4QDZA 1OHHD 3ABOB 2XGSA 4CMGA 5E4JA 4ZRDA 4LF8O 1IPHA 1O97D 2JLSA 4AZTA 1V26A 2BRUA 2OE2A 2B8TA 2QM0A 3IMEA 1G7TA 1EK6A 4UUQA 4C0LA 1JJ2U 1BJKA 2OFOA 2KB0A 2M6SA 1ODFA 2QTBA 4M0LA 2B4AA 1TU3A 3MB5A 2WLIA 1T3LA 3DPSA 3DCJA 4DWWA 2ONZA 3UYLA 2O7SA 4BLUA 2JIZA 2JW5A 1TZ2A 3ZQ6A 5CVTA 4Z4GA 5F7ZA 3CZ5A 1BX1A 4MCJA 1FYWA 2ECPA 5FUWA 2OESA 3H3JA 3WI7A 2EJ7A 1Z07A 3F47A 1COWG 2KYRA 4J0IA 1TJ5A 3TW4A 4M4SA 1GO3F 2X23A 5B2FA 1TADA 3KD3A 4LJSA 4CG2A 4WMLA 1Q92A 1VJ0A 2X2FA 3LUCA 4NCJA 3I2YX 1Z0JA 1GR0A 4PELA 2X5OA 1I5OA 3F7MA 3LDUA 2QX4A 5GY7A 1UJ4A 3R3HA 2GESA 2BOCC 3TEJA 3DM5A 2Y0BA 1G5FA 2QRGA 2WNSA 3FOZA 1UOPA 1YB1A 3IQZA 3IC5A 2KLHA 3IT1A 4TM7A 3A6LA 3FOCA 3DOUA 1GG2A 2IXGA 3G6KA 4WLUA 3JARA 4NTWA 4PLWA 4C0KA 1KHTA 2Y0DA 4JKYA 4YP0A 4JWTA 4WA7A 3PWKA 1L5GB 2V7QG 4AY3A 2MW2B 3JAMA 1ZL0A 4EJSB 4WESB 1U04A 4PC1A 5CLHA 4LZPA 2VUSA 2HNAA 1CEEA 3AM5A 3E4CA 4DJFC 1VI6A 4KN6A 3OF3A 3TCUA 4CKZA 4HZ3A 2P9GA 3R7DA 2AOUB 1DUSA 3K15A 2X0NA 3K58A 3LZDA 4FOSA 3C3AA 1PNOA 3X1DA 3KSBC 2L17A 4DLYA 3ZWDA 1E63A 3CPEA 1O95D 3VR2D 2QWOB 1PK9A 2RAVA 3P97A 4PS0A 4TMVA 1DMRA 3WADA 2ZSBA 4K8XA 4ZTBA 4D79A 4KO8A 5F3DA 1H8EG 4GYJA 4UHHA 3K0FB 4P2BA 1Y4AE 1V9PA 1YJ8A 3LKBA 4XYBA 4JLWA 3LX6A 2GAAA 3LTEA 4L6IA 3DUFB 1C8LA 2CXNA 2GPNA 1QK3A 3WJAA 2OHOA 1W4LA 1B3BA 1P84F 5FFFA 3U7RA 4DRYA 4Q4LA 3OFVA 4PR0A 2A3NA 3BT7A 4DR3B 2JEUA 4HNRA 3GPLA 3G2PA 4O4HB 2QM8A 2WC1A 3KOXA 4X1YB 4KXFB 3UM9A 3VPAA 1WCYA 5IG2A 4BMYA 4WJKB 2QX8A 3UOGA 5TR9A 5YASA 2CNBA 3ZY6A 2EKBA 1QE0A 1GM7A 3K8QA 1U2PA 2IZ6A 3KSUA 1SZCA 2P1ZA 3WISA 2RHTA 1YFZA 1G3IA 4MINA 4ND1A 1MOZA 5DHUA 2F43G 3SNHA 5HDBB 3A3OA 2JFUA 2C7VA 4EPVA 2I4TA 4FGJA 4XE5A 1AS0A 1U0JA 3ZNPA 4C05A 3THSA 1EPUA 4BMDA 4HH0A 3H2JA 1ZD9A 1J8VA 4K3UA 4EKGA 2VT2A 1L8OA 1ZM7A 1NA5A 4PLVA 2HIAA 4B3SB 3E7PA 2DT5A 1HEUA 5BMVA 1H1TA 4M21A 4E2WA 2JHPA 5KSYA 3H8VA 5A5EA 4UUMA 2A33A 2UZ1A 5ALTA 2FMTA 5C7LO 2C03A 1ZMXA 4DANA 3PRYA 3PVSA 3ER9A 3QJ5A 3R7BA 2VN8A 6REQB 4OXSA 2VJQA 2P8SA 2X6CA 2FP4A 3ZDAA 1U4SA 2NZYA 1DMSA 3QPWA 1LGYA 3OT4A 5FUYA 1VFNA 1UH5A 4K6HA 3CMCO 1EUCA 4HAIA 3ENVA 2ZUVA 3LRXA 1SVOA 2AI1A 1E2NA 3JTEA 3H1BA 2Y1DA 3VR5A 4TSKA 1YZHA 4YPOA 5B1EA 1VKJA 1IZ8A 1P5FA 1NWCA 4KW7A 3GP5A 3TOSA 4O2BB 2BFFA 2IW1A 3HVUA 1WKVA 3DJFA 4CUZA 1P75A 2UYYA 4OM8A 2OKGA 4DQVA 3PGLA 1E4YA 4OSOA 1SBZA 1Z5GA 3QSGA 1QB8A 1RYBA 2OZKA 3CRQA 3FUUA 4YJ3F 3PJFA 1PO7A 2L35A 3AY3A 5ILGA 4MB0A 4KNVA 3VR4D 2E4AA 4MDFA 3K9FC 2WNHA 3HS3A 2V5UA 3VNSA 1UF9A 1BS3A 1N6HA 3PCRB 4G81A 4Z1MA 1SCNE 4UXNA 4HWKA 4F5DA 4RKWA 1WDMA 3TI9A 4R4JA 2Y4OA 1DO2A 4MQ4A 5KOYA 1TLFA 1DIHA 3OCUA 3DYVA 3DOFA 2QTNA 1BW9B 1GCGA 3O8CA 2IYQA 1DJQA 4FFLA 3K9SA 3QTTA 5E7IA 4KVAA 2NYVA 2BTQA 2WFLB 2ZM5A 1KFEB 5DNVA 3JD0A 4KGXA 2VEDA 4AZVA 4V38A 4E14A 1A9YA 4IFBA 5AI6A 1T35A 4BNDA 2PSEA 1VE6A 2YMPA 2ANBA 4ZO6A 1PJTA 4QQ8A 2GD1O 4Q1VA 1ISSA 5LZ2A 3AB7A 1AVTA 3GZJA 4TZ0A 2EIXA 3EVBA 5ALZA 3NORA 1G1AA 5C8YB 1WU7A 3OA0A 2QW1A 3K53A 2OKCA 3COZA 4Z86A 1EN6A 3AW8A 5BMOA 4RKRA 3DXYA 1U11A 4WXYB 4FFOA 1M2JA 1X0XA 2Q0AA 4U6NA 3VH3A 1OI3A 1ZGHA 4Q3KA 2CKDA 5B3LA 4N5LA 3RVSA 2V4ZA 3GEHA 3J81k 4ZQGA 1VF6C 1Q5OA 1SU8A 4HVTA 1HA3A 5LP6B 4GUDA 3UO2A 4IXDA 4OQDA 4WKPA 1M5RA 1RC8A 1VI5A 3F90A 5DBHX 4E4TA 4DQ0A 1KMNA 2MSCB 1TZKA 1SBQA 4W4TA 3FTCA 1MQ9A 5LP6F 1AQJA 1RFGE 4D82A 3HZZA 2P35A 4HLQB 3ORFA 4UCUA 4QXAA 3OJEA 1GZ4A 4CT0A 2BISA 4GOJA 3AYZB 2EF1A 4JXJA 2VPXA 4L9WA 4JCCA 2DQZA 2R1UA 2REBA 4ZCIA 4OFZA 1RYYA 2W7TA 1WZIA 3VMFA 2ITCC 3IMKA 3U7EB 2OM6A 5I9MA 2ENWA 1O2DA 3ZDRA 4HYTA 4HATA 4LQCA 1FNCA 4B1FA 3DV2A 4KE9A 1I7NA 1YMVA 1G4HA 3GMDA 1T9AA 5LQUA 4Y18A 4MDHA 2W58A 5M34A 4JJ7A 5IBCA 3RYIB 4IZHA 3KJZA 1NR5A 4U00A 5CJJA 1K5QA 5FL7D 4KQ1A 3A11A 3ZN1A 2LW1A 1UBKS 3CSXA 3GY0A 1P0CA 1DLJA 4E5NA 5DULA 1OI4A 5EZYF 1L1EA 2HZBA 3MBIA 5JQGB 1OCRC 3M1IA 4PSVA 3ZWBA 2HMAA 1UPFA 1CDDA 2VP2A 2DFLA 1XD8A 1N32B 2P65A 2IPMA 3PDIA 2WYHA 1VJ1A 1LBEA 3R74A 4ND4A 2Q6TA 3A14A 3NMUF 1PT7A 1EA5A 2RHBA 1T24A 2GCGA 3L7LA 1JL3A 3DZIA 4UUJC 2RGYA 3ZG6A 4IYJA 3LC7O 4JVMA 1BN7A 2WYIA 5I9IA 2BRUC 3CTPA 3QSYA 1D5NA 1AI7A 3UQ8A 2VHXA 2G5GX 1BGWA 1LSJA 3UQZA 1Y37A 3EVFA 1E7MA 4OQ4A 1R74A 3AUJB 3L1KA 2O2JA 3TINA 1PUXA 4KO3S 3HH8A 4CH4A 1FJHA 2NADA 2D6FA 1PJQA 1UBNA 3V6MA 3RR2A 4NBLA 2C94A 3MUFA 4RF4A 3IV6A 1GN4A 4Q21A 2JEYA 1CRWG 2K4MA 4MV5A 1L4YA 5KYXA 3NOXA 2W0SA 2DWDC 3DE5X 4C0HA 1VHWA 3AERA 2BT4A 3NT5A 2PXHA 4LFAB 1EK2A 3VH4A 4CTOA 4TLDA 5EESA 1BMQA 1FXSA 2VHQA 1HE1C 2OO7A 2PT5A 4L4XA 4IIXA 3K70D 1FS0G 4US1R 3CZRA 1IQRA 1J39A 5BVHA 5HIKA 1L7DA 1XAJA 5EEGA 4DV6O 3F74A 2SICE 1K1EA 2AQIA 3KU1A 3COVA 4YA6A 1QU2A 4U7OA 4P3YA 4CC5A 1KJWA 3A70A 2C83A 3SCZA 1JU9A 2ZUEA 5I45A 2H06A 4LNUB 4JI0O 4D96A 1UKYA 1WL8A 1LW7A 1U3FA 3WNZA 4MI6A 1GV0A 4RLSA 2DOKA 1YZLA 2Y93A 4JUDX 2ZYUX 1DT3A 4ZAWA 5L3EA 2DUMA 2YS6A 2D59A 2BY4A 1UMBB 1YBHA 4B3CA 1O4VA 1W94A 1WTCA 2C2MA 1KTIA 4XR4A 4HNGA 3KEGA 5LYJB 2J9YB 1E6MA 3PFKA 2V74B 2HRRA 1E6WA 1DJMA 1JQJC 1X7ZA 3AETB 3R3YA 5AXCA 3QVSA 1TK2A 3TMYA 1WD7A 4GMGA 4IIVA 2IZ0A 2I4RA 2WIBA 3THWB 1OAAA 4X24A 5DTEA 3IA2A 1XMIA 5L3GA 4DB2A 1U3DA 4J10A 2C96A 1G8MA 3K0SA 3NTLA 1YHNA 2D00A 2NTVA 2XNDD 4U3JB 4HDQB 2P2YA 3WKAA 5COBA 4FYJA 2QF7A 4PHHA 2P4EA 3FRJA 1IXKA 4DK1A 4QAJA 2WHPB 1A76A 2VO1A 3THOA 3WLRA 4PA7A 1PSDA 2I99A 2NU6B 2WF7A 4BQQA 1B00A 2CXPA 1Q20A 4MMXB 5JYDA 1Y5MA 3PQ7A 4EKEA 3MSXA 4XPZA 2ZWMA 3DEAA 4GP6A 3OC0A 2GKOA 3FHLA 4MVJG 3TTVA 1QG4A 4ALKA 3W2GA 4IGIA 2MDTA 1XWWA 1BE3H 4Y1GA 5HMLA 2I78A 2WUDA 3ED5A 1RHJA 1M2OA 3HQ4O 3QZUA 4FKMA 4DMKA 2HA4A 4D6PA 4L4UA 9MHTA 4O5AA 1Z2OX 5KQRA 3PHGA 3MYRA 1G6KA 1B2RA 2C0CA 4FYKA 4I55B 1S96A 4XD7A 1QP8A 2PS0A 4L2IA 3AFOA 4XI9A 3T7TA 3H1TA 5H81A 4W8OA 3BWMA 2DJVA 5IT5A 2SHKA 1GVNB 3CCLV 1E9EA 1EBUA 1IJBA 1XZBA 4I55F 5HUQA 1KJZA 3ZZUA 1CR2A 3ZZ1A 2XCIA 3MT8A 3RW9A 2XMCA 3W7TA 3QKSA 1RYDA 4MUBA 4IFIA 1H2SB 1KFCB 2XD9A 2VS1A 3K70B 3GX1A 5BR4A 2FPUA 2LVBA 2ABWA 2OCIA 1E8MA 2IV3A 1PR6A 1ZJYA 3R5HA 4ER5A 1FP2A 3H8JA 4QG7A 2GBOA 1PZHA 4O4JB 1AKWA 3FFAA 1GPLA 1JWLA 3SJBA 4XKJA 4OJYA 4P4UA 4MS2A 3DHVA 3UB3A 3WGMA 1EFUA 1XRSB 1WHSA 2DF8A 2CL6X 1RXVA 1BS2A 4FT2A 3PXBA 4O4JF 3WTBA 1IHOA 1ZPDA 2E4VA 2GHTA 3SJAA 2ACWA 2DFVA 5JDCA 3GJ5A 2Z8ZA 2DPXA 3HGTA 1EDDA 5EBWC 3FHJA 3GCWA 1U8CB 1OZFA 4YI5A 3K05A 3BJIC 3WFVA 3BULA 5IHXA 2JFVA 4B3JA 4URXR 3A31A 1JAXA 4UDNA 3HYSA 3GXOA 3M49A 2IEZA 3V1LA 2OPHA 2FUCA 4HEHA 3S7TA 3OPMA 1PQWA 3BHMA 4JI8O 1MX3A 3GBSA 4LJ8A 4Q4HA 1SOUA 3QU9A 3IALA 3RAEC 2Q9LA 3UZUA 3EWIA 2AOTB 2Q0HA 2DR2A 1Z56C 3AFIA 1KDRA 1A7JA 1XL0A 2C00A 1GUZA 2WT8A 2RCVA 3EGEA 1LLFA 4RJLA 4EUSA 2PG3A 2BFPA 4HB0A 4EGAA 1M6VB 1GTRA 1BDBA 1T13A 3QTBA 2J4DA 1YA4A 3TIVA 2O3JA 1L3BA 1GGHA 1MIOB 1T0IA 2KSQA 2ZUUA 1Z7BA 3ZEIA 4QU8A 1QVFU 3D4NA 2R2AA 4PNHA 1KYVA 3H4VA 1TI7A 4M9RA 1BHO1 2CTWA 5L3CA 9ATCA 3WQRA 1HV8A 4EW3A 4NCNA 1QBKC 1IH8A 2WLJA 4B6PA 2BDTA 1MAVA 4GBGA 4X88A 5LKRA 1QGZA 3O75A 2F1OA 2RHJA 1LPNA 1JLLB 4F6CA 3FYSA 3WSTA 4TMZA 2GBGA 3EGCA 1EEXB 1HF3A 4FUTA 2O0HA 1V9CA 4M87A 2XMPA 1XP5A 1H9BA 3I52A 2GPYA 2PFKA 5D84A 2R6DA 3ZLBA 5DV9A 3VV2A 3PNMA 1OYVA 2Y69B 4JAVA 3G88A 4D0NA 2ZR0A 1L9KA 4R1SA 4BNKA 4KXXA 3MQ4A 1LKZA 3W05A 1TPYA 1GADO 1GDTA 1RYEA 3I34X 4J9ZB 1YVPA 4QGSA 3U3DA 4PI0A 2OZEA 3KRTA 2WTAA 3F3YA 4C4RA 5I4IA 4MIKA 1U3VA 3ZEAA 4L5CA 6YASA 3RT7A 3P9YA 4JMLA 3R0ZA 1QAOA 5LNK6 1B3QA 4QGAA 4K40A 2W48A 1H8HD 6ABPA 3VOUA 2CVOA 3SX2A 1CTQA 5CTAA 2H1SA 4U0JA 1NVBA 1KBOA 4HB2A 3HKEA 1QE5A 2BPOA 1MOSA 1WLSA 3FVRA 1KC1A 2VRCD 4PIMA 1VYTA 3VGJA 3QEBZ 3ME5A 4JDUA 4FILA 1CQPA 1ZAYA 2JGFA 4Q48A 5AHOA 5DN6G 3P9NA 1WAZA 4R2WA 5J23A 1H4TA 2D0PB 4C5CA 4F4LA 4MW8A 4UBLA 3A6DA 3DYBA 5E9WA 4LZOA 2R00A 2C59A 2NU7A 3ZE0B 3HUFA 3E7WA 1HYQA 2GZ2A 1NJ6A 2H1FA 2BEWB 3FAVA 4R1NA 3H4IA 1I7PA 2AYZA 4XLLA 4C01A 4HT3B 4NI5A 1TQHA 1E2IA 3LL4A 3V1YA 1HPLA 2WJYA 1KERA 2OHFA 3OZCA 4XGRA 4BO0A 1UDCA 5KKNB 3ZPXA 4BIZA 3TPFA 4CMJA 4I36A 1G64A 4RTJA 1CUIA 1D2RA 5JVDA 2XJ9A 3HMKA 3OTFA 5F7JA 1E9CA 1L7VC 3OZUA 1KQNA 4Z4HA 3KOMA 3O4IA 4QQNA 4Y6LA 3OAAD 4LG1A 2CZQA 3GRPA 3BSFA 2RGDA 3TM5A 3K92A 5CA1A 4PI2A 4OVKA 1K75A 3SHQA 5IX8A 3W90A 2HCFA 3W6OA 3MGGA 3QVUA 2AJBA 3OWHA 3UQYS 3Q0IA 3BMXA 5H3LA 4WUVA 1WDLA 4J49A 1FPQA 5B1YA 4P35A 3AVPA 1SK9A 2XIQA 1G8GA 5B3AA 3LF1A 2HXYA 3BJMA 2LDXA 1CJTC 4G8CA 4F84A 3TLBA 2PKQO 3UA3A 3R1IA 1BMDA 2YZNA 3STVA 5TF4A 2CXXA 2UYOA 3GFPA 4WN9B 4ZARA 5ARBA 4EG0A 3W06A 3GMTA 3JWPA 3UG7A 4C89A 1QONA 2VJLA 1KS9A 4UAJA 2DX7A 1NW7A 4R1PA 2QLBA 4CRWB 5E1MA 2AW9A 2DTDA 4MJLA 1DEKA 2BFDB 4RCYA 4H1HA 1QTQA 1M34B 4PYNA 2M6RA 2XWSA 3GW8A 4IJ6A 2WUVA 1TEHA 5ERGB 4KMRA 1C14A 4B82A 3IHTA 1VQMV 3CWQA 4JZGA 1TGYA 4CXMA 4V0RA 1LPOA 5LU8A 2CK3A 5DGIA 5G1NA 2WTEA 3KZXA 4X5OA 3MHHC 2GRUA 2B0CA 4RFSA 2QGZA 4UE3S 3LT2A 3HBJA 5AKIA 2B25A 4X3OA 4WOCA 2BKLA 1GA4A 1FMCA 1OXMA 3HACA 9LDBA 4NPCA 1P7WA 3WL6A 5L3ZA 4BWYA 4U7WA 2EIMC 2PA3A 4IJMA 3G1UA 1QDLB 5FI1B 3SQDA 2AG5A 1AR5A 1CP3A 4AKIA 3DTVD 1X8KA 5HRUA 1VB3A 4C0BA 4CTNA 1B93A 4LISA 5DISB 1GVHA 4PC3A 3K79A 1JTVA 1E7RA 5LPNA 2VQ3A 4GKVA 3UJHA 1K9SA 3TW8B 1RRCA 3S5JA 3STLC 5HM8A 3E1SA 3IBGA 1U5CA 1QIIA 3S1SA 1VQ9V 1SWVA 2MMGA 3ERCA 2OBLA 2WTUA 2PR2A 1EXMA 4PGMA 3AVYA 5DHSA 3R5TA 1SM4A 5JISA 1JHAA 3OE7A 3MWGA 5TB5A 3W7BA 1UANA 1Z8DA 2EKQA 4QDUA 3RVNA 3KJEA 3VDQA 1NVGA 5KZMB 4WD3A 4ZOEA 4N6GA 2BI8A 1EGVB 2HEGA 2ZUBA 3HBLA 1DXYA 2HTEA 3CCEV 1SCKA 2H9IA 1W47A 5KUKA 3LKDA 4XX0A 2QN1A 4L5JA 2X86A 5DW3A 2WM9B 5HWSA 2YASA 4OEHA 3BIWA 2PUBA 3QYPA 1ORTA 5CYPA 3G5UA 1XEXB 3PEYA 2ZITA 5JV5A 1R3UA 3ZZMA 2OGWA 3O8OB 3N0XA 2QXTA 2NYRA 3KXPA 1YQEA 5A3QA 1LRKA 5EBLC 2FEKA 3KHTA 2W4QA 3FI9A 3VC3A 1OCZC 1N7HA 4RVFA 3N2LA 4CV0A 2CDRA 2BR5A 3S81A 5KHHA 3R7AA 3F7TA 1U3GA 2ZWVA 1MZFA 3K5IA 4MV6A 4XCQA 3CRZA 5KYTA 4WOBA 2WD9A 3TSWA 1V7PC 5KCZA 3BBLA 3QV1A 3CEAA 1SGWA 5FLXA 4DPMA 3ZRSA 2VPWA 5EIWA 1XNJA 2ZTLA 1PYOA 2WM2A 2CYAA 1YRWA 3TETA 3SYMA 3QELB 1SUCA 2V3CC 2IZ7A 2ZIZA 2XCOA 4NBNA 1B04A 1NVFA 2J33A 1AJNA 3KYBA 3LFHA 3ZMZA 2B37A 3SJBC 5GPBA 2B5VA 1N33B 4A9AA 1IAVA 3H4MA 3O4VA 3OQBA 2WLLA 3BMOA 3ZTWA 1EFRD 1F9EA 2BW0A 1JHPA 2WTXA 2R97A 1OJHA 1VG9B 2ZXFA 2B8NA 4PLFA 3SJAC 2YWDA 2FW8A 5JDCC 1P60A 5LQAA 1Z4KA 2GV9A 3JYQA 2AF4C 4BZPA 5ALDA 3S2UA 2NVUA 2X8LA 3L7DA 5JSZA 3FE2A 3RARA 3AQ4A 2OHHA 4M49A 5DDIP 1ORWA 1FLDA 2G4VA 5A71A 5D5PA 5GM1A 3MFQA 1EN5A 4LJKA 2CNOA 3SPIA 3T7CA 4DW1A 2WYVA 4I0WB 1TO1E 3KSZO 4KOAA 5CP8A 4G9EA 2C20A 1P9LA 1A04A 2MTBA 1UL1X 4OGQB 1TA9A 4F3RA 1ID8A 4MR7A 5CITA 1D2AA 1X9HA 4DXAA 1UBCA 3DBLA 3IS3A 1MPXA 4UTPA 3G5LA 4BO5A 3ASVA 1MLDA 4EF6A 3KV1A 5J1SB 1D6MA 4GZ3A 4LWPA 1UBEA 4X45A 4HR7A 2R84A 3GELA 2QE7G 2B34A 1KL7A 1GUBA 5CRIA 1OXVA 2XMZA 2J7PA 2JGDB 4MI3A 3NEJA 4RF3A 3TR0A 2X9NA 3O3NB 1KIMA 5BR7A 1TA8A 4WNIA 1ACMA 1EDBA 3CPSA 2HJGA 4J2HA 1F14A 1Y63A 4TLMB 4JOCA 1QIEA 1EWRA 1KNQA 1QCDA 3RF6A 1XN4A 2WQ7A 3E81A 1BTOA 3H9UA 1JT2A 4PGHA 3PV0A 3UCFA 1GYPA 1RCUA 4GGPA 1G41A 3DV9A 1QH0A 1RAIA 2VK8A 3CBQA 2FU5C 4ZREA 3DDUA 3OZFA 2G70A 2DYSC 2WF5A 4LTNA 2QIOA 4JAVC 3RAJA 5JSUA 1VQ6V 1R4NB 5LXTA 3FAZA 4W5OA 4CV1A 1YB4A 2PMBA 2XGGA 2WT9A 3EEYA 4UUAA 3FVTA 1B1CA 4Y9UA 3AVTA 2I3BA 4KRFA 5HHTA 4CV3A 4IDPA 3CO5A 3WQBA 1TAHA 3W4JA 2Q2VA 4ML3A 3NIFB 3PICA 3EGXB 3VV3A 3TOCA 3C3JA 2GSWA 3FYIB 3D4LA 1XZEA 1X80A 3JXEA 3OWXA 3HJAA 1V7CA 1FCJA 2ZATA 1J06A 5E6SA 2POCA 1VKZA 2EKPA 4DR1O 1JG7A 4Q05A 3JY6A 3D1JA 2D5AA 2DWUA 3NHAA 1CJCA 2DKFA 1JE1A 2YWGA 2CXOA 1QQ7A 2IKSA 2VXOA 1IB6A 5ILQA 4Y9TA 2R0QC 2WPNA 4AIRA 5EN4A 1CUUA 5TT1A 2Z3WA 5EUMA 5BV7A 4D99A 4MVQA 3A58B 3H1PA 4ZK2A 4BKRA 1D5AA 3OHMA 1GPH1 4CIAA 2JAXA 5DTMA 3VTFA 1MG1A 1CQIB 2R00C 3DBRA 1DE0A 1I13A 4HN9A 2XV1A 4B85A 3C8UA 3GDWA 2W6QA 3HR0A 5NULA 3LQKA 1ECPA 4EBFA 2ES4A 4CEHA 1CJBA 3GEMA 3IBYA 4KWCA 2XYRA 1MXHA 4KVFA 3QK7A 1AQUA 3W2IA 1F23A 2ZB4A 5HW0A 3KSRA 4YJFA 4WKOA 3TE6A 2JS7A 4AJPA 3WGVA 5AJZA 3DOCA 4FFMA 4PNZA 3Q4HB 3G6WA 1XPJA 3DCIA 1KJIA 4WX2B 5AVQA 1OIWA 1E6LA 3IUJA 1K73W 4RJJA 1Q0UA 4RORA 1FNNA 3KL2A 3OM8A 3GFOA 4MVRA 4MUYA 4IDHA 4TSFA 4W63A 4U7PB 1FQJA 2Z30A 5GOTA 1IN7A 2ZEJA 1S72V 1YMUA 3BE6A 5EXEA 3IEIA 1O96A 2AJTA 2IS1A 2X7HA 1YRBA 2JPDA 4BXOB 1BMFG 4C22A 1T0JB 3KQSA 5AW5A 2PXCA 1N78A 1BU5A 1VHLA 2H1OA 2HJWA 1GZDA 4DSOA 2YDYA 1WPGA 2GKSA 2UV8A 2OXRA 1Z33A 3H5VA 2G88A 3ROMA 4DSTA 3O4JA 3JYCA 4IZ6A 2HXGA 5KHOC 5BWOA 2AK2A 1DXOA 1JBKA 1WXIA 3PRHA 4YQZA 2KX7A 4IG4A 4YJHB 4BO9A 1CY0A 2BCEA 2J85A 5IEBA 3BK7A 3AUYA 2WB2A 5GJVC 4Z0NA 1SC6A 2FGJA 2OORA 4FFWA 2G04A 3P0EA 3V00A 4OGWA 3SP1A 2BSQA 5LZ4A 2YINC 2P67A 3BXEA 3AJ8A 1PR0A 1HRDA 1VJGA 4TV9F 3DR5A 4PINA 3IKJA 3RNLA 4HDAA 5ITZB 1L8DA 3OEHA 3WDLA 2V97A 4XSVA 4JASB 3K8YA 4Z9AA 4X63A 1DAEA 2AQHA 2R1VA 4RC9A 5EZQA 4JI1B 2FTKE 2FWRA 4X8OA 1F4NA 1R00A 2ZRHA 3UJ6A 1PGJA 2PMCA 2R8BA 4IEFB 4ERNA 2YI8A 3H04A 1BVYF 3BPSA 3WJ2A 2HPHA 5J63A 2GCIA 4NOMA 3IAHA 1EAMA 3KVNA 4F5YA 1C7FA 3CYFA 1ZLXA 1DUIA 4B8ZA 1WSAA 1X9IA 2WJZB 2AS0A 1VFPA 1J0AA 4NENB 4F86A 1NHGA 1Z5VA 3RSCA 4MVZA 3AG6A 5KC9A 3KQUA 3AK1A 3GJZA 1NR7A 1TT5B 1S1MA 2K9PA 4MUNA 1Y6FA 3O7WA 1TYEB 1PWEA 4HAYA 4TL8A 4K46A 1YIOA 4AHCA 2CTPA 5EIFA 3SICE 3M7MX 2HHAA 1X70A 3QWAA 5DM4A 1V0JA 1I5XA 2TMKA 4Y2HA 5KYUA 1XE3A 3UTCA 2ZAIA 3M4JA 1B23P 5KNCA 1BKDR 4FVTA 4QD3A 1Z5ZA 2R7NA 3ZXUB 4WBSA 3LNMB 2OP0A 3DW1X 4LAFA 5D8DA 4B34A 2C42A 2Y99A 3V34A 3X1ZA 5EMNA 3SOZA 2PKQP 5C7YA 4FS8A 1PPJH 1AGNA 4LFCB 4AY5A 3WAGA 2QTLA 3CNOA 1QFMA 3LT0A 1W25A 1EZVH 4JC8A 4HQ0A 3FKJA 2WIKA 1VF6A 2HUPA 3AK4A 2X7RB 4F97A 4H08A 4G8JA 2C61A 3FJ1A 3IDSA 4YO8A 4H77A 2GCOB 1QZUA 4E33A 3QLEA 3WYAA 2ZIGA 5EHXA 2AN9A 2GASA 1M57B 2Z3YA 4LZAA 3ZGYA 3RKSA 1GSIA 2ZTVA 3STWA 2VTEA 3K6JA 2B3TA 3U7GA 3T15A 3EXHA 1LX6A 5J9FA 1PWXA 3CUSA 3MG9A 1N3BA 4UCTA 2HBRA 3E3AA 3AEZA 2PS9A 2FWBA 1Z7EA 1ZA2A 1GQ2A 5EWLB 4PM4A 5L45A 4TWIA 1SVNA 4EYQA 1M56C 4DV0B 4EUHA 4LNHA 4B3XA 1CLUA 1U6KA 2NNLD 3CUUA 2WSBA 1CP9A 4JQOA 3QNMA 2ZS9A 4D4KA 4ND8B 2F8TA 1P4GA 2TECE 4X6XA 3K9QO 2YTZA 4YCLA 3PRKE 2NU8A 5E8RA 4Y2QA 1MC5A 3JQ7A 5HKOA 5BUCA 2HWYA 4ZD6A 2G40A 2QM7A 3ICVA 5KDOA 4EKIA 3RU7A 4PJ0Z 3VU9B 5IHPA 3H7AA 3L02A 5B2ZA 4DRXA 1GSOA 1XEWY 2GJ4A 3GL9A 2ZUTA 3NG1A 1G19A 1OBHA 1XDBA 4FZ0A 2GNOA 4XVUA 3P2KA 2VQFO 3UJBA 2DE0X 3IA7A 1XRPA 4UNPA 2EINC 2YVQA 3DONA 1G63A 1JEDA 3QXGA 4HLDA 4HV4A 4TPKA 4EI9A 4MVSA 1ULSA 1R73A 1W44A 3ONNA 3ZMVA 4YALA 3NOVA 3M2PA 3N87A 2YJZA 5TLSA 3BK1A 2ATIA 3T1YB 3SYQA 5AW1A 4NMHA 3N2GB 1JFRA 1LTHR 4JI5B 3IIKA 2NLJC 3C97A 2VHVA 5CVCA 2WWYA 1T3SA 1E7QA 1J33A 5HNKA 2CLLB 2DUUA 4XCXA 1LDEA 2OVFA 2WIJA 4XIFA 4YCBA 1C30A 3NDBB 4IL5A 3H6GA 5CIQA 3APQA 3EY9A 4RVUA 3UMCA 4LE2A 1EFTA 3CMAV 4A5UB 2ONCA 3E7DA 2JJMA 4H1UA 4LMRA 3W5HA 4NKGB 1AF4A 1J8FA 4DR2O 1KJ8A 1K6MA 1J97A 4NK5A 1Y9DA 4ZZIA 1J7KA 1JR3A 2V4UA 2JF0A 3ZRXA 3EZ2A 3OC6A 1CUDA 5EHZA 3FIUA 3PDHA 1DFGA 4E3ZA 3JVEA 5E79Z 1ODKA 5EMJA 3LBFA 3HXPA 4OAOA 1RPAA 2X9VA 5BYKA 3O82A 1M2EA 2AQKA 4CKYA 1FZTA 3N2NA 1E3WB 1P77A 5DE3A 5HCIA 3IEXA 1KORA 1WKBA 1QBZA 3DPIA 3DZKA 1A9SA 2DCUA 1O94A 4MZXA 1RJ9A 2PYLA 3D6TB 2CDAA 1JEJA 3ZW7A 3O92A 4M9ZA 5FBVB 2FW0A 2VCHA 1GDHA 1FXUA 1RRMA 2VYFA 3KXKA 2PA0A 1IEVA 1YZ3A 5EJ2A 4LJ4A 3AU9A 2X5JO 5CMUA 5EWJA 2JKZA 1KC3A 2J3EA 3MMZA 1PNLA 4HFRA 2HUNA 4DT1B 1H23A 2DC1A 5JC1A 5CEJA 1CEYA 5C51B 4IINA 3S8YA 1PGOA 2EOAA 1U0NA 1RJFA 3KSMA 3GLGA 2I6QA 5ALWA 2O06A 1UXJA 3OJWA 3F8SA 1K88A 1TUIA 1SQQH 2QVCA 4WERA 1RC1A 4KNYA 1OH7A 5JXGA 4MUFA 1KVRA 3CWCA 1ZNYA 2M7WA 3I3SR 1NU8A 5LCXA 1J95A 1Z5NA 2APJA 2YZMA 3DDCA 4ZCRA 3L70H 1QQAA 2Q5IA 1E3DA 1YDWA 1X8LA 2CE4A 1PT5A 3NRBA 5AMXA 1D7AA 2KJQA 1E5TA 3AKEA 3NEYA 4ND3A 1FVXA 3HABA 3FPAA 2ISSD 3HYNA 1R0KA 4PU0A 1UBOS 3FHOA 3IP5A 4QT4A 3B3FA 2OBFA 4YNBA 3G2MA 3WU2Z 3DLTA 2XVXA 2Y1OA 5KHLB 3E7XA 3SJ7A 3TZQA 3K1ZA 3JALB 1SKQA 3W7SA 1CJSA 3TLGA 4N48A 4KN8A 3EZ9A 1JRLA 3RN4A 1M3SA 2ZRLA 3EHEA 2QSUA 1FB5A 2PL5A 1E1KA 3V2IA 4C08A 4XW2A 3K9BA 2EEPA 4C1BA 5H4HA 3YASA 3SPCA 3MPOA 1DQRA 1Q17A 2XECA 4ZGGA 1RI4A 1PL7A 4PDVA 4OIFA 1T9BA 1Y98A 1UMDA 3LZ6A 3QO7A 5K05A 1T2NA 1EFHA 4XFJA 4R1OA 3TBHA 2NACA 1FFHA 4BDTA 2HPVA 1SJ9A 1WXXA 4RYLA 1WU8A 1NXTA 2MSDB 1GPMA 4Y1EA 1REQB 4OI0A 3PGKA 4QNNA 1RJEA 1K4DC 3KETA 1QG2A 2NO9A 4F96A 1F3OA 1KQOA 4ALIA 4OPMA 2CXQA 3FGNA 1P1BA 2A86A 2PCJA 3UWKA 3AEUB 3IAAA 1YR7A 2FPOA 2HVJC 3CPWU 2ZRKA 2PMDA 3N0TA 4F71A 2OORC 3SM3A 1ODCA 5EIXA 5FV7A 1NUTA 4WE3A 4UMFA 3KLNA 5DECA 1QUFA 4LF9O 2RQ6A 1GCOA 4CM4A 3EASA 2YHIB 3RTGA 3FKSD 3O4GA 4B4UA 3IDOA 3A6ZA 4OMFG 2GPWA 2QMHA 1DDIA 1JKFA 1TOAA 3JR7A 4ZYYA 4CLHA 4LF7B 2OPBA 2QX9A 4YJ3B 5H59A 2CY0A 4DQLA 4BWAA 2M2IA 3B6MA 3GVHA 3VJRA 4Q7JB 1GZ6A 3KZIZ 3U3ZA 2VUTA 3P52A 1BDMA 2X0IA 3E2IA 3PSHA 4N3GA 1ORVA 3GLTA 1J2YA 1JV2B 3RWMB 1MD9A 2RHHA 2VZLA 3S6JA 5HF5A 1JPXA 3L4BA 1BXGB 4MRNA 4QEDA 1AQLA 2KQUA 3MMNA 3O91A 2NW6A 1AQYA 5FIUA 4HDMB 2GOYA 2EFCB 2NTJA 1IK6A 2VBGA 4FK5C 3ZXIA 3HXOA 2V45A 1SD1A 3ZU4A 4C7OA 2ZYWX 2IPLA 2UXXA 1VG0B 1G5HA 1AKYA 3FOFC 1DXHA 5JFOA 3GLFE 1VPTA 4NU8X 1K8XB 4DR6B 1OIVA 4C0AC 3G1TA 4MS1B 3SQOA 4NV0A 4FOOA 5K0JA 1OLXB 2C9DA 4KFCA 4WLEA 2RE8A 4RHFA 2CH7B 2AOXA 3AKDA 4PPNA 4D2IA 3BG5A 5FPKA 4HRYA 3WSVA 1M8KA 3S2FA 3B1KA 3FOBA 2PVPA 1I2ZA 4ASUG 1I32A 1R8XA 5I01A 5F5LA 2VC2B 1SUDA 3WNVA 4P80A 4D7AA 2AOWA 4OHUA 2GYUA 2I1WA 1Q0ZA 4EJ0A 3T7DA 1XZCA 2FMLA 3G2QA 4W9RA 2ERYA 1UM9A 4AMVA 3IE0A 1YZKA 4NEGA 2HQ1A 2ZRIA 2XZTA 4MUHA 1UKZA 4X3CA 1T2CA 1HNXB 4B2YA 3OEWA 1QGUA 2YN2A 1C29B 1ZK3A 2OFWA 4K6OA 1ZL8B 3UCEA 3ZVMA 1WCXA 4J0GA 3FY4A 4AXBA 4Y9SA 3M6FA 3IJ5A 3KQNA 3EXHC 1BGYH 4MS3B 4J2TA 4UHCA 2FMXA 3LFUA 1L5VA 3ZZ0A 1KI4A 3HO6A 3UPDA 1Y9JA 4QUBA 5EA2A 3VH2A 2M6YA 1B1AA 4NP6A 3A3KA 4DBLE 4FHFA 1NFQA 3N3BC 2J3KA 2X3YA 1KY2A 1E5QA 2J3DA 3GGJA 1PT8A 3LIIA 3IT0A 2O8DB 1BX3A 2P9TA 4GRIA 4F72A 5CCBA 5EZYB 4EI7A 1P7BA 4W5HA 3ZY5A 2J9FA 1W93A 1YWGO 4HBZA 4OHCA 1PV4A 4WPGA 2C9BA 3AY7A 3I2HA 4WY5A 5FLEX 2F3RA 2IU4A 4NFHA 4YYZA 1MAHA 1PWYE 2JLAA 1FQOA 5FPYA 2X8BA 1JS1X 4CMCA 1UZLA 1EVLA 4N7BA 4DXHA 2NTNA 3DNMA 3D6JA 1V55C 1Z9BA 2WINI 1DZIA 3WWEA 1QFYA 2F4NA 3VR4H 2RB4A 2PL9A 1HI9A 1ULBA 4YHBA 2I2FA 4LBWA 4L1KA 1UPUA 1B76A 3N2EA 4U2DA 2PJUA 4BEJA 2D1SA 1OBCA 4BQSA 4NZYA 1CZKA 5AHRA 1JN0A 2CD7A 4J0HA 3KLPX 2OB1A 3ET4A 1TCAA 1E79A 1RLTA 3IVCA 4EOGA 3TL6A 3KOYA 1VHDA 1KDYA 5FLYA 2F1RA 1XN1A 1U0EA 4K0RA 3TB4A 1RHRA 3TWOA 1GTMA 1YVRA 3ASUA 2ZAGA 3TNFA 1XL6A 1T9HA 4A0SA 1F8GA 4ZJUA 2EF0A 1SRRA 3KAJA 3ZWXA 5EPUA 4C30A 3TNYA 3D4OA 3KQWA 3C5VA 3NT4A 4MS4A 4KBGA 5DCLA 1V41E 2P11A 4PLHA 1ZISA 1CG6A 3PEVA 2IYAA 1DTWA 1UDWA 4IR7A 4J7JA 1U0TA 5F98A 1QZTA 3BICA 1VPLA 4NPAA 1RLUA 4N0DA 1E9RA 4CH6A 4WZZA 1KYXA 3DTTA 1RXIA 2IXEA 4YRAA 4RHUA 2ZRAA 1Z5UA 2NNWB 5B64A 3CCFA 1O94C 4MPRA 4RAOA 3TIXB 3EA0A 4CS3A 4GFDA 3TCNA 3NT2A 3RCBA 4F8EA 1R18A 3FMGA 5EWMA 4D6XA 1PP9H 3QMPA 4TV8A 3JQDA 1ZJ4A 3KXIA 4HDKA 1RKUA 4XGKA 4F8JA 3Q2IA 4Z4CA 3UO3A 4FM0A 4OAQA 3F1KA 3T0IA 4CMIB 2CHFA 1S76D 5FYDA 3UANA 2VQEB 3N1UA 4G36A 2RKBA 2ZETA 4WZBA 3F46A 3ZQJA 3ACBA 4IY1A 1UJ6A 3R4VA 4AX8A 1VC2A 1COZA 5HTOA 1BXKA 1V2GA 3B8HA 3WYFA 1SA0B 4R2XA 5JZSA 4TT3A 4KPEC 4B79A 1AVMA 3I0ZA 1VIAA 4BMNA 3AOGA 2YN0A 1EQUA 3MJHA 3W2HA 5LLDA 2JFNA 3ODGA 1R0BA 5JDIA 4XR9A 3UMVA 1W4CA 2GHIA 3PR3A 4EB3A 4F9GA 2RHRA 1SXHA 4N5MA 3PG5A 1J24A 4JGBA 3A0RA 2H5EA 2QT9A 2J1LA 4MV7A 5H16A 7REQA 5KYNA 3MRTA 2X6AA 4PSDA 3PNVA 4CIWA 1Z7WA 3VU3A 2XVMA 1ZK1A 1W0KA 4QVGA 2BE3A 2JIZG 1T0HB 3U7IA 1D2MA 1HT1E 4F9TA 1UJMA 3EOZA 4E2YA 4X54A 1FAFA 3DZFA 3GAZA 3SYNA 4RUEA 4HL6A 4HNQA 4IZOA 2BBTA 4JLDA 2HDOA 4HXYA 1MCZA 3EPHA 4O2LA 2PMKA 1U7PA 4GYKA 2YCBA 2M1XA 1XFAA 1XRMA 2ARKA 4QHSA 1BA3A 3AL0C 4NZNA 4FZ3A 4URZR 2HK8A 3K6KA 2O1EA 4MNTA 1KBQA 1F2TB 1MAAA 2XKBA 1N8NA 4R7TA 2OBYA 3C16C 3KQQA 2FEWB 1F2DA 3OT1B 1Z75A 1HT3A 3JWGA 4P08A 1M2WA 3D8NA 3K4QA 2PUVA 4RLHA 1TQ8A 3FGOA 1N2JA 4RA9B 4YUAA 2D13A 4LVUA 1NW8A 4IIEA 2QD2A 4FCWA 1RWVA 2AHZA 1EK5A 4QJ3A 4I7ZB 1BVHA 3PPVA 5A5FA 4RY0A 4I8XA 3GG2A 3BA6A 3NHLA 1RYFA 1OVGA 5C1PA 1SC3A 1MB9A 2K1EA 2P2ZA 3ONWA 4MYSA 3MT7A 1LC0A 2QN7A 2FUG1 2FFHA 4IF6A 3NR2A 3T6KA 1DG1G 1XQYA 4FLMA 3ZS9A 1ZJWA 1SUPA 3DL7A 3IP8A 3BJZA 4KXYA 4P81A 1GU7A 1KP3A 3OO1A 2G09A 5F2EA 5KKAA 2Q4EA 3E61A 3B5EA 1CF4A 2MHCA 1ZU5A 5EJGA 5ER9A 3UENA 4PAQA 3Q3HA 3EAGA 4PTLA 1DEAA 4DAOA 2AI3A 2I66A 1R4MB 3AL2A 1BNCA 1ECCA 5E9AA 1P8AA 2LD4A 3GUYA 3L4BC 2H0AA 3IUEA 4AS3A 1SERA 2HP8A 1UJWB 1PQUA 2NXNA 1KQFA 5ED4A 4RNDB 1GIAA 1RKVA 4KHZA 4RUKA 2QUHA 3OPXA 2BF4A 3W8FA 1GCIA 2Y0IA 2LGJA 2E1RA 4WHMA 2AXPA 3TFWA 2FPIB 3FBGA 1T1EA 3F7NA 3MRSA 3INGA 4RVSA 2R9AA 1KYOF 3EA4A 4GDFA 4QYWA 2E7ZA 4YV1A 2WJJA 3GARA 2V4DA 3TBFA 1DOHA 3Q3GE 2LRHA 3OLYA 3K0CA 5F4ZA 4C1NA 1QKIA 4YIPA 1A8PA 1YF2A 1DKRA 3IVGA 2QY6A 5E1AC 1W6RA 1NPYA 1VDMA 4JHLA 4H1TA 1H2EA 4UREA 1H69A 5A9SB 3CJTA 4I4TA 1CNFA 4FI3F 2OYSA 1AUOA 4JVOA 4DMCA 1U7ZA 2X6TA 5KSPA 3G8CA 4LDQA 3C7CB 1WHTB 5U4QA 3DEHA 1W5FA 2A9PA 3ICPA 2GM4A 1QOQB 1R3DA 4JB0A 3Q40A 5L95A 2XUHA 3NEPX 1T5IA 3R7NA 1K8RA 4QARA 2GEBA 2ZD9A 4RADA 3P9KA 2WYUA 1TJNA 2PPLA 2YWCA 3STHA 4B3MB 5H8WA 3AP1A 4C2AA 1DS6A 3COJA 1QP4A 3EYAA 3PBKA 1T3TA 4M22A 4Y7DA 3BWXA 4XOUA 3RRFA 3LBHA 2VSNA 4CQLB 1H0SA 4IO0A 1Y8QA 1J1IA 4U7FA 4DXWA 2HCBA 2Z8XA 3W7XA 3OPYB 1QNFA 2VNAA 2C4VA 3V80A 3M83A 1U7HA 1ZCBA 5C1OA 3ZCUA 4MQLA 4GOND 4AROA 3NTVA 5BQ3A 3ZJZA 4M1QA 4RF2A 1P3DA 1Q3KA 4KGVA 5DB4A 3B20A 1ZD8A 3RJTA 4PLYA 1AGXA 3M3DA 4IGEA 3QEMA 5A4FS 1R8YA 4LXTA 2CJWB 4JL5A 4U2BA 1N4DA 4JY7A 3NS7A 5C32A 2JLRA 5ICGA 3ACCA 5CUQA 4Z1MG 4R31A 2PTHA 4IQGA 3DDWA 4J29A 2X77A 4BLSA 4HS9A 5BY1A 2J5KA 4L3VA 2AXNA 2AN4A 5DMHA 5A06A 4DUZO 3EFFK 1RRFA 1DBRA 2JRCA 3A6KA 3KB6A 5JI2E 3IB3A 4OA8A 2J6CA 2SKEA 3KJFA 1TVKB 2ECKA 3WWYA 3SQWA 1VE5A 3OPYI 3TB6A 1L7NA 1RWXA 2J0EA 2A0KA 1GG9A 3DWGA 1P2UA 5HJ2A 4MI9A 4LXIA 4GXQA 1PWHA 2E4UA 3M5CA 3F5WC 5LP1A 1MSWD 3ZLUA 4QXMA 4W5TA 3UNXA 5F35A 4TX1A 4DV5O 3SQLA 4A27A 3GDGA 4LSMA 4LA4A 5B3SC 2H6EA 1UPBA 2D3TA 3VAAA 1TXGA 1KQPA 3CNNA 4IS3A 2H7YA 4TYWA 1HYHA 5K6RA 1RLIA 1J2RA 1LF0A 5CMLA 4YVFA 6AT1A 1UXIA 1GN8A 3N05A 1MJHA 3RHSA 3BEOA 5K8IA 2H08A 3KYDB 3S99A 4YO7A 3I32A 3I9NA 1AXGA 3TTSA 4QJFB 3GDOA 4W6ZA 3JQ8A 2EP8A 3I04A 2I3DA 3BCUA 2O8FB 4FS3A 2R2GA 3GGGA 3MQFA 4DIBA 4BNLA 3VPHA 1E94E 1CR4A 3EWAA 4LSWA 4MKRA 3G85A 3ZWVA 3H6KA 3PA6A 2CLIB 3ADPA 1HDIA 1CR6A 3X2QB 5FOQA 3DLPX 4FD2A 3FTDA 5AT1A 1KI8A 4P7GA 5E6RA 1B42A 3QUQA 4EVQA 4L15A 2ACKA 1C5KA 4ICGA 4FQ5A 4RTPA 3C5HA 4FZ5A 1XTJA 2F9FA 4RVDA 1VTKA 2OAEA 2JC3A 1O8CA 2WWTA 4D43A 3B2QA 5C37A 5C31A 1M6HA 1Q7RA 1E62A 2BGRA 1DWOA 1YMQA 3R3JA 2X7JA 1O1YA 4IIUA 1L5HB 2ZI3A 3IULA 4L85A 3PDCA 3LUDA 1EZJA 3EXIA 4N18A 4NBVA 1S3JA 4EY6A 1T6ZA 3M8KA 1DQYA 4B74A 3CGWA 3DLHA 3FDZB 3GNSA 2FETA 2C97A 4P86A 3V97A 3URKA 1BXRA 4AQDA 2IWRA 2OTJV 2JGJA 4M8LA 1YRAA 4JI6B 4J16A 3O4FA 5JDIC 2H3EA 5D86A 4J0KA 3OUTA 5B4UA 4I4NA 3OT7A 2D4HA 2Z09A 1JSLA 1GM8A 1P74A 4PIVA 5B12A 3KE9A 3D7RA 3SHFA 4R81A 1PKEA 4G5OA 1VP3A 3M9LA 3WJ7A 2OGSA 3QLJA 1ZH0A 5IKMA 3C1OA 4LN1A 3I4CA 1WXFA 3MJEA 5EYPA 2J5QA 2FXIA 1ZQ1A 3KYCB 3SSMA 1YCFA 4KC0A 5IVPA 4MKXA 4PZDA 1HFJA 5AHXA 1SXGA 3L04A 16PKA 1W36D 4LOLA 5LZ7A 1RRGA 2NPIA 4YRZA 2O8EA 4HG2A 4G8DA 5KWEA 4QGFA 1PN3A 2MR6A 2C77A 3CEMA 2I6SA 3ZTYA 1Z0UA 4OXNA 3L9DA 4FGLA 1GR1A 3PR1A 3A4MA 2OA0A 5KO2A 1KR5A 2FG5A 4NMXB 3Q7IA 5FPPA 5FWYA 1WETA 3B82A 3IMFA 3OEED 2IH5A 3EZ6A 4LPKA 4EHJA 1BX0A 3C3MA 2ITDC 3UHJA 5EJMA 3WYGA 1FOEB 3QOXA 2PGJA 1FX0A 2QTVA 1QTIA 1RWWA 2IDJA 4P9NA 2DTEA 3BORA 1NR1A 4LBEC 2YXNA 2IBTA 2O2EA 3DTUB 1DHRA 1U02A 4N1AA 1DQZA 4UU0A 4LXXA 2UXCO 1Q1GA 2N47A 4IEEA 3DXXA 4P53A 4A8HA 4AS2A 2WAAA 4X65B 2HBZA 5IAKA 2VBFA 2VKTA 3A06A 2DQ4A 1GYRA 3SC2B 1M7HA 3EXEA 4N7MA 4JUFA 2EJUA 3GR6A 1KH1A 4WSOA 4CLOB 5A3SA 5HP4A 1DBWA 4FLEA 3WHLA 4JYAB 2YQ4A 1C50A 3P26A 1ELOA 2B7BA 4ID3A 2XNCA 1E58A 1FBTA 4X6UA 3DSQA 5IF3A 2EILC 4MW2A 3JASB 4QXOA 3K4HA 3O9MA 3R9XB 1EWQA 3ROXA 2CVZA 1I0LA 3A1DA 1NSTA 1UXOA 1K0FA 3DTVB 1JMYA 2ICAA 2EJRA 3I04M