1YSOA

Yeast cu, zn superoxide dismutase with the reduced bridge broken
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
153
structure length
153
Chain Sequence
b'VQAVAVLKGDAGVSGVVKFEQASESEPTTVSYEIAGNSPNAERGFHIHEFGDATNGCVSAGPHFNPFKKTHGAPTDEVRHVGDMGNVKTDENGVAKGSFKDSLIKLIGPTSVVGRSVVIHAGQDDLGKGDTEESLKTGNAGPRPACGVIGLTN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YEAST CU, ZN SUPEROXIDE DISMUTASE
publication title Unusual trigonal-planar copper configuration revealed in the atomic structure of yeast copper-zinc superoxide dismutase.
pubmed doi rcsb
molecule tags Oxidoreductase (superoxide acceptor)
total genus 39
structure length 153
sequence length 153
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1995-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1ysoA00
5KBLA 3PU7A 3GZOA 1CBJA 2AQPA 3QQDB 4B3EA 1UXLA 5KBMA 2WZ5A 1Z9PA 4A7TA 2WYZA 4BCZA 1S4IA 4OH2A 3LTVA 2E47A 1Q0EA 3ECUA 1UXMA 1XTMA 2E46A 2Z7ZA 4FF9A 1SXNA 1IBHA 3RE0A 2Z7WA 2APSA 1RK7A 3HFFA 1PZSA 3KBEA 1TO4A 2C9UA 3CQQA 4BD4A 1DSWA 1OZUA 2LU5A 1SXAA 1IBFA 1BA9A 1SXZA 1SDAB 3CQPA 2AQNA 2AQQA 1XTLA 3F7LA 2WKOA 1OEZW 2JCWA 2WZ6A 1EJ8A 1P1VA 2AQSA 2ZOWA 1SPDA 3F7KA 4A7VA 2Z7UA 2GBTA 3S0PA 1SOSA 4N3UA 2WKOF 1SXSA 1XSOA 2GBUA 3L9EA 3KH4A 1SDYA 1JK9A 3H2PA 1OZTG 2AQRA 2VR7A 2GBVA 1OAJA 2NNXA 1DO5A 1FUNA 2WZ0A 3GZQA 1OALA 4A7GA 1JK9B 1YAIA 2JLPA 1E9PA 3L9YA 5CU9A 1SXCA 3GTTA 1EQWA 4MCMA 2AEOA 3GZPA 2AF2A 1E9OB 3H2QA 3ECWA 1E9PB 4U4IA 1IBDA 1QUPA 1KMGA 1SXBA 3HOGA 2SODB 3KBFA 1JCVA 3SODB 2ZKXA 1F1GA 1IB5A 2WWNA 1BZOA 1N18A 3K91A 2K4WA 2V0AA 3MKGA 3GQFA 1YSOA 3ECVA 1L3NA 1COBA 3GTVA 2ZKWA 1Z9NA 1F1DA 5KBKA 2VR8A 1HL5A 1E9OA 4A7UA 2Q2LA 4N3TA 3HW7A 2C9VA 3CE1A 1MFMA 2WWOA 1U3NA 1CB4A 1E9QA 1HL4A 2XJKA 4A7GF 1N19A 3KM2A 3MNDA 1TO5A 1ESOA 2XJLA 2AQTA 4BCYA 1YAZA 2C9SA 1B4LA 2R27A 2ZKYA 1F1AA 1E9QB 2Z7YA 1IBBA 1AZVA 2WYTA 4OJAA 3KH3A 4MCNA 1PTZA 1PU0A 1SRDA 4A7QA 4A7SA 1F18A 2VR6A 3T5WA 1B4TA 3QQDA 3KM1A 4L05A
chains in the Genus database with same CATH superfamily
5C0BD 4NM8H 5DO8A 2VDQL 2DAVA 3HUJA 4PB9L 4MWFA 1SF3A 2W5PA 1GZPA 3TT1H 3GXDA 4LFHG 5AWNH 3VWKD 4PBVC 2V2XA 1FFPA 5BO0D 4CGUB 2EXWC 5M94B 2HTLD 4TL5A 4PLKD 3UADA 1TMCB 4YXLL 3BP5A 2FD6H 2HT2C 1Y0LA 5CNHA 2EC8A 3DTDA 4RZKA 4GMSH 3B3IB 4QYOB 3NIGE 3VI4F 5ADOH 3MRPA 2VRAA 4HMDA 1T0PB 2OR9L 2VLKE 4HIIB 4AYBA 3KLAA 2BZDA 4FQJH 4YFLI 3WTVA 4PTTB 2R7EA 2YGOA 4E41E 5KOVC 1E67A 4FXKA 4I5BB 1EJ8A 4Y1TA 1TF4A 3OSVA 2K6WA 3NABH 1XGYH 4K71C 2VDPB 4YDZA 4GAGL 4HJUA 5JA9A 3DO4A 1RJYB 3GDBA 2DYPB 4R7XA 4X6BB 1NFDB 2I69A 3BAXA 2R15A 2FT6A 1FNFA 1O0VA 2GBVA 3E9UA 4P2QE 2VQUA 2XNAA 3LN9A 2BIPA 5ANME 5EZJA 3GMRA 2GJPA 3JV5A 1S9WA 4AH2B 4A38A 2N0KA 1MRCL 3QXDB 1CL7I 1FP5A 1UZ6E 1CF8L 2X7LB 1IAOA 3GZPA 5C3TA 3SQRA 6PCYA 4ODUB 3ZE2E 1N4XL 4Y2OB 3KPPB 4N90E 2CKBA 3JVFC 5F6HI 2XPZA 4DQAA 2DQEL 3S96A 3PWPB 1ZA6A 1M7DB 1UFGA 2ZX9A 3THMH 1ZRUA 3ULVH 1W80A 4HEPG 4LEOB 5AW3B 2IWGA 3ZZQA 3ECVA 4DFHA 1DFBL 1HH6B 2C5DC 2YA2A 4HXAH 1JHKH 1HDMA 1J9TA 2DWYA 2WP3O 2ZCHL 3DMMA 3ZTJG 3LPPA 12E8H 1PEZA 1U0QA 4R4BA 2HFGL 1X5ZA 2CALA 3LSOB 3PNRB 2IH8A 1WHPA 3TN0A 1D9KD 4ZO7A 1RD6A 3FQUA 2ISDA 2JKWA 1D5BA 4HT1L 1LE5B 1GA2A 3WE1A 2VDMB 4MVBD 4NPKA 2D3LA 4XC3H 1CXKA 4YXKL 4HULB 1PYWB 4L8SA 4S1SH 5H4ZA 3WIFB 3NDYE 5HYFA 1JPTL 2VR5A 4F2ME 4Q9BA 4DK6A 3GRWH 3WMQA 3KGSA 4MAYD 4PMEA 2LLLA 3NACL 1BF5A 1GR7A 2VW7A 3CVDA 3CVHL 4NQED 2GIMA 2W0FB 1XGPB 5HVHB 4KPHL 4NC1C 1I1YB 4OCLC 1OW0C 5JHBA 2G9HB 4RX4A 1FH5H 1BG9A 3ARBB 1HINH 2LHAA 2WNGA 3R1GL 1IIIA 5IOPB 2QELA 2ENYA 5KVFE 4YWGL 4U1SA 2W0LA 3X17A 3CFIC 5J1AA 4RFOH 3ZOAA 1LEKB 3ATDA 4EUPH 5KSAD 4Z7UF 5HYJD 2B39A 3SKUD 5I1HH 4QRFA 5DEZA 2EKSA 4DO5A 4MJ2A 5E6ZA 3QISA 3PWPD 1H19A 4BDVA 3ZMRA 4X6EB 2BNUA 1FL6B 1AS8A 1P7QD 2ZOWA 3PQYB 1KEGL 2XWBB 1HHGA 1OHZA 1IM9A 3PWJB 3BIBX 3N91A 3Q0HA 3HUJF 3U4EB 4F91B 3L9EA 1CFNB 1UJTA 4X8XA 1ZSHA 1G7QA 5F9DC 3X12A 4KKBC 5BZWB 1A0QL 2VO5A 4M3KB 4HK3J 1DLHB 1NFAA 5EA0L 3IJSA 3ORJA 1FUNA 1ROWA 2H6OA 3QH3B 4MZ2A 2H6PA 3OAZK 3IJHA 1SN5A 4MDJA 5T8IA 4XXCC 4P2QB 3OKDA 1WT5C 4TOYH 3EO0B 3KXFA 3QA3A 1A6AA 5IQLA 2GB2A 1NIEA 1KB5H 1HC1A 3CPUA 3BVTA 3IKCB 2IJ0C 3SQOL 2Z3FA 3TIEB 3Q1EA 4C55A 3ARBC 3EHBD 5E1IA 2ZP0T 1F0LA 3FQXB 1PX4A 2EYTA 5CCKL 1FNHA 5DTFA 3FTYA 1X7QA 2X6VA 1NCGA 1KEMH 1MHHB 2V7NA 3HLAA 3PXHA 5EOCH 2OZ4L 2GYSA 3O6FA 2GSMB 3MLWH 1U8CB 5E6UB 1OOAA 3KYNA 3NCCB 4OZFB 5I1KL 2WNWA 1FWXA 3C8HA 3AXLA 1MAKA 3SDAB 3ARBD 4E42B 2VH5L 5AOLA 3AT0A 2CD0A 3OKMB 5HHOD 1XCTB 5KSBB 3UG3A 4P3DA 2R4SL 2R2CA 2UUDK 2EVFA 4MMYB 3TYFA 4JM2A 5AENA 3ZHNA 2YFOA 1QSFE 4HX1A 3GK8L 5I6LA 5CINL 5I19H 2J5WA 2VLRB 3O6LH 2WWKO 4ZUUB 5TQ2H 4XMLL 1NGXB 3VJ6B 1CFTA 4GLRH 3SOBH 2O6DA 3VSUA 5CM1A 4E0RB 4NO0B 1ZLUH 2C1PB 3D4YA 1SGKA 4G3YH 4B96A 1QNZL 3RVXC 3VFSB 1ZT7B 2ROXA 2O61A 2OMZB 3QUYA 2WYZA 3CUPA 4IHOB 3MBXH 3QZWG 4TVSa 4R96A 1QLEB 2IDQA 4GW4A 2VYRE 2HVBA 1WK0A 1VEOA 5FUOH 1BD2A 1X5HA 5DFWH 1U8PA 5GSVB 5A1AA 3B9DA 3T77A 1G1CA 5HDBF 3V4VH 2JELL 3MLYL 1MWAL 3WFZA 4M4PA 1HHKA 2NX5E 5DHEA 1KIRA 1V05A 1O9ZA 3KPMA 2ZG3A 1D6EB 5HI5D 5ITFA 5IBUG 2R59A 3SDAC 2PTTA 1N26A 4JY4A 3SPGA 5JOFB 1R3JB 5ABDE 1E6OH 1BP3B 3OAYK 1Q0YL 3EGXB 2GC7C 4B0MM 3UAFA 1M2OA 3JWNH 3WFBH 4BSVB 1YA5A 3IDJB 5CN2A 3HE7B 3IMTA 4XNYH 3SKJH 5H35A 1KTKE 1AHWA 3UTTA 3NSCA 4X2UA 2WOYA 2VLLB 4MB5A 2JIXA 2AXFB 2EH8H 5AKTA 1U8KB 4AGNA 3GI9H 1NBZA 2KHAA 3QP3A 4YHPB 2DRUA 4TUKL 1KGIA 5GS2H 1RJCA 1IAMA 1Z0NA 4UMGA 1Q0XL 2ZWYA 3VFMA 4FQLH 2WN3A 2ICWB 4EOWL 4P9ML 3D39E 5B3SB 2HLFC 1DBJH 2NTSP 3ET9F 1SUJA 4CVXA 4S0SD 2GUOB 3CMOH 3EJYC 4JB9L 4S10A 1HU8A 5F3FA 3BP6B 4MS8C 2EP6A 3QXAA 5CSZB 2EJ1A 3BHBA 4GPVA 4M43L 4CMMB 3WLWC 5I82A 2XVLA 3Q8CA 2O5ZL 4IDJL 4KRPB 4EI0A 4MHHG 4JPKL 3ZHLA 2VITA 4FCAA 4L8DA 5C0DB 3N85H 4NX0A 1CU4H 3WS3A 1D7BA 2C9XA 1G6RL 3UC2A 3GXMA 2BVOB 2XPYA 5INDB 2F54E 2G2NA 5JPMA 4ATWA 1CXHA 5FM4A 2VJ0A 5IQOA 3M6DA 4MS8D 5IT2L 4NNYA 1MFEL 3HE7C 1J1XL 3B2MA 1JXFA 4PJAE 4HWUA 1UM5L 2YAFA 1ZHNB 4JPQA 3JWDL 5DEFB 1A1OA 1YUKB 1A7PH 2WXOA 4LLDA 4H2CA 1JG9A 3HR6A 3L9RB 5DYOA 5I76A 3ECBB 2E76C 4PB0H 3S8WA 2KBGA 3S4SG 4U1KB 1AYOA 1P6WA 2AK4E 2BVEA 1MLCB 1ZY9A 2ICES 4X0NA 4RETB 2IGLA 1HIMH 1DUZA 1TLKA 3JV6A 2YKLH 4XVUD 4JHBA 5DS8A 3GO1H 3D2UD 2XWRA 1MHPH 5KOMC 4MZRA 4EO5A 6PAZA 4KK6D 3V0HA 4DP5X 5JHLH 5HSFA 3G3LA 5K33A 2QL1A 3WTSA 2CR6A 3F5WB 2J21A 2VLMD 4KRPC 3B7UX 4JM2F 3BCFA 4PRIB 4XI5D 3RY5A 4ZX4A 1AP2B 3FQWB 3MODH 4LKCA 4NUGL 5LBSL 4Z0XB 3IKKA 3EDJA 5AW7B 3DXAB 1NMCB 3TJHD 3MFGB 1VACA 4GSXA 3LMJL 4GAAA 3ZHDA 4NO2B 3A6BH 3LKSA 4KRLB 4H0GA 1AXIB 2BP5M 1N0XH 5LLIC 2IEPA 2XN9B 1E4KA 4N2GA 5AB2A 3ZDYF 3AWGA 5FKAA 5C07D 1OQOA 4KRPD 5C0IB 1UB5A 5B1CA 3TA4D 4ELMA 4OLXL 3ZT6A 5HDOA 3ISRA 3SPHA 4PJBE 1I9IL 3L13A 4YO0A 2G5UA 1J86A 4F20A 3G5YA 3SKNB 4MHHI 4NHUB 1UGNA 2DQHH 5GIRA 1PLBA 4KQ3H 5C8JA 4N2NA 4PLJC 4OCYL 2E7MA 5IB1A 2BY3A 1MWOA 4UI2A 4F9LA 1OB1B 3P4MA 4GBXA 3BSHA 3IMUA 3O3EA 4TNGA 2BHFA 4X6DA 3SE9H 2WWMD 2FSEA 2UX7A 1AXTH 1PY0A 3RJDA 3LCYA 3ZRFC 5LXGL 4LCWD 2LFEA 3WMPA 4YFEA 4GG6E 1RP9A 2N1KA 5C09D 4JUSA 3TNMA 2CLVA 4I77H 2W95A 2CO3A 1E27A 1NMCC 3Q6FA 3WN5A 2BC4A 5AVYB 1BZ7B 3TO2A 1TVBB 3L3OA 1N19A 3MJ9H 1TO5A 3SDXF 3L4ZA 4FFZA 2AQTA 1NCHA 4E5XB 1RZKC 5HDQL 5I1LA 1B0WA 1FZOB 2XV3A 4PRID 5EU4B 2YXFA 5F7AA 3UEQA 2X9XA 1PU0A 4ERSL 2KLRA 2XIDA 3DXAD 3QUKB 4O2CA 5CZXD 5DD6A 5J6GA 4PJAB 4Z18A 4DK3A 2X87A 3HS0B 4FI8A 2BSRA 2YD0A 3FT2B 2HCZX 4ALAL 3WD5H 2ITEA 2XN9D 2XU9A 4RMWA 1DJWA 3IGLA 3OSKA 4KV5E 1EEYB 2CGZA 1KTLA 4I2XE 3UGEA 4GMTH 4IU3B 4JFFD 3TEZA 4HIPA 5DUJA 3MFFA 4JKWA 4ZPVB 2XWEA 1GSKA 3SSGA 3MGTB 4FI6A 4QY8A 1XIWA 1QQDB 1BVZA 4LVEA 4PRPD 2AXWA 1CJYA 1AZBA 4ZDHB 2WJ7A 3FU8A 2FWOB 3OKNA 4MCYA 5KJRL 3QJSB 2YD8A 3NJKA 4FD0A 2V5TA 3MRNA 1F4WL 5KSVB 3CLWA 3SE6A 3NG5A 1HOEA 3REWB 4H8QA 4IMLB 2IF7A 1GPOH 3MRHA 4WIQA 4DGYH 4NFDA 4GW5A 1OXYA 1A9EB 2V3EA 3LIZH 5AKSA 4N9GA 5DMGD 4FQ2L 1W16A 2X4SA 2ZXGA 2K6YA 3GLAA 2W9LA 4AG4H 3H3PL 3GMQB 3ZYJA 1NC2D 2JI3A 3D85A 3IDNA 1HESA 2WP3T 3T1WA 3UYPB 4KJQD 4F80A 4BA8A 3S34L 4O02A 1M7UA 1VCBC 3H2PA 3ARTA 1YC7A 4JHWH 3V6ZA 1CT8B 1PX8A 2DM3A 2DQCL 4IHBA 2BNQD 3HG1E 1W0YT 1N7MH 4N2HA 3SD2A 5GXBB 3HS0C 3T08A 1UCTA 3J7HA 5D7JB 3FCUB 2FX7H 4J3UA 3K1KC 3CLEH 1S7SB 3UTSE 4Y5XA 2PP9A 4G6AD 4QI3A 4FQ1H 3II2A 4UOZA 2DL9A 1FO0A 4Y2LA 3LJ3A 3SY0A 3RWJA 4Z7WA 5I0VA 2M83A 5IJKC 1KG0A 2Y1ZA 5G5DB 4CW1A 3IXAB 3PHQA 3QR2A 4JFHD 3QZBA 4ORZC 1MW0A 1T5XA 2QBWA 5IFJB 4JLRB 5JDSA 2YQ3A 5GS0L 1TZHA 1F4YH 4LOUC 5FLVA 3ULUD 4JG1L 4BJLA 4IEFB 3UAEA 3ILPB 4ONHB 4GG6B 3BW9B 3Q2NA 1TVHA 3EYUH 2J4WH 5AKRA 3GSWB 3G9VA 2BZ7A 5AVXB 3NN8B 5BNXD 2QADD 2WTOA 4R6UA 1W72A 3QO0A 2VIRA 4HFUH 2ZOOA 4OF0A 4RGMB 5JW4Q 1EXHA 3OG4B 4HJIA 2XTJE 4FFYH 2OP4L 3NCWA 1C5DB 1Z9LA 4N25A 2PWDA 5CP7A 2Q8AL 3G6AB 1T80A 1I9EA 2A9ML 2BSSB 1JFQL 2FO4B 2B59B 4PHZA 1KV7A 4P46D 5EBMA 5KW9H 3ZKND 4JGNA 3CTTA 4X6DF 1IT9L 4HOMA 3POCA 4WFEE 4XMUA 1VHPA 1A9BA 3BAWA 3FB6A 1MNUH 5D7JC 4X0KB 5DZNA 3QBTB 5INCB 4Z77B 1FCGA 4KQ0A 5FO8B 2Z0UA 4P2RE 2NW2A 2MNUA 2FEJA 5MP6H 2D9QB 1JNNH 2UY6A 4L3EB 3TFKC 1EHLL 2J6EH 4EMZA 1SVBA 4MXVF 2AXGB 3BDYH 3PL6A 2A6KB 3A5VA 2WO3B 5FM5O 3EOAA 4X9HA 4P8QA 2A7BA 1BAGA 1X9RA 2CUIA 5F96H 1GS6X 2IPKB 4G71B 5LO7A 3MRFB 1N0LA 3U48A 4G5ZH 4O58L 1OAKH 1T04A 5JPNB 2KZBA 4QHMA 4L4TA 5B39A 4ZAKB 1NL0L 2VZVA 2HWZH 1XF5B 4TLUA 2QSVA 3G08A 1NCNA 5MEQA 3QIWC 1E2ZA 2AQQA 2YK1H 3C8KA 4MQXC 4ANXA 5B38B 5IBTH 1N2RA 4U7KA 4GQZA 3AADB 2VXSL 4RGMC 4JY6A 4YPJA 3MR9B 4Q9RH 3MKKA 2ARWA 2ESVD 4XN2A 2VL4A 2YQ2A 2ZZUT 5D7IA 5IM7B 5GZNC 4MRBA 3I6KA 1CIDA 4P3WA 1VA9A 2Z64C 5K59E 3MO1A 3QIWD 2FNWA 1KCWA 1BCIA 3CVHB 5B3NA 4R8WH 5E6YA 3HG1B 2XBTA 4WUUB 1TUPA 4BGLA 2F68X 4HXBL 1M2VA 1NCBL 4HJGA 3QWRA 4QRPA 2WWKT 2V2TB 5F88B 5GZND 1DL7H 5H37A 5FDWB 5IKCA 1G6VK 2Q7YB 3L1EA 4AXWA 3FT4B 4ZX3A 1NUFA 3NCYP 1DLFH 5LXVA 3LKOA 2HKFH 4TXVB 4X80H 2DLFH 1REIA 2PCFB 1YJDH 5JPNC 4U33A 4WUKL 4QKXB 1RV6X 3UTOA 3O3DA 1PIGA 4M4RB 4U1NB 3EGSA 1CFVL 3BMWA 1H3PH 2WW8A 2VMEA 2MMXA 2ZUWA 3WJMA 1A14L 5D5MF 5J9PA 3S9DB 5FAAA 4OLVL 2BNRD 3QXVA 3NFNB 3RY6A 3UROR 4TUUA 3BWAA 3ZE1F 1G1YA 1WGOA 3HC3L 3K72B 4MYPA 2IH1A 1QSED 5D4QA 3MRIB 3O41B 4LLYA 4L8CA 3N3EA 4WFGD 4KNTA 5E99H 3UZEA 3T5WA 4LLWA 4Z7WF 5EO1A 1EJFA 4NKOB 2NY0D 3GEFA 1JF1A 3TIDB 4LF3B 2XZZA 5IW1A 2F5AL 4WHYH 3AS0A 5L4MA 5BMFH 1SJHA 2HKHH 1DBBH 5H94A 1ZLSL 4WHDA 4KAQL 3KL0A 5MENE 5ISZA 3QW9A 4GSQA 2FQEA 3DX9B 1VPOH 2JLLA 2LABA 3PDGA 3NIDF 3IXTA 4DTGH 1E5UI 2EVGA 4FFVC 3HBGA 4GKZB 5EZLB 5C08D 3HHSB 5GJSH 1JP5A 4P5RA 3ZZ1A 5LGJA 4W9LC 1RIUL 3BSZA 2HFEA 3ESNA 1A25A 3GSRB 5CN1A 5EOQL 1JDDA 4IMKC 4JE0A 3ULVF 3WU1A 2P5WB 1Q4NX 1MJUH 3CWGA 5DQDL 3ULUH 5DJ0A 1BWWA 3LQAL 1OP3K 4LGRB 1MI5A 3FQNA 1GGIL 1NGYA 2CE6A 3KYMA 4N24A 4NQTA 4M6MH 3WG7B 1IKNC 1NIDA 4LP8A 4PGEB 4RLDA 2RTTA 5EZOH 3DPDA 4R4ND 2DM2A 3HZYB 4OGZA 4OD3H 4WW1A 1BBDL 3TV8A 1BEYL 1R9FA 2NTFA 1Q9KA 1N5YH 1HHHB 5D1XA 2GBUA 1AFVH 4OUOA 4OIFA 4JPWH 5T1LA 3K5RA 1R17A 3EXJA 4ODVH 3GUFA 2BRRL 4IBTA 1NICA 1T1XA 3B8SA 1RLWA 1FH2A 1I1AB 2XZCL 1XH3B 1BVKA 3PCYA 5BRQA 2WIMA 1M3JA 1W0WB 4W81A 4G8GE 4QXTA 1UA6H 4P4RB 1QFWH 3EH4B 4LNRA 4HWEH 3D3VA 3O4LE 4AYFA 2YXVA 3HOGA 2BK8A 2CO7A 5A2AA 3VXRA 4KFZC 5EU5B 2MPVA 2GFBB 3RU8H 1Q94A 1OSEA 5KBPA 1AI1H 1MWAB 2OJEB 2XSKA 4H26B 4DERA 1FYHB 4HEMA 3GTNA 4D9QE 4FABL 1TU2B 3C9NA 5D7IF 1U8IB 4FEIA 2ZIDA 4MMXC 1TJHH 4IBLT 3L1FA 3QIUB 1S9KC 2D0FA 4QF1B 2X9ZA 3H8NA 3WN6A 2KL6A 4DJMA 3H9HB 4M7LH 5LGYA 1YQ2A 2EEFA 4UMSA 5E94B 2OCCB 1C5BH 3QJZA 3EYQD 3X3FH 4QGTA 4BWTA 2QQQA 1KGWA 1O75A 1SRDA 3MRBA 3RGHA 2WCPA 1YYML 4WKZA 1EZVY 4FXTA 1OSPH 4XBGA 5I1CL 4K07A 1IGCL 1OGSA 2NR6D 1I1AC 1AHMA 1OGAA 4FA7B 2RCSL 4YSPA 5BJTB 2ZICA 3KPRE 2UY7A 4Y9CA 5HDRA 4FEMA 3MLXL 1BXVA 2YOAA 4H8VA 5ICZA 4EI5D 4U0QB 3BQUC 5DZAA 2CIIA 1H15A 1RUPL 3T4AA 2KDGA 4PRHB 5DRWB 1ZCRA 2BXYA 4G9FB 3F85A 1HHJA 5MENB 3T3PE 1I1CA 1G9NH 5L2KA 3WKNA 5I18H 2CHDA 4HJ1A 3A0OA 1S9VA 5E6ID 2UZXB 2XWZA 4XNUH 3FH5A 1KTDA 3BQUD 3QPKA 2A5UA 1DQMH 2DM4A 2ERJB 1E7UA 3QIUC 3RVWC 3CSBA 3HI6L 3UBFA 1XR9B 3D50A 3QQXA 1R24B 3X2QB 2SEBA 4Y19E 4KI5C 4LLMB 3ARXA 3GXNA 1FYTD 5SWSB 3AS3A 1IM3D 3GJFB 4UU9B 2NXYB 1TZAA 4NQDE 1RK1B 3WKYA 1LYQA 5T3XL 1EHXA 3CC5A 1DQVA 1DJGA 4NNXB 2IDFA 4ENEC 1DO5A 2AJSL 2FLBT 2ZE0A 5JUEH 5EIIG 4Y88A 3OJDB 1XHHA 4D94A 3US0A 2H32H 1HJBC 3IK2A 2EE6A 1Z9SA 4LPYA 3S36L 1OO2A 5CLYA 3OMIB 1FGNL 4N0CC 4X4ZA 5CR1A 2FJFB 1UXSA 1OPOA 5IFHH 1TR7A 2FWUA 3C5SA 2YWYA 2OSXA 3HLKA 3WUWG 1H3VA 3FFOA 1F8TL 2CJUL 2ZWNA 5FYJL 3ZL1A 3O4LB 4ENZA 4AX3A 4N87A 5JYMA 5J8OA 4JZOA 1YMME 1Z9NA 3KYKL 3X1EA 3F2LA 2AEPH 1K5NB 5A2FA 1IGJB 1HWGB 4UDUA 3MV8B 3MRJB 4F92B 2ERJC 3BVDB 2NSQA 3QJOA 4MA1B 3U1SH 2XQBH 2BMKB 5M95B 5AVWB 1SQ2N 4FAAB 3FOLA 4MA3A 1KPUB 4ZQKB 4L5FL 1TTFA 2V7HA 1IL1B 1YAZA 3JWDC 3TWYA 2E8ZA 3P3RA 2NXYC 4LESA 3VXOB 1ED3B 1F4XL 1MSPA 4GI8A 3SPJA 3L54A 2ZF8A 4JUTA 3W9EB 2RH0A 1NFKA 1WBXA 4TYUA 1VFUA 1Q9LB 4XP1H 1JYNA 1OAYH 3ZR5A 5KN5A 3LX9A 4JRFA 5HVGB 5HP5A 3W0WA 1KEGH 3KM1A 3FN3A 4YHIA 1QRKA 4YSOA 1NMBH 1OE1A 1UXWB 2BHZA 4PJIB 5EO0A 2L3BA 1OAXH 2HX8A 1JV5A 4QNPF 4OF6A 2ZCLL 3VXTB 2F19H 4NZDA 5HI4D 4PCKA 5I8OH 1BHGA 1NBVL 1JD7A 3QPQD 3ABGA 3QUXA 4G7QB 1ORQB 4UTBA 5GRVK 4BZ2L 5KSUB 4POYA 1WSST 1LK2B 1YN7B 2Z31B 5HGHB 5I1JH 1UZ8A 5JXEC 5DR5L 1OLZA 4J28A 5TK2A 3MRQA 4P49A 1G9ML 4N2BA 4PUBL 1SM3L 4DP8X 1A6ZA 5JHDA 4KZEH 4OFYD 4MA1C 4EN3C 1T83A 5EN2B 4APXA 4AENA 1F90L 1BQHB 5CCKH 1M71A 4N20A 2FJHB 5DA4A 1RZFL 4DN4L 3QFDA 3HS8A 4WK4B 3I9IA 4XCCH 4OZHA 3RL2A 1HEZB 2WQUA 4XHJC 8PAZA 5K9OA 5CLWA 5CS7A 4QRQA 2WXGA 3SE4A 1HXYB 4R7NB 5HXMA 3NBNA 4Y19B 2QPDB 4NKDB 4EN3D 4HETA 3MNVA 5KVDL 3TZVA 3KHOA 1I7ZA 5ERWA 1F3JB 4OD2A 4ZMLA 4RWYH 4KK9D 5AQ0A 4N0FA 2E75C 4MX7A 2R1WB 3ABMB 2FJSA 1QI4A 1ZTXL 3BESR 4LIQL 5CINH 1CWVA 1JN6B 1HH9A 1TG8A 3W9DA 5C0RL 4W9JC 1OWWA 3N2JA 4BV1A 3P69A 4HCFA 3UP1A 1PBYA 2Z31C 5HJGA 1NDMB 1BVLB 1S7RA 1FVCA 1IFHL 1YEJL 4TVUA 5LGHL 3B2VL 4JPVH 1J18A 3FFCD 4X4ME 2CA4A 2QGEA 3QUMH 1YSOA 2MJWA 1E30A 3MLZL 4Z7NE 5IFAL 4HIJA 4I9WE 4FZ8H 4CC4A 4TM9A 1LM8V 3HUJE 4XBPA 3L08A 2OX5A 3FCGA 4GB9A 4BFBD 4HHAB 1TFHA 2IG2L 3ULAB 2WQWA 2FWSA 3C09B 4NQQA 4Z7IA 2E59A 4BQ8A 3C2SA 3QDAA 5D71L 2ED9A 4A7QA 3FQTB 3C5ZB 2RMNA 4ALAC 4MJ6A 4RAVB 2JB5L 3DX6B 3CHRA 1S9YA 3ZL2A 1CGYA 3Q1SH 2X2HA 1RMFL 1NJ9A 3K8KA 4RIRB 5DJZA 1I7TA 4HV8B 2WXFA 4R7DA 4JGUA 5SX5K 3UO1L 4P2OD 2Y2TA 3L3JA 5I28A 1EMTL 4RAHA 3PPEA 1KN2H 3A6CL 4BE5A 5B7MA 1T7VA 4N6RB 4N4YB 5AALA 3ZYIA 5E00B 1J11A 3ZPDA 4UTAL 2PCPB 1LJMA 3MRGB 5AL8A 3NJHA 4Q0XL 2WMPB 2B1HL 5BW7A 2DLHA 3H85A 5ICXB 3WGVB 2AABL 5IB3A 2NSMA 3T3MB 3U9UB 5BS0A 1XH0A 2BW4A 3F7YB 3ARGB 4Z23A 3MLPA 4YHKL 1QFHA 3LY6A 1OGTA 2KYIA 2FHFA 4XWOC 1JZ3A 3WIIL 2D0HA 2AV1A 4UTCA 4NQCA 3KPQB 4XNDA 1JV2B 3GBML 1NC4B 4W1TA 4XN7A 5ILTH 2CLZB 2GT9B 3FB8B 3KD4A 3WNPA 3C09C 4ZMNA 3WELA 4PG2A 3KGRA 1G7IB 2D3VA 5EEWA 3MI6A 1G6RH 4WEBH 3TYGL 3C5ZC 3FS9A 1N6QL 1WICA 2IADA 1QSVA 3Q01A 2E7LC 3O2WL 1FDLH 4OZFG 5FECB 4JFDB 1Z3GH 4S1RL 3DRQB 1UM5H 5CP3H 2DWDB 4XZUB 4OB5L 3PGDB 4FYRA 1QO3A 4AEHH 1HCYA 1NLBL 3VXMA 3MA9L 1F6LL 2X1OA 4G82A 1WP6A 3O3BB 5B3JF 4AKQA 4NCC1 5ESAB 2DEWX 3ECQA 3WS6C 5CIPA 3A22A 5ID0B 4APQD 3FTXA 5D72L 2A9NL 2KLSA 3VXPA 3UG4A 5GS0C 4LRIC 5C86A 2DMHA 4BH8A 4DOHB 1BGXL 2HRGA 3FRUB 4OZHF 4YBLB 1BVNT 3S35H 2BJML 1ZLWK 3OKKB 2QGDA 5D7SL 3WEBA 1CQKA 2H5UA 1KZQA 2HJKB 4GRLA 3RWEB 3ARGC 4GKLA 5DVOA 3X3GL 4B9YA 3BAKA 3E8UL 5J56B 3PWLB 1A8JH 4MXQD 2D2CC 1YLBB 4Z7NB 1KCRL 4KUCF 2F0CA 2RGSA 5EPMA 3ETSA 1YNLL 1AKJA 2AQ3A 3K2IA 4BYHA 1JNLH 5E4IA 1R5WB 3DX8A 3QC5X 5CGMA 3DUSA 3RB5A 1HCFX 4ONGH 1XSJA 3ARGD 3E9TA 1OOWA 3EOBA 4ZW5A 3IFNL 4LPUA 2DEYX 4ZPTB 4YFLF 3V10A 1U92B 5ENWB 3MRPB 1B4JL 1XBDA 4R97B 4OZ4B 3P0GB 2M26A 3CFDA 1T0OA 4CDHA 2VLJD 4ZD3L 2RAMA 4F24A 5DD5H 2DWTA 2QVFB 1GRWA 3WL9B 1UKSA 4FP8H 3U9WA 2W91A 2R29H 5MHSD 1AQKH 1XD1A 2EAEA 2WQXA 1AD9A 2W60B 4X7TB 5T5FH 1ZE3C 5DF0A 5GGTA 3VFWB 4JFDD 4OCYH 3RL1A 5FLUA 4YBLC 1VADA 4M7ZC 5EFIB 4UIMB 3ZK0A 2E7HA 1FFQA 3BISA 4PW4A 4YX2L 2VB5A 1H5BB 3BXNA 3QPXH 2F61A 4ANVA 3KXFE 1EFXD 2D3NA 2EDTA 2OMBA 4FMKA 4BZ1H 1JGDA 2IOOA 1C16A 4JN2A 1P1VA 4LSPL 1XGQA 5E7BA 4PEEA 3BE1L 4XN1A 2I60H 3ALPA 3D0VA 3L5XL 4M5ZH 3DYMA 2HMIC 1INQB 3B9KA 1ZA6B 2YARA 1YAIA 5HHQB 3D9AH 3GRBA 3BH9A 2Y36L 3EJJX 2W1NA 3PY9A 3IGAA 1FVEA 1VGKB 4HC1A 4KX9A 4R97C 2WXQA 5FM5M 3WTUA 3QORD 1J88A 1AIFA 4IRJD 1BXUA 1N68A 2DWEB 4DHLA 1QOKA 4I3RH 5JMOC 2ETWA 5HHNB 2HMID 5DK0B 2YAHA 3RTQB 5IB2B 2PF6A 1NAMH 4WRLA 3FQUB 4JFPB 5EF2A 3WFCL 2X53A 1A47A 2HH0L 1EO5A 4F1SA 2ADFL 2V33A 5JHMA 2DQFB 2WXHA 4IKKA 4XE0A 1J9SA 1UFUA 5IR1B 3GSUB 3OHXB 1H5BC 2WPGA 5B1JC 4QPEA 5E5MA 2QTEA 4ODTL 4HWBL 3I75B 3C60A 1U6AL 3LXAA 4YDJA 2UYLB 4AW4A 4YDLB 1GY2A 3IBEA 1ND0A 1EAPB 3L7EA 2QGBA 3GSQB 4JFQA 4JN1H 3E6FA 5DK2A 1GKEA 3MBED 2X4TB 5EBWA 3BRFA 2R27A 2K4AA 2JKLA 3ISWA 4U6XA 4E9WA 1UEMA 1IBBA 2N01B 2E6QA 2Z91B 5TDNB 4GAJL 1SQMA 4FQ2H 5KVGE 1BD2E 3LZFL 2OTUA 4LL4A 4NQXA 3MGOA 5EBGA 1SF5A 1U33A 3N40P 5J6HB 3QFJA 4I88A 4LDLB 3U36B 2F53A 4WSGA 4X5XA 1CIUA 2EIBA 2WYIA 5AZ2H 1MCEA 5HHXH 4NJAH 4CU7A 5DDHB 3T2QA 2FX8H 5F1SA 3U46B 1MFBL 4H2AA 5B1AB 4P9HL 5HHME 3TPKA 1U41A 5MERB 3FO9A 3W39A 5E2WH 4TMPA 2ICWI 1YEIL 2XFGB 1N59B 2W65A 4G6FD 3VFGH 2VZSA 5GZOD 4K94L 3RTQC 5CZVL 1LP9B 3UTTE 4BDVB 3AABA 1UYWL 3FTGB 1NDTA 3PFUA 3QT2A 1KV3A 4WEMB 5IB4A 3ARZA 4N8CL 4XP4L 4URKA 4F8QA 1A22B 2PN5A 2WTRB 1HHGB 1RK7A 3QJHB 3IDIA 3JVGC 4AQAA 4DGIH 3VG9C 3OHXC 4TPRL 5T5NG 1VDGA 1YQVH 2X4OA 3QI9B 1O5PA 4HWNA 3WLBB 3GBLA 4I0CC 4UM9B 4YDLC 2A9DA 3QRLA 5AVUB 2W9EH 3CX2A 3V7AG 4F8TA 2HB0A 3U0TA 5LAPA 3PLYA 3HN3A 1QYGH 3QJUB 3NZHL 1MFDL 5CUSL 5B4MC 2ZPKH 2HJFA 5I17B 2CDEA 3QNZB 4KO7A 2W9DL 2R56L 3KPSB 1J8HE 3TLRA 2J7LA 1Z2KA 4NWUL 1BREA 3J2PA 1GTNA 4MTMA 3MCLL 4H1LH 3JT2A 1GOGA 4WW2F 1AXSB 4PJ9D 2C9QA 4KK8C 2Q2EB 4E5XG 1V3MA 4OU3A 2JKSA 2OXHA 5C0CD 4OJDH 4YHML 1H6TA 1CK0L 3AREA 4Q4EA 3FONA 1NUGA 2VMCA 1WS7A 2V0AA 3MKGA 4YLQT 5FCSH 1I8LC 3GTVA 4XP5H 4M29A 2WVTA 3QI9C 2NT0A 1LE9A 3LB6C 1Q72H 1E2VA 2BS71 3SZKC 3HRPA 4JRXD 3FO0L 4LSUL 4KK8D 3SDDA 1BJ8A 4B9KC 5IG7A 2X4NA 2V3FA 2YD6A 1ADQA 1M7IB 2EDFA 3WXWL 4FX5A 4C59B 2B15A 5E8NB 5EUOA 3D4CA 4J27A 1KCBA 4IOFD 1I9RH 1EVUA 5F9JA 2C3VA 1IAIH 1L9MA 4JKKA 4YL9A 2O61B 3WHXA 2W0KA 4HLEA 4F27A 2FATL 4W70A 1KPVB 3LKNA 4NZUL 1D3CA 5IJBC 1SYVB 1S7UA 4GW4B 2DMGA 1RK0A 3ALWA 1FNGA 5D4HA 1OAUL 5E1GA 3WIHH 3HZVA 4Y16A 4DZ8B 4JKLA 4L3AA 2J44A 3ALXA 2MHAB 2H3NB 5ESQA 3HRZA 1GW0A 4B60A 3KPSD 4WO4D 1PSKL 1CFQA 4L1HA 2VWEC 3DX4A 35C8H 4LT7A 3B7SA 4ELME 5DWUL 5ICUA 1ZAGA 2PO6A 3IJEB 43C9A 2BWQA 2IMNA 4OSUH 3UTTB 6FABH 1IEAA 4LU5L 3S4SA 3X11A 3QK0A 2JIXB 1BA9A 5C70A 1TJGL 1B6UA 2DQMA 4N0YL 3L6FB 3EFDH 3RBSA 2Y5EA 1F6AA 5IROA 5JNYB 2ZYIA 3LEVH 5DI8A 3DK2A 1SEBB 3PE9A 4NSKA 1T1YB 4OQTL 4RGOH 4Y2DA 5EOTB 4IRSB 1UH3A 1W0VB 1OTUD 3RDJA 2ZSVA 4X6DE 3DV6B 4C4BA 1CZ8H 3ARSA 4QT5A 2OK0H 2WKOF 1B0GA 3TBVA 2KERA 2E9WA 3QUZD 3PDDA 2X6UA 4YEEA 1LD9B 2R0WL 5FHBH 2CIKA 1Z3RA 2QDWA 4ZUTB 4Z8FL 3UL4A 4NZTL 1KENL 4PWKA 2VLKD 4QCIA 1KSRA 4S1QH 4S0TD 1J8HB 2VITB 3E1F1 2DIEA 2XV2A 5T3XD 3L5JA 3B6SB 4E41D 4C8XA 1TMQA 3RWHB 1UD6A 1P53A 1CGXA 1S8DA 2VUYA 1ZT1B 3RNQA 3UZVB 4XMVA 3TVMB 3H6AA 3MLTB 1YDPB 1X9UA 1GOFA 3C12A 1ITCA 4EXKA 1A7RH 1KLFB 1W9XA 5ID1A 3HNSH 2H1PH 1QPXA 3U2JA 2UXVA 4QYAA 4J3VA 5EWIH 2ZOTA 4KTDL 5EC2B 3VYOA 2A77L 5IVXB 2VISB 2CDGB 1JZ7A 1MCDA 4GIPD 3ZHFA 3DBXB 4IRSC 3SDCB 5FYJD 3T2OA 5CAYB 1O9WA 3M1BA 4PG9B 1RIUH 3D69B 1DQIA 4ODHL 2IQ9H 3QHZL 2OL3A 4KVNL 1A6VL 2XWTA 3D8MA 3MUGA 3O4OB 5DQDH 1CLCA 3QYNA 3LQAH 2J3SA 4Y1AD 3FDWA 8FABA 4YXHH 1WZ1H 2FT8A 3GSNA 4HU8A 1JGVL 4DN3L 43CAA 3CFJA 4MDRA 1U3YA 1HSBA 25C8H 4K23H 5FGCB 1FG2A 1GC1H 1YY8A 4L4VA 4NPJA 3O81A 1BEYH 3RZCA 3BVNA 3F58H 4CJ0A 5JLZB 3RDTA 5B38G 4YDVB 4AW7A 5EU6B 4FZEH 4PS8A 4FQQA 5CEZL 3SBQA 2XN0A 3L3KA 5I9QB 2H0FA 4OZGB 1SJVA 3WFDH 3IMSA 4FFTA 1BM3L 1K9TA 1WFJA 3TVMC 5LWYL 3UBXB 3MJ7B 3KNBB 1G9MC 3H54A 1LMIA 2P3YA 3K71A 2APSA 5EUOF 3IDUA 2VXTH 3VVWA 1Q9WA 4GG8A 1VFBA 2VRKA 3VXUD 4YOKA 2GIXA 3T8VA 1H3UA 3VMPA 4XVJL 2R0LH 1UB5B 4YGVB 4Y4HD 4HS6A 2HX9A 3MNWB 4GW1A 2GTZA 5E2VL 4XO5A 3VD5A 3DIDA 1G7PA 4JFVA 2AJ3B 3L16A 4KXAA 4YK4B 1A4CA 3SDCC 3IRCA 2K6ZA 2ORBH 2OTPA 4K9JA 3ZE0E 3TVMD 5GIRB 5C8JB 5D2LB 3L3GA 3HCVB 4FXGB 1F3RB 2XWJB 3DSNB 2P5EB 2YKKA 4EDXA 4PJHA 2A3TA 4XOAA 3WXVL 1MH5A 2ODHA 2C8NA 5C7ZA 3NCJL 5EN3A 3TNNB 3WNOA 3SCMA 1UUSA 2A6IB 1X9QA 3UAJC 1J0JA 3SGKA 4HUVB 3JV0A 1A2YB 3NIDE 1JGEA 3O2VH 4F33B 3H9SA 1NCAL 3HG0A 3I02A 4JKMA 3ZRSA 1GIGL 3DX1A 2ATPA 1LHZA 2V17H 5I9QC 4WDIA 2VR9A 1UM4L 3GLZA 2H1LM 5EU7C 3FMGH 5I1CH 1XQ4A 3VGAC 4RBPK 2F9BT 4WTQA 1IC5L 4X8GA 3SPVA 5TE4H 2B1OA 4NN6B 1OY3B 3D06A 1EO8H 3UAJD 3US1A 2A1WL 5FHAH 2ENSA 1ROCA 3AZUA 3BUDA 4Y2NA 2Q6WA 3WNNA 4A66A 1V55B 2JTYA 4WI4A 2XOTA 4HH9A 4V2CB 5EU6D 1J5CA 4LCUA 1TZ8A 2J72A 4NRZA 1NCOA 4CSPA 1D5ZB 4XVTH 5JIIA 3WTXA 3L7FB 4LSVL 1CDGA 5GPRA 3NFSH 1CB4A 1OPGH 3SYAA 1E4XH 3PUUA 4NRXB 3MRKB 2ZXBA 4JHVA 3WJLC 4JZJA 1BQUA 4FXGC 1YZZA 4NOFA 4FJYA 4A2LA 2I9LB 5I8KL 5CF3A 3SJVA 4MA7L 3D2TA 3RVVC 3FN0H 3VYNA 2XPGA 4XPBL 1DVFB 3IT8D 1P5VB 3R4RA 1KIPA 1D5RA 4K3GA 2JJUA 4M8RA 4YSDA 1KFAL 5DYFA 4D0DA 4L4TE 4HP5A 4YDIL 4OZIA 1NLDL 2NDGA 2VDOH 2WINB 3HFML 1KELH 3AM8A 4NDMB 2GK0A 4M3JA 4ZFOL 5DJAA 5I1IH 3CBKB 3ZKMD 5L6YH 2H2SC 1SJEB 4MXWL 4XMPL 2WQRA 5T3XH 1QBBA 5I75B 3WKMH 2ZOUA 4WO0A 3EF7A 2HFFA 3EJSA 3M46A 5BVJB 1OP4A 5EEYA 1YC8A 4NLHA 5A7EA 2X3AA 4J4PD 2UZIL 1J8KA 4I0PD 4OGAD 4ZTEA 3AG4B 4AYGA 5J0BA 1EEZA 3STLB 3FOMB 2P7TB 1MY7A 1F11B 1QSFD 3MHZA 3P02A 4MD0B 3V6ZB 4XMTA 3GUTB 2DI7A 4R9HA 4E9TA 5ANHA 1GZHA 1QBML 1XSKA 5DLML 2XY1A 5LN8A 5DMIH 1LQBC 5FYJH 1U3ZA 2OMXA 4QRPE 1Q1JL 2AKRA 2I07B 2BSTB 2P26A 3T0EC 3UH8A 1S5HA 4ZFFB 2PYED 3LRGA 1ET8A 3TX4A 4BKTC 4IOSD 2A4EA 1BQ5A 2AV7A 3L2LA 4TSCL 3ZE0B 5IMKB 2ZUUA 2X89D 2XKUA 4P59L 2CJ3A 1DVFC 2X44D 2PPEA 3SY0B 1KBWA 5KYYB 2FB4L 4QLWA 3AQZA 3II3A 2GBAA 3CZEA 2HKAA 4DKFH 1FZJA 5J12B 1X5GA 3X14A 4BHUI 5CGYD 4P4KA 3N43F 4LARH 3T0ED 1F4XH 2NX5D 5TK4A 5L88H 3JUZA 3K0YA 2WQSA 5I75C 2D7PA 3FHAA 3NP3A 4WTZG 4ZMQA 1J05B 4R2GD 1IGIH 5DHMC 3H3KA 2WTPA 5DJDA 4JFTA 3QEUB 3QC6X 4M02A 4S11A 1AGCB 1FL5A 1I75A 1JWMA 1KJMA 3N5AA 1GS7A 1F1GA 2YN3A 4G8IB 4KOCA 2FK9A 1BMWA 1P7KA 4G42A 1RUKL 2JKXA 4NOBA 2HUHA 4YJZL 2BY2A 4MQTB 4PFEA 2IGFL 1HL5A 3VI3F 1J8SA 4J3OD 1S7QA 5EBMB 1JPEA 4X6FB 4XWGH 4XXWC 5DR5H 3WIAA 3EYSL 2Y7QA 1BQLH 5F7DA 5ABZA 1KLGB 7TAAA 3VFTB 3B2UC 3QQ4B 3Q5YA 1U8NB 1E50A 3D39D 4UQCA 1I7UB 3V4UL 1MIMH 3NMEA 2EDWA 3WNIA 4N5ED 4ZW7A 1KY6A 3RPIA 5EUKA 1C8PA 1VZIA 4YVNA 4UB0H 3T2NH 1ID5I 1JHLH 2B08A 2VDNH 3AROA 3ZYOA 1AOZA 1BX2B 4X9YA 4RMSA 1AAJA 2EINB 3MV7B 3TBTB 5A16B 5KVFH 3L95B 5LB1A 5J12C 1MI5E 1XGRB 3NJVA 1JDAA 2O6CA 4GQQA 4HUWB 1BJ1J 2QTVA 1M6UA 2BOCB 3GMPB 4GSUA 4LE8A 2XG5A 3B2UD 3SGJC 2JKRM 2HJLA 3LNGA 3V6OC 4Q9QH 4OT1L 2DQGL 4ZODA 5GGQH 5DZ9A 4EQ2A 2F54D 2MNWA 4OH2A 2YC1B 5D1XE 5KS9F 3PWUA 1WCQA 2P8LA 2B9AA 3EUUA 4R83A 2EEAA 1A7OH 4X6CB 1F2QA 2PABA 5T1KB 4WTWA 2D31B 2VZ3A 1J7VR 3RE0A 2Y06L 5AAMA 3MLRL 1E8ZA 2F74B 3DARA 3O9WA 3EFFB 5GQBA 4JVPA 3TCLB 1J87A 3KLDA 1KTJA 5IIEB 4A6YA 5TD4A 4EJ1C 3U4AA 3I6KB 1NPNA 1G0DA 1T2QL 4RISH 4ZMTA 5C0RH 2Q76B 3CG8A 3IAQA 4JANA 5I71B 2Z93A 2GKIA 4FJZA 1CMOA 4LHUB 1OSZB 2WUBL 4LLUB 2WLJA 3D3VE 4ACTA 2AK4D 1CDUA 3IRPX 4XPTH 1JL8A 2C7UB 4JX0A 3DLQR 3MLZH 1DHKA 2NZ9D 1EAQA 1NCDL 4JO8A 4U6YA 3VXRE 4QHUA 1O6SB 5IFAH 5C6WH 3TEYA 2A9AA 2JTDA 3S6CA 4PS4L 1ES0B 1H8NA 2WZPA 1AYRA 5HD8C 3HMXL 3GMMB 3IMRA 4PGDB 1JAEA 2VQ4A 3RIFK 5T1MB 1CXEA 1BIIB 5DRXA 4HEME 4AXWB 3FZUC 2IG2H 3RG1C 4HD5A 3K81A 1CD1B 3D0LA 4R4FH 4YMPA 2ZX5A 3N1FC 2FSDA 4DVRH 5EG6C 1E5CA 3D87B 2AEOA 2ZXQA 3U6XS 1E4JA 3V5HA 5D7LE 3BWSA 5E0FA 1MFAL 4D7PA 2K45A 4AIEA 1P9MA 2A2QT 3MRRB 1K2DB 2AW2A 4K0OA 4NWTH 3VA6A 4L4JA 4MNQA 4CADA 5CD5C 1ZLEA 2SODB 1EV2E 3EDEA 1KJ2L 3FZUD 1DN0B 2EYSA 3BFWA 4K9EL 4O51A 3R19A 1T5WA 4PPTA 3ZDXE 5GGRY 4Q6IB 2DQJL 3TF7C 5FUCE 1O7SA 1OGAE 1PCSA 1LXMA 1VFMA 3FKUS 5I71C 3UPRB 4W93A 4E9QA 4N9OB 1KBGL 5C9JA 4YH6A 2JQAA 4M8QA 4HFWA 1BZQK 3ZKSD 4UT7L 1PD0A 4S0HA 3CIAA 3KR3L 1LEGA 2XZQH 3NA9H 2FO1A 4WJG3 5I2IA 4YNYB 5FCUL 5L2KE 3I9AA 2Z8WC 5I6MA 1A1NA 3FAWA 4AK1A 2RJMA 3IXTB 3DTXB 4KZDL 2EEXA 1B4TA 5DHVA 2ZOKB 3HE6D 4P9HC 2E27H 4ZNEA 5TQ0H 4DAGL 5BV7B 4OF8A 5GGVY 4PJXB 2GABA 1QRNA 1TTAA 1BQHG 2YQGA 4H25A 4K94C 3NJLA 5DJ0B 3PWVA 1CG9B 2CWRA 4HIHA 4PD4K 4X9IA 1MI5B 1UD5A 3NQIA 1NGYB 3KYMB 4I9XA 3RWCB 4GRMA 5K39B 4KROB 5EC1B 1K8DA 2NW3B 1T7ZA 5I15H 1U8JA 1B2YA 4OJEH 5LG6A 3I74A 3RUGA 5IUSA 2Z7WA 3P73A 4LOFA 2NTFB 1K85A 1I85C 3OLEA 4Q6IC 3UO8B 1NLBH 1CYWA 3FO1A 1YY9C 3VWJA 1J10A 3KVDD 4J3OH 2CBMA 2CHNA 4Q2ZB 4XAKD 4WWKD 5A40E 1RZJH 3SE3C 2CMRH 1G9HA 3C6LD 4JO1H 2Y5TA 3EBIA 1T7WA 2HG5A 1ZA3A 3VM7A 4QHKI 1NGPL 4QXTB 4XX5A 2BVQB 1N6UA 4OUUB 2IAMA 5IHZA 3MX0B 2FBOJ 3SO3B 5SX4I 1L5GA 1NPJA 1BFOB 4TSBL 1CGVA 3V4PA 2XV0A 1XL6A 1N5AA 3GI8L 4RSYA 5C2BH 2EVHA 3PJSB 4NBXB 5LCVH 3VQLA 4FADA 1UD3A 4HBCL 3A67H 1HILA 5BV7C 1PAZA 4PP1C 2PXYB 3C5JB 4RVBA 4Z7QF 4KKPA 1PD1A 4CNIB 3A24A 2QSQA 2OMYA 3O8XD 3U6RA 1FE8L 1WA1X 4OV6F 4F7CB 1YUHA 1WDAA 4LSRL 5MEOB 5B7EA 1D6VL 7PCYA 4KROC 3L81A 1O6TA 4HOZA 4DZBA 5L4IA 3PP4L 1KMGA 4GUCA 2OMWB 1HHIA 2H9GA 4PJGA 4IS6B 4X8CA 5D7LB 5IWLC 5JORB 2Y6SC 4B5EA 1YEEL 2IIJA 4JGMA 3BQVA 1B4JH 1DQLL 3L45A 5AEAA 4ZO9A 5EIIA 2RFXA 1RULL 1YVLA 5E9DA 3OGOE 3IWUA 3AFLA 1K6QL 1BZDA 5C0AA 1MFMA 3WEOA 4PCYA 5E8PA 4KROD 4TQEL 3SYOA 1T2XA 2NY4D 4GUPB 4YSUA 1DBKH 1SOQA 1NOLA 3HHRB 1CGWA 4N0RA 3LS5H 2JXMB 1WLHA 2OZNA 2Y6SD 3N0AA 5D8JL 3WUWA 2MH4A 4BUGA 2FYYA 2ZWLT 4L3FA 2CIIB 3SO3C 1XDTT 3QCTH 2BSEA 1W6WA 2E5EA 2EIEA 3BO8B 5JHDE 3KLSA 3DHUA 1HHJB 1BJ1H 3N50A 2PXYC 5B3JE 2WOBA 1JGLH 5I5JA 5DMKB 3QRFM 3A6OA 4IU2A 4KJWC 2OTWB 3INOA 3AY4C 3L5XH 3RGVD 5FK9B 1AHKA 3W37A 3OTTA 1FCCA 3TT3H 5CJ8A 3SGEI 3W81A 4X5RA 4OZHE 4OGQC 2XQYG 3B3IA 4QYOA 2AEQL 2E6PA 4A67A 4K3EL 3GKWH 1HXMB 4HIIA 5F0PB 2XTJD 2LGNA 4PTTA 2CXGA 4KJWD 3TF4A 2WN2A 3DUUB 3OQ3B 2A73B 4J6RH 4J6IA 1U30A 1ET7A 4I5BA 1J0ZA 4XBEL 4BIKA 3WFCH 3RYMA 3CC1A 4ACPA 1BEXA 1RJYA 2ADFH 3K4ZA 4LVOB 2FUQA 2DYPA 3MN8A 4JAMB 4P2RD 4X6BA 1BZ8A 2N7BA 4UANA 3I2CH 5ADPL 1M42A 3PV7A 3MACH 1MIEL 1SDYA 1LO2L 4HWBH 5F7FA 1F56A 2WAQA 3C6SB 4A2HA 2C1OB 1NKGA 4AH2A 3QXDA 1YEKH 2X7LA 1I3VA 4P5TD 4Z7OE 4OCWH 5DUML 4ODUA 4Y2OA 3KPPA 3RUGF 3ARDD 4GSDH 3NSYA 4BFOA 3GXIA 1OW0A 1SYSB 3PWPA 4JHAH 1M7DA 4Y8AA 4AEIH 2HLAB 1E8WA 1IBDA 3F62A 4PWEA 4LEOA 3UJIH 1MFVA 5KYWB 3BEWB 3FOLB 4MA3B 1HH6A 4YAQB 2OI9B 4UT9H 3TCTA 5DS2A 2V7HB 2ITFA 4H0LC 4K15A 1BXAA 1U8MB 1GYVA 1UJ3B 1J5DA 2Y0SA 3LSOA 3CGTA 1D5IH 2ZKWA 2GEQA 5JIHA 3H55A 3GWJA 1OLLA 4BFEA 1C1EL 3ILQC 1FGVH 1AR1D 1LE5A 1PFCA 1L7IH 2H3XC 5KN5B 2YSSB 2YAMA 3NJFA 5EORL 4LVOC 3ZMNA 2AJUH 3UG5A 2XTLA 1PYWA 4D9LH 2IMMA 3BN9D 4N2MA 3LEYH 4TPRH 2B1AL 3GHPA 3WIFA 5E08H 1PTZA 4FC3E 4JJ5A 5AFAA 1GGCH 1QI3A 3Q48A 5EF1A 2AQ2A 3ILQD 4XXCA 5H4YA 4PJGF 3TTSA 4ECNA 2W0FA 2WZAA 5BS0E 1XGPA 3QQ9D 3MCG1 5D1ZD 1I1YA 1P4UA 3OWRA 3QNXB 5AG9A 3DO7B 4AY0A 1HN1A 5JHDB 2G9HA 3B9EA 4NQCE 3ARBA 1R3IL 1KOAA 5D70L 5I1AB 2AI0L 5IOPA 1Z9PA 2NY6B 2OMVB 4ZXBD 3TGXA 3QDMB 5C6PB 3TBYB 1TSHA 2Q8BH 4GRWF 1LEKA 2OI9C 4XPGL 1UJ3C 2GITB 3PAVA 2YUWA 4P07A 1ZJBA 3CHOA 2BO0A 1A4BA 4D9RE 4OCRL 4QRQB 2BFVH 2EDDA 5C0EB 1IC1A 4X6EA 3HC4L 1FL6A 2E0PA 3PQYA 1R19A 4UT6H 2XWBA 4ZUWB 3PWJA 1I7ZB 3VXME 1JZFA 3U4EA 1EZUA 3VD1A 1CFNA 1EDQA 4J2XA 1QASA 3UTQB 3OAZH 4MX7B 4ZOEA 3GDCA 3MSPA 4IKNA 4DGVH 1DLHA 3OAUL 5J11B 2UZPA 4DKEL 3ARFD 5GJTH 1YEGL 4ZTPH 5CR8A 4P2QA 1T4WA 1FVCB 3DOSB 5DRZB 3G5VB 5KYUB 3TESA 3EO0A 5FM8A 1JJUA 1HSAB 2WO2B 5L4FA 2AC0A 3IKCA 3TIEA 5CILL 4HIJB 4Z7OB 4IRZH 3VUAA 2J1KA 5C7XH 2NY6C 3FUHA 3E2HB 2V8LA 2Y72A 4DQOL 4JO2L 2DQIH 4QHKJ 4XBPB 2OX5B 4P5KB 5F1IB 5T3ZL 1MHHA 2QSCH 3O6KH 4KKCD 2B0SL 1EUUA 1S7VA 3F05A 4E9XA 4Z3GA 1U8CA 1YECH 3EOTL 5IHBA 4OZFA 1NFDF 1CN4A 2UUDH 4POZD 3RX8A 3SDAA 2OSWA 5DMYA 3KBPA 2B4CL 3K2KA 5TDOB 4BFIB 3UC0H 4E42A 3TWCL 1NCWH 3OKMA 4F3FB 1JRHL 1XCTA 2EDBA 2VXUH 4BELD 5KSBA 4FN0A 2VW6A 3AXHA 3HI5L 2JCCB 4MJ6B 5I26A 1UADC 3FBQA 3QG7L 4MMYA 4Z3TA 1R47A 2Q3AA 3QFGA 1EGJL 4PLNC 1XR8B 1KT2B 2Q10A 1I7TB 3CMGA 5J11C 2VLRA 2EQDA 3EH3B 4EEEA 4ETQB 3OZLA 5F1NB 4H8PA 1JFHA 4ZUUA 3VU1A 4UWQB 1HYSC 3KH3A 1M4KA 1NGXA 4JKPL 3VJ6A 5DZVA 2D73A 3ROLB 3P2BA 1DSFL 4K3JH 1WAAF 4KJYB 3P11H 1Q38A 4NO0A 2C1PA 3V8CA 3QWOB 2DLEA 3VFSA 1ZT7A 1RZ8B 2VXQL 3CFMA 1INEL 3OZ9L 4TQ8A 4V1DD 4IHOA 1QACA 4AUJA 1AGDB 2PTVA 5CU5A 3GINA 3KCPB 5FWQA 5GRJL 3MTXA 2MEJB 4J3XA 1CDBA 2K0RA 3E2HC 3KEHA 1A4AA 1NCCH 3FN9A 2C3GA 2OSYA 4ZS7L 3GIZL 4FQCL 5SWZB 3U82B 2L7JA 2GY5A 5HHPB 4OLYL 5GSVA 4KTYA 3AWFA 4BE6A 3IEAA 4HISA 2WB7A 4XC1L 3FULA 3OAYH 4ZI8A 3S5YA 1D6EA 5CEXB 3VI4B 5AVZB 3VDCA 1M6OB 5IQMA 1CLYL 2XKSA 3VGDA 1P4BH 4TN9A 2EUVA 2Q1EA 3A21A 2L04A 2O5YH 1AKPA 2LU7A 3EGXA 2X5PA 4J3TA 4BSVA 2FEDD 3IDJA 1OM3L 3CAFA 3FTWA 3HE7A 2KUTA 1OE2A 2VJXA 3NK4A 4BQ9A 4DIXA 1DQDL 1CUOA 1A6WL 3KPRD 1DBML 4HJ0C 4PR5B 2VLLA 2VDLL 4A7VA 2AXFA 1U8KA 1IGTB 2QT6A 3LKPB 2D7OA 1RZGB 3QQ3B 4LEXL 1XXDC 4YHPA 3VXMB 3BPLB 3GD1C 4W4OC 2DQUL 1NANH 1KB3A 2C7FA 1OCOB 1WHOA 3WJJC 5FOBB 1ONQB 4JY5L 1X44A 4N8PA 1IBYA 2ICWA 3VGHA 4YLCA 1RKRA 3QHZH 1GJUA 2EO7A 2EACA 3S3BB 4HJ0D 3A4FA 1IVLA 1CLOL 4GAYB 2DQTL 5D1QD 4AQEB 4DO4A 1PKQB 3NIGF 3QR1A 2BP0B 3BP6A 3E6HB 4GKSA 2CSPA 2QQLH 1CC3A 3LZPA 5F3BB 3RFZB 3NJGA 4M9OA 2UWEA 5CSZA 4CMMA 1WWCA 2OKMA 4GKOA 1IB5A 3GXFA 5C0DA 1MVFA 1CE6B 3QFJE 2YA0A 2F53E 3GBNL 4C56D 2EZ0D 2DD8H 3FQ2A 2BVOA 4NQDD 2IDUA 4HS8L 3DX8B 3B83A 5INDA 4MAZA 2RIKA 4PJ8B 2OJZH 3EO9H 5D7EA 2D3JA 1OAZL 3Q3GA 3O6MH 4MCZA 4O2FB 4PREB 4TRPH 4P2AA 3OF6A 1OQXA 3V52H 1FF5A 5B8CB 1ZHNA 2CAKA 5DGRA 5DEFA 4YDKL 3RWDB 3B9VA 2D0GA 4ZMYA 1UZ6F 3L9RA 3BPLC 4QXWA 2PCYA 2WYTA 3TFBA 3WMSA 3ECBA 5DUPL 4NXKA 1NIAA 5GHWH 5AW8B 4LMQE 1GY1A 5ACLA 2W38A 5KG9B 1LNUB 1MLCA 3JBG7 2YIHA 1AZCA 2P80D 1BAFH 4EKXA 1C5CH 1YMMD 2AEWA 5DRNA 1Y1UA 1XVSA 1ZXQA 3H4HA 5FYLE 4DP4X 3CBRA 3RFZC 2B7DT 3P77B 4QDGA 5D4IA 5KSBF 3F5WA 5BOZG 1F02I 3NCMA 4NM8L 1VERA 2YPVH 1C16B 4PRIA 3FQWA 1PZ2A 3TT1L 4FULA 2CUHA 4Z0XA 5AWNL 1UWFA 3DXAA 1WRFA 4KVCH 1GIGH 1T3FB 3DDGA 4PJ8C 1WBZB 5DURD 4Z7UB 4QRTB 1E6JH 4NO2A 1IZJA 1SXZA 2FD6L 1OF2B 4RA0C 3PGCB 2XN9A 5E0QA 4JQIH 3DGGA 1IC5H 1YEFH 4GMSL 4RQQB 1X4ZA 1KPRA 3MCYA 5ADOL 5B8CC 5E8OB 3QDGB 1TENA 5C3IA 1T7YA 1PDKB 5C0IA 3IGAB 4HKXB 1ZIBA 3F7KA 2C3WA 4FKEA 3KGUA 4FA8A 4YBHA 4CL7A 2LVCA 3OM3B 3BJLA 3D09A 3VSTA 1AGEB 3LQZB 4HYTB 5AB0A 3SKNA 2YD3A 3NABL 3PHOA 4NHUA 4ABVA 5I1GH 1LVEA 1XGYL 1Q90A 2UZYB 1TFPA 5KAQG 2APTA 5E1QA 1FNEB 4W6WB 4ZFQA 4WWNA 1ERNA 1N3NB 1JPSH 1OB1A 3HZKB 4AQ1B 3B7RL 1NM4A 1WTLA 2FH8A 5CMAB 1JVOA 2XA8L 4GEIA 4F8LA 3L7EB 4ZW6A 4K9EC 3FJTA 3POHA 4X9FA 4OF5A 4GS7B 4QHPA 3S35X 2IBGA 4XCEB 3K91A 3RIKA 1FAIH 3DVGB 1TTUA 3HNVH 3G5XB 4WGVB 4K3DH 1N6VA 1BZ7A 1TVBA 5LN4A 4NGHL 3THML 2OTUB 5CFAA 3ULVL 5FR3A 4L0ZA 4ZZKA 1GSMA 4E5XA 3SD5A 4CKQA 3FF8A 4DP0X 1MELA 2WBXA 2R69A 1FZOA 2JQMA 5F71A 1JHKL 1NGZA 4F2FA 1KJ3H 3NP4A 2DN7A 12E8L 3QUKA 4UDTA 3UBXG 1KBVA 4OAWA 3HS0A 2R0KL 2AZAA 3FT2A 3H9YA 1CICD 3CV5A 5TF0A 3VH8B 4Y4KB 1EPFA 1YG9A 3OG6B 3HNTH 5DFTA 1EEYA 4XC3L 2Y9RT 3KLHC 3NH7H 1BYOA 5KWYC 1ZVHA 4KHTH 2EDLA 4JCMA 5DMJB 1BSIA 2CK0H 2J8OA 4AQ1C 5IGXH 1LO0H 2WBJB 4FFWD 2DB8A 3MGTA 4Z3HA 3R0MA 4XCYB 4S1SL 3B9AA 4KX7A 4G8AC 4ZDHA 2FWOA 2BVYA 5IJKA 3GRWL 3OBAA 4PVBA 4AKOA 5KSVA 4HCRH 5EH1A 4JO3H 4OD1H 5DQJB 3REWA 4GS7C 3K0WA 4IMLA 4HJTA 5FYKU 5E7FA 4I1NB 1A9EA 1DSYA 4JEGB 2YMTA 2HJFB 2CDEB 1FH5L 2X2IA 4HSCX 2XFXB 1JF6A 3B5GA 5D6DC 3GMQA 3T0BA 1XV8A 2OMNA 1EWHA 4AMXA 4RFOL 3DOHA 4HLZG 2GHWB 2YOCA 4YGAB 3UYPA 3RVTD 1BYNA 1E4WH 4HZ1A 2L7UA 1HS6A 3FUNA 5L7XH 5I1HL 1CT8A 2WBWB 1AIZA 3JT0A 2VMJA 3F84A 2F1EA 1GYCA 2JMRA 4WI2A 3AS2A 1I31A 2OXHB 4WV1B 2ROYA 4Y4KC 1KTBA 4X50A 5D7JA 1P0SE 1S7SA 3GZQA 5EULV 2ED6A 1IC7H 1WVZA 2WBJC 3WEXB 1XEUA 3VG0H 3IETA 3MRLB 4JZNB 3JWOH 5BXFB 1PZ3A 3FXIC 5G5DA 3OWEA 3IXAA 1GKOA 5IJVB 2AJYH 4UNIA 3GSOA 4WNQB 5IFJA 4Y8DC 4JLRA 4Y4KD 4HUCA 2ZKMX 4TOYL 3V4LA 3TPUB 3AS1A 4WJ5A 3UBXI 1KB5L 4IOIB 3O3AB 2PR4H 3ILPA 1DYZA 1LDSA 4ONHA 4AQOA 2EUZA 2WBJD 3AU1B 3JYCA 3BW9A 3GMLA 4OT1H 4L4VE 3CZFB 3KVQA 3R7RA 5E2TH 3QIWA 4Y4FB 1DUYA 1PZDA 4G8EB 3DMMD 4XN5A 3MDJA 2N0MA 5T5NF 2BIQA 4K2UH 2ARJB 1KEML 5EOCL 3IB4A 3HPJA 4M1GH 1C5DA 3MLWL 3MLRH 4QD2E 3TN0D 1T4KB 4EIBA 4Y16B 5GZNA 1AMYA 3FK3A 3G6AA 4I18B 2V2WA 1BDYA 1GAFL 2B59A 5CJBA 5F70A 5FO9B 4UQ2B 4WV1C 2DIJA 2VZTA 1CFQB 1EAJA 4X0KA 2EDHA 5INCA 4W9DC 4Z77A 2ZTBA 5FO8A 3WUZA 3GZKA 4HIXH 2EIDA 1JTTA 1CDCA 5AKVA 5I19L 1RURH 2CHWA 3O6LL 1HAWA 1T66D 1TNMA 4L3EA 4K8RD 1MF2H 4B6ZA 5TQ2L 4TLKA 4QXGH 5E1AA 3EJZC 3PJLA 1GGYA 2BNRA 4P04A 4BFKA 2O1AA 3SOBL 4G3YL 4PJHE 4RX4D 3MRFA 4H20H 1S5IH 5JPNA 3CZUB 2TSBA 1XF5A 1MY5A 3D51A 1TO4A 3MBXL 4AGQA 4Y4FC 3CDCA 4PJAF 3LNFA 5B38A 3H9SE 4UILH 1XXFC 3MR9A 4PJCB 2YD5A 3EJZD 5FUOL 4ZYKB 2AVGA 3O0RH 3V4VL 4PJ5D 2NT1A 4QRUA 4Y16C 5IM7A 2EXYC 4I18C 4GT0A 4XN4A 4BK5C 5ITBH 2ZAIA 1AE6H 1ZE3H 1IM9D 3KPOA 3LOWA 4Y4FD 1DN2A 1E6OL 2R23B 3CVHA 4UQ3B 2ATKB 3WFBL 3HG1A 3ME0B 3ZTCC 2XVBA 4WUUA 2YPLB 3SKJL 4XNYL 2RALA 4OCMC 4E36A 4Z7VA 1TNNA 2DWSA 4LPTA 2A38A 2V2TA 2EH8L 5F88A 2EXYD 4JDTH 4JRYE 3GI9L 4PAZA 4AIZB 3AAZB 5FDWA 2L7QA 3FT4A 2DJUA 1U3HB 4G8FB 4HF5H 1FV1A 1P5UB 2UXGA 3CZLA 3V7MA 4FQLL 2PCFA 2VQTA 3KBFA 3SJVE 4IMKA 1WWWX 5GRUH 1EANA 3FUFA 2NCEA 4NZRL 1DBJL 1BZOA 3GB7B 2XWTB 4M4RA 4U1NA 4XO9A 3QJTB 3CMOL 3IBOA 5B7FA 4OZIE 3F83A 4NI6A 5E4AA 3QEQB 4XT1C 1NAKH 2ZD0A 3OB0K 1QWHA 1IKNA 3DV4B 3O6FD 1UATA 1E3XA 2ADJB 4QMEA 1OANA 1HSBB 3NFNA 2YGVA 3CSFA 2BHYA 2E74C 2K1MA 2LQRA 3K72A 2YN5A 1FFNB 3IDMB 1I9JH 1T20A 3SDXB 1XGUB 3N85L 1CU4L 3MRIA 3O41A 4HAKA 4ZSOB 1UG9A 4BCYA 4WK2B 4W9FC 1RPQA 4I3SH 4JM2D 1H3WM 3H0TB 3UZQA 4NKOA 2WGNB 4BHUA 2BY1A 3TIDA 4LF3A 2H8PB 4LVNB 4WCYL 4A55A 2G75B 2Z9TA 4ODWB 4JFSA 4HGMA 3QZPA 3ZQWA 4L05A 1PEWA 1VFBB 2VMDA 4JFXB 2QZ5A 3DX9A 4LHUG 1A7PL 4PV1C 4GG6F 3IGFA 2WKGA 1GHFH 2VDKH 4GKZA 1U3HC 1TETH 5EZLA 5IMOB 1OP3H 3GI8H 2VQ1A 3KGTA 3QUYD 1P5UC 4PB0L 2YAPA 2OZ4A 2CKBH 3GSRA 1FQ9C 4J8QA 1XTMA 3BFQG 2GTQA 2P5WA 3AY2A 3CH8A 2UVFA 1HIML 4BRVA 3T0WA 3NRFA 4UOW0 2YKLL 4Z76B 5HI3D 3GO1L 4ABWA 4PJHB 1MHPL 1UZGA 2FBJH 4FS0A 4MMXA 4EI6A 4PGEA 5JHLL 3NJXA 3HZYA 4NKQB 2VKXA 1DQKA 2JKIS 3TO4B 4ZMOA 1ADWA 1HHHA 2Z6FA 3QHFH 5HHMD 1T1ZB 3MODL 1DJXA 4N2FA 3PWNB 5DJ6B 2V9TA 1SY6A 2HYMA 3I6GB 1AG6A 1ICTA 3S0PA 1OGPA 2GJZB 3A6BL 3I50H 3PHSA 5CXPA 2QPUA 4LVNC 1I1AA 4F8NA 3V55A 2J2ZB 4QJ5B 2CRIA 1WZKA 4FQXC 3RX9A 1W0WA 4AM0B 1RUAH 2QSTA 4P4RA 3C6EA 1LO5B 3BQUA 4NKIL 4H88L 2VRQA 5JR1H 3HKZA 1FHNA 4WI0B 1OKEA 4GXUN 2HT4C 1K72A 1WCBB 3BUPA 4K8RH 3RILA 3K6OA 4LCYB 2LT9A 4N1HB 2EDMA 3S2AA 5EU5A 2GFBA 4HAFA 2PTUA 4FTVE 1FYTA 4R7VA 4KQ3L 1MWAA 2OJEA 4H26A 4JRYB 2IH3A 3GS7A 4JZJB 3IPBA 4FQXD 2B4CC 3T8XB 1TU2A 2IDTA 4DEUA 1U8IA 2BWDA 3V0FA 2CQVA 1SBSH 3IPEA 1B0IA 3FUDA 3WNLA 2MQ0A 3SE9L 3QIUA 3UIZA 3MOBH 3K1DA 1G7HA 1AXTL 4QF1A 5AUMB 4WTZA 5E23A 5T3ZD 1KIPB 3H9HA 3TO4C 3WFEH 4F8OA 4OZIB 2VL5B 1MFCH 2CGRH 2GJ6E 5E94A 4I77L 4ESKA 2QV4A 5I8EB 1WIPA 2GTWB 3S8GB 4RMVA 1B4LA 3QNFA 2ZX8A 3PAUA 1T6VN 3H56A 4PJDB 1URIA 4PJFE 2DQDH 3ZDZE 2J25A 3LXUX 4X7DC 3VNZA 5BJTA 2X1PA 3GSVA 2WVVB 3WY2A 3CZKA 4UTBL 4P5MA 5CGBA 4A2GA 5IBLC 5GRXG 1A3QA 4PRHA 3DHJA 5DRWA 1A6PA 5D2NB 4G9FA 1MCWW 4PWHA 2AMUA 3WD5L 2NY2D 4KXCA 1T03H 2FL5A 2BP3A 1MJ7H 1CE1H 1I8AA 4GMTL 4RFEB 5CZKA 2NXZB 1DCLA 4LCIH 2AV7B 4BFFA 5IBLD 3CN1A 4NT6B 3IVKB 4D7BA 1PCXA 3HBQA 1OSYA 5DVMA 1XR9A 7PAZA 2W07B 1R24A 1JS4A 3WKQA 3BKMH 5I16B 2I7OA 3EO1B 1N8ZB 3FTUA 5SWSA 1ACXA 1QG3A 2IC2A 3GJFA 4OKVB 1BECA 1GPOL 4DGYL 2H2PC 1CYGA 3KHQA 4MNQE 5GGSB 3LIZL 3FQRB 1QW9A 2AFNA 4NNXA 4KNUA 4XOCA 1OARH 4R0LB 5IHLB 4AG4L 1JPFB 5DJDB 4XH2A 4JFOB 1SOKA 2NY5H 2HZHA 3OJDA 4BKLB 1IQWH 3NSDA 1P7KB 1UVQB 4OFYA 1UA3A 4OLWH 2GK2A 2B1AH 3W11C 1QSZA 4JHWL 1CI5A 1R75A 4FYSA 3CIQA 5LJYH 2Q0ZX 2FJFA 5D2NC 4MLIA 1GXEA 1WBYA 5DEJA 2PW1B 4F15B 2N7SA 5JXEA 1A3LH 1EBAA 5LBSA 2FX7L 5F7DB 3CLEL 4WWID 4GBXD 5GGRB 5C71A 1FNLA 1KBPA 1FSKB 1K5NA 2NXZC 1IGJA 1W8OA 2D7TH 2ZWZA 3M17B 3MV8A 4FQ1L 1LDPH 1AZNA 4FTVB 5LAXB 3RPIB 4EN3A 5KVGH 5BRPA 2BMKA 2X38A 1KYDA 1AO7D 4PW3A 1ZPUA 1KPUA 1QRNE 3BVXA 5G4NA 1DP0A 2IANB 3PAYA 2KLTA 1IL1A 1G7JB 4P5SA 4H5SB 1SN0A 4XPGH 4QOKB 1FZKB 3QWNA 3VXOA 1ED3A 1F4YL 5D5MB 3MJ6A 3W9EA 2HJLB 3B2PA 1BZ9A 1Q9LA 1TCMA 4U3SB 3ZE1B 3KLLA 1TYEB 4R0LC 1NGQH 3RUGE 5FV2A 2GJ6B 2J4WL 2NNFA 3VXSB 1UXWA 4PJIA 4HFUL 3ZL4H 2F1BA 4L29B 3K6NA 3D18B 3VXTA 1DVZA 1Q9OB 1X5IA 2W81C 4FFYL 4AYDC 4PJ7A 2WUCH 4PJFB 3E3QC 4CILA 1JZGA 3IDXH 3ZDZB 2HUEA 1ORQA 2Q3XA 3E0GA 4A6YB 5KW9L 5KSUA 1LK2A 2WLIB 1YN7A 2Z31A 5HGHA 4D0BB 1ZMYA 4F15C 5HYSB 1LWRA 1M56B 4D3CH 1HNGA 4OFIA 4TQHA 4CBPA 2VZ1A 4S2SB 1RJZB 2MIZA 5ABAA 2DLIA 5GS3A 4R5VA 1XIWD 4KI5F 1FSKC 5I6XB 4RRPG 2KT6A 4MJIB 5MP6L 2NY3D 1RCYA 3VXQB 2W0PA 4KKQA 1RU9H 4AL8H 4NERA 3KWVA 2DKUA 5EN2A 1OCRB 1BQHA 2LU5A 5JO5B 5LDUA 3ASWA 3ATAA 3BDYL 2FJHA 3O11B 2HTKC 5G55A 2JNZA 1I3RB 3U2IA 2B0SH 4QGYA 4X7SL 4QTFA 4RMRA 5F8QC 5F96L 4DP9X 1HEZA 5FOJA 3EOTH 3UPCA 4G5ZL 1U2YA 4L2YA 1HXYA 3ML8A 4R7NA 2HWZL 4Y19A 1OTSC 1PNDA 1MUJB 3D85D 1A7BA 4NKDA 4ZQTA 5BRZB 5HYQA 5HYEA 3OR7A 3UFIA 5IBTL 3VD4A 1ZT4B 1F3JA 3MUY1 5KYNA 3HC0A 1ETZB 5E9DE 3BOVA 1PD6A 5FGSA 4Q9RL 2R1WA 3PP3K 4QOKD 5IVZB 5IP4A 5CJQH 1JGIA 1JN6A 3GS0A 5CO1A 3P4OB 4C47A 4DNLA 1NDMA 3LNHA 1BVLA 5JXAH 3VXSD 5GSRB 1D5XB 3R8QA 3EOYG 2YA1A 4BK4A 1PG7H 4R8WL 1UH4A 3UXFA 4X42A 5I6XC 4M8QB 1INEH 1G87A 1IGFH 4A68A 1MREL 2IBZX 4W6XB 3X1BA 5A3IC 3ULVC 1YNTF 1DL7L 4OFKA 2VERA 5ACZB 5FX3A 4LL1A 3U0WH 4HHAA 4EZJA 3MUHL 3W2DH 2AQ1A 3CE1A 4NZFA 1DLFL 4EUPB 4IDLA 5HJDA 5BOJA 2DLFL 1BXXA 3ARUA 4M61B 2PPCA 1YJDL 4XC1H 4Y7OC 4CC0A 4J1UB 1IU1A 2NY1C 2ZWKA 4AYEC 3IE9A 3C5ZA 1H3PL 5SX5H 3ULVD 1QLFB 4RAVA 4FMVA 3U83A 3DX6A 2E7LA 4F7EB 1NCUA 3QAQA 3NEOA 4KX8A 3TJPA 1A3RH 4RIRA 3HN5A 1UGKA 4HV8A 4Q52A 3N1GC 5TGBA 2FVNA 4Z78A 2X3CA 4NQEE 2NY1D 3OLDA 4KTEH 5E99L 4TNVF 4N6RA 3JZYA 3WS6A 3QYMA 5BRZD 3HG5A 5C0BB 4CSZA 2PCPA 3MRGA 1I8KB 4LRIA 3SQBB 2WMPA 3BZFB 4F37F 3VWKB 1KB5B 4S1DC 1I4FB 5BMFL 2HKHL 1SMAA 1DBBL 4XNQB 4XCFH 1L6XA 3U9UA 3PL6D 4FCHA 1ZA3B 3F7YA 4PWGA 3ARGA 1VPOL 5FYKE 2HRHA 3STBA 3Q9PA 1LO3H 4NUJA 3KPQA 4NC1E 1LMKA 4PWJA 1JV2A 3T65B 1EHAA 1UCBH 3K3QA 1NC4A 4HD9A 4OGXH 1N5AB 5D7KD 4L4TD 2CLZA 2CO1A 2GT9A 3DX7B 3FB8A 3PWPE 4HLZH 3ESUF 4AMWA 2XQYA 3AQXA 1G7IA 3DETC 4ODBD 5E5UB 5F9OH 3U7WH 1MJUL 3ULUL 1SPDA 4CJ1A 2CBQA 1MVUB 2OS7A 1T89A 1Z9MA 3DPBB 3CXDH 3IMVA 4FFZH 4LCVA 5IV2B 4WFHE 15C8L 4M6ML 3EAKA 5T1JA 1ASQA 5EZOL 3Q2VA 5FECA 4JFDA 1AC6A 3VE0B 4OD3L 1NCJA 3DRQA 4LLQB 4JG9A 3HMWH 1SFHA 4BA0A 2DWDA 2QJDA 3Q8EA 4XZUA 1N5YL 3PGDA 5HGAA 4KXZH 1AANA 1AFVL 1P6AB 4ADJA 3O3BA 5ESAA 4Z6AT 2OMTB 5ID0A 4ODVL 2CNYA 1ZLWH 3AGVA 4J3SA 2KDYA 4YDMA 4XO4A 3ZMEA 5HHVH 2X70B 3P9MB 4ZOAA 1O7DC 1DANU 3QWRD 4QRPD 2K8MA 1IILE 1KBBA 4W9EC 3VWKC 5K69A 4I87A 3FRUA 2YLKA 5M7QA 1QHPA 2HTLC 4U7SA 5MI0B 3AG1B 2HJKA 1UA6L 4EE2A 2VCOA 1QFWL 3Q5TA 4R90H 4HWEL 3PWLA 1MW2A 4I1RA 1H0DB 2ZUYA 1W8EA 5ESVB 3HS9A 1IEBB 2Q2LA 1Z5HA 4XRCB 3V4VB 3RU8L 4MA8H 1AI1L 1EJOH 2YZ1A 3K8LA 4I4WB 4B3VA 5DJ8B 4HS3B 4IU2B 5FIEA 1R5WA 3DX3A 1FFOB 3J07A 2QR0B 4J8RB 4JS7A 1D9KB 1TJHL 4FHKA 3QNYA 3V0DA 3ULSB 3ARWA 2D7NA 1OT4A 1P1ZB 4O02H 4ZPTA 4Y9EA 4ZTOL 2FLRT 3GMOB 1TKWB 1U92A 1AD0B 4M7LL 5ENWA 5CGTA 4AGOA 1TJIH 4OZ4A 2H7WA 1C5BL 3X3FL 1NEZB 3PQYE 1TTRA 3VFRB 2G0KA 4GQ9H 2XQ0A 1MCKA 2F7OA 3NJJA 4HGKC 3CXHK 3WL9A 1OK0A 5LBVA 1OSPL 2BLFA 2W60A 4MAYB 4OGYH 1F00I 4X7TA 3CVCA 4XNZB 3RAJH 2F7RA 2XXCB 3W38A 3VFWA 3K46A 5ISZD 4NQEB 4NEHB 5HDLA 3MREB 5EFIA 2W88A 4UIMA 1FO0H 4JPIB 3S7GA 4NHCH 5MI0C 2YRBA 3CN2A 4KKAD 1JZ6A 1H5BA 5B1JA 1TEGA 4N8VA 4FKKA 1SJMA 5IVOA 3ZN6A 2XA8H 2IOMA 1RAMA 5FW7A 2WCSA 1EFQA 1G9NL 5KSAB 1JIBA 5I18L 4JE4B 3GS4A 1X5KA 4XBMA 4DPBX 5HYJB 2CCWA 3BP4B 5IZ7A 4M7KH 1DJHA 5GZOA 3UERA 1H9DA 4XNUL 1JYXA 1RI8A 3NPSB 1INQA 5FUZL 1D9KC 2DM7A 1W72H 3INUH 1XEDA 1DQML 4NGHH 5IB5B 5L9DH 2HAZA 1IE5A 1P7QB 5D1XD 4MVBC 1NZRA 2AVFA 5T1LD 1A6TB 5ECJE 1VGKA 4Q89A 4LQFH 3CVBA 5J1TC 2VC2H 5KSBE 3V9EA 3ARVA 4WQOA 2DWEA 2GHZA 3RNKA 2X4RB 5HHNA 5DK0A 3RTQA 5IB2A 3QS2A 2DDQH 3T6XA 2R0KH 4MAYC 4JFPA 4XNZC 2E7CA 2VLRE 5JUEL 3ZR6A 2DMBA 4ES8A 4QAMB 2DQFA 3O45B 3JVGA 3C87A 3IMBA 3MCKB 5IR1A 2HG0A 3GSUA 3OHXA 2ZP8A 1HI6B 5T33L 4LAQH 4PRNB 3TA3C 3QXTA 1E43A 3EHBB 1FNSH 1ZKAA 4LCCC 2YUZA 3I75A 4HQQH 5CLZA 2UYLA 5GGUB 4FNUA 5IHUH 2CRMA 3QO1B 5GS2D 5IFHL 1EAPA 3UCQA 3GSQA 4JJ5B 4QXVA 4MMZB 3K6FA 5F21B 3V0JA 5KSAC 2C9VA 2X4TA 1PQZB 5JA8B 2ZNWA 1UT1A 2Z91A 5TDNA 3NPSC 2AEPL 4KJPD 3HKFA 2J1WA 2JE8A 4A2MA 3TA3D 2EXSA 5J6HA 5HHOB 3U1SL 2XQBL 3U36A 4AGLA 4DW2H 2C3HA 1KNOB 2HVKB 2QV2A 1A1MB 1ODAA 2I5YH 3L3HB 5DDHA 2A83B 3U46A 3UGUA 2R0ZH 2YPKA 2VR6A 1X4XA 1T22A 3SIKA 2FT7A 5MERA 2DKSA 1SBBA 4MBOA 4TVPE 1N59A 4NM4H 3ARRA 3VTAA 2VNCA 1OGAD 4XP1L 1LP9A 1OAYL 4NJ9H 5C0JB 2V5YA 4LP5A 3FTGA 2X10A 4BKSC 3U4KA