1YSOA

Yeast cu, zn superoxide dismutase with the reduced bridge broken
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
153
structure length
153
Chain Sequence
VQAVAVLKGDAGVSGVVKFEQASESEPTTVSYEIAGNSPNAERGFHIHEFGDATNGCVSAGPHFNPFKKTHGAPTDEVRHVGDMGNVKTDENGVAKGSFKDSLIKLIGPTSVVGRSVVIHAGQDDLGKGDTEESLKTGNAGPRPACGVIGLTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unusual trigonal-planar copper configuration revealed in the atomic structure of yeast copper-zinc superoxide dismutase.
pubmed doi rcsb
molecule tags Oxidoreductase (superoxide acceptor)
molecule keywords YEAST CU, ZN SUPEROXIDE DISMUTASE
total genus 39
structure length 153
sequence length 153
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1995-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1ysoA00
3KH4A 1MFMA 2WWNA 1B4LA 1FUNA 4FF9A 1TO5A 2R27A 1IBBA 1CB4A 1IBFA 1BA9A 1SXAA 1BZOA 1YAIA 1PZSA 3LTVA 3RE0A 4A7TA 3GQFA 2AQTA 2Z7WA 4N3TA 1XTLA 3KM1A 2AQRA 4L05A 2E46A 4BD4A 1KMGA 2XJLA 1E9PA 2C9UA 1IBDA 2C9VA 2ZKWA 4MCNA 4A7QA 1TO4A 4N3UA 1EJ8A 1IBHA 2WYZA 3L9YA 2JCWA 4U4IA 3T5WA 2C9SA 1YAZA 1SXNA 4OH2A 2JLPA 5KBLA 1SXSA 3MKGA 1UXLA 3HOGA 2GBUA 3GZQA 1UXMA 2VR7A 1CBJA 1YSOA 1E9OA 1B4TA 2E47A 3GTVA 2Z7UA 1E9PB 2WKOF 2GBTA 3QQDA 3GZOA 3S0PA 3KBFA 4A7UA 1N19A 4BCYA 4A7VA 1SOSA 1JK9A 3CQPA 1EQWA 2WKOA 3L9EA 1DO5A 2K4WA 2LU5A 4OJAA 1JCVA 1E9QA 3ECVA 1E9QB 3HFFA 2WZ5A 3H2PA 2WZ6A 3K91A 4BCZA 1IB5A 1F1DA 1SRDA 3QQDB 3H2QA 1E9OB 1PTZA 2AQNA 3SODB 1U3NA 2AQPA 1S4IA 3F7LA 2AF2A 2APSA 2Z7ZA 1SXCA 3HW7A 1Z9PA 3GZPA 2ZKYA 5KBMA 2ZKXA 2AQQA 1OALA 1OEZW 2XJKA 1HL5A 1N18A 1F18A 1RK7A 1SXZA 1F1GA 3MNDA 2Z7YA 3PU7A 5CU9A 3CQQA 1COBA 2WWOA 4A7SA 1F1AA 2V0AA 3ECUA 1OAJA 1XSOA 4B3EA 1JK9B 1DSWA 5KBKA 1L3NA 1AZVA 2SODB 1P1VA 1SDAB 2WZ0A 1OZTG 2VR8A 1SPDA 3KH3A 3KM2A 1ESOA 3ECWA 2NNXA 2AEOA 2VR6A 2Q2LA 3F7KA 1PU0A 1OZUA 3CE1A 4A7GF 1HL4A 2ZOWA 1XTMA 2WYTA 2AQSA 1QUPA 3GTTA 2GBVA 1Q0EA 1SDYA 4A7GA 3KBEA 1Z9NA 4MCMA 1SXBA
chains in the Genus database with same CATH superfamily
1G0YR 5KAQF 2DYPD 1BWWA 4KHXH 4NHUA 2XG4B 3FO0L 4RDQF 3HVNA 4WWOA 1NC4D 5CCKH 1BA9A 1YEJL 4FTVD 5CF3A 1HYSC 1QHOA 4AJVA 5ABDE 2I7OA 3C8KA 3FQ2A 4RISH 4WEBH 3WNIA 1X4XA 2AQTA 2DQ6A 3B9DA 4XNBA 5ERWA 4M03A 3BVNB 1R5WB 3VFPB 2WP3O 2UWEB 5AW9B 3GSWB 1NJ9A 1FNAA 4K3EH 2VOTA 4H8UA 3L9YA 4AH2A 4P23C 5HVWA 5CEXB 4M6NL 2P52A 3V4PL 4U1LB 1U95A 3WFDL 3DJ9A 3QCVL 1IU1A 1GW6A 4Y1AB 5E6IC 4AQEA 5AW6B 4O4YL 3LXUX 3NIDF 5GIRB 4FG4A 1DR9A 3A0OA 4UNTA 4NKOA 3DTDA 2X4OB 5GJSH 1UWGL 4K3GA 3NP3A 4DUWA 3QIUB 3JTSA 4PCYA 3RUGA 4DZ8A 3W9DA 4FLOA 1ASQA 3D4GA 4JHAL 2BP3A 3HUJA 1IAKB 2F7RA 3U0TA 3LV3A 2GJZB 4ZO9A 1GC1H 3JZYA 1BV8A 1DVTA 4BKTC 2EO1A 4F15B 2PP7A 3T8XB 5BQ7A 3LKNA 3APMA 5F96H 5E6IA 4JM2D 3MLRH 3KL0A 2LAAA 2WXGA 3EGDB 4UIKH 3JWDH 4RFNC 5JUEL 3T04D 1PGRB 4WO4A 1ZHKB 2X88A 1B4RA 2QLYA 4JHAH 3HN3A 4PJ8B 4WJKB 3ZU8A 3S3BB 3ZO9A 2FT8A 2WXKA 1O6TA 4GMTL 5F9JA 4JFXB 1MI5B 1JCKA 4W4OC 3QORC 2AI0L 4JKPL 4F9LC 2UXGA 3AY4C 4AWJC 4UQBA 3MR9B 3OJVC 2NDFA 3ROOA 5DLML 3VX1A 3ZYZA 2R2BA 3TBYA 2R29H 1KJVB 4G6KH 4R6UA 3EBHA 2ROYA 3ULVD 1FORH 3KHQA 1Z5LB 3CTTA 2DYPA 3V7AE 5EEUA 4KAQL 1LVEA 2UZIH 3O41A 4AXWA 3E8VA 1D5XA 4ENEC 3RL2B 3TPUB 4FTVA 4U1GC 1IC1A 5F7YC 3GXTA 1HNYA 4ZUUA 3B3BA 4XVJH 3TL5A 1ZGLP 2GVYA 4Q6YA 1KGIA 4UTCA 2AZUA 2E0PA 4KJYB 1I8MA 5DZVA 2YAQA 2YMOA 4NDMA 1XX9C 4CVXB 4MHHG 2AEWA 4NCDA 5EZPA 4MZRA 1FF5A 4ZFOL 1KB5L 3MLZH 3FRUA 3QUXB 5HYIA 5LGHL 4ILDA 3FO0H 4NUGL 3BAEH 3GMOA 3UJIH 2JJSA 4LHUG 4Q89A 4YHKH 1E2VA 4N5EC 2W60B 4FLSA 5SWZB 4J3UA 4Y2DB 4PG2C 2D8KA 4LU5H 4QHMB 5EU6B 4J3WA 4WTWA 2FGZA 5SX4H 2VLRA 3CWGA 5E8EA 1SHWA 4OGAC 2CO1A 1JPTL 3TONA 2FWOA 4BH8A 4F8LA 4DT2A 1KCWA 1KSRA 4G83A 1U93B 4ZTOL 2Y5QA 1RZGA 4ZMWA 1ZT7B 1DVFC 3TN0D 3EFOB 3P0GB 4QTHB 4BZ2A 4AYMC 5HI5D 4PAZA 1MQKL 1I9JH 4W1TA 4XO5A 1XSIA 5C3IA 4HUNB 1CPUA 1ORQB 1DUZA 1KGJA 4NRYB 3AJ7A 4LSPH 2DMBA 2R2EA 3Q13A 1P4BH 2OQJA 5CR1A 4TRPL 4FYTA 3WIHH 1JP5A 5F0JB 1I8KB 1HXYA 1MCHA 3ATAA 5E6RB 2P5WB 4UZUA 1TQCB 1FFNA 4OF3A 3WSQL 2FL5B 4BZ1H 3WIFA 3ARUA 3VWJC 3G08B 4AEIL 2GBAA 5EBLB 2IAMA 1BD2A 2NY7H 3QDGE 3F6JA 2BHFA 4E9QA 3L48A 3GJEB 1NBZB 2BIIA 2G4EA 2ICES 3KG5A 4X6CF 4P46B 1JHTB 4OJYA 5AW3B 4KI5D 4Y9CA 5I1LB 1EXHA 2V3EA 5DURD 4HUWB 1JPEA 3K4AA 2X9WA 1I85A 1MNUH 1D9KD 3TPKA 5FKAB 4GO9A 1D5BA 1T20B 4NQSB 4G6FD 4DKEH 3UX9B 2HFFB 3RNKA 2R39A 4ZD3L 2HKHH 4PD4J 5FA3B 3HZYB 4GT0A 1TDQA 4Y5YB 4JFEE 1ZS8A 2W95A 2G75A 4LVHC 4QRAA 2P46B 3NK4A 1IJ9A 3V4PA 1JE6A 4ZYKB 1A9BB 3KPRB 4H7VA 2JF1A 3TNNB 4POUB 4N1CA 1NH6A 4JQIL 2XWXA 2FX7L 1UM5H 5BQDA 4NQXA 3WFCH 1DBJL 4DKFH 3RWJA 1T89A 5DQJB 5IMMB 3LS4L 4LLYA 4AW4A 5I0VA 3RTQC 1CFVL 3NOIA 2XTSA 3C08H 5EU6E 1G7IB 3QO0A 1YZZA 1TZAA 5GZOD 2IAND 2F2HA 4HETA 1YCSA 4IJTA 4PRAB 3QYMA 1PD6A 1E8ZA 2VQUA 1DJXA 1YEEH 2OMYB 3KCWA 2DI7A 5DU7A 1U33A 5K9OA 1PKQE 4OZGA 3U4AA 3BUYA 4BQ9A 2V8MA 1LO0L 1R34A 4ZSOB 3I9GL 1XGQB 5EV7A 1MHEA 3PWNA 1GYCA 1T6BX 2HT4C 4NBXB 4BRVA 4XNAA 2EDEA 3RWFB 5H37A 3X1BA 2Z92A 4JDVB 3BC9A 2CMRH 1EHKB 3AMKA 2O6PA 5LGJB 4E41D 5D7IA 2H9GA 4GXUN 3HA0A 5DJ6B 2AJVL 4S2SA 1BAWA 4KHTH 4M93B 1J05B 2Q7YB 2VN4A 1KTJA 5I1CL 3MBED 4MYPA 1KWGA 1YYLL 3BXNB 1N5AB 2Q8BL 1NEZB 5HGDB 4YNYA 2CCVA 3NRQA 1ZTMA 3OKKB 3QHFL 4POZC 1PEWA 4NO5B 2WP3T 1G7LB 3SKUD 3Q44A 4P2OB 2Y5TA 5A7EA 1NCAH 4PV9A 4M62L 1EJOL 1FIEA 1IGFL 1MY7A 3H9HB 4KJPD 3QZOA 4NUJB 1UZ6F 2EYTB 1OSEA 2QHLA 4UIMB 2PWGA 5EC1A 5KYUA 3WHE1 1TQBC 5BVPH 5CJQL 5HYSB 2ALAA 2CRMA 3F7RA 3B37A 1MZYA 1YDPA 1CT8A 2BXZA 3RG1C 1WWCA 1AHWC 1F58L 1L5GA 3NTCH 2A83B 2HH0H 1MEXL 2QVFB 3JWDC 3O3AB 2J4WL 5HHMD 1BAFH 1OAJA 5EB9A 3H0TA 3SYOA 4BBWA 3FSZA 1NIEA 2P1YA 2F15A 1HL9A 4C83A 5KBKA 5BOZG 1T5WB 5DFWH 4ODTH 2Q86A 2OX5B 3MLUH 1EGJA 1BG9A 4S2SB 1M05A 1P5UB 1A3ZA 2XG5A 3LEVH 2BHYA 4L8SB 1PU0A 2ADFH 5ACZB 4M6ML 3X1FA 3GSNL 1CYGA 2H8PA 1BF5A 4WJ5B 3AUWB 3ARGA 1SHSA 1E3FA 1RERA 3X1EA 4MMXA 1FWXA 4JDZA 5TPWH 2B59B 5JHDE 1R3JB 4TNWF 3KPLB 4JLRB 5GZOA 2AAAA 3BDYH 2V7NB 1CDUA 3DX1A 1QBBA 3DHUA 3SO3C 4M8RA 3W9EA 5DA0B 5FHBL 4KKBC 3INUL 2E76C 4KWUA 3NGBB 3UBXI 2ZXCA 3PNWB 4PJ9C 2HRPH 2VXTH 3CPUA 1R75A 3N0PB 3QUMB 2D0FA 4AYSA 2WOYA 3F8UB 2QTEA 4DP7X 3JVGC 2MNUA 4Y2DD 3FU7B 4WEMB 2VISA 2W1NA 2G3XA 1EO7A 3HKZA 3SHSA 1W0VA 1E4WL 3NAAL 3D07A 2D31A 2Y3AA 3GUFA 1JPFA 5IEKB 4L4JA 3QUXD 4U0RB 5AG8A 5A43C 4NQVA 2YLKA 1SJEA 4NB7A 3O6FB 1LO4L 4DGVL 4KQ0A 1UVQB 1PZ3A 1A7PH 3IMBA 4FQLL 5D7EA 1UWEH 3SZ6A 1CDYA 1MUJA 3QQDA 3FT4A 4NZTH 3VXQA 1NLBH 1P0SE 3K1DA 3MGTA 3T4YA 1MRDH 2QSVA 5KUMA 1RZQA 4GPVA 5L8JB 1J5CA 4B9YA 3BESR 3G6JE 1J5DA 1KCSL 2MHAA 2LU5A 1JTTA 4JFQA 2DQHL 3GXDA 5FKAA 2VABA 5KEZA 4OIFA 2PYEE 3MFGB 3SGDH 3F12A 4TVPD 4LSQH 5F9DC 3VXUB 3MRPA 3PREA 3RWHA 2W80C 1BF2A 3MDJA 1V5JA 2XI9A 1Y6NR 2PO6A 3BYTA 3GMLB 4XVTL 3SDAB 3QEQB 3TZVD 2QDWA 1FG2A 4UT9L 1FVDB 4NNYA 2YKLL 4LHUA 1U3NA 5D7JC 3NA9L 1MI5D 2APSA 3W3BA 1W91A 2FO4A 1GXEA 4XPGH 1I7UB 4MS8D 2OL3B 2R0LL 4IKNA 2EH8H 2RGSA 5DYOA 5D2NC 3WD5L 4Y2OA 3QDJE 4WWNA 1GRWA 1IILE 3CLWA 4I9WE 4G5ZL 1CFBA 3K2KA 5CJOH 1I9RL 3ZZLA 2CO7A 3P54A 1F1AA 2V0AA 1VEOA 2E3VA 3C08L 5FC9A 1WE5A 3JTTA 2WLJA 2WXLA 2F1EA 1QUNB 2EIZA 2Y6SC 2FJFB 5CINH 2FTAA 1ADWA 2VQ1A 4TNFA 3TBTA 4C56B 3M1OA 4TXVB 4BGDA 2AQ2A 3R4RA 4NZTL 3NCWA 2J12B 4G7QB 4WHCA 4XP4H 5IB1B 1PZ5A 4KGJA 2PTUA 4NERA 4Y2DC 5FUCC 4M1CD 1UD2A 5CP7B 3ZBMA 3FFCE 1TKWB 3MRKB 4DN3L 2UWEE 4UB0L 4ANUA 3NJNA 3ARFA 4BQ6A 4R26H 4UBDC 5K39B 3VFTB 3K5RA 4AENA 1MSPA 1MNUL 4KO7A 4N2FA 1A1NB 2FYYB 2HG5B 4OKVB 3G9AB 2DLGA 4JRYE 3B9AA 4OD1L 4QY8B 4JVUA 4N86A 3PL6B 3C5JA 4N2KA 1ZHLA 3O3BA 2WNKA 1FJ1A 4HCIA 2F19L 1RIVH 2IC2A 2XA8H 1HDMA 1XAUA 4NM8L 1IBHA 3H42L 1FGNL 3L8QA 3MLTA 2EVIA 3EHBB 1BMGA 5AG9A 1QHPA 3DVGB 3HZMA 1G6RL 2ZCKL 1NGQL 4FKHA 1Y1UA 3SOTA 3PE9A 3IMTA 4PJ6A 4HCRA 4XTRD 1R3KB 5FF6A 4HX1A 4OT1L 3CN2A 4ZTPL 2VDQL 3KW7A 4UMSA 4Q97A 4F7EB 1IZKA 2VDRB 2Y24A 3LAFA 2OR9L 4MB1A 5DRNB 2CRZA 4XHQA 1IRAY 4TTGA 1EFQA 3KPOA 5J6HB 2ZCLL 2DMKA 1VDGA 3ESVF 3VRJA 4A2DA 1E8XA 2VO5A 5IB3A 2R2BB 1NAKH 2WO2B 2AV7A 2DYRB 4Z7VE 1JMZA 2K6ZA 3IU4L 3QB7C 3WFCL 4EDXB 5LUMA 4LEXH 2YRZA 5K5YA 4QHPA 1RZKH 2VXSH 4U7KA 3QDJB 3QRBA 5AZUA 5DJDB 2NLJA 1JVKA 3C9NB 2NY0D 2EDFA 4ONOA 1LMKA 1XEDA 3AB0C 1A5FH 3EH1A 3VXUA 2VABB 5I9QB 1AGBA 3IK2A 2EILB 2PW2B 3AROA 4I1RA 1ZD6A 4EN3C 1RJLA 2K7QA 4WNJA 1XR8B 4AYFA 3OR7B 4Y4HD 4BH7A 4DPRA 4HWNA 4CVZB 1T0MA 4FMVA 3UTZA 1L7TL 4NYLB 1P5VA 3CSYA 4GRLA 3NJMA 2K1MA 5T1JA 3ZQWA 3QQNA 3MJ8B 3LV3B 2EDRA 3BPOB 1OTUC 4GRWE 4R7NA 3HG1D 5AYTA 2MPVA 2XIBA 4G2AA 4Z7QE 1NKGA 2W38A 2OK0H 2VXQA 2MFNA 4KY2A 4NKIL 4AEIH 2X9XA 1TT6A 4UV4H 1PCSA 5C7XL 1IKFH 1PNCA 1SOKA 2ZOWA 3MV8E 2UZIL 1RZJL 1CXLA 2D7OA 2GHWB 2Y07L 4LO9A 5DVMA 2YD2A 3NABH 4AG4H 3GI8H 1TQUA 5EOCJ 4ZFFB 4ZX4A 3ZK0A 4KRPB 5LBVA 2YGOA 3IDUA 5IVXB 1VIWA 1KBBA 4WGKA 1ET8A 4YHZL 4KXBA 1LO2H 3ARSA 3MBXL 4CA4A 1KYOJ 1D5IH 2M1KA 3QVAA 4H8WL 4MMZC 3M17B 2EC9T 1Z66A 4ANKA 1G7JB 5HDRA 5FCSH 5AW1B 3VFPA 2UZPA 1AIFB 3BGAA 4JG1L 5DYOB 2X05A 1LE9A 1AHWB 4YK4B 4PVNA 3L3JA 1KIPB 3UDWA 3H6AA 5C8JA 3I50H 4Q14A 1F2QA 4ODSH 2P8LB 5J11C 2C4FU 1SXNA 4GIPD 1CI5A 2NY6D 4WWPA 4YHKL 1OSZA 3QPXL 5FOBB 1T3FB 5T1MA 1RLWA 3UBGA 1SN0A 2HX7A 3HTLX 1S7QA 2IGFH 3VCLA 1IV8A 4I0PB 1DDHA 4M8QB 3SO5A 5D7IF 4HWBA 2Q7AA 5LN8A 4FKEA 1EZUA 2F58L 1HINH 4B60A 1T7ZA 2FX8L 4GAYA 2ED7A 1N70A 4FQXB 3RUGE 2YAHA 4Y8AA 1OQXA 4UANA 2YEVB 4NUMA 4K94L 4UIMA 5KYUB 1CGYA 1WAAF 4G9DB 3VXUD 5IGXL 3V9FA 4NO0A 4NP9A 3ZDWA 5D2LB 4N8VB 3ZTNL 1L0PA 1LQSR 2XUWA 5D7JB 4WK0B 2VSDA 3DX6A 4IHBA 3O4LB 2X1OA 3RU8L 3AUVA 3BZFB 5L2JB 1T2QH 4XPAL 1K5NB 1WFMA 4LT7A 4ZO7A 3GEFA 3VXSE 4KO5A 1TTGA 1ZT4B 3AM8C 3O6FD 4UNVA 2Z8RA 1INEL 2JB5H 1RZ8A 4ETYA 4CNIB 4TRPH 4HISA 1F11A 4G9DA 4BKSC 1RK7A 4GUPB 4KY1H 2QKIB 1DN0B 5I5RA 3MNDA 4MA7L 3ZDXE 2VMJA 5MHSE 4P57A 1C5BH 3GSQA 4FYSA 1J1OL 3QUMA 4GAYB 4O02A 5I5MA 3BYYA 5SWQA 4WI5A 4IEFB 4U1IB 4YQXL 1P84J 3TC9A 2EEXA 1U3ZA 3IRCA 2HT2C 3QJFA 4HKBA 3AG1B 5HY9A 3UP1A 5JIPA 4APQC 1J5OL 4OKDA 5DHVH 2IOOA 3JWNC 1BZDA 4P9HH 4NJAH 5GSRA 2X9YA 4Z7AA 3NZSA 4IHOA 3RURA 1I3UA 2GI7A 5ITBH 1CDIA 1NGXB 4XC1L 2GB2A 3DWTA 2FHCA 4PP1C 5CFHA 4RSYA 3J27A 2IPKB 2APTA 4KUZL 1E5ZA 4FJZA 3HNTL 2IPUK 4JUTA 4MAUL 4EIBA 1C8QA 4S1QL 4QYOA 1A7BA 3B7TA 3QEUB 3BVWA 2VDLL 4FF9A 3BIKB 3TA3C 2NR6D 5JYLA 3NA4A 2WZPD 1UD6A 4HOZA 3IF1A 3ILQD 5E8OA 2ITDB 3CZGA 3DX8A 1QRNB 3KPQA 4LL1A 3V7AG 5EG6C 2X28A 5F7WC 5JO5B 3VRLF 1EEZA 2JIXA 4XOBA 5AZEH 1DQLL 1O0VA 4I13B 2XKNA 4A2LA 2XRAH 5IVXA 1JVLA 4MCNA 5A3ID 1JF1A 1SFDA 4NUJA 4ZOCA 4YDLC 2ESVD 1M56B 1Q0YH 2Y7LA 4JO5A 5EZJB 1TJXA 4LLDA 2K9FB 1U6AL 5C86A 3UTPE 2GBUA 2ITEA 1HHIA 4A6YL 3CFJB 4XWGH 5EMYA 1JZ4A 1CDGA 3TBWB 1QVOA 2OYMA 3C6SB 4O51A 3CFDB 2YOCA 1Z32X 4K9EL 2EDDA 3GXUB 4HJIA 4DP1X 3BCDA 3KBHE 3X14B 2PR9A 1HJBC 5IFAH 4KRLB 4NYLA 4GW1A 1OD9A 3RWDA 5I19H 3HFFA 3GJFH 1S7RA 3LKRA 3AS2A 4DFIA 4RGMC 3FC8A 2OW6A 3OSVA 4YHPB 4AEHL 3ZR5A 4FABL 1BFVH 3T8MA 4FQJH 4AIEA 3HC3L 1M42A 4EI5C 1W15A 3S88L 5I8CA 1EGJH 5B7MA 4JHWH 4J28A 5FXCH 2L0DA 2DEWX 3F7LA 5E1AA 1T21B 3ZHNA 4ZMNA 4MRCA 5FYJL 1XH2A 1DHKA 5BS0D 4U1MB 5KBMA 4JREC 3PABA 3QXVA 1T6VN 4TVUA 5EN2B 3CH1A 3H4HA 5FGSA 4QR7A 1RZFL 2HT3C 1S7RB 5DZAA 1F8TL 1OAYL 3EGSB 3IDNB 3DK2A 2ZAIA 3BIAX 4FHBD 2PF6A 2R15A 2ZOUA 3K1KC 3AU1A 3PL6C 3T6VA 3ESOA 3MO1B 2ODHA 4HFUH 1VLXA 1K5WA 4G7YH 1MFDH 2WZ0A 1LO2L 3QFDB 3BZ4B 4JFHD 4ZAKD 3SGEI 1CICA 2C3VB 5IOKA 4X7TB 2XTJD 3PWPB 2VR6A 3ALXA 2YSTA 2GFBB 1HIML 1JV5B 2BH0A 1ZRUA 3HZVB 2CNZA 2E9GA 4AGLA 5J13B 4XBEH 5I1HL 4FGMA 4GIAA 4CC4A 2J7LA 1GKOA 4U1JA 4NT6A 3T8VA 3V6BR 4BK4A 4W9JC 2HVBA 4LVHB 4YX2L 1RKRA 3KLKA 1SXBA 5BZDB 5I0YA 1NCOA 4WUUB 1UENA 2PABA 5F7KC 3ZHKA 3DI2B 4PTTA 3QI9D 1AZCA 1DJWA 1OT4A 1QWUA 1BQHG 2IALA 2EDWA 4NN5B 4LDEB 3QIWD 2UWEF 1FNHA 4QY8A 2BLFA 1S9WA 3DX8B 4B5ZA 3N3EA 1WA2X 1WEJH 3G5XA 2YA0A 1N0XL 4X4XA 2Z7WA 1A0QL 4PP1D 2QV2A 3CXHK 1JG9A 3R4DA 2RBLA 3HC2A 1E9PA 3CK0H 2YK1L 2JELH 3VFMB 3ULUF 4JANB 3MTRA 1JMXA 1TOXA 1CE1L 4P46D 3D52A 3CFCH 7FABH 1X5LA 1J8HA 4Z18A 2YPLA 4EBQL 1UZ6E 4QO1A 5A2CA 5IQ7H 4PJGA 3MLXH 1U36A 2ZX9A 1IC5L 2OQJB 1UXSB 3SYPA 4XODA 3PWUA 1GTNA 4NRYA 3QFJB 3BVVA 1WV7T 1SLWA 2A5UA 3D0LA 1MDTA 2AKRB 5D1QE 4NKDB 4CSTA 2WY3B 3V9EA 2EDLA 4OF8A 1Z3GL 3DTXA 4DJMA 2ZUXA 4XNYH 3IT8D 5K9QI 1T1WB 4EI5A 2WTRA 2MJWA 4FRWA 1XGZA 4ZXBC 4D7PA 4XMLH 1C12A 5CLXA 5L9DH 3EG9B 2NY0B 1F11B 1ES0B 3VJ6A 1FO0A 1WZ1H 5AW2B 2FR4A 4WW2B 1MWAA 4AZ8A 2GJZA 5HHOA 5KBDA 4HUMB 3D85D 1B2WL 3PJSB 4XNDA 1JGDA 3H3PL 4GXVH 4G6AD 4BA0A 4TUJB 1E28A 4OLXH 2IG2H 4TUOB 3OJDA 4FS0A 3DX6B 3EJPA 4Z3EA 2H0PA 5DMIL 5GS0C 5EU6D 3MOBH 3T0EC 2Y4SA 4CL7A 4E9LA 4HHAA 1ZIBA 3OHXA 4FLHA 4CN4A 2H41A 1FL3A 4MCYB 3ULSA 4WK4B 4FQHB 2GITA 5DK0A 5FOBA 1L3NA 1KYAA 4NLHA 1LO5B 4RZCA 2F5AH 4QT5B 2CALA 4JQIA 1UCBH 2W5PA 3BKJH 4JM2F 4Y0GA 5C07E 2IFGA 5KYXB 4PM1A 3BEWB 4IGBD 2EUZA 2OMBA 1ZGLM 3NIDB 3QI9A 5B39A 4F20A 2AQSA 1KIQB 2VSKB 4DWHA 4LIQE 1MFCL 1JGDB 4YSEA 1MJ8H 4FMFA 1MREH 1SEBB 4H0GA 3KPRE 5T3XE 5C8JB 1L0YA 1WIOA 3LPFA 4M93C 3R7RA 4JFOB 5LN4A 2B08A 4Q9CA 2WCSA 1YQVH 3BFQG 1NDGA 2ED8A 5C08D 4GG6E 4M6AA 5HJGA 1YYCA 3A5VA 2UZXB 3EADA 5KG9A 1DBAH 4LKCA 5FYKD 2V5MA 4LLQA 2ZZUT 2J73A 4GSQA 3B7UX 2A3TA 3P4NB 2A99A 2XHNA 4OI8A 5E94B 2WYZA 3S34L 1GKEA 1IMHC 4YHIA 3K2IA 2YAMA 5L4MA 1YPZA 3HPLA 2P4AB 4JFOA 5C0CA 4X98A 4ETQB 3RDTB 1JGVL 2XNAB 1O5PA 3IGAA 4TQEH 2FWUA 4NAQA 1QFOA 1H6EA 5D72H 5BRPA 2AEQL 1J1PH 1KIRA 1V7MH 2A4EA 3P9LB 3ZE1B 4CMHB 4LSQL 1EJFA 1QLRA 4U2YA 2R23A 5GGVL 4IU3B 3GBLA 1DSFH 3O3AA 3FN0L 5KYXA 1IC4L 2FX9H 1KELH 4P9HC 3HPJB 4K7PL 3MRFB 5I74B 3NCBB 2MH4A 3H8NA 5C0JA 3IGFA 3QUKB 4HSQA 4J5VA 5AUMB 5E5RB 4WHDA 5D7HA 4AQEB 4PTTB 1CN4A 5DJZB 5MEPB 3UTQA 5DQDH 4UQ3A 2XU9A 2YD9A 4JVPA 4ADIA 4IMLB 3RKDD 5AFAA 2D0HA 5D1ZB 3SYAA 2JJTC 5I6LA 4B0MB 4Q9RL 4Y4FA 3QUMH 1XXFC 3EJCA 4TUOA 4K7PX 1CDCA 1XL6A 3OKNB 3MMEB 4EDXA 3MUHL 4MQ7A 5HHOB 2O6CA 2BFVH 4I18C 4PVLA 1IBGH 2V9TA 2ERJC 3CC1A 1T03L 3U7AA 4IGBA 1CFMA 3EG9A 1RIHL 1SNRA 5INDB 3EGSA 5C0CE 4HIIB 3VQLA 5D1ZA 3D2UA 3E9UA 3EJUA 1LO0H 3D85B 3JTBA 5D1ZI 3ARDB 3LZOA 4X5RA 4YDVA 3PGFH 3GMNA 3LPPA 2B77A 1JTPA 5E2TL 5ENWA 2A74A 1A6ZA 2AJSH 2ZWSA 3CMOH 5HYQB 1EXUA 2NT1A 4Y5YC 1HOEA 1O7DC 1UM4H 5DMGC 5EOQH 3OPZL 2VW7A 5GGSB 1A1NA 2FYYA 2HG5A 2OJEB 4I18A 4J3OH 4K3JH 2DKUA 3ZMNA 3ZKXC 3MACL 1J8HB 1DFBH 5JIKA 3RZCB 3C5JB 3EOAA 1BAFL 3ZE2E 5BRQA 4QRBA 1TKWA 2IF7A 5HGAB 4K94C 4N3TA 1XF3B 4PHXA 3QISA 4AENB 1QLEH 3RVWC 4JX0A 4MJ6B 3DV6B 3TASA 3TNNA 2UYLB 1ZWIB 2D3LA 2HJLB 3FUKA 4JL2A 4XP6L 5TH2B 1GS7A 4ZD3H 3VWKD 4Y5YA 4QRRE 4I5BA 5MENE 2NXYB 3QEHA 5JQIB 4MB4A 5C0GA 3BRGC 1SBBA 2P42B 1JD9A 1QLFA 2E7DA 1IM3A 1HWHB 3GMNB 1RIUH 1U8NB 1URIA 3NUKA 5F2FA 2UUDH 3VSUA 3G7TA 1QI3A 3MLYL 3RGVC 4A2EA 3OB0H 3JWOL 4G8FB 3FQNB 1U92A 2GFBA 3NCYP 3I9IA 3OAZH 2DQUL 4K5LA 2OCCB 4Q56A 1F3RB 1MW0A 4GXFA 3WFBL 3SZKC 3NIFB 2VLJE 4J1UA 1SEBA 4HAGA 5TQ2H 4DKDC 5LO7A 2D7MA 2C9XA 2DLFH 4MA1B 4HC1L 3I3BA 3QEUA 1GJWA 1YECL 4X2UA 1JHLH 2WTPA 4GKSA 3M8OH 2BVQB 4KKLD 4R4FL 2SEBB 4JFDD 3QCTL 4Y16D 2QSQA 3G04A 3MCKB 2APBA 1UB5B 2R1WA 1HOCB 2LVEA 3HR6A 1B0RB 1F4YH 1JRHH 4GKOA 3LPOA 1HILB 3VI4B 2XC8A 4LCUA 4XVUC 2N4IA 4MCYA 4P4RA 3ULSB 4KBPA 3F7VA 3F12B 1I1AA 1Q72H 1JZGA 3HNTH 3MCG1 2CKNA 1T1YA 2Y7MA 1LE5B 2XX1A 3IWUA 1BPVA 1FZOA 4PJHE 1HHGA 3RGVB 4GUQA 4ZUWA 3DIDA 3IDYC 1A8ZA 3QDAA 2NXZC 5F89A 2K6WA 2G5UA 3D0VB 2N7SA 2X1XR 3PHAA 3VXME 2VZ3A 3U9WA 3OSKA 5EUOE 1Y0LB 3E8UL 2W0FB 3ARED 4JFFA 4OAWA 1QSED 1CE1H 3GIVA 3K81A 4HOWA 1IZJA 2R1YA 5GPRA 1NCAL 1KBVA 4RGNB 3HB3C 5LGHH 1QEXA 1ZV5A 4QRUA 2R4RL 2WLKA 1WZAA 3KBEA 2OKMA 1ACXA 3NCMA 4QD2E 3TNMB 2MQGA 4Z0XA 1UGKA 1H0DB 1TMQA 1O75A 1A2YA 1R4XA 3PLYA 1QFWI 2VNCA 5DEGA 1LDSA 3UZEA 1D7CA 3BAYA 3QE5A 4PB0L 1EX0A 2VW6A 2X4SB 4MQXD 3PQYA 2VLME 4U6YB 4P0DA 5AB1A 2VDLB 3X1NA 2P5EE 1CUOA 3N42F 1IC7L 1IC7H 3NSCA 4I0PA 1CR9L 3MRJA 2GIMA 3HE6D 1G7QB 2P80A 3Q8BA 3UTPD 2XCMC 4Z7OE 4OSUL 3TTSA 1HIMH 1D5XB 1LO3L 4JDZB 3BN3B 3VDCA 3STBA 4QYOB 3GBML 2XXCB 5I71C 1MFDL 2YIHA 1FLRH 4XPFH 1QSEE 1N6QL 2Z91B 5BMFH 4FQIH 1E5YA 1GVIA 4MJJA 3FRPA 4QT5A 4R0LB 2WUBL 2X42A 4UT9A 5DF0A 5F9JB 3DJTA 1HXMB 5SV3A 3B1UA 4ICWA 3FCBA 4KKPA 1JWMB 4ODHH 5EC2B 5GGQL 4LEOB 5EC1B 1HESA 3PWPD 4WUKL 4PRPE 3ECVA 4UIKL 2CG9X 1RHHB 4PWHA 4UBDD 4IS6A 4XNZC 1N12A 5A6MA 1CMOA 2R9HC 1JPTH 4JY4A 3LKOA 1P69B 1UASA 2I32A 2DWSA 5HHVL 3QXWA 5J5EA 1OGPA 4KVCH 3VH8A 5B1BB 1A6TB 3MVSA 2RHEA 5T1LB 2QKIA 6FABH 5IFJB 3KS0H 4UQCA 3B43A 2DEYX 1IKOP 1MG3C 3LHPH 4AGPA 4LK4A 3GRGA 3QZWB 1RJYA 3HNVH 3INOA 1B6UA 5TGBA 4D0BA 5ADOL 4N2MA 1E5CA 1K5NA 1BM3L 3HI5H 2DL2A 4ONFH 3UPCA 5HGDA 4ELKA 3JTSB 1UWGH 2AJZA 1ODAA 4YXHH 4HLZG 1OAQH 1VFAA 4NKOB 4BZ1A 4JRFA 5B7FA 1CXFA 4A6YH 4IBWA 4RMTA 3F7VB 5E1AB 2AKRA 1CZ8H 4JDVA 1Z9SB 2N59A 5E24E 3MA7B 4UF7C 2MMXA 1P2CB 1QPPA 4K3EL 1WTLA 4MKMA 2NY3B 1WT5C 5CEYB 3NMEA 4OZGB 2C1OB 4OJDH 4G82A 2WLNA 3AG4B 1M1XB 3TFKD 1U8IA 3VVWA 4GP4B 2FGWL 1NDMA 2WJ5A 4FQXD 2C8NA 1N8OE 4WJG3 5FKPB 5F1OB 1XSJA 1CTMA 2VR9A 1L7TH 2AI0H 2WVUA 4JKPH 4K3DL 4NQXB 5FO9B 5IM7A 4F57H 2HLFC 5BOPA 3C8KB 3UCRA 1UH3A 2A38A 2X6MA 5KAQG 3R8QA 3QO0B 4NNXB 5D4QA 4BUQA 2ESVB 4GAFB 4H20L 3P02A 5AVTB 5JHDA 2XKUA 2KZ1B 4B9PA 4L5FL 2JKSA 2Y2WA 2CLRA 1NC4A 4K5OA 2HFFA 4B9GA 12E8H 2PLTA 3JUZA 3HG5A 4JFFE 4E9RA 1HQ4B 2AJ3A 3HJEA 3THML 3IJYA 2G75B 3OPUA 4PRPB 3ARPA 4X6DB 3UBXB 4E9SA 1BBJB 2HJFA 4IBLT 4I88A 3LSOB 4O2FB 2I60H 1JWSB 1FBIH 3O4OC 4C4BA 3K7UA 3HE7C 4ENED 2FJHA 1YEIL 2EZ0D 3GZOA 4OM0L 2K3HA 1ITBB 3CIAA 4JRYA 1ZGLA 2DWXA 4JRWA 4KRPD 2DM3A 2XFGB 3PL6A 3C6LB 4QIRA 4R9HA 1KXQE 1TZIA 2JB5L 2ZYHA 1JNLL 3DRTB 2V37A 2DQCH 3ZE0E 2AZAA 4NX0A 5I6OA 3LYRA 3U7WH 3TT1H 1BWMA 4MD0B 5GGSA 4GRWF 1GH7A 1T66C 1SF5A 1XGPA 3RJDA 1WAAE 1H9DA 4KXCA 2YRLA 2BFVL 4KAQH 3PRZA 5FLUA 3G6AB 1A6ZB 3A6OA 2VN7A 4HT1H 1JZ2A 1SEQH 3HW7A 3QA3B 4MCZA 4RNRB 3RVUD 1ZT7A 4PB0H 1SLVA 3VB9A 2VLKE 1V3JA 3HHRB 1Y1DA 4PJ8C 3FCGA 4GRMA 3KWWB 3Q8FA 4AYEC 4WF7A 3BH8B 4HIJA 4XNQB 3V52H 3VGDA 5CM1A 4RLDA 5T1DL 1KJ3H 1EZLA 2J1ZA 3BIBX 3VXPB 4HKJB 3JWDL 1NCWL 2XTJE 1HZHL 4YVUA 3DECA 5BZXA 5KN5A 3MXWH 3GBNH 2XWTB 5T5FL 2H32A 4AL8C 5KANI 2PPCA 5TK2A 3QJHB 1JIBA 2JJSC 5LBGA 5F3HA 1QHQA 3LRLA 1AG6A 2GQHA 2ZQKA 1NGYB 5AENA 3FS9A 3UTQB 5MEPA 5JHDD 2GEEA 4MDRA 3LEYH 1C1EH 2VGLM 4Y5XC 1GIGH 2Z34A 5CNHA 3WMSA 1HCFX 3FO1B 4ZMVA 3V5KA 1XCQA 1JRHL 3H9SB 3HS0B 1FNSL 2R59A 4IBYA 3MRFA 1CFNA 3C5XA 2WVTA 4OZHE 1AQDB 2DY2A 5E1QA 1MAMH 3EO0B 4K07A 1FNGB 4MA1C 4OIIH 3IPBA 4M5YH 1T22B 4LCWB 4UQ2B 5BZWA 3TFBA 5HP5A 1GA2A 1XSKA 3OHMB 1DBMH 1GY1A 2ENJA 1JNHB 3O6KL 5HGBA 5IMOB 4MDJB 3RAJH 3L1OL 3QORD 4P07A 1NGXA 4WWKC 1AHWA 5A3IC 4KZ0A 3MRNA 1AIFA 2EDHA 3PL6D 4YHIB 5EDXA 4S10A 3BP4B 1UB6A 3SGKA 2XY2A 1OAUH 2HAZA 4K2UL 4TKWA 3RVXC 4LDLB 5GGUA 4MS6A 4GKLA 1O6VA 5CP3H 5KVEL 1FSKC 3EGDA 3K80A 4FNUA 5C0AD 4BZYA 3D09A 3HNSH 2C3WA 2YGPA 3ABLB 3OAYH 1UJ3C 3GM8A 3PXJA 4HH8A 4H0HB 2V9UA 2H0EA 4Y8DC 4GQZA 5EOTA 4WO4B 2BDNH 3DJSA 4FEIA 5HDLA 4MQTB 3QSKB 1K4DB 4APXA 2VMEA 5I2IB 1MFEL 4XP6H 1ZXKA 3O9WC 2VUKA 3ILEA 3AITA 5F71A 2WNWA 1IM9A 4HU2A 4DSYA 1FPTH 3GRWA 4UU9A 1U3HD 2WJ7A 2Z7ZA 1J8SA 1WITA 4JGJA 4PJ7F 3FF7A 3OAWA 4L8SA 3FOLB 1KPRA 5IQMA 2OMUA 3B83A 4Y4HB 5ACLA 1JNHA 5HGBB 1WUNT 3K2UL 4EF3A 5DMIH 1DJIA 3FYEB 2WXQA 4KNUA 3ZDYE 5BZZA 5LBSL 4XC3L 5C0AE 4HFWB 3GDCA 4XNMA 3VE0A 2OZNA 4Z9KB 1CTOA 4QJ5B 2F54D 4GUOA 3N06B 3UTTE 1S9YB 3MRPB 3UTSD 5TDOA 5IBTL 1XCTB 3VRIB 2K4AA 1MRFL 1SN2A 2MQ3A 2ZE0A 3QEQD 4HDIA 3TZVB 2HSIA 4YDNA 3BE1H 4JFEA 2VDKL 4PJHF 2EDYA 3BD3A 4MXVF 5I5IA 2HMID 2JB6A 4FNRA 1RUKH 2X4NA 2YPKB 2D7TL 2BVEA 3WN5C 1S7UB 3LKSB 4L4TD 4PG9A 1GZQB 5AVXB 1JPST 3FHAA 4XH2A 2XWTA 3PHOB 4E36A 5KTEL 3WIIL 5T3ZE 1R5WA 2KZBA 2G3ZA 2NR6C 4FZEH 4Z76B 5CILL 5H2BA 4YSSA 4P2QE 3QNXA 1XGRA 4Y9EA 5F21B 4KZEL 2F6AA 3BSZA 4OFDA 1QEWB 3CHPA 3KPNB 2B8OT 3QORA 1QOKA 3DTXB 3QH3B 3I6LE 1DTUA 4LQFH 3L3GB 3PAZA 5E95B 3UAAA 4WSKA 2F53E 4E42A 4GRMB 2XOTA 4XP4L 1UUSA 3I2CL 4RGOH 4KI5F 3WNPA 1WD9A 4EKXA 1M2VA 3MGOB 1MHEB 3PWNB 5GHWH 2XFXB 3NIFE 5FUCE 3KLHC 4ADGA 4RNRA 4LOUD 5C0AA 3DPBB 4KHTL 4Y5XA 1HHKA 2LR4A 4BIKA 3CDYA 1R3JA 4AL8L 1QMUA 5DHVA 1A9EB 3Q5TA 4MB5A 3KYAA 3L3IA 3OV6A 3I6SA 5DFTA 3PAUA 3L3OC 3Q6GL 5CHNB 4UQ9A 4MNGE 5IJCC 3EGXA 4FNSA 3MJ8A 1LD9A 3ARFB 4I77H 3CFMA 5J1TC 2HWZH 1SY6A 3LRGA 5IJKA 1JUFB 1JZ5A 4NM4H 3O8XA 4N25A 3QWRD 1E4XI 3S34H 2N0KA 4KMTH 9PCYA 1WHOA 1CD0A 1KPVA 1EZVX 2BVPB 3LCYA 3L2NA 2P5PA 4H1LA 3KXFB 1MRCL 5EA0L 2CHZA 4XC3H 5BO1H 5DRWA 4OZIB 5GS0L 5A1AA 2AGJH 1LLAA 5CBAB 3KGTA 2X3AA 3LN9A 5HHMB 3RNKB 5IESL 2EYTA 3LS4H 2F7IA 4PY8I 1M3IA 4Z5RA 2ICCA 5ETUB 4FZ8H 1CXHA 1WBZA 3IFPB 3PIQB 3OG6B 5I0ZA 3ZN6A 1QD0A 1UWEL 4BA8A 3CBJB 3BZDA 1I9IL 4YE4H 4P9MH 2X44D 1GGIL 2FB4H 1J9CT 4E9TA 8PAZA 5G2NA 4L4TA 3F01A 3WXVH 5LCVA 1UWFA 4PTUB 4TUUA 1BQSA 5C09E 2BVYA 3EYFA 3VVVA 1J88A 1FYTD 1PJWA 3D51A 4IBQA 3FT9A 4J8RB 1S8DB 5IB2B 1BFTA 2F8IA 4NKMB 4QOKD 1XGQA 4ZUSA 2PWHA 1INDL 2GJ6B 3UJJL 2JI1A 2WGXA 2ZUYA 2BVUA 1Z9SA 5D1XB 2G5BA 4QRRD 2XN9E 1TFHA 3BW9A 2HPTA 3OLIA 4JHUA 4Z95L 4FA6A 5BV7H 3DROB 3MRCB 4LPXA 1FO0H 1QSEB 5ESVA 2VLJD 4PRHA 4AGMA 1SJMA 5HBBA 2WBWB 5LB1A 3TEWA 4JEGB 1JGUL 2XRAL 5AB9A 1QO3B 1JDDA 1Z9LA 2ADFL 2FQFA 2EDBA 3EDEA 4OUOA 4AY0A 1SN5A 4LB8A 4OFYA 4MMZA 4J8QA 4KQ3H 5HDBB 4ZX5A 2G2PA 3ENEA 4R5TA 3T6QC 3RTQB 2DQIL 1OB1A 4J3TA 4XPTL 1Z3GH 1P9MA 2Z7UA 3ZE1E 1GOFA 3QUXA 4KVNH 1YMMA 4RFOL 3O8XD 1W6LA 4GG8B 1H8SA 3AREC 1E2WA 2W88A 3HAEA 4JR9L 3VD5A 1IIKA 1EEZB 2IMNA 2EE9A 2JIXB 1JK9A 3PP4L 5DWUL 4AK2A 5I8KH 5F1KC 3KYKL 3TO4A 3SEPA 2K8MA 4P5KA 3KMDA 3WNLA 3MA9H 4CDHA 2NW3A 4E9WA 1HC1A 1UOWA 4JRLA 3DRQB 5IOPA 1ZLWH 4RH4A 5K1VA 1HZHH 1T80A 1IE4A 2I9LA 4H44C 5K93A 3RL1A 1FL6B 2ZSWB 2A6JB 3JV0A 3OL2A 4JAMA 4K7FB 4YQXH 4A2HA 1Q94A 4WVRA 1KCRL 4QAMB 2Q86B 5I30L 5KVEH 4NQTA 3GS4A 1T83C 3SDCC 5F9OL 4UTBH 3L7FA 4HS6A 4PVBA 1DJYA 2Y6TE 1R3HB 5DUMH 2PO6D 4PRNB 3UL4A 1U30A 3HUJE 4Z0BH 3QYCA 4TVPL 5FA4B 5I1JH 1S7SA 2VJXA 1N18A 3LN5A 4LHUD 2FSEB 2NOYA 4PJ9A 2AMGA 3LZFL 1MI5A 3K72B 3MGAA 4AUUA 3Q05A 4CGTA 3VH8G 1SDDA 3TH2T 5SWQB 4L2LA 4HZ1A 5BRZB 4ZJ9A 3ILDA 2GT9B 3FTSA 5DRWB 3L95A 3DXAE 1ZXQA 5JMRA 1UQSB 3VXTB 4KITB 4D9LH 4B97A 4NUQA 3BMVA 3DBXA 4ELMF 4IU2A 1SJEB 4KZDH 3SGJA 3BZFA 2FEJA 4YNYB 2CO6B 4QEGA 1WWWX 1SY6H 1QFWL 4U31A 2D31B 4W81A 1C1EL 3VU2A 1KLFA 1DBKL 1L0QA 3FFDA 3VM5A 4PRHD 2YXWA 2YWYA 4XPBL 1QKZH 4IMKC 4L8BB 3SY6A 1J8RA 3DUSB 3NQIA 4YDKL 2KHAA 4PLKD 4DCQA 4DKFL 4JKKA 4LFHG 3MNVB 1MAKA 3RB5A 1U8HB 4PGZA 3U4BL 3V6FB 4A7TA 4KI5C 2AJXL 3RWFA 5K59E 1SFHA 3L5XL 5B8CA 4KJWD 4G9FB 2ADJA 3K6NA 4IGBC 4BWTA 2IANB 5GIRA 1YNTF 3G6JB 3QUXC 3MUY1 4N0RA 1JNNL 3WI9A 2HG0A 1WCBA 3F6IA 3NRFA 4J6RL 3CFBB 1AC6A 4MMXC 1KBGL 3FCSA 3RVWD 4XP5L 3S37H 3GZQA 4KFMA 4BINA 1ZT1B 2EIEA 3IAGC 3BD5A 2NZ1A 1OW0C 2P28B 3IS0X 3V8OA 4DTGL 4XNXL 3QUZD 4LLYB 4AG4L 3LXBA 3OF6D 2XZCL 5IK3A 1BX2B 1U0QA 3ZL4H 3WDIA 2XT1B 4CILA 5EPMB 2IFFL 3QJOA 1GHFH 3IXAA 2NUTA 2EAEA 2ARJQ 1YUHA 3BO8A 4PJCE 5E6SB 4C57C 3GINA 4XO9A 4I8DA 4L0ZA 2IXQA 5IWLC 3CFQA 5DURB 5A7BA 1T5KA 5EF3A 2HXAA 3FSOA 4ZBJA 1B3IA 4OGAD 1SZNA 2QELA 5E8NA 2AC0A 2C7FA 4E9YA 3C2AH 3CN1A 3F64A 2X38A 3L81A 3L3DB 2CK0L 4I5BB 3OHXC 32C2B 3BGMA 5KOVC 1NEZA 1MHPH 1X5YA 2VDLH 2Z64C 3DV6A 2VDMH 1BBDL 1GR7A 1WQVT 4RZKA 5AAMC 1OOAA 3NEEA 2OMUB 4Y4HA 3NDYE 2JCCA 5GGTH 5HGAA 2PO6C 3GSRB 5B3JF 1AS6A 1QABA 2BY3A 5GGTL 5KWYC 5DTFA 4GMSL 4H5SA 2E7BA 3VXRD 4LSSH 4AQZA 7PAZA 4PRDA 5KVGE 3V4UH 5L6YH 2OR7A 4AQ1A 3N40P 4M61B 4KTEL 4B9KC 5T3XL 1PYWA 4TLKA 1KGWA 1KCBA 3FTGA 3OKOA 2NY0C 1S78C 5D6DA 4CKVX 2ZWLT 3PPSA 4A7GA 1N4XL 5I17A 4H1LG 3V4VL 3SE3A 5DD3H 4PREB 1BZEA 3ULVC 4XRCA 1HH6A 4TV3A 3FT3B 1N9PA 1YNTB 3HBQA 4BKLB 4PUBH 1TETL 4MRBA 4WHTA 4X4MA 4FQ2L 4MD5A 2IWFA 4S11A 2QMKA 4XCCL 4QRTB 1BQUA 3FFCA 3WO3B 1R0AL 2I5YH 4RFEB 1GHFL 4RRPM 3MV7E 2BIPA 2EXWD 5MP6L 1IBDA 1TJGH 2QGEA 2X10A 3DHJA 3NZ8B 2EC8A 3Q1SL 4JPVH 4QXUL 4A7QA 5ICYA 1NIBA 1IQWL 5AVUB 1NFKA 1TZOA 4JY6A 4X6CE 3ZTNH 1TUPA 3VUAA 1YAZA 3SBQA 2XPGB 4N0UB 4Y5VC 4L4VA 3FB7A 1KN4H 5JPMB 1HCZA 5ESAB 4K94H 5CO1A 4PJGF 4LSTH 5K1JA 1WC7A 4PGJA 1FZKB 5DHYA 3GMMA 2BINA 2YD0A 4Z3JA 1WCQA 3ZRSA 2E7LC 1W8EA 3IDGA 1IAOB 3OWRA 2R4RH 5CJ5A 3RGHA 4HS3A 4QRSB 1JI2A 2DM7A 1BQLH 5FUOH 2ENYA 3H7BA 3V4VA 3WGVB 5IQLA 1ID2A 4KRMB 5E08H 4OLUH 2LOEA 2EUWA 4PRIE 1P7QD 2W81C 1HWWA 4IRZA 2YQGA 1MY5A 1TQBB 2CRYA 4J39A 1XFPA 3I50L 2YAEA 5K39A 3I6KA 2OI9B 3E6FA 2VAAB 4NN7C 1KCUL 2PN5A 5EIIB 2G4GA 4ZFGL 4PJ8D 2MOGA 3WIFB 1FFNB 1EFXD 2EUXA 1XGTA 5F7EL 3ROOB 4NO0D 5ICYB 3HG2A 4HW6A 5FPIA 1BZ9B 3V5DA 5K9QG 1D5IL 3MUZ1 2VKXA 2FBJL 1PFCA 3KJ6H 2E8ZA 5EF0A 4C56A 2VZUA 3UAJA 4I7ZC 4F58H 2VZVA 1UGNA 3GRWL 3NJKA 4DGYH 1COBA 4OZFH 5I73C 1T1XB 3SQBA 5I66A 4X6CA 5HGGS 4OZFB 5FK9A 2HT4D 4YDJA 1DSWA 3CU1A 1GOHA 3LNDA 1M9WA 4M48H 3GHEH 2HX9A 2LW3A 1SPDA 4HC1H 3WUWB 4W6YB 1UM6L 3CDZA 4ZFZB 3U0PA 1YN6A 4QLWA 4M5ZH 3KCPB 5LNDA 2FO4B 1CF8L 1XZ0B 4Q0XL 1MPAL 1ZE3H 3C5SB 3U36B 3VQ2C 3FSVA 3GDBA 4ZS7L 4CC1A 1MRDL 3V0IA 3LZQA 2RTTA 3EJZC 3OJMB 2ZP9A 3JT0A 4NC1E 2VXVH 3QJQB 4X9YA 2AS5M 1E40A 1X9LA 3VD0A 1HHHB 2FQEA 4FXKB 1Q9OA 4D9RD 5I16B 4OV5A 1YNKL 4Z77A 1QNZH 4TL4A 4HPYH 4APQD 5I15L 4Y89A 1PZSA 3ML8A 4HCRL 1IEAA 3TM6A 5JHLL 5AVQB 4QGTA 4FG0A 4ZDHA 3PUUA 1NFIB 2VUOA 4L4VD 4PWGA 1E4WH 2QZ5A 5C3LD 4WV1B 5FGRA 3IE4A 1IQDB 1MF2L 4NQEA 1MFBL 3FONA 3GMRA 5F7NC 2CKBB 3T09A 1NCGA 5D4JA 4LEEA 1U91A 3APNA 1C5CL 4U4IA 2C9SA 4W93A 1X5IA 3VFOB 1W8NA 1AQHA 4N2NA 3OKEB 5DK2B 2Q8AH 2BSED 4WHYG 4ZQKA 2HLEB 4AVKA 2XBZA 1O9WA 3OJDB 1NANH 1DFBL 2W59A 5IEKA 3BO8B 3E2HB 4ISVA 4NENB 1P7QA 4GO6B 2NNRA 3GSVB 3IVKA 1D3CA 3ATFA 4NPYB 3M1CA 3TV3H 3ZLQC 3C2AL 4Y5VB 1RMFL 3L4CA 1LDPL 3QI9C 4R7DB 2FWLB 1U8QB 2AJSL 3QCUH 1YY8B 2ORBL 1EFXA 4KRPC 4BFNA 3UAFA 3IBEA 4H4NA 4IRSA 1F4HA 3UGXA 1A47A 2GTWA 4Y19A 5IHUH 1FGNH 4TS6A 2A9CA 3WS6C 2YSSB 5KVGH 3D3VD 3UIZA 4L8CA 4TSBL 4NKDA 3WENA 3BSGA 3FB8B 3GTNA 1AZUA 2ZUQB 4CADB 4XWOC 2X0UA 2HH0L 1SHMA 1I4FB 4JZJB 1UXSA 2YAOA 3WAKA 4L8DB 2OYLA 3LNHA 4XNUH 4MJIA 3MV11 1CLCA 4ORZC 3C60B 4PGEA 3A47A 1C16B 2WSDA 4XP5H 4YSPA 3S37L 3V55A 3OAUL 4PU2A 4MJ5A 2MNJB 3QIUA 4Y5VA 4JG5A 3PWLB 2H6PA 2WNGA 1CI3M 1ZJAA 1TTAA 1BIHA 4G9FE 2C1PB 4IBVA 2B0SH 4ABUA 4LCYB 4CAGA 5LCVH 4D8PB 4MHHI 1XH1A 1F90H 3QDGB 5C0BD 5BPPA 5HYJD 4PJAA 4ZX3A 1E4XL 2GSGA 2XWJB 3LH2L 5IFJA 3V0GA 5T1LA 2AHIA 4P04A 1KENH 2IAAC 3GSOA 2WSKA 3DUUA 5AQ0A 2KLSA 2G3NA 3JV4B 2A6IB 4JN1H 4J4PA 2BK8A 3CHOA 1JXJA 3ZRFC 1P4LA 4ZMZA 1NJ9B 3MBEC 5EA0H 1UM4L 3O4LE 4B7IA 2CLVB 2WPGA 4GEJA 4PS4L 4PLJC 5IMLB 4JO1H 1N5AA 4FJYA 4KUCD 1IEAB 5ERWB 4WTZA 2BRRL 4PJAB 2BOBB 3CMOL 2KS0A 4PQXA 4YHLH 3B1TA 1VACA 4AV0A 1OTUD 3M88A 1PLGL 4XAKD 4F8OA 4FXKA 3H1ZA 4HKXA 1YEEL 4PJ5A 2VZ1A 4UMGA 1ETZA 1BECA 2C7UA 3FQWA 4FFZA 5AVWB 2UZYB 1RIHH 3PV6B 5EU3A 4Y4HC 4N2HA 2VM3A 3P77A 4RMUA 1WZLA 3IWVA 2CBTA 4LOEA 4UM9A 3TH4T 1JYXA 3OKMA 2WD0A 3PNRB 2H3KA 3GGWA 1MIEL 3R18A 5LWYL 3OR6B 1AO7D 3GXMA 5EU4A 2XQBL 5SWSB 1V7NL 2WKOF 2YPLD 3BP6A 3VX0A 1KACB 2H3XC 3MHZA 4NWTH 5T1KB 3RB7A 3D3VA 5EN3A 5LXGH 3U6RA 2YJQA 5C7ZA 4OZ4A 3ZTJH 1EA9C 3DYMA 1YMMB 5DEFA 4UYQA 4ANWA 4L3AA 3AABA 3NCXA 4HCFA 2BNRA 5IQNA 3OAUH 5F1NB 1FRGH 4RA0C 4EI5D 5GRUL 4EUPG 4XXWA 4MJID 4NJ9L 1KLUB 1CL7L 3MJ9L 3SYCA 1Y0LA 1ETA1 5GSVB 2YWZA 1XBDA 3SKOB 3SODB 3WIIH 4CU8A 5E6UB 4TSCL 3X11A 2DIAA 4OD2B 4LE8A 3I6KB 3A23A 1CIUA 1MW2A 1K8DA 4QDGA 4XB8A 3RGVA 1OF0A 3U9PH 3VXMD 3KYNA 2XWDA 4PJBA 3K4ZA 4LSUL 4Y16C 3SE4A 3FL7A 2ZICA 3SN6N 3VXSA 4KTDL 4U1HA 3TXAA 1I1AB 3FQ4A 3W82A 1SYSB 2HJKA 3KDPB 4HUWA 5T1LD 2JCCF 5D1XA 2BY0A 4MX7A 2DKMA 4ONHB 2NY6B 1KV7A 3W37A 4CVUA 2Y36H 1RMFH 5J0BA 3QRLA 4WZ9A 3ARYA 5F7FA 3LZRA 1XGYH 4NZRH 4QF1A 3WL9B 3LHAA 1QTYT 2JE8A 3JWNG 2LVCA 4PY8J 3F7YA 1WP6A 2PCXA 2ZWZA 3B2VH 5GGTA 3WEXB 4A7GF 4QHUA 1NCTA 2FHBA 3BPLC 4FXGA 2I26N 3NZ8A 4R96A 3LRSB 5I82A 3RVTD 3VFRA 4JFTA 4G8GB 1HZLA 1DVFD 3TN0C 1U92B 2BNQE 3ULVL 2R2CA 2B1AL 4OCRH 4F7CB 1QSVA 4DEUA 1H3WM 1Y18A 2VRKA 3SKJL 3HE6B 1A65A 5D71L 3JV4A 3OKDB 3E1ZA 3HB3D 3ZRCC 1HH6B 3BAEL 4EO5A 4PWIA 3F2LA 4ZTEA 5FFLA 3VYNA 3FRPG 3I74A 3TS8A 1AO7A 2R69L 2FBOJ 2X1QA 2ETWA 3ERXA 2Q8BH 4YDLB 2DLHA 3MRRA 1SXSA 5TTRA 9CGTA 4TULL 3MV8B 3SGJC 4HPOH 5KS9B 3MX0B 4XBGA 3A3YB 5DTFB 5FV1L 1CVSC 5HTSA 3CBRA 4WKZB 2CJUH 1WIPA 2M2DA 2QSTA 3OVUB 1J18A 3LNFA 4LNRA 4Q2ZA 2BNRD 2IG2L 5C0CD 1MCNA 1MRCH 3NEOA 2X6AA 5DVPA 4ZX6A 5D2LA 5I73B 5E56A 1T2JA 2R2HB 4ZUVA 2G5RA 1DE4B 1FVEB 1UJ3B 2DM2A 4UILH 3GJFA 1BHGA 4GRLC 1KLGA 4JQXC 3VGFA 3AWEA 2BIMA 3QUZC 3RGVD 2ZSVB 1GY2A 5EO9B 3AW5A 3K2MC 2W94A 1K4CA 1GGUA 4JO3H 1CFSA 4LOUC 3L08A 4AXWB 3OLEA 4BYHA 1OSZB 2WMPA 4HBCH 4PFEA 3CIQA 2GCYA 2F1BA 1KCUH 1KGUA 3EYVB 3T1WA 4MQ7B 1E43A 3T0XA 1C7SA 43CAB 4XE0A 2GSIA 3VNYA 5IHHA 3QHZL 4EI6A 1VB9A 2VDPL 4U1SB 1U58A 4Y4FD 5IROC 5E7FA 1Z5YD 3FFCB 1FNFA 5D1QB 2BS71 2KI6A 2UXTA 3J8F7 4PLKC 3OZLA 5CJXA 4DP8X 2VL5B 4FABH 2ZCHH 1PW3A 1BVNT 3A22A 3L9RB 5I26A 1CLYL 2LQRA 4KKBD 3PFQA 5I19L 4HK0B 4WNQA 5EWIL 3GJFK 1JHKH 1ANUA 4X4ME 3UC0L 2E7CA 5AZ2H 3RNQB 3ZKQD 4HMCA 1MG2C 1ZLUH 5E4IA 3T8XA 3CVIH 3S8FB 2OCFD 3Q2LA 4HIEB 3V0AC 2W9EL 5I1IH 2ICWB 2R9HD 3L16A 4JY5L 3OBAA 2F74A 3OKOB 4F8NA 3B9KA 2YUZA 4QPEA 1MVUA 1TG8A 1WHPA 2NW2A 1TCRB 2X12A 3ARBC 4ZW6A 3WTWA 1I1FA 4L37A 1KIRB 1FG9C 5EOCL 2ZXGA 2VDKH 4DGWC 3NDZE 3L54A 4HJJH 1MFVA 3QO1A 1WFTA 2LU4A 4TLTA 4JE4B 4C55A 2DD8L 4ESKA 4TLUA 2IH1A 2XV0A 3U0PB 1B88A 1QA9A 1IBYA 4KO6A 4BZ2H 3LS5H 5E9DE 3UXFA 2WB7A 5CD3B 1OO2A 2X7LB 2Y7SA 1VGEL 3MTXA 2JJWA 2DQJL 4H2AA 3L9RA 5CCKL 4OZGF 1RK0A 2GTWB 5SV4A 2ICWA 4OB5H 3HKFA 4XAWH 3AAZB 1TEFA 3ME0B 2RCSH 4MYWB 4DVRL 3V4UL 1S3KL 4BDVA 2CR6A 1JFQH 3NSDA 5IB4A 1IM3D 1W0WB 1Z3RA 4MA8H 2CJ3A 4JFPB 5IIEA 2IADA 3ARGC 5AKSA 4OGXL 1T4WA 3QC5X 2EXSA 3BCFA 3O2VL 3BKML 2DQTH 4P4KD 3B5TA 4L3FA 5DJXA 1HEZB 4OFQA 5FECB 1MHCB 3RVXD 5FWRA 4BK5A 3QJZA 3JT2A 2VXQH 3GM0A 4PS7A 1RURH 1E2ZA 3RPBA 5HDBF 4K3DH 4P99A 3EAKA 4F7MB 3GXFA 2YBRB 4U6VL 2GIYA 4WFHE 2YPVH 1JYVA 4B9CA 4XXCA 1YEDB 1I7TA 5F0PB 3SDXE 4JS7A 1XF5B 4JQXA 3V0DA 4X5XA 5EO9A 4G9FA 1INQB 4XVJL 4F24A 1DO6A 3Q8CA 1GC1C 2IO5A 4N87A 4I2XB 3LZNA 3NK3A 4AQOA 4RMBA 5AOJA 4AJ0A 1KLGB 1AYOA 4F5CA 3HFML 3DOHA 5DUBA 1G1CA 4LFHD 4M5YL 1CYWA 3VGAC 2WO3B 3ZL1A 5CEZL 1PLCA 4L8BA 1E50A 3LQZB 4JMNA 2YEZA 2ZX8A 1H15B 1OZUA 4N1EA 2VJ8A 3WNJA 1NC2A 3GYRA 3UC0H 3BT2H 2QVTA 1KBGH 2HTKD 4UDTA 5TF1H 3EW3B 4FQ1H 3NJVA 3BDXA 2EDJA 4IIQC 3GPEA 3KYMA 4M1GL 4NQEE 5CN1A 4JFFD 2P48B 1DANU 1M3JA 2XBDA 3KD4A 4B9IA 1YEGL 4XRCB 4KKNA 4AT6A 2ZAGA 1CBVH 4HIJB 1BEYH 3BFOA 4DUVA 5HPMA 1JFQL 4KH2A 4M8VA 1MJJA 3KW8A 3ISRA 1WFOA 1MFUA 1TSRA 5KJ7E 2W65A 1IL1B 5HVFB 3KWVA 1FZJA 4DVRH 3CBKB 5IBLD 2P5WE 2ADIA 4R97C 1XMWA 4NKMA 5IREA 4Y9GA 4WDIB 1Y18B 1YEGH 3HLKA 1E4KA 4K5NA 5DRZB 3KLQA 2COVD 4HS8H 2JCWA 4OZIF 3VYPA 3OMAB 5GGVY 5IB5A 4X4ZA 2C5DC 3U4KA 2RIKA 3DX0A 5JR1H 3WAJA 2QVMA 1H15A 1IEBA 3SCMB 4LHUB 4DP5X 1WDAA 5J89A 2YLHA 5L88L 5DUBB 4TNWK 4P4KA 1Q9WB 2CM5A 3T0ED 5KSVA 5IHZA 4PR5A 5JHAA 1QG3A 3QZMA 2HJKB 1SYSA 1OAZL 3VTAA 4QJ3B 4LCVA 3WBDA 1BSIA 2DI9A 2NNCA 3CSBA 2GHZA 2OMWA 3MJ9A 3MLWH 1H3GA 5CLTA 5DRXB 5DHYB 2C9QA 4U3CA 3B34A 5EU5B 1WA0X 5FDWA 3U79A 3ATEA 4X7DC 4J27A 1BBJA 2HJFB 1YN7A 3ZZSA 3ULUH 4J3VA 1U8PB 4L8SC 1XMEB 4OCMC 2PYFB 3AQYA 2PWDA 3PWPA 5E4EB 1DQDL 1OT1A 3E2HC 4I2XE 2DQGH 3MJ7A 5IKCB 4AIXA 3RWEA 3U48A 4M00A 4PJBF 1OGTB 2YOAA 2VC2L 2Q9OA 3KLHD 1S7TA 5IK3B 5LAXA 3US1A 4P3CL 4PLOB 4RCAA 1JZJA 5HJDA 4P46C 3MRGA 1FA4A 4QRTA 3L45A 3SKOA 2WXNA 3E8UH 3VFGH 4N26A 4B3EA 4GMSH 4NRZB 5A2KH 3D34A 3QIWC 2P26A 3OR6A 1NMCC 1T0PB 3AAZA 3ME0A 3S2AA 4L5FH 5BS0E 5E5MA 3UTTD 1ZANH 3IU4H 4I48A 4OB5L 1D5MA 4XXCC 4XX5A 1S8DA 1Z1WA 1LEKA 1EUUA 1WTGT 5SWSA 2E27H 1THAA 1T0OA 1IEHA 4GLRH 3EF4A 2HMIC 1LP9B 4WLCA 3TYGL 1FC2D 3HG0A 4NI6A 5IF0A 3I3DA 3V5HA 3QIUC 3AXHA 1MJ7H 1HAWA 3N1QC 1OARH 1DQJA 3M8OL 4LDOB 1EUTA 1XGRB 4OLYH 4MDIA 4UOW1 4HJJL 1I1YB 1U8KB 2HN7B 1PG7L 4JO8A 5HDBE 1FO0L 5JOFB 1ACYH 4R90H 5G5DA 2CLVA 5I1DB 2CO6A 4IKJA 4M4RB 1V27A 5EOCH 5M94B 3O6LH 4LSUH 5CWSB 1ZDSA 4LPVA 2HT3D 4LZKA 3RWGB 3EYUL 1EAQA 3Q7JA 4G1MA 3RFZA 2DIJA 5DD6A 1UUNA 2Z1PA 3MOQA 3W5NA 1QQDB 5FCUL 5HVHC 4LXFA 3KJ4C 4BXVA 2BSSA 1XF2A 2BZDA 2NNFA 3BUBA 1KTKE 3FMGH 3AGVA 3X1GA 4JY4B 2J8HA 5CP3A 4WUUD 3ILPA 5ID0A 3KPQB 3PDOB 3K6FA 2GAZA 1A6PA 2I69A 1LYQA 3P4MB 4CVWA 4Q58C 1EDQA 1Z9OA 4GY4A 3UBFA 2YN5A 3KPTA 1LMIA 2JK5A 4XNMB 3VE0B 4BK5C 3HAEG 3QS2A 4GG6B 3ZW3A 3L2LA 3N0AA 4U1SA 5TE4L 3JBG7 4RQQA 4DUXA 4BXSV 2WZ5A 3L5XH 4NWUH 1AIZA 3EYVA 5BW7C 3PHSA 1PZAA 2VW4A 4G6JH 6PAZA 1FC1A 4LEXL 1RZIB 2WMPB 4NO3B 1TVBA 3O9WD 4PWJA 2FWSA 2IAMC 3D30A 1VZIA 2QJDA 3V9CA 1L9MA 4BWWA 3G5YB 3CLFH 3WKPA 1Z7JA 2WHVA 1S4IA 3FB8A 5DVLA 5IVOA 1DBKH 5SWZE 4BUGA 1G9NH 5G4OA 2P43B 2M26A 5ANHA 4XX1G 5JYMA 3CLEL 5J6SA 5KYYA 1QP1A 5E8DL 3ARWA 2ZX5A 5FYKH 4PYHA 1ED3B 3GIZH 4NBZB 4JB9L 5AVYB 5F44A 5HSFA 1BCIA 3NCFB 2JXMB 2Z0BA 2VDRH 5GGUB 1ZT4A 4WFFD 1PS3A 2AABH 1IVTA 1N64L 4X6DF 3QNXB 3V0WH 1UA6H 2EYRA 2NX5A 3QIBA 2N3JA 2OM5A 4G3YL 3T9WA 1UOVA 2B14A 4EZMA 5KS9A 2N7AA 4AL8H 3OKEA 5DK2A 5KVDL 2EH7L 1H3PH 3QJTB 2H45A 2WCGA 4NQDD 1NEUA 5FW8A 1RFDH 2CGRL 3KPRA 2K7PA 3BVXA 2B3IA 3D8MA 1CL7H 3MJ9H 1QBMH 1ZS8B 5HHNB 1BVKB 4NQEB 3A67H 5D70L 2BNQD 4XR8C 4RGOL 1MCBA 3BAJA 4ZQKB 4N5ED 4IJ3C 4UWQB 1HQRB 3RWCA 1KJMA 4JM0A 1DANT 5D93B 5D7LD 1CFNB 3BWAA 3PP3K 3CVBA 1MXGA 2D03H 2N7BA 3CVHB 3JYCA 4IKIA 4M8QA 3VFVB 1TYRA 4QTIH 5FWQA 2OMXB 4MAYA 1IGJB 3FN9A 2WVVB 3V5KB 3OXRB 5D70H 3VCLB 1DSYA 5KSVB 4LCUB 4AV4A 2TRYA 2X4QB 3HJ0A 2X9ZA 3ULVH 1YEHH 1Q8MA 5FFGA 3MLSH 5F9WB 1OK8A 5LQBH 2J8UA 4JZOB 1OVZA 3LIZL 4LARL 4KVNL 2Z65C 4RFOH 4JAMB 1KIPA 1OPOA 3K0WA 3AADB 4OV5B 5KJ4A 1X5MA 5I9QC 3V6OC 4HUUA 1AD0A 3WIAA 4O2EB 3EKCA 3DRQA 4HP5A 4OR1A 3B2VL 1UXMA 3GO1H 2P5WA 5J9PA 1RUAH 5FW7A 4TYUA 1OM3L 2O61A 1HAUA 4JM2B 2ZOOA 4NQCA 3IJ8A 2BSRB 3CQFA 1RI8A 1U3HB 5FO7A 1MCLA 5EOTB 3MOAL 1B9KA 1QASA 3C60C 3TP4A 4PS4H 3JZ7A 3L5HA 3QQ9D 5DT1L 1VCBC 2DIEA 2Y7NA 2ZOLB 3MJ6A 4CN1A 4GW5A 1H3XA 3ZTEA 4C4UA 3VSVA 4DNLA 3KYMB 4Z7NE 5C0GB 3HE7D 1FVCB 4K23H 4S1SH 5DC2A 3QWQB 4DVBB 2XTJC 3IFOB 1JWUB 2EE3A 3UACA 2VJ0A 3ZYIA 1NCCL 5KSUA 3TV3L 3CUPB 1YEKH 4M02A 4QHMA 3GLDA 1TIUA 4NWUL 5CHNA 5J11B 1IM9D 2YQ2A 3MJ7B 1NWPA 3KPSD 5IMKA 3FT0A 3MODH 1I7RB 2W0LA 2L7JA 5FUZL 3O4LD 3M6DA 4G7VL 2OSWA 2EVGA 4FKKA 4J3SA 4RFNB 4Y1AD 1JRHI 5I18H 3T65A 4HD9A 4E9VA 3S97C 3H9YA 5CCJA 4Q6IC 1BREA 1C5DB 5CZVL 1NUNB 1LK2A 3TVMA 5CGMA 1XF5A 1IAIM 2NDGA 1XCQB 4XPHL 3UYPB 1AXIB 3IDYB 3AQZA 3FO1A 1UZ8A 3WXWL 4F37K 2QADB 1REIA 4P4KB 5G55A 1Z0NA 5LWYH 4Z7VA 5A6IA 4U1NA 5EZLB 2WKLA 1G7MB 1MCJA 4QWWC 1ZLEA 2DIBA 2HTKC 2Q6WB 2WLMA 4PJDA 4PMEA 4JY6B 1DVSA 2ZUTA 3UDWC 5BCAA 1KT2B 4H26A 2DTMH 2B3RA 4MAYD 1NC4B 3I6LD 5EO0B 1AXTH 4Z7UF 5HGHB 5EEZA 4JGNA 3FT1A 5H4YA 5H2BB 2DYPB 2VDNH 1U8MA 3BDYL 2V3DA 1K8IA 3DA0A 1RUMH 4KFZC 4RDBA 3TBYB 1P6FA 4GBXA 1XB3A 2YGNA 2FK9A 2BRQA 3AQDA 3EJZD 3NJHA 4FMKA 4KTGA 4JFXA 4AE0A 4BKLA 1TCMA 2J57A 2UXVA 3BUQA 2AQRA 3GMQB 1BFOB 1PQZA 4L1SA 1OCCB 3CZEA 2EXTA 3MLUL 2AXJA 4AYID 3K6IA 1DUYA 1CWVA 4JFEB 1LEGB 2KQNA 1R46A 5JLZB 4GSXA 3DUUB 5BVJA 5LQBL 2WNXA 3G6AA 3UERA 1UM5L 4YUEL 5E99H 4M1CC 5BVPL 1YYML 2B20A 5FS5A 5AB0A 2MEJB 2QPEB 3ESPA 2E9BA 3MXVH 3N44F 4WI9A 3QO1B 4DN4H 4FE9A 2A0LC 3LMJH 3FOLA 1JTOA 4DZBB 4I9XA 1TJIL 1I1FB 4HIHB 2E6QA 4LLUB 4V2CB 3CZSA 1OGSA 3GS7A 5KSBB 3P9WB 5C09D 2JCCB 5ITFA 2MKWA 2JSFA 1GSMA 1NFDF 3NJFA 4ZW8A 3ZDYB 3MUJA 3RUGF 1X5HA 4BCZA 4PSRA 4LSTL 4U05A 2IBGA 2FJHB 3HUJF 1K6QL 2F7QA 1P7BA 2F5BL 1MWAL 1RZ7L 2LGNA 3FB5B 1H3PL 5I1EL 3LSOA 4WI8A 2XX0A 4HHWA 1K2DA 3L3DA 1G5GA 2NY5H 3M1BA 3IAPA 3FW6A 5DVOA 4HH9A 3IPEA 2XZAL 4JDEA 25C8L 3DYPA 3QULB 3LH8A 5CUSL 1D7FA 3BP4A 3CHQA 1JXGA 1YY8A 2WWOA 3G3LA 2G3MA 5DJXB 3X2QB 5AALA 1WO2A 4ODXA 5C1MB 1M9SA 5IBTH 1ONQB 5JHLA 1M7XA 1TU2B 4G59C 1NMBH 2FH8A 4Z6AT 1SJHB 4ISVB 3H7LA 5B38A 2Y7QB 4UCFA 1A1OB 2X4NB 2YPKA 2J1XA 1LP9F 4JO2H 5B39B 2ALWA 2ERJB 1WCBB 4I85A 1RZFH 3PGDB 1CFVH 4MVBC 3WJMB 1U91B 4NBYB 1G7PB 2X4PB 4YL4A 1RHFA 1UWXK 1W72H 2MHAB 1DZ0A 4XN1A 3QXTA 3D1MC 3VG9C 3VI3F 2G9HA 1FL3B 3PQYB 1FPTL 4IM8A 4L9DA 1RUPH 3U6XA 2DWEB 2OZ4A 1CIDA 1ACZA 2DM4A 4ABVA 1FYTA 2DI8A 2AMUA 3WY4A 2EZ0C 4A66A 4GOSA 2ADYA 1MVYA 2FT6A 3MV8D 5AOMA 2AVGA 2YBGA 4QOKA 5IROD 1XTLA 3ZX1A 3BHBB 4L0YA 2RQEA 3BKJL 1KY7A 1KPRB 1MVFA 3T77A 2YQ3A 2CBPA 4FHJA 1KB5H 5KN5B 1G9NC 1R19A 1XIWB 1TZHB 5IVXE 3PWJA 4G8IB 1TCRA 1AACA 1JGEA 2H2SC 3D06A 4F9PC 1A64A 4IU2B 1CG9B 3HB3B 4PRID 1AOZA 5DMGD 2OS7A 4GQQA 4FA7B 4RBPK 5DFAA 4OM1L 4KKLC 5C0EA 3N42B 1HXKA 4I3SL 4MWFB 1XAKA 4HK3N 1A6TA 4JMXA 5C09A 1KBKA 1KUMA 1QWHA 4JGMA 3U2SA 3D7PA 4OFYD 1JZDC 1T1YB 5IP4A 2ENSA 2K4WA 4IS6B 3CPLB 2YUVA 3L17A 4K73A 5JHMA 4FOMA 1A7QL 4DGYL 2QPDB 4M3JA 5LBSA 4ES8A 1TVBB 1U8OB 1V3KA 3V4VH 3GI9H 1KCVH 1OCRB 5CLZA 4J6RH 3N41B 3IETA 3IFLH 5IR1B 3C6LA 2AEIT 3ZTDC 1T22A 2H2SD 1ZDQA 4LCWA 2YR3A 4UQ2A 1FNGA 3VACA 1IUZA 5FYKE 1GAFL 3HI1B 4YHMH 3MLRL 2VMCA 4J1UB 2XA3A 2AQQA 4GNKB 1E67A 3KYOB 4FXTA 1Q94B 4PCKA 1MFAL 5INCA 3EH2A 4IDJH 1NBQA 3TO4B 3F05A 3L5IA 3ZE1F 2ZSVA 1ZPLA 4YDKH 5GS1B 3S96A 4X6DA 5DMJB 3UBXA 1YJDL 1YC8A 3NIGB 5E4OA 4G70B 3EH3B 4ENZA 1UT9A 2VWEC 4U1HB 5HDWA 1X5XA 3VXSB 4PJ9D 5IJBC 1NPUA 1QZNA 4OLWL 3X3GL 3SDYL 2E9JA 2NNXA 2Z8VC 4K55A 4WFED 3CU7A 4FXKC 3HRZA 1C5BL 4ORGA 3SB3A 3NGBC 2WXPA 3ARVA 5DS8A 3LS5L 1IT9L 1O6SB 4G71B 3FTXA 5JPMA 4HIPA 4MVBD 4KPHL 2EIDA 3QYNA 1AQ8A 3BXNA 1AH1A 3S37X 1MIMH 3TIEB 5DQ9B 4ODWA 4BUHA 5GGRB 1TZGL 5IM7B 2IH3A 2WWNA 4XCEA 3NQKA 3AXLA 1NCDH 3MRCA 1Q1JL 1Q1JH 5IF0B 5LGYA 3MBWB 4XX1E 4RGND 4PY7B 1RD6A 4DO4A 3ZKMC 2BCKB 5JORA 1F6FB 1A7OL 4KJQC 4TTDC 3HHSB 3LIZA 1JNLH 3IMUA 2LLLA 2RMNA 3DTUB 3MNWA 1U8CA 4P23B 4FFVD 1GS6X 1FGVH 3W11D 1JHKL 2VDKB 2Y72A 4AJWA 3DGCR 1AR1B 3DGGA 2Q2EB 5DHXB 1L9OA 3I6GA 3EBGA 3SPJA 1WS7A 2BSDA 2NY3C 1U4FA 2WIMA 1N4XH 2VMFA 2J8UE 1WA1X 3O3DA 2OCJA 4HUCA 5EU3B 1UADC 2WLHA 3L2MA 3CZJA 4A39A 3MBEA 2AFNA 2D73A 5CCHE 4O02L 5CS7A 2NYKA 2XQYK 2OL3H 3SE8H 1AQKH 4IDJL 1I3VA 3LPGA 5JW4R 3O9WB 4HJ0C 1ZVNA 2CBOA 4J3XA 3E9TA 12E8L 4LAQH 1CLOH 5F9AC 1ZAGA 4TUKH 4OJAA 4ZSOE 3OKNA 1E30A 4G43B 1CGSL 1UACL 3SPGA 5IKCA 3EIFA 2JCCE 4ZYKA 2AITA 1S9XB 3UBHA 3EYQC 1Q72L 5AAPA 4ONHA 1U8PA 2GY7B 4GAGL 1FAIL 3OF6A 4PW3A 4HC1A 2EDTA 1SY6L 2W92A 3WLWC 2JNZA 4D9RE 1IGIH 3LKQB 3RX9A 4BQ8A 1R5IB 5FR3A 4L1TA 3H53A 5DYFA 1QLFB 3UPAA 5E2VH 1J0YA 1QR4A 3IRZA 3F5WB 3DX7B 4W70A 3WLBB 2BY2A 1J8HE 1RJZB 1NZRA 4BHUI 1JFHA 1BD2E 3QDGA 2VDNL 3IDIB 2VLKD 2BW5A 5DD0H 1K72A 3SSGA 2VDOB 3R0NA 1E4HA 2Z1KA 3DHPA 4XVUD 2H3NA 1NCBH 4D7BA 4KKCD 1F56A 3GRBA 4Z0BL 3UO1H 4HWEH 3ISYA 5ILTH 2BIQA 2JKWA 4ALAL 4UTBL 3B7SA 4LIQH 4F7PB 2OULB 5AYUH 5I8OL 3M07A 3VSTA 1NGPH 1P6AB 5DVKA 1JNJA 4P59L 2IDSA 3FK3A 4MFHA 5GZOC 5I18L 1DEDA 5D71H 3RTQD 1QX1A 4Y2LA 3ZR6A 3OMNB 2ZCZA 5CIPB 1AI1H 2NCEA 3FN3A 3O45A 1QEWA 2C3XA 3RJOA 2B1AH 1IBBA 4OCRL 2OTWA 1NMAL 4ZFOB 1KB5B 3S35X 2AJZB 2XZQH 1GCYA 1G5AA 3LEXA 5L2KE 1RZJC 3N2JA 3AGWA 3QZWG 4KDTA 3U4BH 4AITA 3JSSA 5ABZA 1EWHA 4NPYA 4M9OA 4R4NC 4X5WB 1D6EB 1S7UA 3LKSA 3QZWA 5TGBB 1QKZL 4PBWD 3ZMRA 4ODWB 4OCXH 2A1WL 3O3UN 4JW3A 4GH7B 4W6XB 3GNMH 2WUBH 4QXTB 3QG7H 4OH2A 4U6XA 4YC2B 3RVTC 1QSZA 2IBBA 5F72S 1D5RA 1M1SA 1YPZE 1NKOA 1AC0A 1A02N 3FHQA 1KF9B 2ZOKA 1JGUH 1T66D 3B2XA 3VM7A 4UTBA 1INEH 4ATTA 2XWCA 2DZEA 1I7ZB 4AX3A 1IQDA 3L95B 5DK0B 4N2LA 4CU7A 1EO8L 4IK6A 1LO3H 4I77L 4A7VA 3P73B 1FFTB 2PWEA 2YPLE 1JXKA 4PJXA 2VZSA 4WGVB 5ALCH 2GSGB 3CVHH 4YHOL 3MV7D 4UOW0 3S7GA 2QFPA 3ET9F 2KYIA 4G6AC 4N4YB 2WQ8A 2OMVB 1HWGB 2QMJA 1NCHA 3KDMA 2Y06H 3PWLA 3T4AA 1F1DA 1RQ5A 2XV3A 3P9LA 2HX8A 4Z23A 2PCPA 5GRUH 1OGAD 2QPUA 2FUQA 1HKLH 4O58H 1IGTB 4JFPA 4WWKB 1TU2A 2R69H 5JOPD 1HS6A 1NUFA 2NY6C 1KNOB 2NY1D 4GAJH 2DDQL 4TSAH 3RILA 3EYSH 4LCCA 4JRXB 2J1WA 3SBPA 5JQ6L 2A9AA 3TH3T 4PJ8A 2X89A 3VWKB 3KXFD 3QG6A 2DV6A 4WTQA 4DN4L 5IJVB 1LTXA 3U4EA 4P5KB 4YDJB 5TDPA 3FTUA 3MV9E 3QHZH 4N28A 4PGBA 4X6CB 4Y19B 4FZ8L 5JHBA 4B41A 5CMAB 3X13B 1EFXB 4MXWL 4LRNH 3TA4D 4X8GA 4JZJC 4MWFA 3NG5A 3RZCD 1SUJA 1XD1A 2BZCA 4MJ6A 1BF8A 1UA6L 2B5IB 4RBPH 5D5MA 2DQIH 1CC3A 2AXFA 1OQOA 4TQ8A 2IWGA 1BXAA 4X6FA 4BFJA 5ITFB 3IPFA 3L3HB 1F4YL 1PAZA 4X0KA 2HTLD 4YHZH 5C08B 3WO4B 4BSWB 1XGYL 1F4XH 2ED9A 4DZBA 3OAYK 1EVTC 2OMVA 2XWRA 2MPAH 2HWZL 5ESVB 1S9WB 2Y07H 1KN2L 1KXVA 5SWZD 3SDDA 3RHWF 3ARBA 3ABZA 5AVVB 1LO5A 4H0LC 2IALB 1YECH 1AVAA 2G2RA 3LVEA 2MTAA 2BHZA 2HPOA 4HS3B 4AQ1C 3CLFL 4YBQC 5KUKA 4JN1L 1G7HA 3OG4B 4NZFA 1KCSH 3NZUA 2AJUH 3G5WA 3BVTA 1KENL 1FFOB 4YN3A 1BVZA 1SOQA 3JWOH 3HC0A 2R0ZH 1EEQA 4FERA 4FXGC 4G80B 4ZAKC 5ICZB 4HJGB 3Q8AA 3IN0A 4OD3H 1BVNP 5A16B 3VWJB 4AJYV 5CZVH 3MV7A 1A1OA 2B4CC 5F3HB 5F8QC 4UT6H 3QJHA 2BDNL 1LEIB 3RIFF 4X5WA 3MO1A 1S5IL 4CJ1A 1R1CA 4X8JA 1ICTA 2G60L 3S36L 1RXLA 3DO4A 2NY2C 1D5ZB 4ZNEA 1QFHA 4RMQA 1D9KC 5T33L 1PL3A 3STLA 1GCFA 1ET7A 1FH2A 2O1AA 4K2UH 1NCCH 4HX1B 1ILUA 1IM3B 1TQVA 2I07A 2QPSA 2VXSL 4HWEL 4MNQE 4OLEA 5D7LE 4ZW7A 5I66B 1IB5A 1ZEAH 3T1FB 3CXDL 4PREA 3PXLA 4WI2A 4FEMA 4G6MH 3UMTA 1UZ8B 5AUMA 3MRMB 3NCYS 2LFEA 3KXFA 3DDGA