1YSOA

Yeast cu, zn superoxide dismutase with the reduced bridge broken
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
153
structure length
153
Chain Sequence
VQAVAVLKGDAGVSGVVKFEQASESEPTTVSYEIAGNSPNAERGFHIHEFGDATNGCVSAGPHFNPFKKTHGAPTDEVRHVGDMGNVKTDENGVAKGSFKDSLIKLIGPTSVVGRSVVIHAGQDDLGKGDTEESLKTGNAGPRPACGVIGLTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YEAST CU, ZN SUPEROXIDE DISMUTASE
publication title Unusual trigonal-planar copper configuration revealed in the atomic structure of yeast copper-zinc superoxide dismutase.
pubmed doi rcsb
molecule tags Oxidoreductase (superoxide acceptor)
total genus 39
structure length 153
sequence length 153
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1995-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1ysoA00
1UXLA 1SXZA 3KH4A 1F1AA 1F1DA 3CQQA 1CB4A 5KBKA 2AQSA 4A7TA 1Q0EA 1BZOA 1YAZA 1JK9B 1PZSA 3KM1A 2Z7YA 1IBBA 2VR8A 1KMGA 1SXNA 1XTMA 1TO4A 2VR6A 2XJKA 1SPDA 1E9QB 1FUNA 1SOSA 2Z7UA 1AZVA 4OH2A 2NNXA 4BCZA 4A7VA 1Z9PA 4BCYA 1UXMA 2WWOA 1MFMA 5KBMA 1PTZA 1Z9NA 2Q2LA 2GBUA 1SXSA 3QQDB 1L3NA 3KBFA 3RE0A 1ESOA 4U4IA 4BD4A 3GTVA 1E9OB 2C9UA 1B4TA 1OEZW 2WZ5A 2AQNA 3MKGA 2AQPA 2E47A 2R27A 2WYTA 1E9PA 1QUPA 3KBEA 2C9SA 3S0PA 3GZPA 3HOGA 1IB5A 1P1VA 3KH3A 3K91A 2ZKXA 3F7LA 1SDAB 2E46A 4A7QA 2AF2A 4N3TA 2WZ0A 4B3EA 3L9EA 1RK7A 2ZOWA 2VR7A 3KM2A 1PU0A 1SXCA 3H2PA 1SXBA 3GZOA 2WYZA 2GBVA 1DO5A 1N19A 2SODB 1TO5A 2V0AA 4L05A 1OZUA 2Z7ZA 1JK9A 1SRDA 1OZTG 1DSWA 1OAJA 3ECWA 2ZKYA 2AEOA 3F7KA 4MCMA 1OALA 1E9QA 3LTVA 2Z7WA 1IBFA 1N18A 4MCNA 4OJAA 3GZQA 1EQWA 1F18A 1JCVA 1SDYA 2JCWA 4FF9A 4A7GA 3QQDA 4A7GF 2AQQA 1IBHA 1HL5A 3GQFA 1EJ8A 1B4LA 2WKOA 1XTLA 2WKOF 5CU9A 5KBLA 2APSA 1E9OA 3ECUA 3T5WA 1BA9A 1XSOA 2LU5A 1SXAA 3HFFA 2ZKWA 1E9PB 3CE1A 4A7UA 1HL4A 4N3UA 3MNDA 2XJLA 1YSOA 1S4IA 3GTTA 3PU7A 4A7SA 2K4WA 1IBDA 3CQPA 3H2QA 1YAIA 2AQTA 2C9VA 3L9YA 2GBTA 3ECVA 2JLPA 1F1GA 2WZ6A 3HW7A 3SODB 1U3NA 2WWNA 1COBA 2AQRA 1CBJA
chains in the Genus database with same CATH superfamily
1DQMH 4HX1A 4O5LL 3QDMB 4R0LC 1Q0XL 4TNFA 1OAUL 5DLMH 3E6HA 3SPVA 5BCAA 5FA3B 2K0RA 5EU5B 1KSRA 2FB4L 1XF2B 2OI9B 2VXSH 2EADA 5SWSD 4HJUA 1IE5A 1I3RB 1AI1H 5KS9E 5T3ZL 1Y18A 3HZKA 4RMTA 4OLYH 4EDXA 3L2NA 2JK5A 3BAXA 2H0PA 2IEPA 1K6QL 3BUYA 4OSUH 4Y4HD 5EV7A 4WV1B 1K3IA 1AGDB 2WLNA 3LSOB 4M6OH 1QPXA 3KPOA 1U8JB 2A7BA 3EUUA 5KYUA 1HXMB 5I1GL 1KXVC 4MMXA 3HRPA 7TAAA 2V8LA 2IWKA 4FX5A 1JXKA 1EJOL 1QUPA 2DIEA 1CFMA 3NA9L 3RWJB 1ZVSB 4LU5L 4MVBC 3WBDA 3RBSA 1R46A 4RQQA 3PAYA 2NYYD 3HE7B 5B4MD 2ZSVA 3HPLB 1LK2A 4P5KB 2O61A 1NIBA 1FVCB 3O3EB 4QRPA 4DKEH 3MOAL 1KT2B 4M1CC 2XX1A 1MHEB 3NIFB 5E2TH 3DX9B 2ITCA 3DVGB 3LNDA 5IJVB 4CW1A 3ESNA 4M5ZL 1N0XH 2PTVA 3UIZA 3BKYL 1EJ6A 5HHVL 1E4JA 1YJDC 1N64H 2DI9A 2Y72A 3APMA 3RU8L 5C3IA 1U95B 4PLKC 1IFGA 1E90A 2RCSH 3I9AA 1U91B 4Z7QB 3PF2A 1NUFA 1PSKL 2IAMC 1DQVA 4JM4L 1H19A 1YUHB 4Z7UB 4W6YB 1JNJA 2R15A 2XG5A 3TXAA 1I8KB 2EYRA 2L8AA 2LU7A 5GS0C 3PNRB 2Y1ZA 3N1GC 1H3WM 3ARGA 2ZKHH 1EJ8A 2BP8A 3FULA 5EF2A 1M7DA 4A2DA 3BKMH 2XVGA 2HX8A 1JZHA 4HVBA 1ZXQA 3S96A 3RLSA 3X14A 4M43H 1J05B 1NDMB 3LOWA 3H0TB 4XXDA 1I85C 5E8OA 3SDCB 3MN8A 4QRUA 2A6DA 3VXQA 2CA4A 4O02A 4OB5H 1YEHH 3KXFD 4KO6A 4UT6H 3U9UA 4F1SA 2AJUL 5AAWC 3BQUA 1ML0A 4NUJA 4S1SH 1AQKL 3RZWA 3VXMD 3P3SA 2PCPB 5EIVA 3SO5A 5KW9H 3QZPA 3PGCA 3QIUD 1EHLH 4JNXA 1T7XA 3LVTA 1LQBC 4X7TA 1JTPA 5DEJA 2H41A 3VGDA 3MRBB 2YD1A 3QQ9C 1BPLB 4FKHA 1MXDA 5KVGL 3FQUA 3A3YB 1UURA 4F9PA 1MUJB 2CCLA 2ZONA 1O7SA 4A6YH 2VDOL 3EO1A 3L95A 3RILA 5E6RB 1M42A 2GY5A 3ZE0E 4OJDH 2JTYA 5FLUA 1BDYA 3M07A 2AEIT 1OSZB 1A6UL 4OF3A 1KTBA 5A2JH 3DUSB 1T7YA 3PGDA 3TTSA 2Y5TB 4BFEA 2V2WB 4W9KC 1WVZA 2WLIB 5BUAA 3K6DA 3ARWA 3QPQD 5ICZA 4JW3A 5AOMA 1F4WH 2JCCB 3BAIA 3F05A 4M93B 4W9FC 5LAXB 3SGJC 5L2KD 2P8LA 1GS7A 5D6DC 3HE6D 4LSTH 2IG2H 4PGDA 5ILTH 1ONQB 2H1XA 3SE4A 2QR0A 4LPXA 4RBPK 4UNVA 3QH3A 1S5IH 2JJSC 5BS0E 4AIXA 4HHGA 5ANHA 2XZAH 5HYSB 4AVIA 2HFFB 3CD4A 3FNKA 5AL0A 4LASL 4WWKC 1I1YA 4JZJB 3CSTA 2VL5B 4PJ9C 5C86A 4E41D 4JHVA 3FQRA 1KCRL 5C0JB 5E6IA 5DQ9B 1UASA 4XPBL 1DO6A 1WBZA 2PUQT 3TWCH 4FG6C 4X5PA 3UTTE 3NEEA 2APBA 5D1QC 1RJZA 2Z35B 3S5YA 1RZJL 2A74C 5D7JB 1HL9A 3NQIA 1NDTA 1XH1A 2BVEA 2VWEC 1A14L 1T66D 4N8PA 1CR9H 3AXLB 1KFAH 2W91A 1MFAL 1MNUL 4LSSH 4PRPA 4ISVA 2NY5C 3STZA 1H3VA 1SHMA 2P8PB 3ARBB 5DJDB 5E1GA 4NQSB 2YUVA 3FF7A 3MJ8A 2H3NA 1G9MH 2OMUA 4DTGL 3QEQB 4D3CL 1RZQA 1TENA 2OX5B 1CL7L 4S10A 2VZOA 4KJPD 1IC0A 3WXWL 4PLNC 5JOFB 1TTUA 5IJBC 5AW0B 2KYIA 3GSOB 4IKKA 4YFLI 5F7HA 3W0WB 1F6FB 2EACA 1I7TB 4TKWA 1IAII 2VNCA 4K7PY 1KLUA 1I8UA 2FX7H 5D9SB 4YHZL 2G75B 1AXTH 5C70A 2GHZA 4JQXA 2BHFA 3HFFA 1IUZA 4WU7A 3ZL4L 4HS6B 4UT9A 1FNLA 4EE2A 2W88A 3MBWB 4P2RE 4M1DH 5FX3A 4F7CA 1PLBA 2BM3A 2KS0A 4JGNA 3F83A 1FLRH 1G1YA 1T5XB 1VGEH 1W0YT 1XX9C 5D1XD 2R4RL 2YS4A 5FDYA 2X10A 1J1XL 1EBPA 4K8RH 3ZN6A 1NKRA 1YMHA 1AIFB 4RFNB 1NEZB 2WWNA 5D96C 1JHTA 4WI0A 2H6UA 3M45A 5IB5A 5J57B 4XE0A 4GSRA 3L3KA 4ZS6D 5IHLB 5M94B 2DF3A 2LT9A 5HHMD 1LMIA 1KACB 2DBJA 5I73C 4MAUH 5C3LD 5DJZB 4OQ1A 2DD8L 2ZPKL 4K7FA 4UDUA 1ZGLM 1XQ4A 2MCMA 4Z77B 1K4DB 1UZ6F 3HTLX 1FUNA 3SBQA 1CLOH 4HKXB 4XOAA 4FD0A 43C9A 2X4RB 4DUXA 3U83A 1UWXK 5HJBA 2FVNA 3RWFB 3SDYH 4FQXB 5CZRA 1DJXA 4RGMB 5CFAA 3LQAC 1QRNE 3T71A 2VW6A 1LP9B 1E9OB 1ZT4A 2YD0A 2H9GB 1W72A 3BSZL 2FBJL 5C09A 3SZKC 4APXB 2WBJC 2IAAC 1V27A 3FCTB 3J7HA 1KYFA 4N22A 1YC7A 3VFTA 2NY2D 5FYKL 5B38B 2VIRA 2IPTL 4FFZA 4PB9L 1UWGH 5FO7B 2FX8L 3V9FA 3JYBA 1E50A 5JW4Q 4WIQA 4WHYH 1XWVA 5SWSE 2DQHH 2DDQL 3OKLA 2FNBA 4KDTA 2QGBA 2F61A 3JT0A 1YEEL 4U7SA 3VVVA 3GKZA 1W0VA 4AEEA 5KYXB 1TQBB 4RRPM 3KM2A 5TF0A 1KXTB 3FUJA 1E2ZA 2DWTA 5HDWA 5D5ME 1JXDA 2ZAIA 2F5AH 1MLBA 3IGAA 2JH2A 4PJ7F 3CZJA 1J0HA 2BC4A 1SDDA 2WQXA 4CAGA 1I8MA 2OAAA 1PMYA 3BUIA 5A2LH 2E7LC 3BVNB 1ADQA 3RAJH 4HS8H 1MJ7H 3FTXA 1I7UB 2UWEB 3GBDA 1RZKH 5AVTB 2AXFA 3P1VA 3TVMB 1CG9B 1PEZA 1HOCB 1PYWA 4F9LA 4HUWA 4CSSA 4FFTA 1IKOP 4OZIF 1F00I 1XGPA 2WKOF 3PWUB 3OAYK 1GIGL 1I9JL 3ARZA 4WHCA 3SCMC 2IC2A 3ZYZA 5IQ7H 3TPKA 4KK8D 2BY3A 4NPYA 5ENWB 4Q0XH 4YDNA 3VSQA 1L6ZA 1LEKA 2GABA 3O9WA 4PJ7A 2E3VA 3MBED 1FNEA 4OLXL 1DEEA 3M6DA 3O8XC 5GRVK 3RY4A 2CJUL 4C4KO 2AQTA 1SVCP 1JPGA 4JJOA 3TA3A 2W95A 3UO1L 5A6IA 4RDQF 2MPVA 3TJHC 4H1LH 4OZIA 5IEKB 3D9AH 2JIXD 5LNDA 2F5BL 3NSYA 5D7IE 3IPBA 1QW8A 3OXSB 5CXPA 1YPZF 1YQVH 3QAZC 3UAJC 3ZDZE 3WTWA 2EUVA 4PJIF 3RL1B 3R1GH 5HVHC 4K23L 1NANH 2FWSA 5HGDA 3TEYA 1L9OA 3N42B 3C2AH 4LAQH 3TJEL 4G82A 4JDEA 5HI4D 1SYVA 3TO2B 4L3EA 3FUHA 1TITA 4KX7A 1QFUL 3KXFE 2KPWA 3RGBA 1KTDA 3KGTA 4M4RB 5T1DL 2XTLA 4NKDA 1BFVH 5ALBL 5CGBA 2WQSA 3RGVD 3VXME 5CSZA 4BE6A 4QT5A 1XL4A 3QJHA 3APNA 4M3KB 1Q72H 2DLHA 3CZFB 1KN2L 4W81A 1SMOA 3WKNA 2JKWA 3GGWB 2H32H 3BI9X 4Q9CA 5KANI 4F2MA 2EAEA 3OZKA 4JFDE 5DK2B 1IIIA 4PJIA 1DLFL 1DL7H 2AZAA 1HIMH 3AM8C 4OI8A 2GUOB 5DVOA 1U8HB 1WIUA 3GRWA 1EAOA 5I1EL 3BJ91 5HYJD 5F6IC 3PJLA 1ID5I 4HLJA 2DMBA 3IJEA 1RUKL 4LLYB 4B95C 1A4CA 2QPFA 4ETQB 1SJHB 2DB8A 4MWFA 1BZ9B 2J57A 2C9QA 4OKDA 2BRQA 4HZLA 5D4HA 4H13C 2NY1D 5L2KE 1A1MA 3KLSA 5HHPB 3BAYA 2CE6A 1I9RH 3CZSA 1V7ML 5E23A 4PV9B 2VSMB 2R1XA 4KH2A 2AEOA 1XB8A 3HMXH 5GGVY 1NGQL 2ENQA 4JM2C 5ESAA 1AKJB 5C6TL 1UCBH 1V05A 4IRSD 4HXAL 1IBFA 2WLKA 1KJVB 2PP9A 5C9KA 5IKCA 2Y6SC 1FNSL 4E41E 2ETWA 5I17A 2RIKA 2VO5A 1HL5A 1JHLH 1KDJA 3GQFA 1HWHB 3JV6B 5EIIB 1YEIL 3TIEA 1D9KC 4UINH 2EDHA 4NHCH 4U6HA 2YRZA 3BVXA 3F12A 1SEBA 3IDUA 1J9QA 3T08A 2HH0H 1A0QH 1MFDH 5EN2B 4LMQI 3VI4F 1P7KA 4NWTH 4NP9A 1TZAA 3FTSA 3B5GA 5I8KL 1FZOA 5C0AA 5ICYA 5FHBH 4AQ8A 4AGQA 2GTWA 4J4PD 1BZQK 3FO2B 4PW3A 2PO6B 3T6XA 4ZDHB 2ED8A 3WEXA 5DRXA 3H9SA 3AB0B 4U1NA 1FVDB 2DL9A 4ZK8A 3DIVA 1YJDL 1YEJL 2V5RA 1X4XA 4U1KB 2AQRA 3LEXB 1S7UB 4ZXBD 3Q9QA 1AANA 3DKHA 1MFNA 1E4WH 2VISB 3Q48A 3GLEA 4X50A 2V17H 3N43F 2G5BB 5FGRA 4R7NA 5LNEA 5I1LA 3IU4L 5CP3A 3N1PC 3VI4A 5L88L 6TAAA 2XPGB 1YEFL 4LQFL 2CDEA 1JV5A 4WTXA 1QLRA 1EANA 4P46A 3B43A 3EGXB 3VG9C 3C6EA 2BS9A 5GS0L 4XCFL 2VDRB 2YA2A 4LKXA 4JFSA 1YN7B 1M2VA 4WUUA 4OZHE 5D1XE 2BS8A 5GGUB 2VLKB 5EOTA 1S9YA 2IOIA 2PN5A 5ISZB 2D7TH 2WNKA 3HRZA 3OZLA 3MGOB 4CL7A 2EVIA 3IETB 2VR4A 4FJ6A 3MLTB 5ERWA 3WJMA 2VLRD 2GJZB 1LO4L 3NIGB 2YJLA 5KSVB 1HSBB 2OMVA 5ES4B 3LIUA 3FRUB 3TZVB 2A99A 2G2RB 3QJFB 3LZPA 4G59C 2KL6A 1G6RA 3P2TA 3MGAA 2FT7A 3O2DA 3PHAA 3QNXA 1YDPA 5D6CB 5KSAD 1Y0LB 1TZHA 1TETL 2D2CC 1U92B 3T2NH 2J8HA 3D12B 4N3TA 3O6LL 3ZE1F 4OF5A 2B16A 3EJUA 3L9EA 2A6JA 4NBXB 5EWIH 2K7QA 2QMKA 3LS5L 1C5CH 3U30B 3VGFA 3H2PA 3N41B 1FZJB 3T8MA 3ZTDC 5J3HD 3GNMH 1KIQA 2YKLL 1J0ZA 1DBJH 2NTSP 1XIWA 4KRLB 4IMKC 4X0KB 1JXJA 1MZZA 2I5YL 1S7TB 2HJKA 3INUH 3TN0B 4DJMA 1U8IB 3NAAL 3T0BA 4LF3A 3T65A 2DIJA 2X09A 3AAZA 1EVUA 1KPRA 1DVTA 4ZSOE 1YEGL 4UQ2B 3CDYA 4ANWA 1KGJA 3DBSA 1MCHA 5HGBA 1WS8A 3LXBA 2N1TE 2F58H 2ARWA 3APCA 3DX1A 4UTBA 5B3NA 4KAQL 2P7TB 4PD4K 3EGSA 4G6FB 1FSKB 5D8JH 5K33A 2A0LC 1BBJA 5CLZA 5BQ7A 1DVFC 1OM9A 3FF8A 1HNFA 1MJJB 2EE2A 3V5DA 5DC2A 4EUPH 3S88L 1BOGA 3UXFA 1NCAL 1TZGH 5KS9B 2CUMA 4PLOB 1RZGA 3U7WH 3ECVA 3T6VA 1GMEA 4FQ2L 4XRCA 2EEBA 3T8XA 1B2YA 1M1SA 1NFDF 4DETA 3Q06A 3L81A 3UBXG 2VUYA 4BK5A 1NC2D 2NY5L 1DR9A 1TCRB 3O4LB 1JGEB 5JXEC 5LWYH 4NXKA 4OF0A 4GMSL 4DP5X 2ROXA 1CTOA 1VAHA 2AVFA 2OR9L 1QR4A 3CFEB 4NQED 4P5TB 4YHNA 5K93A 3MFFA 5FF6A 5JHDA 1B6DA 2XC8A 1PX8A 9PCYA 1ZGLP 3JZ7A 1N7MH 4XMKH 4EZJA 1ORSA 4L3CB 5I1JH 3WE6A 2ALAA 2K78A 2YAOA 4MX7A 4X7DC 4MXVF 5DHYA 5FR3A 4L0PB 4CDGC 4Y19A 1OHZA 2AK1H 4NN6C 4FG0A 1A7OH 4PVNA 4N28A 3V6FB 1UZGA 1CBVH 1SEQL 4MQXD 1NFDA 2FR4A 1RUPH 4J3TA 4NQVA 4JRYA 5DI8A 2HUEA 4TSAL 3EH3B 35C8H 5JW4M 5D71L 2TSBA 1I7RA 3G04A 2P26A 4UIKL 3RFZC 2ICEC 4YBLB 2EO7A 5LG6A 1IAOB 1XZ0B 5CJXA 2ZP8A 4NOBA 1OSPL 1F90L 1JZ3A 4Q9BA 4H8WC 4XBGA 5FV2A 1JMXA 1O5PA 3SSGA 1D5ZA 2UXFA 2I69A 4KKBD 4XBPB 5FFGA 5DUBB 5AVQB 3T0EE 3ZRFC 5FGCB 1A7QH 4KVCH 4K5NA 5MEPB 2CQVA 3KPLB 5IHUH 4HUXA 3KMDA 2ORBL 4GRLD 4HA1A 5DZOA 4YHYB 4DKTA 1XH0A 4BH7A 2IXQB 1U4EA 5TE7L 1MJ8L 3VWKC 2IV8A 4FXGB 2BSTB 4GSUA 4HK3N 1EMTL 1LE9A 1H6EA 3JWOH 1QAWA 3QQ3B 4IBUA 3LHPL 1OAJA 5E1AB 2CJTA 4JKPH 4X4ZA 2YXWA 2O93L 3NDYE 3W38A 5I6XC 3LQAL 2FECL 3FO0L 2K6YA 3WE1A 3ZT5A 2A9NL 2MNWA 1V10A 2P5WD 3AVEA 3LRHA 5HYJE 2A9AA 5SV3A 5KBLA 3QWRA 3P40A 1EEQA 1HVXA 1Z2KA 1AKPA 1JWUA 2B0SH 4I5BA 5E2VH 5FM4A 2D2OA 3K7UA 4G43A 1QPKA 2W1NA 3NGBB 3PIQA 3BRDA 4QHPA 4I88A 1ETZA 3E9TA 3ZE0B 2A4CA 2DJMA 2E7MA 2OYLA 4A6YB 2N7BA 4X99A 3RDTB 5FCUH 2Q3AA 3CDFA 1H15B 3T4AB 4AWJC 3WAJA 5GRWA 2VXQL 2QQKH 4XWGL 4PJ8A 3L4CA 2QBWA 3D05A 3IGFA 3T6WA 3H3BC 1ETB1 4AQEA 3KH4A 4NO0A 2DKUA 3S5ZA 1T0MB 3L1EA 5CZVL 5BS0B 1R5VA 4PJFE 1DQQB 4Q8BA 3SKMA 4PV1C 1BVNT 3VFPA 4JZNA 4E9LA 1MWAL 2YA1A 4FL4B 3HZYA 1MPAL 1M7IB 3I50L 1AZBA 1P69B 1R3HA 3HAEA 2XYBA 3GRGA 5DSCB 1X9RA 4IIQB 3KYMB 3QRLA 3UTTB 1MFMA 1PG7W 5J11B 2OR8A 2B3IA 4DFIA 1SXSA 1NOAA 4J2QA 3VRLF 1OW0C 1U4FA 3MLYH 3ZLQC 3NEXA 4YHOL 4ANXA 5LGHH 4KC3B 4U6XA 3P0YL 1FZMA 4OBRA 5GGSA 1B4JH 4Y9CA 1Y6KR 5BV7L 2VL4A 3MRNA 1BZ7B 1DCEA 2ZWKA 2C4FU 4FAAB 4L8SB 4KFMA 1MRFH 2GSMB 4X6BB 4RCAA 2KLRA 3QWOB 3X3FL 1BREA 3CBJB 2FJUB 4AITA 4F57H 1XFPA 4L8CB 3NEOA 4A04A 2BMKA 3CH8A 1HZHL 1FHGA 2J88L 3E2HB 1KELH 3MV8A 3LNGA 3K80A 3QXDA 3MRCA 5B1BB 3S3SA 5DFVD 4U05A 1CLYL 2CLVA 4N5UA 1AE6L 2RJMA 2P28B 3ZXAC 4L05A 4XO3A 4Z8FH 1BV8A 3NN8A 4K9JA 1TG8A 3ZKMD 3AG2B 5L7XH 1L9TA 4P2RB 4DWHA 2EYTB 1MWOA 4LLVA 1PGRB 2VLRE 4HMCA 4JG9A 5HHQB 3FHQA 4KI5D 2XUWA 3PWPD 4ODUA 4CADB 2VQUA 1N59B 3DWTA 4P23A 5CEZL 4EOWH 2JKXA 1XGUA 4HWBL 1BVNP 4EIZC 4K3JL 5I1KL 1OAKL 1B0RB 4M5YH 4NBZB 5JDSA 5FIEA 4ZO7A 3TO4A 3OAUL 5JYMA 1O7DC 1V7NL 1PQZB 1YEDB 4DVRH 1T03L 4ZZKA 4ZD3H 4DIXA 2QFPA 2I07A 2AXGA 1LK3H 1HZLA 1JG9A 2WWMD 1GC1C 3O6KL 3PWNB 2AS5M 1R0AH 2NNCA 4FNLL 1MRDH 5TGBA 3DLQR 2P24A 1VZGA 3HG1E 4HJGB 1MCSA 3D30A 4J23A 3L9BA 1WBXB 4M1GL 1P4LB 2ZSWB 1GSKA 2WYIA 4WHTB 4FQJH 4DGWC 1L5GA 2WZAA 1TJIL 2J8OA 2DEYX 1GAFH 5TFSH 3QJOA 5I8OH 3WO3B 2NX5D 3GM8A 1QSFA 4L1SA 3WLWD 1J8SA 3VDAA 4F7EB 4KU1A 3N85L 3RWCA 4LFHG 1XF4A 2GITA 4JY6A 5SWSB 2ZYHA 4M5SA 5HI5C 2YAHA 3DHJA 4FOMA 4TOYL 3CSBA 3PJNA 2J7LA 4OTXH 4MA8H 4QRTA 1N5AB 4HUUA 4LLUB 4K9EH 1LEIA 3BD3A 3VWJA 4BJLA 4Y4HB 4PPTA 2YIHA 5D5MB 2X70B 3SBRA 2NMSA 4U1JA 3WUWG 3LMJH 1K8IA 3A4AA 2CBOA 3CFIC 1NFIA 5I76A 1N6UA 4X6EA 2HP4A 4G3YL 3CN0A 1HQ4B 4S2SA 4Z18A 5D7LA 5PCYA 1MFEL 3IU3B 4HZAA 4NQEE 5C0BE 3EXLA 4JRXA 4DPAX 1SBSL 2HFGL 1AO7E 3KJ6H 1XCQA 3SQBB 3VXUD 4PUBL 1BMZA 4P9MH 4UQIM 4XAWL 2A1WL 4NPJA 3OKDA 4BSWA 4KBPA 2GEEA 5HHNA 3AU0A 2R0ZH 1P7QA 2W9LA 5DFAA 3KE0A 5JIHA 4JFHE 5HVWA 4HAGA 3IMBA 2BSCA 3HMWH 2SEBA 3K71A 1KZQA 4GUOA 4JLRA 3VXOB 4ZW3A 1PCXA 2Y7MA 3FU8A 1SRDA 5IBTL 3UBGA 2J72A 1D6VH 3GTNA 3BJLA 4XNUL 4KX9A 2BNRE 2UYLB 4ZW8A 3THMH 4B27A 2VRKA 3WTYA 1J5DA 2Y07H 5FUOH 4DF9A 3DYOA 4GG6B 5IB2B 4MNHA 3QORD 4GMTH 5MEQB 4Q2ZB 3NJXA 3DURB 4YSPA 1AOHA 1NJ9A 4N24A 2XA8L 5TF1L 5DXWA 3EDEA 3WS3B 4KKLC 1OPGH 3U36B 5D7IB 2FWOA 3OKKB 3GFUA 3CSGA 4XZ4A 3ZDZB 5C07D 1ICTA 3NOIA 3VG0L 2DJSA 2XJLA 4M6NH 5C71A 5DMYA 1UEMA 4GNKB 4EZLA 2IDFA 1HINL 4XNMB 3DPDA 3NSJA 3FB8B 3QIWC 4QYAA 4XNZC 3WTTA 4TVPD 2FJHA 2CDFB 2EABA 2ZOLA 4JDTH 3W9EA 3B2UC 4WTQA 3KXFB 1F3RB 1KTLA 1SVBA 2IADB 3MZTA 4TS6A 3VXNB 1JWMA 3ABLB 3HA0A 5E8NB 3NUKA 3BRGC 3VXMB 4D8PA 3MMEB 2NY6D 5DK0B 3D06A 2V37A 5DEFB 5GGRY 5FUZL 4BZ2A 3HPJA 3QIUB 2PPEA 3IPEA 4UTAH 1QFWM 2OMZA 2P5WE 2B1OA 3CZNA 1BBDL 3CC5A 3MUZ1 4ZYKB 2HX7A 3C60C 2CKBH 4JQVC 3JTSB 2H32B 4HIIB 2LR4A 4M6AA 2HMID 3NP4A 3B9KC 3CMOL 2WXKA 3DX7A 1E5YA 1GYCA 1IEAB 1BW8A 4E5XB 1GS6X 2ZJSL 3U4BL 1KY7A 3IFOA 3ECBB 5EN3A 5EO0A 2OYKA 4LXFA 1T22B 4B0MM 3BW9A 2EDXA 5D1ZC 1VZHA 5L2KB 2YZ8A 3VH8B 2CBQA 1X6LA 3HE6B 2AQPA 3L4XA 1NPNA 1P5UB 3RWIA 3FZUD 3WFCH 4BA0A 2YMOA 4FFVD 4Z5RB 1TSRA 2WIIA 1OCZB 1PZ3A 1G87A 3GXNA 1KXQA 4IS6B 4H88L 2XIDA 2GIYA 1CGXA 2HYMA 5DRWA 3QJSB 4ICXA 2MCPL 2N3JA 3V10A 4PR5A 3MAWA 4PTTB 4IKLA 4E41B 1RJYB 3UC2A 12E8H 3DC0A 3I9GH 1VHPA 4LPYA 4L8DB 3BH4A 1GGIL 3AG4B 4C57C 1KULA 2AJYH 3FCSA 4TULL 2OXGB 3P54A 1NCCL 2COVD 3D3VA 2XY2A 2HTLD 3MRLB 4Q6IC 5C0GA 1HAUA 1XH3B 1IC1A 3L3IA 1MG3C 4N2IA 4FZEH 3D4YA 4IJ3B 1IT9L 4UZUA 2MTPA 5PAZA 2DLEA 4MDIA 4I4WA 3VTTA 2BP0B 3IJSB 5JOPD 4G8FA 1MH5B 3GJFB 4EI5D 4CKQA 4XWOC 5C0EB 1QR1B 3A6CL 2MNUA 1W6LA 4F7TA 3CMGA 3HZMA 3OSKA 4UBDC 3QUXD 4RESB 2H1PL 3EF7A 4GXVL 2RALA 4LOVA 5LCVA 4EDWH 1N6QH 4PCYA 1A6AA 3QZWB 4UM8B 5TDPB 4LQ1A 3UYOD 3QP3A 3QDMA 2ADGA 4URTB 4GAFB 4QGTA 5EC2A 4U1MA 2X9WA 2EE3A 5EORH 3LIZH 4H8WL 3X1FA 1VPOH 2JF1A 1D5BB 4XMWA 4IBWA 3HUJA 2XFXB 5EU5A 3K6NA 1PX4A 2YWZA 2CMRH 5HBBA 1I82A 3AU1B 1NUNB 4OV5B 3C9NB 1I3RA 3B8YA 4OZHB 1CL7I 3T4YB 5D1XB 3NIFF 4C4BA 3RGHA 4TVUA 3D8MA 5D2NE 3PWPE 4WV1A 4KXDA 1AGDA 4JO2L 1E6JL 5JXAL 3QXUA 2AITA 4ADIA 2A73B 2C1OB 2G60H 1TPXB 2G0LA 4AY0A 4MB5A 3OHXC 2MEJB 4FQLL 4KV5F 1FVEB 1PZSA 4KKPA 4N8VB 2FD6H 3WXVH 3RWJA 1T1WA 1ZVSA 5HHMB 3ULVC 5AOJA 1XXDC 1FGNH 4Z7QF 3HE7A 1TYJA 3MLWH 3KCPB 2HKAA 4P5KA 1FVCA 1UJ3A 3VQ2C 1C5DA 4FYRA 4Z7UF 4YWGL 2GT9B 4S1DC 4XCEB 3BPNB 5FYLL 2Y3NA 4M61B 4YFLF 3KPRD 2VXTL 2CRIA 1JL8A 4HOMA 1J1PH 5EU4A 4LPTA 3SOBL 5T1LA 4F7KA 4H2CA 4TRPL 1BQLL 3U0PB 4KK5D 2H4EA 4GPVA 3UJIH 5AWNH 5KJRH 1JDCA 1U3ZA 1A21A 1UB6B 4U6VH 4HPYH 2B77A 4X4YB 2NY2B 2RD0A 2X1PA 4HEME 1IQWL 4HSQA 1U91A 1NEUA 3HG4A 2NX5E 3M7FB 3EJJX 3OX8B 4OF7A 4ZSOB 2FLRT 1L9SA 4ALAL 1G1CA 2XQBH 2IF7A 3H9HB 2QGCA 3GS0A 4XNYH 4Z7UA 2P52A 1X9UA 2P4AB 1RUQH 1I8KA 4AW4A 3KL3A 4R5VA 4TQEH 5LXGH 2YK1H 2BVUA 4WWOA 2HCZX 5FO9B 3CLWA 4W9GC 5FW7A 3UP1A 1I9IL 3LS4L 4CSZA 3JVGA 2ZCZA 1FCCA 2MMXA 2XLLA 2VSCA 4PRHE 3MOBH 1E5UI 4E9VA 2CRZA 1J05A 1NDMA 2W0LA 2LLLA 3H0TA 1B0GB 1WF5A 4PRIA 2LGNA 5A3IC 4NKQB 1MAML 5J5EA 2HFEB 5H37A 2VDML 1T4KA 2IAND 2DKSA 3OR7A 1A6PA 4GG8A 5CLYA 3GO1L 4JPIB 4D94A 1DN2A 3C5XA 2YD2A 3H1ZA 5FPIA 2PCPA 5DVKA 2JCCF 4HFUL 2AKRB 1WZMA 2MPAH 3NG5A 5F72S 1AVAA 5CEXB 4Z7WE 3S8FB 5GGSY 3VSVA 1WT5C 2FLBT 5LUMA 3GUTB 3SDXE 3LDBC 4MJHA 3KNBB 1MUJA 2X3BA 3GZKA 5HTSA 2DV6A 3MRMB 1KCWA 4FTVE 4K7PX 3EYOA 2HXAA 5FO8A 3MODH 2YAEA 3Q5TA 1S4IA 4J27A 4F80A 4EVNB 5SX5H 1NIDA 5T3ZD 1OSZA 3TPUA 5I9QB 1NFKA 2YR3A 3DUSA 2Y5TA 1WC7B 3MBEB 2ICWI 2WLIA 3GI9L 2HN7A 4PYHA 4K7PL 5IQLA 4FCHA 1UXWA 2JCCA 5KWYC 5LAXA 2WUCL 3LKSB 3B7TA 1KPUA 2UX6A 1AJ7L 4K3EL 1T2JA 1ONQA 1VSCA 5KBKA 1M4KA 3JBG7 5DD0H 2JIXB 1EWHA 3MBXH 3QUKB 1L6XA 2V7NA 3VYNA 3ULUL 1IGCL 4TM9A 3KDPB 5HYSA 2HFFA 4H5SB 3IVKB 5KSUB 4TVPH 4FC3E 4FN0A 4JZJA 2VL5A 1HFUA 4ZOAA 4HLEA 3NK4A 5C0JA 1IM3D 4XPTH 5DCCA 4AZ8B 2BFVL 1ZHLB 4KJQC 4Y1SA 2OK0L 3TYFA 4F8LA 2KH2B 3BP5B 2X53A 3H85A 3RPBA 1UACH 2GBUA 4NO3B 2WVUA 5CJQL 1LWHA 4TVPE 1XV8A 1OARL 1JNLH 2Z35A 3LEYL 3N9GH 5DWUH 3GM0A 3K8KA 5B1CA 2O1AA 1AP2A 3RGVB 1EO8L 2QVMA 2AQNA 5CBEB 3SPCA 1CO1A 4JPKH 1TVHB 1T1XB 1SHWA 1OQOA 2NNAA 2ZUQB 3AXLA 3NFSL 2OJEA 1AYRA 1FBIH 4TUKL 3WNJA 3ARFD 2P8PA 3ARBA 4WY7H 2RAMA 4CC4A 3T1FB 4KJWC 4PWHA 5FYJU 3PGFL 2FH6A 4HV8A 5G4OA 4LPCA 2ZNXA 2OX5A 1CD1B 4ZUUB 1BWMA 1MDTA 3G5YB 4HOWA 1PLAA 4P2OC 4LRNH 1P1ZA 5HYJB 1Q9KA 3GSOA 1B9ZA 1KEGL 3QT2A 1ASQA 3WGVB 3MRHB 5I1IL 4FP8L 1I7TA 1KTKE 8PAZA 5D9SA 1RXLA 4D9RE 4X9BA 5IEHA 4GW4B 1ZD6A 3PREA 2J20A 1H5BA 2QSTA 2NY1B 4BEIA 4KROD 3V0AC 2PR9A 4K2UH 3T2PA 5LGKA 4QF1B 4ZPTA 5EUOF 4JANA 2CBTA 3EYVB 5H4ZA 4ZRGA 3MLUL 1L0PA 2OKMA 1REIA 1FHNA 1D5XB 4PGZA 2RA1A 4M29A 1XD1A 3KPQB 3VFVA 1FQ9C 4IRSB 1FRGH 3FKUS 1AIFA 1JPSH 3HC3L 2VJ0A 1KY6A 2C3XA 2CO2A 3CX2A 4WI5A 5ECJE 3Q6GL 1A4BA 4OFYA 4PJFB 4I9WE 4ZOBA 2X6UA 2BW5A 3IMUA 4PGCB 1VGKA 1VCBC 3MNDA 4PCSA 3V4PH 4Z77A 4IRJD 1BOYA 3LZFL 3KLQA 4I48B 5EUOA 3S37X 1WAAE 5FXCH 1JVOA 4UNIA 1CXKA 2ED7A 4B53A 3CZKA 5JOPE 1OGAD 5F6HJ 4JHUA 4PLJD 2YPVL 3WKMH 3VD4A 3QHZL 4F9LC 4OI9A 4FQXA 3O45B 2DTSA 3C5JB 2WB7A 4BKLB 1TTAA 4GBXD 2H8PA 2R39A 3S37L 2ARJQ 4G83A 4APXA 2H9GA 4JKWA 4ZXBB 1Q0EA 1BWWA 3FCTA 4POYA 1SOKA 3MACH 3ZTCC 2CXKA 3O9WC 1AR1D 4K71B 4MD0B 4YJZL 1U0QA 1TTBA 3CXHK 1L9MA 3D25B 3OF6D 4H0IA 5ACZA 4N5EC 3TA3C 5F9DC 5D7KD 5FO7A 2H7WA 2UWEF 4LBEA 1S2EA 2I25N 3BKCH 2UUDK 3FMGH 4PJ5D 5EUKB 3EJQA 3CK0L 3SPIA 1UM4H 2NY3D 3S4SG 2B9AA 3FT3A 4U0RB 4J3OD 5LGYA 3WFEL 1KBPA 2QADC 3LEVL 3PJSA 1BXUA 2CNYA 3D09A 5E9AA 2XBZA 3QHFH 3VD0A 5IQ9B 3AMLA 1DQLH 1IARB 2QQLH 2VLRB 1A5FH 4XP6L 1K5NB 3CVHL 3HS0C 4X9YA 2UWEA 5KSAB 3CN3A 2VJXA 2Z91A 4NGHL 2XZCL 1HKFA 3TVMA 4R26H 2DBLH 1BJ1J 5CGYC 1J5OH 2ZXDA 2VN3A 3GZOA 4DN4L 2XN1A 1J5HA 3OAZK 4JM0A 1EFQA 4XN7A 4BWWA 3VGBA 1IC7H 2YPLA 3WMQA 1KB5L 1S5HB 5MHSD 3WIIH 2X6BA 3N42F 4LCWA 2IQ9H 4XVSL 4I77H 5CKAA 1ZLDA 4X4XA 3ZY7A 2ZD0A 3MRQB 5B8CB 3W81A 2YD9A 4HIEA 4MD4B 3WN5A 3W2DL 3DIFB 1F3DH 1ZOXA 4OD3H 3CGTA 3TL5A 1ZRUA 1HYSC 5LQBL 4JQIA 4S0TD 3VE0B 5LDSA 3FN0L 1N4XH 4JFED 4OIBA 5IOPB 2YD7A 1VDGA 3PP3H 5GGVL 4B9ZA 2PYED 1D5IH 3HHSB 1NMAL 3NACL 5AZEH 1NMBH 4E9TA 4KKRA 1NTDA 4KXAA 4DNLA 5EZOL 1LO3L 4UQBA 2G4GA 1AS7A 2IANE 4O5LH 3EZ8A 1Q0XH 3S3PA 1OAUH 3C75A 3BWSA 5BOJA 5B1JA 4LCYB 2ZXEB 4M6ML 3NBNA 1Y1DA 1XZWA 2X38A 2X88A 3QXWA 3O41B 2J56A 1HDMA 4P9HL 3GSVB 1S7XB 1FGVL 5FYKD 2XOTA 4NJ9L 1NC2B 2QDVA 4CDHA 4O2FB 4B6ZA 1H3PL 5DK2A 1E42A 2WXHA 4I2XA 1FO0A 1CE6B 4FQHA 3DMMD 1Q94B 5T3ZH 2YRPA 4FFYL 4P2QD 5IW1B 3P3RA 2GUOA 1K6QH 2EDOA 2OMNA 2CLZB 5GS1C 3SY0B 1N10A 1SFDA 1Z9NA 5T3ZE 4ETQA 1VENA 3TFKC 5CLWA 1ZSHA 4WI6A 2B15A 4UQEA 2C9UA 1RURL 4WQOA 5L8JB 1EJOH 3NA9H 2X28A 4LU5H 1RIUH 3QRGH 3SY6A 1MVYA 5HHPA 4MNGE 4IJTA 4YSOA 2H5UA 5C2UB 5G4MA 3SGKA 2FEEI 3SDDC 2NDFA 1N67A 3OLDA 4FLRA 4P4KC 1AR2A 1AG6A 1LD9B 4O2CB 1WWAX 2L7EA 2Q87A 4JRLA 1AKJA 1QTSA 2XBTA 4LO9A 2WZ0A 2OL3H 3BKYH 1S7QA 4Y7OC 4IOFD 4FZ8H 4ODXB 4PV8B 5D4QA 5HHVH 4DT2A 2C5DC 3W9DB 1TMCB 2VZ1A 3JV6A 3OMAB 5EIIA 4O02L 2RQEA 3QIBD 3ULVL 1CVSC 5ABDE 1BVLB 4GRLB 2AQ2A 4HPHA 5EN2A 3P2DA 4BIKA 1B3IA 4RIRA 3KYOB 1PSKH 4JR9L 3MLSL 1AZRA 4L9LB 1PKQA 3G6AA 2MHAB 3BISA 3FXIC 1R5IB 3L3DB 4IIQC 2PO6A 1HKLL 5B39A 1KNOB 2BJMH 1JZ7A 3K72B 4Y2DA 2WSDA 5A7BA 2ZX9A 2XX0A 1BIIB 4NDMA 3EYUL 4R83A 1S7UA 2P5WB 3MJ6A 2YOCA 5EHFA 5CN1A 2VISA 4HFWB 1XIWC 1IGIL 3DX6B 4DPRA 1MXGA 3WD5L 5F21B 3NIGF 2XPGA 2B8OT 2ZG2A 4MAYD 3B2MA 3EIFA 3QC6X 5T1KD 4Y9GA 1HHHB 4AYBA 3PAZA 1X7QA 1KC5L 1XEUA 5FKAA 3ZIMA 5MENA 4ORGB 3EGDA 1YN7A 3V5KB 3SE3A 2Y2WA 2GFBB 2F1BA 5KVGH 3I3EA 3P9MB 3L7FB 5EF3A 1U8OA 1VLXA 4HG4K 3CH1A 1MY5A 3ZIYA 4OCSL 2VDOH 3DOSA 1E5BA 5DVPA 1P2CB 5ISZA 1EK3A 1P4IL 4JHBA 3DO7B 2O5YH 3MVSA 5KVGE 4BXSV 5BOZG 2OFQA 3MLTA 5CGMA 5I8CB 3KPTA 1A6UH 3BVVA 4PRNA 1IKNC 5KSVA 4QJ5B 4ERSH 1ZJAA 3WN6A 2G2RA 4G70B 7PAZA 2VQ4A 3GSUA 3IAQA 2BVOB 2XV2A 3QJFA 5CD5C 1RJLB 5D6CA 1Y0LA 4WW1A 5DFWH 5AYTA 1U92A 3P3TA 4QXTA 3LVEA 4JDZB 2VXVH 3LKQB 3NPSC 5DDHB 1JZ6A 4TL5A 4BK5C 1NM9A 2WXOA 4PJBE 1U42A 5LDUA 4MS6A 3NSFA 4K8RC 1EXUA 4G6AC 2ZYIA 1FZJA 1N8OE 2ZAGA 4OY9A 2G3MA 1UZ8B 3CXHJ 4U31A 4LASH 2R29H 3K8MA 3U2JA 1KCRH 3MX0A 4LKCB 3VJ6B 2Q5BA 1U8IA 1KPVB 2OCCB 3NJIA 5KS9F 4TPRL 4Q14A 4DEPC 2XFGB 3EJZC 3NMEA 2BNUB 1GW6A 2BIPA 1RZJH 3T3MB 3KJ4B 2D4FA 5AAMC 1KB9K 1I31A 2JELH 2VLLA 3QR1A 5CMAB 5D7KE 2RFXB 2CH8A 5EEWA 4J3OH 2P7TA 1MNUH 4TUJB 4M03A 1G7LB 2ITDA 1QFWL 1LO0L 3G5ZB 1KV7A 1Z3GL 5IVXB 2VRQA 4V1DA 5DC4B 2O5XH 4GKZB 4H26B 5BO1L 5J7CC 2WXQA 2C8NA 3VFGH 4X5WA 4C59B 1NICA 5L0QC 4DN3L 1MJJA 1FL6B 2PPFA 3BH9A 4M1CD 3FOLB 2ZCKH 3CCHA 1CL7H 1BM7A 3WXWH 3D50A 3IBOA 3NRQA 3FPXA 6PAZA 1OWWA 2OTUA 4FEIA 5AVZB 5HJ3B 1RU9L 3GSNA 2WXNA 1WYJA 2ZYRA 3U4AA 2MJWA 2HVJB 2QT6A 2Q6WB 4S1QH 3KLHC 5J6GA 32C2A 5IF0A 2JNZA 5D2NB 3PWPB 3LQMA 1UA6L 4K0OA 4BDVB 3SYPA 1SLVA 1N5YL 3O4LA 4H1LG 1JGEA 3B4NA 4HGKC 1QSEA 3OKOA 3WIAA 2GIXA 4AVHA 1AZNA 2IAMD 1HX0A 3AGWA 3CFEA 4HCGA 2R4RH 2ZP0T 1IBDA 1RIHL 1RP8A 3HAEG 5GS0D 2QSQA 1QYGL 1T21B 3PPSA 1MLCB 4XVJH 4NKIH 3AQZA 3PDGA 2EO1A 5MHSE 4N2OA 3WOVA 43CAA 4WI2A 3A67L 4AV0A 4AXWA 5BXFB 1UEYA 3HB3C 4HDIB 1MF2L 5HGGS 2CHXA 2FO4B 1HXYA 1VKXB 4NRZB 2YRLA 3FAXA 2HA1A 5FB8A 3H3PH 3N55A 3RL2B 2ZPKH 5J12B 4EQ2A 2WHVA 2E75C 1MCOL 8FABB 1J86A 4P2CG 1LEGB 2OMXB 1N6VA 3H4FA 3KYKL 4XMXA 1IAOA 4ACTA 3TT1L 3E0GA 3AC0A 1G7HA 4JFEE 2UZXA 1UD3A 1A4KA 1NCOA 2V9QA 3MCLH 1MCRA 2NX5B 4OIAA 5DZ9A 4IGBA 5I5JA 3QQ9D 4GUCA 2PYEE 1DBBL 4NKOB 3UYRL 1SJXA 4NQDD 5L6YL 5C0RL 2PXYC 3BSZH 4NT6B 2GCYB 2WANA 4Z76B 5MEPA 3V4VL 3KPLA 4M3HA 2WKLA 4XO5A 4JEGB 3VB9A 3RWGB 5FYKH 3MV11 1KB3A 3P9LB 4PH8A 2IPTH 2IXQA 1T2QL 1ADQL 1A6WL 3OV6A 1C1EL 3V0VB 3ZE0F 2A6IB 3OPUA 2XZZA 4GYBA 2FX8H 5FYKE 1IGML 5K5YA 2F54D 2DDQH 1NCNA 1WZAA 2W8CA 4WDIB 4XN5A 5EPMA 3S5LA 1HCZA 1GSMA 4P2QE 4XX1E 3WNOA 4LESA 3CU7A 4AGLA 1RHHA 1ZA6B 4OBSA 1JGVL 1E30A 2ID5A 3ABKB 4QLWA 2IMNA 3VXUB 5HI3C 3VFRA 4BQ9A 4Z7WB 3L8QA 1GYWA 4WWKD 1CD0A 4PJ9D 3SDXB 5IB4B 4KH9A 2XWJB 1YYML 4FG6D 5KYNA 3UTPD 4FRWA 2Y1YA 4ZAKA 2ZX8A 3FUMA 2XSKA 1FYTD 3MA7B 5D1QD 5DRNB 4MCMA 4EZMA 4PU2A 3G9AB 4PJDE 3F64A 3RDTA 1U9KA 2LV4A 3IK2A 3BIBX 1R47A 5EOCJ 1A6TA 2QJDA 2D7NA 1E4XI 5E56A 1WZLA 1AZCA 1DBKH 4Z9KB 5HJDA 4YSAA 4EIBA 3GXMA 3QORB 4E0RA 1RK0B 4ODTH 3Q8FA 3Q13A 5E00B 3PG2A 1UM5L 5BS0A 3VGEA 1OXYA 3ILQC 4NCC1 2ICES 1R19A 1MELA 4OLXH 3AGVA 3SN6N 2CJUH 3LQZB 4CJ1A 5C07B 2VXSL 1SJEB 1JTTA 3PL6A 4ONHB 3UO1H 5I0VA 4I18B 2WLLB 1AI1L 4DFHA 5IHHA 4NC2B 5IK3B 2PW1B 5DSCA 4Z7NB 3KYMA 1H6FA 3ELAT 2BIMA 4XNQA 4HKJA 4UQ9A 4OSUL 4LNRB 1OTSC 4BZYA 2Q7NA 4ZNEE 2Q86B 2YAPA 3NCJL 2KPNA 3VU1A 1IVLA 1WIOA 2NY6B 2IGTA 1RPKA 1A1OB 1EUTA 4KI1A 3TO4C 3F7PC 2YPKB 1RJCA 1ZLVK 3GRWL 1IBBA 3K3QA 5F9JB 4JREB 5D55A 2X1WL 3LKNB 4QRFA 5GRZA 4OLVH 1IKFL 1BD2D 4EPSA 5AEAA 1DJHA 2EC9U 4L37B 4X6BA 1XMWA 3P4MA 4K5LA 4LLAA 3LB6C 5T1DH 4HG4J 1XD0A 4UU9B 2Z92A 3V0FA 4MASA 1NIFA 2EILB 1OP4A 3RY6A 5BJTB 4L8CA 4LEEA 5E2TL 4TLSA 4KJPC 1KN2H 4KY2A 4MLSA 2J6EA 1PFOA 3QUGA 2X6CA 1V3MA 1BP3B 4JFQB 3U4EA 4EEEA 2N01B 1N64L 5T5NF 2YBRA 5E5RB 3WY1A 2XXFA 4X5QA 1G7IB 3ATDA 3E8UL 1NGXB 4G7VL 1BXVA 5LVEA 3MNVB 2NOYA 4P2RA 2EYTA 3HVNA 4P3DA 1E40A 1RUKH 5L4JA 1F6LL 3RRQA 4PBDA 5HHQA 5C9JA 4HMEA 4DGYL 2W65A 2EE0A 2WBJD 3L1GA 3WS6C 2CIIB 4CADA 5K1VA 4XN1A 1QLEB 4D0BB 3VXSD 2RBLA 3BKML 3CHXA 2QLYA 3VWJC 5DR5H 4GKNA 4L1BA 1B0RA 4KTYA 2DMCA 3KPSA 3B7SA 4BZ1A 4HAFA 1YRKA 1GY1A 1KBKA 4B9FA 3NZ8B 4NQXB 2ZUWA 5FM5O 1NGQH 5C6TH 1T5WA 4UT6L 4HXAH 2FBRA 5CZXC 1FNSH 4KVPA 4WKZB 1IAIM 4EUPG 1F11B 2QPDB 2K8QA 4EI5B 2AANA 4BWTA 5DURD 1EHLL 3NZSA 3GSXB 2EIEA 2HG5B 3V55A 2IPKB 4TF4A 2BSSB 1GOGA 4J39A 3QUXB 2ENYA 1I8LA 4YE4L 1P6FA 1FFNB 2ZSWA 3KGRA 3PQYA 2NY7H 4OF6A 3BP4B 4U0QB 4WHTA 4PP2A 3B1TA 1GZHC 4P3CH 5D5MF 2YD5A 4ZTPL 2FHBA 3FTYA 1XF3A 2VMJA 2ATKA 4EBQL 1YEWA 3MLPA 2L7JA 1PJ9A 1Z9LA 4WNJA 2EC8A 1KCVL 5IFJB 4UOW0 2WTRB 1YJDH 1YNTB 4L8BB 3GHBH 5SWSA 5A7EA 3SCMD 4N2CA 1TF4A 3TOPA 1Q1JL 4CBZA 4PG2A 1URZA 5EDSA 4LSTL 3IU4H 5ILTL 4E9YA 4LLUA 1YEFH 2B5IC 3RP1A 2EEFA 2EVFA 3MGTB 1BZEA 3O8XD 4NIKB 1G6RL 2B1AL 4CKVX 3CFJA 2XZAL 2CG9X 4B60A 5GS0H 4XCFH 1RP9A 3QPKA 2J43A 5E9DD 2DIAA 1HQ4A 3TJHD 5HYQB 3MJ7A 1SHXA 3IU3A 4QAMB 4YDLB 5H94B 3REWB 3UEZA 5F9WB 1UVQA 1UTDA 2AMGA 4GG6F 2V9UA 3UAJD 2TAAA 2V5TA 3KBPA 2HLAA 4OCWL 2BSRB 1MCNA 3BAWA 1XCTB 2YWYA 4XC1L 5AL8A 3SHSA 1MFCH 4OFVA 1LO4H 4XB7A 5D7IF 3VA2C 3KPRB 3OL2A 3UMTA 2DM7A 5T3XH 2WYTA 1CR9L 3SE9L 3WMPA 4CRPA 1KGYE 2F08A 4JFWA 4EN3A 2X4NA 5F89B 3BVTA 2W80C 3H7LA 3N06B 3M46A 4KK8C 3C6LA 3L4YA 2WO4A 5CIPH 1TETH 5I9QC 1KJ3H 2UYLA 4XXWA 3Q3GB 3O6LH 3LS5H 4OM1H 5CEZD 4C56E 3K5SA 4GG6A 2V2TA 2YFNA 1KIUB 2XV0A 4I89A 2VTFA 1N3NB 1TNMA 3AT0A 4G9FD 1I7ZB 3FT9A 1Q9WA 1ND0A 4YQXL 4NQDE 5CFHA 5DHEA 2I5YH 4J5VA 1KYUA 1WBYB 1OTTC 1M57B 3FO9B 1Y6NR 2WP3T 4JY5L 1ZK9A 3S9DB 3TONA 3U1SL 4M1DL 3V0HA 3VGAC 2W38A 1FLRL 4L4TD 1VGEL 4XNMA 3FB8A 2HRLA 2V9RA 3DV4A 3VA6A 2CDFA 3T0EC 3KXFA 5HI4C 2P5ED 4YHLL 3GLDA 1PZDA 2IADA 4KAQH 2IANB 5FK9B 5K1JA 5ANMB 2F54E 1XGRB 2XG4B 3MMEA 4B3VA 3G5VA 2JKLA 5DK0A 5DEFA 5J56B 1X5JA 2YARA 3QIUA 1T1ZB 2X44D 1WPCA 5T5FA 3REVA 4Y9FA 1HHGA 3N1FC 1WE5A 4YUEL 2YMTA 5FUCE 5KSBB 3KVQA 2Y6SD 1NCAH 4ZYKA 2BXYA 1CS6A 2ZXBA 4X7SL 1T04B 1CFVH 3H2QA 4FQ2H 4G1MB 2PWEA 3B6SA 4HIIA 3UTPE 2PKDA 4YSEA 3JWOC 4N9GA 2CU9A 3QYMA 1FYTE 4LCUA 5D1QE 4KY1L 2WVVB 3CDGB 1EZUA 2QVTA 2X2IA 4POUB 3DYPA 5I30H 3SDYL 2PLTA 2AV7A 3MA9H 4LEOB 4YS4A 5JZ7D 5F0LB 4PGEB 4GMSH 1QEXA 2OR9H 1T22A 2KC0A 3QUYA 3K2IA 2EC9T 1Z0NA 3VH8A 4MNGB 4PWIA 3HE6A 5SWQB 1U8CB 5CCKL 2Y23A 1KCUH 4ODBD 1G4MA 1UWGL 1ET5A 4IBSA 2GSGB 2C7UB 3UAFA 2Y06L 1VFMA 1KYOJ 1R24A 4IU2B 3ZBMA 1A4AA 3EDKA 3LZNA 5AB9A 1FFOA 1A1NB 1RAMA 1U58B 2M2DA 2DQHL 4LLQB 1RJYA 4PTTA 4E41A 4AYDC 1IM3B 4PWEA 4TSAH 4ZFFB 4L8DA 5AUMB 4C83B 4NQTA 2J1XA 4UIKH 2OXGA 4XCCL 3IJHA 5I0WA 3DX2A 2A83B 3MRLA 5LNGA 5IROD 4APQC 1OSPH 3L4ZA 1F90H 1NCBL 3F7YA 4Z7VE 4FA6A 2B7DT 3OWEA 5H37G 4BH8B 4GI6A 3P11L 1IB5A 1MH5A 3GJFA 3N3EA 4M7JL 1QR1A 1FN4A 4HSCX 3ARFB 3SKOB 5CSGA 1QW9A 2B20A 1MJ7L 2R0KH 5LXVA 4NB7A 1BD2E 4J4PC 1KIPB 3BVDB 5EBMA 5ECGA 3UJJH 1E28B 4OZHF 2ORBH 4EO5A 4WW2C 1OE2A 2YKKA 4PJEA 2X4UB 3HLAB 5TE7H 3N0AA 5BW7C 3NJLA 5TDPA 4XCYA 3ATEA 4ZOEA 4ZXBC 1PD1A 5IMKA 4CNIB 4FLQA 2JTDA 3LHPH 4C4KT 1PEWA 1YUKB 4YHPA 3LPFA 3GJFK 4OLZL 4ZW6A 4DERA 2ENSA 2XFXA 2D7OA 3MREB 2K45A 4R4BB 3LQAH 3FO0H 4KROB 2A9NH 1AGCB 2HVKA 2GIMA 3RPIB 3C9NA 5IVZA 4PJAB 2FL5A 2ICWA 3CLFL 3ZL1A 3T4YA 3LD8B 4JJ5B 5HPOA 4MNQD 3QUZC 5TDNB 3ZZ1A 5E0QA 2NTFA 3JUYA 1ZSDA 1AC0A 2W0FB 3D9AL 1VRSA 4PJCE 3JVGC 1ZHNA 4AV4A 5F88A 4A7UA 3H7BB 3HG0A 3VXSE 3LJ3A 3FU3A 3B2XA 1FVEA 2VDOB 3RX8A 4ZMZA 1FFRA 3KWWA 4NO2B 1E3FA 3R8QA 2OXHB 3BD4A 4FFWC 2B9BA 1MHHA 2VXQH 2YUWA 5I8EA 2IDSA 3QCVH 4IRJB 4JG5A 4I85A 5DJ2B 2F74A 2GT9A 4XCEA 5GJTL 4ZW7A 3SE8H 5JA8B 3BZEB 1E0OB 4XN9A 4M61A 2A0LD 1DVFD 4QNPE 1OGAB 5CZVH 4PJBB 2VDKL 2XPYA 1Q72L 3ZHLA 5F3HB 5BZDB 1F4HA 4F27A 1HCFX 2X6AA 4OW6A 5H4YA 2Q9OA 4XH2B 5CUSH 1QBLL 4GBXB 3ISRA 2CK0H 2XY1A 4G5AA 1MPAH 1QI3A 4G8EB 1DL7L 1UB6A 3I50H 3LYRA 4WJ5A 2NY4C 3ILPA 1N68A 4NNYB 3FTVA 3RPKA 3OX8A 3NSXA 1F6AA 1H6UA 1AR1B 1HSAB 3H9HA 5AYQA 5JXED 4ODWB 4YHOH 5AOZA 1ESOA 4KTEL 3F5WA 1ES0B 2LOEA 2ZF8A 3D48R 3HI1B 5EU3B 4DQOL 4GAYB 1QBAA 5H2BB 5BV7H 3MLVL 4PJ5B 4RGNB 3LPWA 1TTRA 5CJ5A 5MEOA 4V2CB 2V6HA 4NQCD 2NY3B 2VN6A 3X3FH 4LHUA 4TNVF 1B0GA 4G7RB 2A9CA 5JPMA 3O3DB 4QRRD 5CHNA 1BX2B 4MKMA 3QJZA 1UD8A 1ZHBB 5F97E 3TEZA 1UCBL 4GAAA 1HZHH 3C8KB 2HPOA 3IDNA 4JPIA 4AJVA 3UMNA 5E9DE 2AF2A 2CHNA 3QCTH 4JX0A 2ZP9A 4TNEA 2ENJA 3M7OA 4LCCC 4UM9D 1JHLL 3EFFB 4YPGA 3RNKB 3PCYA 1AE6H 3QUHA 4UINL 4I3RL 2P8MB 3NRFA 4NHCL 3V5HA 1OAYL 5F3FA 1A0QL 3BHBA 4ZMAT 1IAKB 1JGDB 4NWTL 3O2VH 1X9QA 3MRMA 2XN0A 3QFJD 1OZTG 3UEQA 5FHBL 1YHPA 2QVFB 2YD4A 3Q8CA 2OZ4A 5FV1L 4EVNA 3CAFA 2APVA 1GRWA 5CEZH 2JJUA 1YLBB 4HJ0C 4LSQH 4HWBH 1Q9LB 1WC7A 3IS1X 3QZOA 4UB0H 3MBEA 3JYCA 5I1KH 4PJXE 2WLZA 1ETA1 3VWKD 3TNMB 1IQDA 2BHUA 3BUQA 5CEZE 2EE9A 3LKSA 2QHRL 3IDGB 5KANG 4NHUA 3UDWA 5HY9B 1AD0B 4N2FA 1EFXA 4ELKA 1V7NH 4G9FE 5JORB 4TNVK 1H5BC 3QJVB 1DUZB 1F4AA 1DUYB 2JIXA 1T03H 2J5LB 3FCBA 4DKFL 3QUKA 2EQDA 2ZXAA 4JFEB 1Z5LA 3UZEC 4H5SA 3O6KH 3A0OA 3IWVA 4FNLH 5BPPA 3UTQB 2PYEB 3MCG1 5FYLD 4AZ8A 3MDJA 1ZHLA 4M1GH 1O6SA 1D2PA 2BZCA 1DHKA 3BP5A 1D5MB 3MU3A 1TVBB 4L4TE 4OT1L 2CRYA 1CGSL 2H47C 3NCYP 2P5EE 3CSYA 3F7VB 5EZIL 4HJSA 1RPQA 4ZQKB 3B3IA 3PE9A 3VCLB 3ZZQA 5IBUG 3RGVA 4FNSA 1K8DB 2C4XA 5CBEA 3BZ4A 3WKQA 3LNEA 5AD0B 1G7QA 1T1XA 4ODHL 3EBHA 3N85H 4FNQA 4WI9A 1P9MC 3RFZB 3T1FA 4H25B 4FS0A 4TOYH 3DMMB 4QD2E 1YC8A 4B41A 5DUPL 4P2QB 1E5CA 1THCA 4ZUUA 2XKSA 4EKJA 4L1HA 4ZUVB 5EWIL 5C8JA 5AW4B 3MRHA 1VFUA 1A8ZA 4PJHE 4JAMB 3GXTA 1QI5A 2DLFH 4PJFF 4NNXB 1OCRB 4G3YH 1BQKA 2FH8A 1CICA 4GW4A 4YBHA 1MFEH 1OD7A 2CLRB 3O3BB 4HLZH 3HHMA 4JB9L 1SBSH 1AZUA 2HFGH 3FQWB 3FN9A 3EYVA 2GJ6A 5AVSB 2L3BA 2X4TB 4XAWH 3II2A 1HHIA 1D5XA 3IT8D 1AY1H 3TV3H 2CXGA 3LV3B 1NIAA 4IRSA 1NMCC 1V3JA 3AY4A 3I6KB 4MS8D 3BPLB 3ZHFA 3L3GB 2GBVA 3RTQC 4X6CB 3OG6B 1DQKA 5D8JL 4E9SA 1JPTH 5IBTH 1BGXL 3VNYA 1I1AA 4XNUH 2GTZB 3SDAA 2OTWA 3G5WA 3QIBB 3L5XL 2Q20A 3WFDL 2HRPL 2NQCA 1MCPH 1EZSA 1E7VA 3KCWA 4CSPA 1TZGL 4I48A 3U7WL 2IH8A 4BZ2L 3S8WA 1MIMH 5FM8A 4ADGA 1FJ1A 1U3HA 4A7GA 3CFQA 3QNFA 2PWHA 5TF1H 2K9UA 4U3SB 2I27N 3OGCB 1FWXA 3O45A 4AZUA 2BCKA 5JIPA 3C5JA 2X12A 4YGAB 5DD6A 2BOCB 4U1HA 2XKNB 5LWYL 1HHJA 1YG9A 3ULUD 4LVOB 5F8QC 2BPBA 4L4VD 4CMHC 1K2DA 3WO4C 2Y7QB 5CNHA 1PNCA 2Z0UA 3CIQA 1N7ML 3OQ3B 4XMKL 4N2AA 4TQIA 5I1JL 4MAYB 2DH3A 5T1KB 4YXKL 5E2UH 4N0YL 2AK1L 2X5PA 1QNIA 3KJ4C 2AEQH 2G3XA 3MJ9A 2OSLB 4KPHH 5FUZH 3WN5C 9CGTA 2XYCA 1CBVL 5JHBA 4UTCA 4PREA 1J0JA 1BBDH 4W70A 4KZDH 4KO5A 1IGYB 2VLMD 3DSFL 4MNQE 1FC2D 1QP1A 4NQUA 1ZANL 1WDAA 2UZYA 1O75A 3KYNB 4J3WA 4MJ4A 5IQ9A 5I66B 4RWYH 3SGDH 3CMOH 3QG6A 1QD0A 2VLRA 3BKJH 1PAMA 3KPMB 3MRFB 4LGSB 3U4BH 5K69A 3ZQ9A 4CMMB 4LSDA 3N44B 1JZ2A 4PAZA 5I1HH 2XV3A 5B1JC 3DGGB 4R0LB 2EDKA 3HNVH 2HJLB 1DCLA 5IHUL 1V54B 2E4FA 5I0XA 5DJYB 5AALA 1PY9A 2X1XR 1M7XA 1OT4A 3EH1A 1GGBL 4NYLA 3K6OA 2N0KA 4H88H 1AGBB 4PG9B 1AIZA 4QY8B 3SGEI 3ZMRA 3D18A 3TTYA 4AQAB 3JWOL 5HI5D 3PLYA 1DJIA 5LCVL 2NUTB 3QB7C 2XWBB 4GQZA 5ICXA 3ZRCC 5B39G 1BQUA 1GGIH 3MRQA 3QO0A 4ABVA 1X4YA 4PN6A 4Q89A 1D7FA 4IBZA 3QW9A 1A7PL 4MD4A 3DBXB 1WG3A 1F97A 2WWMC 5FECB 1O7VA 3VFWB 4YDJA 3DIFA 2PTTB 2AJSL 1CIDA 4FHKA 3DTXA 1IT9H 1OF0A 1TMQA 2B0SL 4XHQA 1KIRA 2DWDB 5EG6C 3KDMB 2XWTB 2YLKA 5CLTA 3A6CH 5ABZA 3RVWD 1DLHA 2CIKB 3BLBA 1PIFA 2QEJA 3HHSA 2VR9A 3KLLA 3IXAB 5FCUL 3WLWC 4HISA 4AT6B 1X5LA 1P7HL 4IEFB 1UD6A 4NIYE 4QRRE 1HK6A 1AD9B 2IALB 2J1KA 3VFSB 3H6JA 2WINB 2F7RA 3OQRA 5CM1A 1INQB 2VZSA 4XVTL 2BRRL 1H0DA 4LFHD 2W9EH 4LSRL 4ELME 3LZRA 4Q7DA 3ATFA 4UCFA 5FGBA 1IBGH 1CE6A 1AMXA 1NWPA 2IAMB 4PVBA 5JHLA 1CF8L 3QFJE 1OP3H 3VI3E 3OSVA 5E99L 1B9KA 2MQCA 2CLZA 2DQDH 1QX1A 3C5ZC 2Q76B 3CX5K 4Y2DC 1CTMA 1MCFA 3HG3A 3Q6FB 4P0DA 4AJWA 5JXAH 4MB1A 5DJ0A 5J1AB 3L5JA 1WCBA 4FXKC 4H8QA 1C16B 4FQLH 4IBQA 1T3FB 3NP3A 1XT5A 3CSPA 5DO2C 1AHWC 3QIWD 3KM1A 4AGMA 1VADA 1XTMA 3B2UD 4OZ4B 5C0CA 2VR6A 3DX8B 4MHHI 3QDGA 4GEJA 2AK4D 2CGYA 2BW4A 4YWGH 1OOAA 1LD9A 1UA7A 1IAIL 4MMZA 4C56B 3KWXA 4P8QA 3SE3C 3DARA 1JYVA 5CIPB 2B59A 2BSED 3SOBH 4AM0A 1BQLH 2IDQA 1E8XA 4PV8A 4Z3TA 3C60D 1OP5H 4NQDB 1B4TA 3OR6A 2H3XC 2H2SC 3W3BA 4XMPL 4WSJA 3EG9B 3HBPA 5F1IB 3H53A 3IYLW 1BVLA 4JO4L 3VRIB 4V2BA 1SLWA 1IQWH 3B9KD 2DJUA 1KG0A 1IFRA 3KYOA 1U30A 4JG0H 4OKVA 4DVBB 1OE3A 4ALAH 4Z3EA 3WJJA 1RZ7H 4L9LA 3F7LA 2F7IA 2R2BB 1R5IA 3A6BL 3ZDXF 3U2SB 5D1ZD 2F54B 4G42B 3PWLA 5F9OL 1MDAA 1I9IH 5AVVB 4AUJA 1Z9SB 5IM7B 2X3CA 4QHKI 1BIIA 1BEYL 3FHAA 2NY6C 2VOTA 4QHNB 3RWEB 4F92B 1A65A 2VN4A 2HX9A 3DX6A 1MAMH 4JFOB 4WWKB 3OXRB 4PJ9B 2VDMH 4XOBA 3FB6B 3BCDA 4N2LA 3GO1H 1ODUA 1HHHA 1XR8B 4DVRL 2Q7YB 5J9PA 1CU4H 4DK3A 1LK3L 1JD7A 3X17A 1FYTB 2NW2B 5D1QB 4A38A 4ORGA 5IIEB 1R0AL 5EZJB 2E27L 2X0WA 2A74B 5K9KB 2AJXL 1WUNT 5A40E 4GY4A 4IW4C 3U79A 4Q6KA 2BNQB 3JTTB 4XWOD 1CPUA 3DO7A 4AL8H 4QRPD 2HLFD 3QWQB 4YPJA 3AG1B 4JFTA 5F0JB 1T6WA 2FSEA 4UBDD 2G2PA 2V8MA 3KHOA 5EO1B 5DYOB 3GI9H 3PXJA 1A66A 4LRIA 5J4MA 1RJLA 1ZHKB 1E65A 2WUCH 3FH8A 4Y5YC 1CWVA 1TEGA 3T3MF 3VFMA 3T77A 4CVUA 1AJ7H 3MFGB 4OJEH 2WJ7A 5I6OA 4KKZA 4JDZA 4OZGE 5DQDL 3LKQA 1UKSA 4RZCB 1BQHG 3T2QA 3UC0H 3W11D 2KZWA 3ULUH 2JLLA 5IVXF 1IGCH 2FGWH 4B7IA 3LMJL 4Z7VB 1IJNA 1JF1B 2BHYA 1UZ8A 1L9PA 3H54A 1MNNA 1K3ZA 3ORJA 4XCNB 2NLJB 2PF6A 3ULUE 1KPVA 3ARGD 4GKLA 3QISA 3S5LG 5CJQH 3VXTB 4A2FA 4TNWF 1BD2B 3KJ6L 3LEYH 4JFUA 2BNUA 3EO0B 5D96B 4UIMB 4KI5F 3BDYH 5BVPL 5C0ND 1EO8H 1SYSB 3QUXC 4D7PA 3I84A 2R0ZL 2Z4QB 3ULVD 1IX2A 3HMWL 2XWZA 4NS0A 4JKMA 4KTGA 4TUJA 1G7LA 5K59E 2R2HB 3ZVVA 3ABGA 5IVXA 1O7DE 3S0PA 1JP5A 1EGJA 2MSPA 4GKZA 3VRJB 3PY9A 5LN8A 2VLME 1T4WA 3PGFH 4S1DD 1GY2A 4RZKA 1D6VL 2VQTA 3O0RH 4WTZG 2ALWA 3L2MA 3TBSB 3FOLA 2WTOA 3MUGB 1JXFA 3ZTEA 4IGBC 1HILB 4RLDA 3THML 3FSVA 1M9SA 1GH7A 4WO4C 5FUOL 4NPKA 5HJ3A 1KEGH 2VDLH 3ZPDA 5EZLB 5I1IH 3ZKNC 2HVJA 4GMTL 2Q6WA 4NM8H 3QUMA 1A9BB 5D2NA 4PJCB 4X6DB 1QMUA 2WBJB 5I1AB 5DC9B 4Y5XA 1E43A 2GBAA 3VSTA 4LT7A 2D7MA 2VZVA 4ETYA 5TH2A 4FMFA 4JL1A 5A2KH 1CLZL 3VXSB 2PCYA 2WGNB 4BYHA 5E1QA 3MLUH 4M6NL 4XO9A 1U21A 1OB1A 5FC9A 3CFUA 3GXUB 4KZCA 1T21A 2BVPA 4JDTL 4BFKA 2JMRA 3OMZA 2V7HA 1IGTA 4NZJA 3SYOA 1USQA 4IK7A 5BXFA 3FT2A 1E8WA 4NRXB 2CBPA 3P02A 4HDIA 2FSDA 3Q6GH 2FO4A 5DURB 4DO6A 3CHOA 4NRZA 1AGEB 3EOBA 4FI7A 4GJTB 4LIQL 5F2FA 4HIJA 5FKPB 2VDQH 3QNZA 4J3XA 3RL2A 2I7OA 2IOMA 2Z1PA 4AGNA 2LU3A 8FABA 3LZFH 4XB3A 5AKVA 2LQRA 1LEGA 1Q8MA 2CKBL 2OMXA 4ZAKC 5IJCC 3QGVA 2VE6B 4C4UA 3LPGA 3NCFB 4RSVA 1NGWA 1MWAB 2W60A 4PEEA 5E8PB 1GTFA 2GBTA 2YPVH 1U33A 3ZJAA 1BMGA 4L3FA 4KKCC 4NFBA 4DO5A 2WXJA 2X0UA 5BRZA 4Z7IA 3GXIA 2VMDA 3PYCA 2XT1B 3S37H 4BUQA 4NT6A 4DO4A 3SCMB 4ZUTB 3SDXF 1T80A 3MV7E 2CR3A 3P9LA 5HDBB 1WTLA 3WFCL 1H9VA 3ZMEA 3FU9A 4P4RA 4YSRA 3A4FA 1XGQA 4NN5C 1G9NC 3V0VA 5BV7B 2A6IA 3O8XB 2YAFA 3H6AA 6FABH 4Z1PA 3BCFA 1ET8A 3U6RB 3Q0HA 3FFCE 2ZWZA 5E9DB 5FO2A 4PYGA 4LE8A 12E8L 3CK0H 4AVJA 4ATTA 2WQRA 4LK4A 4WFED 1KBGH 2V4LA 1A4JB 3VXUA 4JZOA 1GOHA 2CPUA 4L2LA 1YMMD 3LEVH 3QAZB 1YY8B 4AX3A 3ISYA 4RA0C 1PKOA 3AXHA 3UG4A 2XWJA 1DDHB 5MERB 5HVHB 1U8KB 1P5VA 1DZ0A 3ZR5A 4KJQD 4XP6H 5I75C 3CVHH 2OMYB 3UPRB 1EBAA 1OSEA 5F7NC 4C58B 4HP5A 2YO3A 5INCB 4NGHH 3EFDL 3RY6C 4Z7NF 2AK4E 4JQIL 1HE7A 4PJXB 4OUUB 5BOPA 4YMPA 5GS2H 4UANA 4WK0B 1N6QL 4R7DB 5SWZA 3DXAA 3FRPA 1H8OA 1WAEA 5F7MC 1VZIA 4G9FB 1NWOA 1RK0A 4KJWD 4Q58C 3LIZL 3NJJA 5E00A 3LY6A 3MNZB 2N0MA 4GIAA 4WNQB 3E8VA 4XVSH 1HWGB 2C3WA 5C0FB 1KF9B 5C07A 1CGYA 2ZX6A 4KRNA 4U3HA 5F6IB 1JYXA 2ZWLT 2FCBA 4ONHA 3W2DH 2WLLA 5I19L 2UVEA 5SX5K 1GGYA 1TJHL 4L4TB 2FO8A 1CD8A 1UOKA 5LQBH 4YO0B 2P5EB 4LNRA 2I85A 2AJ3A 3UTSA 3C8DA 3TFBA 1FO0L 1P0SE 4XZUA 3K2MC 5GGVH 2Q3ZA 3QXAB 1YYCA 1IL1B 2DQJH 1NMAH 2FDBP 3TBVA 3TS8A 3LKNA 3WJLA 1LO3H 2XN2A 4L37A 4TMPA 3L45A 3TV8A 1VEOA 2H26A 2QLVB 4N8CL 2CM5A 1XO8A 2BIHA 4S1RH 4M6MH 5BJTA 1D9KB 5IBLC 3RIKA 4P9HH 1IGJA 1I8LC 1J88A 1FGVH 4NJ9H 4PJHB 5HPMA 4I0PA 1AYOA 4JFQA 2X42A 4OLUL 1H3PH 4DK5A 3UJIL 3GK8H 2P49B 1P4BH 4OCLC 2CGZA 4FFYH 1G7IA 4U6VL 3FU7A 2BOLA 3KLKA 1NKGA 4QRPE 1A6ZB 3KAAA 1FFQA 3PXLA 3EDJA 3DJSA 3TURA 2XQBL 3HC0B 4FNPA 3UYPB 1RUQL 4F2FA 1IZJA 1XGTA 4L1TA 1RURH 2CIIA 4TQEL 3FK3A 3D0AA 2WBWB 4D0BA 3O9WD 2EEDA 4RNRB 2X4QA 5AW5B 3PABB 3MOBL 4N5ED 3TA3D 2BOBA 4M62L 3NZ8A 3VG9B 2IDTA 1RHFA 3GWJA 4MDJB 1IAMA 3OJVC 4BFGA 1NUGA 3OLEA 1P53A 2MWCA 2WBXA 4WKZA 1F11A 1YNTF 3LKOB 4EI5A 2VUKA 1MVUA 5I1DA 2IFFL 1CFBA 3GSXA 1LE5A 2QADD 2HG5A 2IPKA 4O02H 3C5SA 5T33L 3ULVH 4WWNA 2EYSA 1LWRA 3L48A 3IDIB 1IFHL 2LAGB 4EXKA 4YIQA 3HKZA 3BP4A 4QKXB 2R69A 1KV3A 1BM3L 4GBXC 3MLSH 4EN3C 5J6HA 4NI3A 2CK2A 3ULVE 4XPHH 5IMMB 1RK1B 3GB7B 1HKLH 3LTVA 5KTEH 3L5WB 5CGYD 3ZOAA 4UQCA 1UADC 2HG0A 3ES6B 5IFJA 3DRTB 3GMMB 2YJQA 2WTRA 1R3LA 1YNTA 2BY2A 3F58L 1Y6MR 3JWDC 3WSQL 4L8BA 4ABUA 4RBPH 3BIKB 3BN9D 3FQ2A 1G6VK 3BPOC 5B22A 1ANUA 4G11A 1IGIH 3FQNA 3U7AA 4Y16A 3GSWA 3TP4A 2Z8WC 4AVKA 1Q1PA 4ODVL 5DD0L 4QWWC 4QRAA 4ZFZB 1NGPH 3ARVA 4R3SA 4LEXL 4OCMC 3RKPA 2Y2TA 2RMNA 4TVPL 4LP5A 4B7LA 3WHXB 2VKXA 1HWWA 4R5TA 5HYQA 4XPTL 2UZIL 1QTYT 4HEPA 2MQGA 2DQGH 3CDZB 1J8RA 4L4JA 2YMXH 2WLMA 1UA3A 2UY7A 5EU6A 4E68A 2BIQA 1P4IH 2FIKB 3N9GL 1ACZA 5TTRA 2WPGA 4WWID 3PS6A 4TUOB 2VR5A 5ADPL 1DVFB 4YK4C 5AZUA 5IMOB 4PTUA 3SOTA 3KPRA 4JPKL 1VFBB 3WL9B 4YX2H 1FBIL 3L2LA 4OAWB 2JKJA 1LO5B 3K6SA 1E9QB 1QQDB 2Y5QA 4C56D 1RZFL 3Q43A 4HU2A 5AVUB 4XI5C 4WLCA 5DJXB 3FTWA 3RVUC 1OL0A 3ZUNC 1GR7A 1W9XA 5BVJB 2JJTC 5HDRA 1FNGB 2R9HD 1QBML 5B1KA 3IRPX 2HRGA 1KIUA 3HCVA 1N3NA 1J9CT 1IMHC 4CILA 3QUYC 2R1YA 5DZLA 4XBMA 1WBYA 3ASNB 1J18A 1N70A 3TBYA 3SIKA 3FO9A 1WFOA 5KSBF 4P59L 1XF5B 3H9SD 3GSNL 4K2UL 3P73A 3NJVA 4LLMB 4NQCB 4O51B 1CJYA 5FW8A 4CN1A 2UY6A 7FABL 3TFKD 2Y2YA 4NN6B 3MRDA 1NAMA 4QRRB 3DVIA 3RWHB 1WCQA 3MRIB 5FK9A 2APTA 4UT9H 5DWPA 5G5DA 5ANMA 5JNYB 1FRGL 1QFWH 1LO0H 2B08A 1XGRA 2GK0B 1SMAA 1JPSL 3LN4B 5DZVA 4P46D 3VFUA 3QQ4B 5GPRA 3SDDD 2ICEB 1T1ZA 3K6IA 4Y2LA 4P4KD 4DN3H 3FFOA 3B1UA 4ELMB 3GPEA 5KSBA 3V4PL 1RULL 2I32A 3JUZA 4N4YB 1ZVNA 1IBYA 5IB1A 1A9EB 4BHUA 1T04A 3QFJB 3VI3B 2BVQB 4G1MA 1PX3A 2QPSA 1INEL 5E8DL 3WKML 3I02B 1RSFA 2ODHA 3CDGA 1A02N 3ZO9A 3QZBA 4GT0A 3KGSA 4U1LB 1N5YH 3UBXB 1CURA 2OYMA 4LEOA 3TF4A 4YDMA 4PGEA 4Y5VA 1YQ2A 2VXUL 3VWKB 2AEPH 4BSVB 4DGVL 4KKQA 3VFOA 1QYGH 3SZ6A 1BVKB 1NPJA 4GKOA 5T1MA 4F24A 5A43C 2YSTA 1JZ8A 3A67H 1XDTT 2NQ3A 4W9DC 5HGHA 5I6XB 1W72H 1EVTC 1KFGA 2WZ6A 1MF2H 4OJFL 3BZFB 4ONGH 3BKCL 3FMGL 1A1NA 3CHPA 1U58A 1BQ5A 1XIWD 4LLQA 3ZK0A 5M95B 3D7PA 1IM3A 5F0PB 5EH1A 5JPNA 1ZVYA 5C09E 4FFZH 3D69A 1MCOH 3W39A 4IOFC 4R9HA 5KJ7E 1QWUA 2A83A 1I8IA 3P30L 5LN4A 4LHUG 3BGAA 3LNHA 4QOKA 3QIBC 2X4OB 3IJ8A 3CUPA 4HJ1A 4GO9A 4R7VA 3BWAA 4OGZA 3BOVA 1DQLL 3H42L 4QO1A 1DBBH 3WFHB 1W15A 2WXGA 1RZ8A 1RZPA 3SBPA 3ARFA 3K1KC 5L6YH 5C0RH 1O9VA 4LOFA 3LKRA 4PJAF 4RFOL 1K4CB 1KIPA 3OAYH 3V4VH 3RE0A 3T0WA 4E2OA 3ZHKA 1NGZA 4R26L 1LDPH 2XNAB 5I6NA 1F58L 2X4UA 2M8XA 4ES8A 3HLAA 4KMQA 1D6EA 1ADQH 1A6WH 1MN4A 2GYSA 3GMRB 4LOEA 4ZMPA 1BZ8A 2HVBA 3IFPB 5F7BA 5CD5D 1IC7L 2JB6B 3GRBA 3WIIL 4NJAL 1ILSA 3VDCA 1UM6H 2FK9A 2IQ9L 2Y25A 3BP6B 5FCSH 2LU4A 2VDMB 1AGCA 1XBRA 1JGVH 3O6ML 3L3HB 5E5MA 4EJ1C 4PJAA 3WY2A 3OGOE 4DESA 2E9BA 1PG7X 1JE6A 4JJ5A 2X4PB 2GY7B 4ZMVA 5TDNA 4PJBF 3VMNA 3NJFA 4KO7A 1R5WB 3S3CB 1ZIAA 3GYRA 4HBCL 1G9NL 3NABL 5HVFB 2XIIA 2Q8BH 2A6KA 3EJZD 4F5CA 2E9JA 4Y19D 1VCAA 5JPMC 1D5IL 4X5LA 5KJ4A 3DROB 3UZVB 1NMBL 3CFMA 1QRND 4JRYD 1QWNA 5KAQF 3BFWA 3I74A 1USZA 4I9XA 4X5XB 1F18A 4TTDC 4KOBA 5D72L 5DJ2A 1UH3A 4OZIE 2DWSA 1JIBA 4QTHA 3PWJA 4EF3A 4OZFA 4R7LA 1OGAA 4K4KA 1UM5H 4G9DB 5GZOC 5BZDA 3JXAA 2FRGP 5F3HA 3UZQA 3GDCA 4XH2A 1MKFA 4YDVA 2F8OA 4J3OF 4QRSB 3AABA 3L6FA 3MYJB 3UGEA 1RVFH 4G8EA 3RUGE 3KLHD 3EOTH 3L9YA 2E56A 2ZOKA 3G08B 3LXCA 3O0LA 1L9QA 1KJMB 2J6EL 4L4VB 5CBAB 1OHQA 2OMTB 3KPPB 4KWUA 3GIVB 5ESQA 4J3VA 1BMWA 4U33A 3NCJH 1AHKA 4WEBL 1JF5A 1ES0A 5LBVA 3HI1A 5DQJA 3P0VL 3GRWH 5EU3A 4F2ME 3PUUA 4GAYA 4PJ5A 2D9QB 1RIUL 4MCYB 1JK9B 4PJIE 3QRGL 2Z7YA 4ONFL 5GRJL 1IKFH 4IBVA 2XTSA 3ZO0A 2OPCA 4ZBJA 2ISDA 2F9BT 3L9RB 4RMSA 3WFEH 3ZDWA 4CVZB 5A2BA 2QKIA 2YGNA 3HB3D 5CP7B 3ZKQD 4XMTA 2JI3A 2M1KA 1N0LA 1WICA 4JFXA 1MQ8A 4LSUL 1BX2A 3QWRD 1CVRA 1XSIA 1ZHBA 1TJGH 3FQTB 1GZPA 3C8KA 2J55A 1HI6B 3JVFC 4GT7A 2CHZA 2GSIB 2OL3L 4FZ8L 3I75A 4BZ1L 3F2LA 1W80A 2FJSA 4BELD 3BDXA 1S8DB 3E8UH 4G7VH 1KENL 1LJMA 2FGZA 5DS2A 4KNTA 5KN5A 3CHSA 4NKMB 4MYWB 3IJ7A 1QASA 3DRQB 3V0EA 1WZ1L 4PJ8D 4DGIL 4G8IB 3NPZB 4DGYH 4FEMA 2LTQC 1SY6A 2PXYD 3VX0A 4HW6A 2DICA 3RHWF 5I15L 4FXLA 4OVVA 3HR5B 5FYJH 1E6OL 3KR3H 2Y7OA 3DV6B 4XTRC 2BJML 2V2XB 5EFIA 3P3UA 4MA3B 1T7WA 4PW9A 3V0DA 2NSQA 1XR9B 5FYJE 1JMZA 3ESVF 5F6HI 4L0ZA 4FYTA 1UKTA 2VDPL 1PZ5B 4X4MA 4WU5B 2FTAA 1AD0A 2CRMA 2NW3B 1CICC 1G4RA 5SX4H 3K6FA 1DUZA 4K07A 3EYFB 1JWSA 3M17A 4AYGA 4EI6A 4HWEL 3ROOA 3Q7JA 4I87A 4H4NA 4BV1A 5HXMA 4Y4FA 1CLVA 2Z7WA 4HIHB 3VD2A 1JZFA 2KMWA 5HI3D 3H9SE 3IGLA 3UTQA 4N87A 5F7UA 1MCIA 2JSFA 4NP4H 5CP3H 1D7DA 1F3DJ 4MJJA 3II3A 4JN2B 4DP8X 4YE4H 4JFDD 2W59A 1HE8A 1D5MA 2PYFB 1TVBA 4GP8B 4H44C 1HH6B 1DQTA 4ZTPH 4Z7OF 2W5PA 5FOBB 1FH2A 5A1AA 3F7VA 1P6WA 4PRDA 2CJ3A 1E9PB 5DZJA 3VI4E 4Z3FA 4MB4A 4EBQH 2O5YL 4H40A 1I1AC 1EAPB 3SDAC 2VQ1B 3RNQB 3D