1YSOA

Yeast cu, zn superoxide dismutase with the reduced bridge broken
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
153
structure length
153
Chain Sequence
VQAVAVLKGDAGVSGVVKFEQASESEPTTVSYEIAGNSPNAERGFHIHEFGDATNGCVSAGPHFNPFKKTHGAPTDEVRHVGDMGNVKTDENGVAKGSFKDSLIKLIGPTSVVGRSVVIHAGQDDLGKGDTEESLKTGNAGPRPACGVIGLTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unusual trigonal-planar copper configuration revealed in the atomic structure of yeast copper-zinc superoxide dismutase.
pubmed doi rcsb
molecule tags Oxidoreductase (superoxide acceptor)
molecule keywords YEAST CU, ZN SUPEROXIDE DISMUTASE
total genus 39
structure length 153
sequence length 153
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1995-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1ysoA00
1DO5A 1S4IA 3GZOA 1UXMA 2C9SA 5KBLA 3SODB 3L9YA 4L05A 4A7SA 2ZKYA 2WKOA 4N3UA 1SXAA 2Z7ZA 1KMGA 1B4TA 2NNXA 2Z7YA 1IBDA 2AEOA 2AQTA 4A7QA 2VR6A 1BA9A 3KM2A 1E9PA 3RE0A 2WYZA 2ZKXA 4U4IA 2AQPA 3GTVA 1E9PB 3KH4A 1SDYA 1OEZW 1YAIA 1COBA 2Z7WA 2XJLA 3QQDA 1BZOA 3HFFA 3KH3A 1XTMA 1CB4A 1XSOA 1F1GA 1XTLA 2GBTA 1MFMA 1F1DA 1UXLA 1Z9PA 1F18A 1B4LA 1EQWA 1E9OA 2AQQA 1SOSA 3CQQA 1P1VA 3GTTA 1HL4A 1SRDA 1FUNA 3GZQA 2LU5A 2WKOF 4A7GA 3ECVA 1TO4A 1E9QB 1E9OB 2Z7UA 1Z9NA 5CU9A 1JK9A 1SPDA 2JCWA 1DSWA 2K4WA 1L3NA 1SXNA 2WZ5A 1OAJA 4A7UA 1JCVA 2E46A 3PU7A 1YAZA 2E47A 3QQDB 1HL5A 1IBBA 3KBFA 2C9VA 3KM1A 2AF2A 1OALA 3ECWA 3S0PA 3T5WA 3CE1A 2WWNA 1SXZA 4OH2A 2ZOWA 4A7GF 4BD4A 2VR7A 1N19A 2V0AA 3LTVA 1SXCA 5KBMA 3HW7A 1RK7A 2JLPA 2XJKA 1IBFA 1ESOA 1Q0EA 2WWOA 2WZ0A 2SODB 3L9EA 3CQPA 2WYTA 1OZTG 1PTZA 4A7VA 1EJ8A 1N18A 1SDAB 1TO5A 1JK9B 5KBKA 1E9QA 3K91A 2AQNA 4BCYA 1PZSA 3F7LA 4MCMA 4BCZA 2APSA 2WZ6A 2C9UA 3H2PA 1PU0A 1IBHA 3H2QA 1OZUA 4MCNA 1CBJA 2Q2LA 2AQSA 3F7KA 4FF9A 3MKGA 2AQRA 1SXSA 1U3NA 2GBUA 1QUPA 3HOGA 4B3EA 4A7TA 3KBEA 1SXBA 4OJAA 2R27A 1AZVA 3GZPA 2VR8A 2ZKWA 1YSOA 3GQFA 1IB5A 4N3TA 2GBVA 3MNDA 3ECUA 1F1AA
chains in the Genus database with same CATH superfamily
4HPOH 5BRZD 3AY4C 4CSZA 3GRBA 2ADGB 2QMJA 2B08A 3VWJB 5IESL 1UZ8A 5L2KE 2O6PA 3SE6A 5FHBH 5E6ZA 3ZT5A 4ODSL 2XVLA 5D2LA 1YQ2A 3US0A 5F3HB 2XETA 1MCNA 3QQ3A 1OSPL 2P47B 1MG3C 4H88H 5ABDE 5HPMB 3WLBA 5IG7B 1VFBB 5IIEA 1KB5H 4O51B 4YHNA 4OZFB 1T03L 5FYLH 1OQOA 4F2EA 3U7YH 3BQVA 12E8L 1CICD 3HC0B 2FJUB 2VDOB 4MNQD 3VYPA 2WKGA 3EJUA 5AW9B 3BIBX 1BF5A 2G60L 2CK2A 3FHQA 1RSYA 4IRSB 3B5TA 1KBGH 3U0TB 3HC3L 1SBSL 5F1NA 4F7CB 5ADPL 1OB1B 3DX9A 3L3GB 2VIRA 1C8PA 4XX1E 1R3KB 1T1YB 2NNRA 1F90L 4HWBL 4J4PC 4WO4C 3SBPA 3ZE0B 2J5LC 3CFQA 2V17H 3FK3A 1RV6X 3I3EA 1N3NA 3HR6A 1NEZA 4Z95H 3V6ZB 1JTTA 3W11C 1MWOA 4NDMA 5F7MC 4WDIB 5LGJB 4AQEA 1SQ2N 2LLGA 5ICUA 3MXVH 5HDWA 4ZAKB 4LP8A 2DPKA 4AENB 3LRLA 4LOVA 3L1FA 3FT3A 5EU3B 5MP6H 3U82B 3ETBJ 1T7WA 4S2SB 4TQIA 5FV1L 4JANA 1F11A 5C09B 3KPLB 1DQLL 1MI5D 5HHOA 1CO1A 3CZEA 5KSBE 5KYYA 4EOWL 1YY8A 2CRYA 3EGXA 1B6DA 4PGEA 2GJRA 4UTAA 3QJOA 3LKQB 2PKDA 3VRIB 1DJWA 4AW7A 4OM1H 5CZVL 3VGDA 5BOPA 3EHBC 3MUGA 4HLEA 1IT9H 1TLMA 5DI8B 3UAJC 4LLUB 4F1SA 5KN5B 2CUHA 2XNAA 5C0JA 4APQA 5TF1H 2B59B 2YPKB 4KHTH 2QVTA 3ASOB 1MAML 2VZUA 3L3DA 1T5KA 3T6ZA 4QRRB 4C83B 1ADWA 5GZOD 5G2NA 3QFDB 4OCSL 1E9QA 1UACH 5CGBA 3H9SD 1VA9A 4BCYA 4KJPD 5E6IB 3QYCA 3UTZB 4JFDE 2FQFA 3EO1B 3P4NA 1N8OE 4AV0A 1BDYA 3L8QA 1MJ8L 3QDJE 5CBEA 4BGDA 1A14L 1OP5H 5E2VH 3BUTA 2WIIB 4XB7A 4B3EA 3IMUA 3GSOB 4ACTA 3QUXD 4QLRA 1OP5K 3FQXA 1HYSC 3NYKA 3V4PB 2NY2C 3LS5H 3P54A 4LL4A 4HMCA 3V9CA 3R06A 5T33L 1F4XH 1NIBA 4QHNA 3LS4H 3KGSA 5IFAH 3BGFC 4YL4A 2V9TA 1U21A 1XR8A 3HRZC 1S3KL 2F5AL 3PFUA 4Q6KA 5ICYB 1RUAL 2OL3A 2F19L 2UZYB 1T3FB 2NY7L 4DK5A 4MSWA 3IJ7A 3KYNA 4N8VA 4OLYH 5B1AB 2XWTB 4BK5C 2V2WA 2X5PA 2MCPL 5GISH 1QQDA 3H85A 1CK0H 5CFHA 1BMWA 5DD5H 4O2EA 1J5DA 3U6RB 1OM9A 2FX7L 2NLJB 1FHNA 1I1FB 4HGKC 2BNRA 2EO7A 1PZBA 1HILA 2W88A 1ED3A 3JYCA 1IGFL 4MHHI 4UT6A 3CCHB 2Y06L 2HTLC 2N01B 4XP5H 2DLIA 3KH4A 5IGXL 5CGYD 3ZDXF 2ERJC 1YEFL 4KPHH 2BWDA 2CLVA 3DVNB 3QPQD 1U8OB 1NGWA 3MRQA 2QVIA 3HUJE 1XTLA 3EXJA 1Z0NA 1AC6A 5ANHA 3WGUB 3MC0A 4RFNC 5HHVH 3STLB 1DFBH 5BOJA 1HL8A 4HCRL 4CVWA 3KYMA 3VRJB 3VMPA 1A7PH 3EF4A 4MB1A 4L1BA 4BFFA 3ZL4H 1PG7L 3EAKA 4G5ZH 4U6HA 4YGVB 2HJLB 3B9KD 1C7TA 4PJBA 5IB3B 4JDTH 4RDBA 3W81A 3CDFA 3HIZA 4XHJD 3BN9D 4KI5D 1VKXA 4JKNA 3RU8H 4LCVA 3WU1A 1I85A 5CWSA 1S8DB 2X1XR 1BQHG 5HI3D 4CADB 4ABQA 3CWGA 3VFRB 1X5HA 4V33A 1U2CA 3ZE1F 1V7NH 1RZKH 5DGQA 1WBZA 4FTDA 1LYQA 2DICA 5KYWA 3CLFL 4EIUA 2ZOWA 4KZEL 3GNMH 5T1KA 1HWHB 1SXCA 3NJNA 4YOKA 5KBMA 4NQQA 3SBRA 1EDYA 2I60H 4L4TE 3MRGB 4GBXD 2WLLB 4LLAA 1BVNT 1ZXQA 1IKNA 4HHAA 2D3VA 3N91A 3HI1A 2PPDA 5E9AA 5LCVH 5IW6B 2WWMD 4HFWB 3LPOA 4C56B 1ET8A 2GY5A 4PRIA 4YBLC 2Z65C 5H4YA 2ESVE 1I1AB 1ROCA 3PXHA 5IHUH 3K71A 5EPMB 4P2OA 3V5KA 1QI4A 2VR4A 3BUPA 4MCMA 4XBMA 3RL2A 4APXB 1N3NB 3H2QA 1MJUH 3ZZQA 3BXNB 4ZMAT 3RX9A 4XTRD 2FUTA 1A5FL 2VH5L 3QWNA 2DQDL 1A6WL 1EMTH 4XNXL 1IAKB 1QI3A 3FCTB 3O8XB 1TEGA 2Z31C 2ENSA 3D08A 3QIWB 2D73A 1I53A 3BYYA 1NCCH 3SKMB 1F97A 4Y4HB 5D7LE 2FO8A 1ZS2A 5J57B 3VXMA 1KEML 2D7OA 5AENA 3SDAA 4IGBA 1RHHA 3TNNA 3DDFA 4Y1AB 3PJSB 3LEXA 2Y25A 3PL6C 4J7RA 4LLVB 1C1EH 5DC2A 3QDJD 3SOBL 3QWRD 4M6NL 4AQAA 2OMTA 1DYZA 1KJ3H 3L9YA 1AR1D 3UPRA 1G87A 3L3JA 3AREB 1UB6A 1P5UC 4JHVA 3HNSH 1BZ9B 1J1XL 1DQLH 3LPFA 3CHPA 4ZXBB 4G6ML 3KXFB 4LGSB 4DGVH 1PZCA 5HDQH 2NSXA 5EORH 4OTXL 5H2BA 1X5LA 3SKJH 4FLQA 2L7JA 4KDTC 1MHCB 4DO5A 3OR7A 4PVMA 4KAQH 3WDJA 4FADA 1QNIA 2H0JA 1WZAA 2KQMA 4S0SD 4WJ5B 5FYJU 1DVZA 1ZSDB 4GAAA 4OV5A 1K5WA 2QKIC 2AJXH 4XMLL 4CKVX 3CN3A 1OAZL 1WS7A 1F1GA 1Q38A 4JDZA 2XFXB 3L9RA 2DMBA 8FABB 1BW8A 4Y5XB 4ZG1A 1N0XH 3D51A 3GMNA 4JZNB 4LSTH 3UBXI 3X12B 2BJMH 2DQCL 4BSVB 1J1PH 4CN1A 3DO3A 4MS8D 4P4RA 2UYLB 1VFBA 4FNRA 2ADIA 1NJ9B 3X12A 3MBEB 3V5KB 3TBYB 1IEAA 1G0YR 3KYOB 4QRSB 4EMZA 4HVBA 2BX5A 3P77A 2OMNA 5KS9A 2JIXA 1FSKB 4X4YB 3GS7A 4ZYKA 2ZX8A 3KLDA 3VX1A 2BOBA 4M5YL 2D4FA 4ONHB 2NY7H 3B9KB 3ECWA 2A9BA 3HS8A 4JN1L 5I0WA 3O3DB 4PGCB 3RWDA 1NH6A 4XOBA 1F42A 3QPXL 4P5TC 3SGEI 5D96B 2HMIC 3B8SA 4HZLB 5IVOA 1HHIB 3VGAC 4XNUL 4L23A 5K93A 4ZUVB 4NQDB 3GS0A 3UIYA 4FI7A 3BVNA 4PJIF 1HN1A 3CFMA 3F65A 4HISA 3MLWL 1XR9A 5E94B 1TO5A 4D3CH 2I24N 4JFXB 5BZWA 4GINA 4JFFD 4R7NA 5CD5D 3KGUA 1XB3A 2N1TE 4XBGA 2BCKB 2FD6H 4TNFA 3K4ZA 3AB0C 4ZFQA 1SYVA 3ARGC 1JHKL 3FO0L 1UTDA 3V5DB 4BH7B 4CGUB 3TPUA 4ADJA 1P6FA 2PR9A 5IVXA 2DLTA 3W56A 1B3IA 2VCOA 4QO1A 2ZIDA 3LY6A 4AW4A 3WXWL 4IBZA 2ED7A 4YDIH 2FH6A 3O9WC 3QUYB 2HX9A 5AAMA 4AT6A 2EUXA 4JRYD 1T6VN 5FGCE 2EIJB 1W72H 3QI9D 5DHVH 4WTQA 4F15C 1J9QA 2WUBL 2D3JA 2WPGA 2WXHA 3D3VB 1CTOA 4HIEA 4J1UA 4TUJB 4WNQA 4WWKC 5D4HA 5IY5B 4Z7QB 1VSCA 3PF2A 3P2BA 2VLJD 3MSPA 3EOBA 4QNPE 5E8OA 2EEAA 4B6ZA 4JG1L 4YHOH 3V0HA 4RFNB 5DRZA 3ZTNH 1FF5A 4QIRA 4NSKA 1I7RA 4I3SH 5ERWA 2PWHA 2F7IA 1ZLWK 1BVOA 4GMTH 3NIGB 4IJ3C 5ICYA 4FFTA 5DRZB 3GUTA 2VM4A 3O4LA 1AANA 4WUKH 4FQXC 2OYKA 2OSLA 4OM0L 3VW3L 2C3XA 1SJXA 3QH3B 5I1JH 4OZHE 4X7SL 5A2IH 1CZ8L 1GIGL 3IS1X 4PBVC 1JWSB 3OVUB 4RQQB 1QR1B 3LKRB 3LHPL 3ZJAA 4KY2A 3E3QC 3E1F1 3O0RH 4Z3EA 4ONFH 2X28A 3BAXA 2HJFA 3V6BR 3NFSH 4PJXA 4OIAA 1J8HE 2UY7A 4YS4A 4KQ4L 3UCQA 2OSXA 1F3RB 2OAAA 3I3BA 3WFHB 1JGLH 2VGLM 1KJ2L 4G7RB 1X7QA 4JO2L 4ZXBA 2XACC 4OCXH 3D0VA 1U8OA 2ORBL 3EJCA 4PJGB 1GYWA 1KBGL 2YGOA 4CDHA 1WUZA 2GW5A 1A7NL 1H8LA 3DOIA 2NX5A 3IKCA 5AW8B 1PLAA 1HSAA 1XL6A 5FK9B 3L9EA 3SCMD 4AEHL 3IDNB 3V52L 1I7UB 2QPDB 4XVUC 4IM8A 3Q48A 5DD6B 3GBNH 1JV2A 2XU9A 4NYLA 2LU7A 4JDEA 4KTDL 3C60A 3E6FA 5I18H 2E7HA 4IU2A 5AYUH 3U9PL 3Q43A 2XVBA 4P2QA 4XZUA 1H3PL 3IETA 3LV3B 1H15B 3Q2NA 4FXKC 2OCJA 4GQZA 5H8DA 1BXXA 2B5IC 3MRPB 5ICXB 1IFRA 4HIJA 4JKMA 3W39B 1YC7A 4X4ZA 2R0ZL 2JJUA 4UU9B 4YX2H 4CNIB 3QXAB 1K4CA 5TPWL 3C9NB 1DLHA 4M00A 1R17A 1T20A 5B1JA 3ZL4L 1RSFA 1KPVA 1JJUA 2IBGA 4KI5E 4OFYA 5CCJA 3F7VA 4F9PA 3U4KA 4AC4A 3HC0A 4PJ5E 4HF5H 4Y4HC 5L7XL 1NCIA 5IREA 2ICEC 1QLEH 4GNKB 1CDYA 5AVVB 4L05A 5E9DE 2A74B 4NQVB 2ED8A 5DJZA 3RU8L 3BDBA 3C60D 3WIHH 2BJML 1JPGA 4LOUC 1PY9A 2OL3H 2NW3A 5DZLA 4ZSOB 4CAGA 4UDUB 4BH8B 3CXDH 1A4JB 1U3JA 2A74A 2EE6A 1PLBA 4Y2DC 4QGTA 5E8NB 2V8LA 4YNYB 3HN5A 3SDAD 4ELMA 5J1SC 5INCA 3S98A 2X3BA 4HXBH 3R1GL 4U4BA 3V6OE 5D5MF 1Q0XL 4HCIA 5CKAA 2AI0H 2VSMB 4PV8A 4AXWB 5DQ9A 1SLXA 1X6NA 3BPOB 2VERA 5SWQA 3NCFB 1SYSA 4NT6A 3VX0A 2IOIA 3RHWF 3TEUA 1CGYA 3BT2H 4XVSL 2CPCA 2WNWA 4NO5B 5EBWB 3SKNB 4QRRD 5FA4A 4GXVL 1DEEB 2WSPA 3WFHA 2CJTA 2GCYB 3Q3GB 5J3HD 1IFHH 4AOFA 3MRDB 2PPAA 2QV2A 1DQJB 3C5ZB 4F5CA 5IK3A 4ZW3A 2RACA 2F58H 2P5WE 3D09A 2FYVA 1ZLSL 4NWUL 1GJUA 4GRWF 1G0DA 1ZVYA 2Y0SA 3FO1A 4MA1C 2OXGA 3KGTA 5CHNB 4F37K 1BOGA 3VFWB 3SKUD 3EW3B 3RGVA 4DESA 2IQAB 5CEZL 3QZWB 1DQTA 2OXGB 4UNIA 4WQOA 4QRUB 4UILL 1R3HB 4X99B 5TGBA 3ZHKA 1C16B 3IGLA 4DP7X 4ZUWA 3VFUB 4UQDA 2PN5A 3O3EB 3WXWH 3DETD 2AEPH 3C5JB 4E68A 3SEPA 5FUCC 1ILUA 3N5AA 2FUQA 4YDVA 4LAQH 4IW4C 2ATKA 3PWUA 4CN4A 1S7WB 4P07A 1M6OB 3W0WE 3V4VB 1YYLL 3BCFA 4OSUH 4Y5XC 3ZK0A 5E4IA 3ZYIA 4AGPA 1QNZL 1UM6H 1PZSA 2YPVL 1NSNL 3AZUA 2EZ0D 4CMHC 2Y07H 5HD8C 4GT7A 3NGBB 5EOTB 5HHQB 1TZHB 1E42A 1B2YA 2UZIL 3O9WA 5TFSL 2IXQB 3D3VD 2Z92A 4M1CC 5AKRA 4ZTPH 3VFRA 2DH3A 5AZEH 4A7TA 1Z66A 2OTUB 3STZB 1M05A 3CLFH 5INDA 2NY3D 1HINH 1E43A 1TUPA 1N2RB 2ZAIA 5D1QA 3CN4A 3VFSB 1BAFL 3ZDYB 3UJTH 2VNCA 5ID0B 4WUUA 2AV7A 2WY3B 3DX8A 3GSUB 1L6PA 4IS6A 3SE8L 1UXMA 3F7YA 2JV6A 4HLZG 3FUJA 1QP1A 1QHPA 4JFHE 4RAUA 4NJ9L 1UH4A 1YEDB 1E30A 3B2VH 5KYUB 1FYTE 3B7TA 1U9KA 4RRPM 3NIDF 1DSFH 3GMRA 4X8CA 1BCIA 3NSFA 3BO8B 3DGCR 1WFNA 4PRPA 3AITA 3OV6A 4HZLA 3U0WL 3B34A 1M56B 4XOCA 5I75B 3H6JA 4AIXA 4HUWA 1WYJA 5D7IB 4DJMA 3D69B 1FJ1A 2XXMB 1KB9J 5AOIA 5T3ZL 2ORBH 4DZ8A 4E36A 5EIVA 1SY6A 4KRNA 3V52H 1BAGA 1PQZB 3ZTJG 4AGMA 5TDNA 4GQPH 4HZAA 4WFHE 1DSYA 3GWJA 2PYFB 2UVFA 4Y19A 4TM9A 3V6FA 5GGTA 2G3NA 3G6JB 3MOBH 3FO2A 1L3WA 3BAEH 5CZXD 5E5UB 1BQSA 1G7JB 3HBGA 4QJ5B 5BQ7B 3AG1B 1BJ8A 3O3AB 3KVDD 2VMCA 2NY2D 2H32A 4N0UA 3H7BA 5EO9B 3LEYL 1N4XH 1FFOA 4AGQA 3CJJA 4LEOB 2X4NB 2E56A 4JM4L 4LHUB 3CVHH 3EDEA 5EA0H 4LVHB 3IDGB 4F7TB 1CMOA 4LASH 5CXPA 1DBKH 1UZ8B 3GXPA 1U8KB 3PHAA 3BUYB 2BY2A 4J1UB 3K2UL 5CJOH 4PGCA 3QFGA 3RWDB 2B14A 4AQZA 2VDRL 2AS5M 2V2TA 3MRMA 2QELA 2YMOA 1ESOA 4LCUA 5K9OB 3V5HB 1I8LA 5D93C 1AGFA 4LXFA 3F5WB 2Q7AA 4OLUL 3FQYA 4L9DA 1C08A 3PLYA 3MBEA 3BAIA 3MV9B 4AL8L 3GO1H 3US9A 4I3SL 2Z9TA 3ZHFA 2D7TL 4FQQA 3PP3K 4ZX5A 3NPSC 3F12A 4KKZA 3UG3A 3KCPB 1ETZA 2Z8RA 4G5AA 4FFZL 1YCSA 4HP5A 2P4AB 3S35L 1E6OL 2Q9OA 3VWJC 1ZEAH 3GSNL 2EDRA 2I85A 2GFBA 4YHZH 2DM4A 2HN7B 4KK6D 4I0PA 3IVKA 4OGZA 3JV0A 4QKXB 4Z9KB 1PD1A 1Z5YD 4AVJA 4JB9H 3QDMA 5DMJB 2WAQA 2J4WH 4G6JH 1IM9D 1JMZA 3FS9A 2QBWA 3V4VH 3X3GL 1CXHA 1ZTXH 4P2QD 4DKFL 2YGQA 3JWDH 3CK0L 3TLRA 2EQDA 3EYSH 3O8XD 3EO0B 4KX9A 3RA7H 1MFUA 3NQIA 4KQ3H 1J48A 1INQA 1OP9A 4QR7A 5I1KH 2DOCA 5AFAA 2Q20A 1NIFA 1NCOA 1Z32X 2GUOB 4NXSA 2FD6L 5G4NA 1OE3A 3QIUB 3CFBA 5IVZB 3IB4A 3IJ8A 2GJ6E 4PJCF 1JHKH 1HXMB 3FO0H 4KBPA 4LEOA 4Q6IB 3TO2B 3V4UL 3GRGA 3W2DH 4S1QH 2J5WA 1C12B 4ILDA 4JFFB 2VR5A 1A6WH 4DN4H 4D0DB 4Q9QL 4XMKH 1WQVT 3W37A 1MCFA 3QZOA 4NSKB 4RIRB 4DQOH 3HC3H 5F71A 5BQ7A 4FS0A 4X9YA 3ZKXB 3HZMB 4P3DA 3F7VB 4LVNB 3WNLA 5DFTA 2BNQA 5CZKA 2AJYH 1RFDH 1WH0A 4KK9C 7PCYA 1DVQA 2Y2TA 3QC6X 2HT3D 4X0KB 3T1WA 2CAKA 4PP2B 1KN2L 3MI6A 4NOBA 1U8PB 3WY1A 3RUGF 3UZQB 5L2JA 3GTTA 3MRPA 3GPEA 5ICXA 5IWLA 1OV8A 4HU2A 5TFSH 4YUEH 5I1LA 1BQLH 3GI9H 4JKPL 1EZSA 2C4XA 2ZCLL 3VB9A 3UZQA 4AYGA 2QSQA 3MCLL 4NZJA 1WPCA 2VAJA 2A6JA 1R3LB 5E9DB 4XO9A 3KAAA 3P9LB 5L2KA 4B7LA 4NXKA 3RVTD 4S1DC 5HYQB 2BDNL 5F6IB 5AZEL 3MUGB 4PUBH 1EO7A 3P9WB 4S11A 4F7EA 2HAZA 3C12A 3JV6A 3L3KB 4JFSA 4MKMA 2RD0A 2JLPA 5B38A 5E6YA 4WKZB 4UQ2A 3KDPB 5KOVC 4HV8B 3WUWB 3G5WA 1MAKA 1UG9A 3SOTA 1T04A 3VFTB 4O9HL 1YEKH 4HD9A 1IGTA 2X4SB 3CZUB 3FT1A 3GKZA 4LDLB 4N2HA 4BQ9A 4WWOA 2BP0A 4N0YH 2BNUA 2C1OB 3D39A 4L8SB 4NKDB 4N2IA 1J9TA 2LAAA 3FCSB 2P5WB 1A0QH 4PJHF 4U6YA 3STLA 4BZ1H 1SJVA 2FJFA 4KX7A 4A6YB 1EZVY 4X6CB 4AL8C 2CA4A 3GC3A 5EU5A 4FQIL 1QHQA 3TN0D 4EN2A 5CZRA 4B5EA 3LYRA 4EO5A 1W0VB 4QXGL 2KMWA 4U1NB 3FFOA 4LCWA 3VRLE 1OCOB 4Z7IA 4H1LB 2NRDA 2AJZB 3SYOA 3TBWA 2BSDA 3LNIA 4FHJA 2WXJA 3Q1SH 3ZBMA 2CSPA 2F74B 2C9SA 1A6ZB 1PG7X 1MF2L 3VJ6A 4ODXA 1R5VA 1QRNA 5BMFL 4GKNA 5KW9H 4CMMB 5F97E 3T8MA 2BY0A 4XXDA 4BWWA 4NPYA 5D2NE 3W0WB 2MMXA 3VJ6B 5E9DA 5L6YL 1RZJC 4F58H 1XWVA 5JUEH 2D31A 1U8JB 4Z7OE 2V5YA 1K6QH 4X6DB 3U48A 4AMKH 4YDLB 2EDWA 3CXFA 4RNRA 1MNUH 4G83A 4BFNA 1IAMA 3QK0A 1USZA 3EYVB 1FORH 3EBGA 1FDLH 5SX5H 1QOKA 4XN9A 2CDEB 4KJQD 5MEOA 3QUKB 3WNNA 3UTQB 2DWXA 4UTCA 1VRSA 4LLYA 4Y89A 3QJTB 4JZOB 1ZV5A 4G80B 1HCFX 43C9A 4LPYA 1E4XL 4WFGE 3UBGA 1I1YB 1VENA 1WWBX 1NC2B 5DEFB 4OBRA 1ITCA 5AVUB 1LP9F 3QGVA 3TV3H 1E9QB 3LEXB 5LBGA 2RQ8A 3W9DB 4FYQA 1YPZE 2VLKA 4ELMB 5LGYA 5GRJL 4PJEF 1EPFA 2R0WL 3MLXL 2WD0A 5J12C 1W8NA 2BHFA 2GUOA 1CLOH 3DHUA 1WLHA 2YPVA 2VLKB 2V9UA 1JBJA 2VDOL 4DP4X 3PGCB 4JRXB 1LP9B 1GGTA 1I1YA 3ZRSA 7PAZA 4X6EA 5HGDB 5GRUH 4NKIH 1JNJA 4R97B 1RK7A 1CICB 2F61A 2OR9H 2YAEA 4JQIA 5D5MA 3PDOA 4EXPX 4UT6L 2F19H 1XGYL 2XC8A 4U0RC 2H3KA 2WBJB 3VFMA 1M6OA 4O02L 2HFFB 3TVMA 3FMGH 4PLKC 1EJ6A 3EOAA 2HG5B 3PNRB 2NNCA 1EAOA 3WTWA 2Z31B 4KMQA 5LQBL 2YC1B 4FHBD 1JZEA 5FHAH 2JB6A 1CLYH 1KCBA 4KK8C 4M6OH 5DURD 3ARBC 1O6VA 2PWDA 5BRZB 5ISZD 1KGWA 1RIVH 4UDUA 3QNYB 4B9JA 4BH8A 1XGQA 5AW6B 1GTFA 3GIVB 4ZXBD 4GKNB 3KGRA 5HDBE 3EDFA 15C8H 5FO7A 2J1WA 3B83A 2NQ3A 4NUMA 1SN0A 2PR4L 3OGCB 4XC1H 3PWVB 5HI5D 1HWWA 2HX8A 2JB6B 4YHNB 3LB6D 3OG6B 1FFPB 1J05A 3L08A 1EDQA 2X4RB 1JZHA 4LSVH 3QJFA 4P2RA 2XXCB 5HDQL 5DMGD 3RUGE 3KPMB 2YBRA 4Q0XH 1WZMA 2QVFB 4Y4HD 3NFNA 5K9KB 3FXIC 2OTPA 1TYJA 2FT8A 4ZUSA 2PXYB 2ZJSL 2GABA 2NY5H 1AI1L 4A6YL 1T66C 2NXYC 1PZ3A 1EV2E 3DV4B 1AMXA 4NDMB 4U4IA 4JHAH 1UFUA 4RMQA 1LP9A 2GTZA 1JHTB 3IPBA 2G4GA 3QXWA 1RZGB 1P2CA 3EJSA 4UTBA 2GJZB 2PMZA 4MNGA 4GG6E 4RWHA 4KKAC 4M7JL 3KDMA 5IJVA 3TPUB 3L2MA 3VCLA 3TBVB 3TJPA 1U8MA 4PWFA 2DTSA 4J4PD 3DGGB 4G8FB 3UBXB 5GQBA 3ULVH 3CX5K 3DV4A 4TQEH 2ZOLA 3WCYA 2YC1A 1RIHL 4YXLH 5FWQA 4LPCA 4PJHB 4UT9L 5LBSL 1AY1H 2G2RA 1FPTL 3ILEA 1B0IA 2IVFC 3ARRA 1MJUL 1RUML 3MTXA 4FQXB 4NKOB 1I7ZA 4XWOC 2W07A 5DJYA 3RPBA 4KXDA 4OZHF 1U58A 4MQTB 4PBWD 3R1GH 2WBJA 4ZFOA 4WI0A 4FL4C 5A2JH 4RRPG 1ETA1 5ITBL 2WTRA 4GUPA 4MTMA 5JOFA 1T7YA 2VQ4A 4I87A 3UYRL 1DVYA 5JIPA 2EO1A 3FUEA 4ISVB 1TZIB 2XVGA 1AXSB 2C3VB 4WFEE 4BUGA 4JQVA 4OGYH 3FC8A 3T3PE 3BPCA 4HAFA 4BELD 3JZYA 4J4PA 1FE8H 1YLBB 4JY6B 1D6VH 3FUMA 4KRPC 4S1RL 2F5BL 4F91B 3O0LA 3HZVA 5TQ2H 3ULUL 2PP9A 3LKSA 4M5SA 2Y36L 2E8YA 2IDCA 3G08A 4K3GA 1DFXA 5MHSE 2OL3B 2WMPB 1PY4A 5EORL 2BK8A 4K7PX 4LVHC 4P06A 1H8NA 1MWAA 3UTSE 5ECJE 2BFGA 5EZJB 4JDVA 4P5MB 4KFZC 2KC0A 4IOIA 3OD3A 1WFUA 1FQ9C 2V2XA 2UZXA 2IPTL 4CVXB 2EZ0C 1UWXH 2EVGA 4TUUA 2QSCL 2MCG1 1P2CB 3HUJA 1G7QA 3JWNG 1U36A 3MNDA 4L4VB 2HVBA 3EGSB 1G7HB 3GI9L 4JKPH 4U1GB 4UNUA 5D7IA 5I73B 3Q8BA 1FAIL 2Q76B 3WL9B 1UOLA 4XNMB 3AVEA 2J8UB 4WW1A 1JNNL 3UJJH 3OKYA 5JPMA 2QGBA 3CFTA 5I8KL 1J0ZA 1IGTB 1OTTC 2MQGA 5FGBC 3B7RL 1Y7VA 2NQDA 3WEAA 3WS6A 4NWTH 1HHJB 2XKUA 1T0NA 5FO8A 1G84A 4NN5B 1FVEA 1JRHH 3ILPA 3U0TA 5FK9A 4F7CA 4Z3IA 5CCKL 4FQ1L 1JE6A 3DOHA 1PX4A 2I32A 4JFDA 1TQWA 2XZCL 3K4DA 4PWEA 4MJ2A 5G4MA 4UAHA 1D9KD 1O6SA 2PCPA 2WNXA 2H32B 3G3LA 3V2AR 1I9RL 3K2MC 4JNXA 3MLZH 1JTPA 2DMKA 2DD8H 2FSEB 3CFJB 4L3EB 3UBXA 4OZFA 1T1ZA 2AJZA 1GAFL 3ZHLA 1UB5B 2IG2L 2CLRB 3L1GA 4Z3TA 3QNYA 2TSAA 1QPXA 5DJXB 3B9EA 1RZ7L 3FT3B 5EO0B 4AJWA 5JMRA 1P7QA 4X6FA 4FQ2L 4GMSH 2XBZA 1N6VA 3GLEA 5E1AA 3WFDL 4N0YL 1WS8A 1UASA 5ESQA 5JQIB 4KHTL 2J6WA 4KGLA 3EKCA 3DX7A 2YRBA 3B2UD 1UZ6F 2CCVA 1FFNB 3GSQB 1VFMA 2YUZA 5HHXH 1P1ZA 5E1AB 5IB4A 1E28B 3SJVA 1U8CA 4YPGB 3VXRD 4IDLA 1U92B 4BJLA 4BM7A 4MXWL 3PV7A 5DJXA 2BWQA 3U0WH 5F7EH 5DJ2B 5BVJA 3KWWA 5EIIA 1XH2A 4FQLL 1N64L 4HMDA 4U3SA 2EVFA 1NTDA 1YJDH 1GC1C 4MFHA 3FO9A 4Z7OB 4BFEA 3DDGA 1SMAA 1QZ1A 1PD6A 2EEFA 1LD9A 3FKUS 4W4OC 3CFKB 3FB5B 4AQ8C 4TSBL 3Q8CA 5CLYA 1JZIA 1KTCA 3T0ED 1G9MH 3KG5A 5TE7H 3ZZLA 4XN5A 2ZJSH 4P4KD 1UQSA 2EC9T 1SHXA 2R7EB 3KWWB 4JMNA 5EIIB 5IW1B 3KYKL 4HKZA 1UWEH 3EXLA 3ROOA 1NQBA 5EOCH 4AENA 5FUZL 2WQUA 5I66A 4FE9A 4PSPA 1WWWX 1OD7A 3A4FA 4HT1H 3WL9A 5CKGA 5KBPA 3QCVL 1TVHA 3IMBA 1ZJBA 3LXAA 3HCVA 2OMWA 1LTXA 2VMJA 4H5SB 4PJ8C 1G9NH 4N20A 3FQ1A 4FEMA 4XTRC 2JH2A 1SDDA 3D33A 1ROWA 3HLAA 4PSRA 4B0MB 1N10A 4JZJA 2N0KA 4YX2L 5T1LB 3BZEB 5TD4A 4ZQKB 1FCGA 1YNKL 3BN3B 2DL2A 1FPTH 3TCXA 3ARFC 3QUZC 1TPXC 4UDTB 2MKLC 1TITA 4L4JA 1DFBL 4L1LA 5I6LA 1YQVL 4PWJA 5D7IF 4Q9BA 5F88B 1BBJB 5J6GB 3F7RA 4G71B 1HXYB 1MVUB 5EBLA 3OWEA 3L9RB 1NGYA 1QFWH 8PAZA 4P2OC 1L9SA 5LNGA 2I5YH 3N55A 4G2AA 1XGTA 3GMOB 1AY1L 3AWGA 3HHSB 1ZT4A 4N86A 2XG5B 2XQYK 5HGBA 3W5NA 3IGAA 2O6DA 2DTMH 3DXAA 2BRRH 2N7SA 4G7VH 2FQGA 3VU2A 4NP4L 4XWOD 3FFCE 5KANG 2GITA 3LSOA 1CB4A 1E3ZA 1ZT7B 1OVZA 4KVCL 3S97C 4I0PD 1R75A 3X17A 3OJ2C 3P4MA 2BHUA 2HVJB 5D7SH 4BHUI 4MA3A 4RESB 3CNKA 2ZG1A 1U91A 2HT3C 5I30L 3RWHA 4N85A 3T1FA 4OF7A 3Q9PA 1JV5B 4NYLB 4JUTA 1SHWA 4F2MB 1F02I 1MPAL 4JJ5A 4JREB 5K59E 1A7QL 2NLJA 2IQAA 4C8XA 2VITB 5I6PA 2ZXAA 3T0WA 3VSQA 1YDPA 2B16A 4CC0A 5BPPA 2ZG3A 6CGTA 4L8BB 2YQ3A 1CURA 5SX4H 1F0LA 5FWRA 4KC3B 1CI5A 2RCSL 3BGMA 3VXPB 4Y8DC 4M1DL 5HHMD 4KNQA 4G9FE 1FORL 2VZVA 2TSBA 2XXFA 2F7PA 6TAAA 1EHNA 4YBQC 3UC0H 4K07A 2F1BA 2B1HL 2CCWA 2I26N 5T3XH 3OHXB 4M8QB 3RL2B 4OGXH 3UOAB 1MI5A 2BIHA 5HHOD 1AAJA 4IOSA 3ZW3A 1QLEB 2FJGA 3PRZA 4OD1L 4HF5L 5I1HL 1HSBB 4G6FD 4AVHA 1NBZA 3ZE0F 3S3BB 5EUOB 5IB1A 5LNDA 3HI1B 3IDIA 2EJ1A 3UG4A 3IDJA 3ISYA 3LN5A 4EZMA 1JZ2A 1S5HB 2YAPA 1NAML 1RP9A 2X0WA 3EZJB 2SEBA 4G8GB 1GZQA 5E6IA 5E8NA 4FQ1H 3ZTNL 5F7DA 2FX9L 1A9VA 5DO2C 1TNMA 2OMUA 5C09D 3AUWB 3B5HA 4LCIH 1OF2B 4OI7A 4MCZB 3CVIL 3L3HA 3NGBC 5F88A 4L4TD 2FB4L 3A23A 3FTXA 2XQBH 2HXAA 2F8XC 3O2VH 4IOSD 4EKJA 4XODA 5LWYH 4NJ9H 4JRYE 4AYBA 2UX6A 4MD0B 5FCUH 1NM9A 3RFZA 2XN1A 1XR8B 2CU9A 4AEEA 1GJIA 3BUYA 1V7NL 3EOAB 3FMGL 2VSDA 3FONB 3T8XB 3N6YA 3UAJD 4PY7A 2YRLA 3CQFA 1M7DA 1NLBH 3UJTL 4LSQL 4WI0B 3WFEL 1LMKA 4ZYKB 2FWOB 4DP0X 4ZPTA 1A6TB 2C8NA 3OLDA 1CLYL 4Z18A 1XFPA 5HYSG 2EACA 1YN6A 2YWYA 1ACZA 3O6KH 2P46B 4M6AA 1CYWA 2R9HC 3HG1B 5JLZA 3PL6B 4YHYC 5C0EA 1AQMA 2F0CA 4G9DB 3RIFF 1P4BL 2I7SA 3D50A 1ASPA 3EGSA 2BH0A 2X9WA 4ZS6D 4X99A 2O61B 1K4DA 5BS0D 3KR3L 4NJAH 4BFRA 3QQDA 2VO8A 1XX9C 4DNLA 5I5JA 2IH3A 4ANKA 2B9BA 1DBML 2Y36H 1FFTB 4X6DF 1JZDC 3V7AG 5I8OH 2FX8H 4L4VE 2WTPA 1LNUB 4HUXA 5F7HA 1WFTA 4PJ6A 3GMLA 2AW2A 2YRZA 2GC4C 1NMCC 5EOCL 4IBUA 5C0GA 3BP7B 3WIIL 1ZA3A 3P3UA 4BSWB 2LHAA 2VLJB 1ILSA 1XO8A 4JHZA 5IF0B 4WTWA 1DBAL 4CILA 2ZE0A 3VWKD 1UURA 5LUMA 4G8AC 4DHLA 5E0QA 3MGTB 1JRHI 4L5FE 1RUQH 4P48A 1E7VA 1AS8A 1Q72H 3SDXB 2PWGA 2XPZA 4D9LL 4ZMTA 2MPAL 4UYPA 4XMTA 2EDDA 3TYGL 5JHMA 4WFED 3SQOH 4P5SA 4V1DD 1W72B 5CS7A 3NABH 2WXOA 1BYNA 1I9RH 1ZY9A 4P23B 5T1JA 2EC8A 3DX6B 3UEQA 4PJ8A 4MVBC 2A9MH 3HI5H 5HHQA 3UAEA 3ABGA 3LEVL 5LDUA 5IOKA 1CBJA 4IQHA 2FO4B 2BIQA 2DLGA 2P5EE 3QULB 4QHPA 4XP4L 4ZODA 2NNAA 3BWUC 4RGNC 2P5ED 1DUZA 1P5VA 2IALA 5E08L 2V9QA 4W6YB 4P4KA 4JG0H 4PJEE 3F5WA 1HDMB 1HZHH 2XWBB 3ARDB 2IQ9L 5GRUL 4UQAA 4PRAA 3QZNA 3L6FB 1JGDA 5GGUB 4EZLA 3F8UB 3LZFL 5KJRL 3ROOB 4U7KA 5IR1A 1AFVH 1E40A 4IYKA 4PJIB 4NHUA 2ESVB 4Z76A 1TSRA 3ULUD 3LB6C 3LJ3A 5I30H 3P0VL 1AO7A 3EFOA 4JPQA 1PAMA 3AREA 1SOXA 4Z7AA 1ET5A 4DSYA 4G8IB 1I9EA 4PVNA 1XCXA 1H3WM 5I8CB 5IGXH 1OHQA 4DH2A 1OF0A 4FXKA 4XO4A 3MLUL 5AVWB 2A6IB 4IRSD 4RMWA 3BISA 1JXGA 3CZJA 2OMVB 2WHVA 5CJOL 4OLZL 2F8OA 3KPPB 3HFFA 3WE6B 5HHPB 4XC1L 3M1CA 3SD2A 4AJ0A 1LE9B 3SPHA 3QAZB 4LU5L 2HH0L 4NZDA 3GBMH 4X7EC 1Q0YH 2R2BB 1XH3A 1AGBA 2A9NH 1E4KA 5DT1H 4JPVH 5B4MD 3VFPA 4DAGH 4ALAL 4MD0A 5TQ0L 5DSCA 5JW5A 2IF7A 1LE9A 3P4OA 2BIMA 4LSSH 5BS0E 4XX1G 1NKRA 2QGDA 1LVEA 1KBKA 2E6JA 4OCRH 2FGWL 2W9LA 2Z4QA 3RDTD 4F7TA 4Z7WB 4HK3J 1MCKA 2ZCLH 4ICWA 1A7OL 1H3PH 4IRSA 3INOA 2ARWA 3OX8A 2IAMC 3OF6D 1FYHB 4PRNA 5I1EH 4N9OB 5AKSA 4N2DA 2R0ZH 3D12B 5LXVA 1YC8A 1N9PA 1NAMB 2BVOA 1X5FA 2GHWB 3FNKA 4XVTL 5IEHB 3QEUB 2FB4H 5L4IA 1AQDB 4L8SC 1LEIA 2OZ4A 3T6WA 3IRPX 3VGBA 1FNSH 5HPMA 3JUYA 3EYFB 1QFUL 2HCZX 3OB0H 1UEYA 4ORGA 1EO8H 1OP3K 2CIKA 4PRHB 4AIZB 5DUPH 4K94H 1V3LA 1MLCA 4DCQA 3V95A 2QQLH 1MQ8A 3I02B 3SPJA 5B7EA 5IHWA 1OL0A 3K91A 1N6QH 2A7BA 2WVVB 5GGVL 2P5WA 3M17B 4OZ4B 1KBVA 4IOFC 4HUNB 5AUMA 5F7EL 1A7RL 5GGUA 5H37A 4Y2DB 1PX8A 3HI6H 4AG4H 4LHUG 3G5VB 2CR3A 1I9JH 4IRJB 1F4YH 3FH5A 4PJXF 4I1PA 2KDGA 3F2LA 5CMAA 4DCQB 2EILB 2H0FA 3B6SA 4UQ2B 2HX7A 3MJ9H 4M6NH 3IKCB 4Z1PA 4E0RB 3RWGA 5GGRY 1CD0A 3TESA 4HS3A 3MREA 4Y4KC 1RCYA 4EUPA 1JK8B 3BP4B 4YC2C 3TS8A 2AXFA 2G5UA 2NY4D 3BEWB 1H3GA 3MKKA 1CDIA 4M5ZL 5ALBH 7FABL 5EEZA 4LIQH 2Y6SC 1IAIH 1PIGA 1YECH 2BHYA 2XHNA 3PREA 1AG6A 3LPGA 3C87A 4TNVK 1XAKA 2OMUB 1GS8A 3V0AC 2P24B 2ZP0T 4DP6X 2OMBA 4XC3H 3WHE0 3KM2A 3UYPA 5J6SA 3MLSL 4LF3B 3GSQA 1XF1A 3AWEA 1NCHA 1A47A 1H8OA 1KENH 2MPAH 1QFOA 1QSFD 2Y7QB 5BCAA 1MJ7H 4AQ1B 3D30A 3T4AC 2IWFA 4F8QA 2ZAGA 1X5IA 1MY5A 4LHUA 3F6JA 4RGMB 3D2UA 1FBIH 1YY9D 5DD1L 2PTVA 3IDMB 3D18B 1UM4L 1WCBA 5A7BA 1KCRL 3PGDB 5DA0B 4LSUH 2QVMA 4R90H 2YD4A 1WAAA 2FR4A 1Q8MA 3NA4A 4UOW1 4JN2B 1QFWL 3GEFA 1TO4A 5C3TA 1AHMA 3HG4A 2X6MA 2OI9C 4F33A 5IMKB 3B1UA 1KY7A 1LEGA 1YEIL 2G4EA 1F3JB 2P7TA 4WENB 3HMWH 5FS5A 3TV3L 5PCYA 2EDFA 3Q9QA 2VN3A 4EIGB 3QQDB 4MVBD 1YNLL 3FRUA 4KI1A 5TE6H 4BFBD 3JWOH 1J1OH 1R6VA 1U2HA 1E65A 1BQKA 3WSQL 2OR9L 4KMTH 4PW9A 4KX8A 4XNZC 4R7VA 1NLBL 4YXHH 4HBQA 4JB9L 4D0BB 2HVJA 2L4OA 1NCDL 1CGWA 3MRBA 3IMSA 3OXSA 4OB5H 4F57L 2WXQA 4OZIB 3GI8H 2QPUA 4X7TB 3M7FB 5CN1A 2LGNA 2WYTA 4N6QA 3APNA 4KY1H 5D1XC 2JXMA 1YZZA 4FFYL 4RX4A 5E4EC 4ZOAA 4PRPE 3E2HB 1T21A 3KEDA 5CBEB 1DSFL 3QUMH 4JCMA 3RVUC 2BW5A 3UYPB 4S1QL 3ET9F 4P59H 4PJ9B 3QJQB 4WW2C 1SOKA 2DQJL 1NGYB 3P73A 3HAEB 2WLJA 3FCGA 4LU5H 4W9HC 3KPRB 3AXHA 4MB4A 4WHCA 3V4LA 1IQWH 4FAAB 1OXYA 2PXYC 3IDYC 4JFZL 1RJYB 1GH7A 2ICWA 1TTGA 2I25N 9CGTA 5KSVB 4OV5B 4FXGB 3JSSA 2BC4A 3FTSA 4DKAA 2VC2L 3RAJL 5JPNA 5JHDE 3F85A 4Z78A 5JOFB 2IDFA 1M71B 1QSFB 3QB7C 5E4AA 5B1JC 4OD3L 1A7BA 1CR9H 1DDTA 4ODUB 3J07A 3IJYB 4DAGL 3HG0A 1NAMH 5DHYA 3OKEA 1S7WA 3MUY1 4EOWH 4LAQL 3T65B 1JPSL 3U1SH 3FZUC 3CH8A 2EE2A 3LZNA 4ZJ9A 2W95A 5J6HA 4L3FA 5DTFB 3M1OA 1WP6A 1O7SA 3T2LA 3LZOA 3I75B 1QZNA 3TEXA 4OM0H 2A74C 4LLVA 3AMLA 5FYKH 3VW3H 4K94L 3PGCA 3A4DA 4IGBD 3DPBB 4BFIA 1OB0A 2V5SA 1S3RA 4IHBA 4OU3A 3RTLA 3DROA 4QGYA 1OOAA 4Z7UA 5HYSB 1RZJH 2KUTA 1PIFA 3V5DA 2ESVA 2LW3A 4UB0L 3GMMA 1ETZB 2X6VA 2YMTA 3FQNB 4TNEA 4J28A 4KRPD 4W1TA 2Y2WA 3FT2B 1RU9L 3H55A 3Q06A 2XKNA 3V0WH 2YLKA 4NQED 3HG1A 3ESMA 3OKLB 4Y88A 3S6CA 2HFTA 3UCRA 3ZHDA 1PSKH 1DSWA 3FT9A 4RFEB 4I77L 3F05A 3MGAA 1KLFB 2H9GB 1CXLA 3EUUA 2PF6A 3GMQA 4N8VG 4TRPH 4LCUB 2FJSA 3BD5A 4GW4B 1M42A 5E2VL 4Y7OC 4GBXA 2JCCE 3FT4A 2XWJA 1O0VA 4S1DD 1L9MA 2W9DH 2X89D 3MX0B 4K7PL 4R2GC 1ZHBA 1JZ7A 2W94A 3WO3B 2Z31D 3S8WA 3ZOAA 2ADFL 1OPOA 5E51A 4K3EL 4PRIE 5FM8A 2EEBA 3GLZA 1R0AH 2CR0A 5DQJB 3AY4A 3DA0A 4N6RA 2CUIA 3BVUA 1MEXH 1OZTG 3QXDA 4ERSL 1SDAB 3HAEA 2V5MA 4NIYE 5H37H 4E5XG 3B7SA 3GHEH 3HG1D 4YIQA 5IHZB 2VMDA 5I9QC 3GUTB 3P02A 5DEGB 5DR5L 4RIRA 5CJ8A 3A6BH 3QZMA 3ELQA 2Z8SA 4ISVA 4FF9A 4M6ML 4X42A 3QYNA 3N1PC 2IH1B 4XWGH 4Y5XA 5LXGH 5KG9B 2WXRA 4GAFB 5BS0B 4Y4KA 2MEJB 1ES0B 1YMMD 4Z7WE 1YSOA 5HGHA 4I2XE 2W80C 1L9QA 4GP5B 1VGKB 1NUNB 4YZWA 5HDRA 5KSBB 3IFOB 3CZFB 2F8IA 3EFDL 2CM5A 3O4OC 1HS6A 3BKCH 2DIBA 3FQNA 1A7OH 2BVEA 2XQ0A 1XIWA 3INUL 1U42A 3S3SA 1V55B 4H8HA 2NNXA 5EBMA 3VXQA 1KTBA 4O58L 3HMXH 3NIFF 3PUCA 4F27A 3SPVB 4R7DA 3PAUA 3PPSA 3HAEG 3S88L 3LKQA 2OR8A 4L9LA 1CLOL 5D7JB 1E4HA 3IFPB 1HYSD 1RUPH 2VT0A 3GTVA 5GIRB 3MNMA 5EMYA 5SWZA 5BZWB 3BZFA 2HFGH 4HLJA 1JN6A 1RZIB 3DYOA 4PS7A 4B9YA 4DETA 4Y1SA 1T83C 5DK2A 4R97C 2V9RA 4NGHL 3QEGH 4S0TD 5T3ZD 3W38A 4JREC 1Q94A 3ML9A 4ZUUB 3CFIC 4Z3GA 1MFBL 3QDJB 2JKNA 2K45A 4HJSA 5L2JB 4FXGA 1A6AB 4DZBB 1T7XA 1NCCL 1CLZH 3PIQB 4MD4A 3QJHA 4PS3A 2VIRB 5D2NA 5EHFA 3WKYA 2WP3O 5D7KE 1JV2B 4G70B 4ZW6A 5HVFB 1B4JH 2DF3A 5E8EA 1UENA 1GRWA 2ZUTA 1CFBA 4LAJH 5D1XB 1MCPL 5D2LF 4J23A 2VDLH 3IWVA 4PJAA 1UCBH 5E4EB 3ZDZE 4PG2C 1YYCA 3QEQB 4L2YA 2EDXA 5AZUA 1GGUA 4FFWC 3PGFL 4HULB 1IQWL 5CFAA 1XF2B 5EV7A 2EO9A 3CV5A 1R5IA 4HS6B 4MDJA 1JNNH 3UJJL 3APDA 4IHOB 2X7LA 1JUFB 1AZCA 4H1LH 4BK5A 1IVTA 3QI9C 1D5MB 5J8OA 1ZE3C 4Q0XL 1ADQH 3GM0A 3H53A 4WW2A 5CINL 4YDJB 1L5GB 2FBRA 1RY7B 2A6JB 1TVHB 3MRIB 3UX9B 1PAZA 5IVXE 1ZT1A 1GPOL 1QMUA 4NQXB 4G43B 5JW3H 3IFNH 5ALCH 3T0EE 1UD5A 3BSHA 4EBQL 4PGBA 1LLAA 2D2CC 4U6VL 1T5WA 2X41A 4BUQA 1BEYL 2H1XA 2MNJB 1NC4D 1E27A 5JPNC 1OQXA 3BZFB 5AVTB 5LBVA 4N22A 3EYFA 3JV6B 2R29L 2E7CA 3E8UH 5C6TH 3K6FA 4ZD3L 1YQVH 4KO9A 1KJMA 3V4PH 4DEPB 4I0PC 3EGXB 1BIIA 2JJVA 1JGEA 1JNLL 1M9SA 3SBWC 1YNKH 1MWAL 2ZYHA 3WLBB 2H1PL 4L4TB 3IF1B 4GLRH 3HG5A 4C58B 2LLLA 2RIKA 3MV8A 5FV2A 1J8HB 3K0YA 1UH2A 3S5ZA 4Z7WF 5MEOB 3MQIA 4JHWL 1HESA 1CJYA 1AKJA 4MQ7B 4UIKL 3MLRL 3NCWA 2JE8A 4GKLA 3O4LD 3FUFA 1JPFB 3GB7A 5JIMA 4FEIA 1D7FA 5GSRA 1ZE3H 2IGTA 4I3RL 1JVKA 4RGOH 5DSCB 5JW5B 4DTGL 1KPVB 4X5LA 4FLHA 5ITBH 4FQPA 1JZ8A 2VISB 1ZSHA 1ONQB 5J89A 2BVUA 4QHNB 4TSAL 3ZKQD 4XXCA 5IW6A 3KPTA 2W07B 2BS8A 1J8HA 4GUOA 2OJZH 4KTEH 3WFBH 4YC2B 1G9ML 2XWCA 4K3EH 3PL6D 2JELL 4P23C 3U9WA 4BKLA 5D1QE 3KPRE 1CXKA 1KB9K 2GAZB 4EN3C 4DP8X 3EG9A 5LNEA 1DQML 4YSSA 3DVGB 4KUZL 3OR6B 3SE3A 4GSQA 4HBCL 5L0QB 1JL8A 3DARA 4E5XB 1R1CA 4KXBA 5F9OH 2JCCA 4MBRA 3U6RA 3WDIA 4BDVA 2HLFD 1MF2H 2F53A 5JHLL 1UXWB 4OF6A 3PU7A 5C70A 5IQNA 3FB8A 5FDWA 3T3MF 1QBMH 2LFGA 4Y1AE 1TEYA 1S7RA 2OMWB 1AYOA 1RHFA 4NNYB 1S7VB 4P5KA 5I9QB 3V79C 3FTZA 3RI5K 4G7YL 3ME0B 2NSMA 4WJKB 3SY6A 1MRFL 1CR9L 1WE5A 4QI3A 5ACLA 5JO5B 2DLEA 4NQXA 3ULUC 3PL6A 4KKLD 4WO4B 3KJ6H 2CHDA 3G04A 5DF0A 2GHZA 3IN0A 2AQ3A 3SGEH 3NJFA 1HIML 4JPWL 2EXTA 1ZANL 1CG9A 5F6IC 4Z5RA 4FLOA 5JOPD 2X88A 4X4KA 4PJ7A 4JFED 2X0VA 1ET7A 3DECA 4IS6B 3WEXA 4N0FA 3DRTB 3TBBA 2H47C 2OMZB 3PWVA 4QWWD 5AVSB 3S9DB 4Z7UB 5HYSA 1SXBA 5F7FA 5G5DB 4AYMC 3MRCA 5AOKA 1MHHA 4NP9A 1XV8A 3IJEA 3GZPA 3S5LG 3L9BA 4XNZB 1QVOA 1M2VA 2G9HB 4N3TA 1UCTA 4H0IA 5IHBA 2NQCA 4N8VB 4PCTA 1XD0A 2BZDA 1S5IH 3Q13A 4WUKL 2F1AA 1UM5H 2VLLB 3VXME 2VN6A 3VXTB 4NUGH 5I17A 5C0RL 4KROB 2YD9A 3CXHK 4YO0B 4PRIB 3HEIB 3OB0K 1MFBH 1HT6A 3MMEA 3UTTD 3X14A 4Y4KD 3IJYA 2PTTA 2YEZB 2BY3A 5PAZA 4DN3H 4HWBA 4TN9A 5EZOL 1MFAL 1T2XA 2YD6A 3LKOA 1REIA 3K0WA 2DYPA 1P9MA 4ZW8A 4B0MM 3KYOA 4K3DH 5L4FA 2WQSA 5FUOH 2E0PA 1A1MA 3MU3A 4IDJH 5AOJA 1DQDH 2K8QA 4OCYH 1EVUA 5J9PA 3K2IA 3MLVH 2XQYG 2CXKA 4XP9L 5FCSH 1ZS8B 4KRLB 1B90A 3OKOA 2D3NA 4XXWA 5JDSB 4ZFFA 1HXKA 2WINA 2WXKA 4G6AC 4HUVA 12E8H 5EEYA 1FZKA 4FXGC 4B9PA 1JWMB 3OZ9L 1Z3GH 2PW2A 2PPFA 5D7HA 1LJMA 5JDSA 4YSDA 3NJHA 4YGVA 3SO3B 2NY1D 4MB5A 3S5LA 5D2NC 4UM8B 5EIQA 1J88A 1TF4A 3PJNA 1W16A 3HN3A 1TJHH 4G8EB 3ROLB 2QKSA 2YEQA 4XNYH 3WIIH 3IAGC 5TQ2L 3VXNA 3ULUH 2W65A 1SPDA 5CJBA 5I18L 1L3NA 3CFCH 2PABA 3WNOA 2FX7H 3ARGA 4QPEA 4QTIL 3QO0B 1DUYA 1LM8V 3MLSH 4BRJA 5F9DC 5ENWA 3FULA 2IJ0C 1B0WA 2R1YA 3B9AA 1CPUA 4XCCH 3KBFA 1BD2A 1G9NL 4KKQA 2A9CA 1K8DA 2C9XA 4HIQA 4JCLA 5AAMC 2IBBA 2KLSA 4AV4A 2Y6SD 4MJIE 3OKDA 3ZDYE 1FIEA 1UYWH 3KBHE 4FQXD 5DD1H 5FF6A 2O26U 2WGXA 5KS9B 2J57A 3X1NA 4P2QE 5CWSB 1MHHB 3IMWA 4J2QA 4X6CF 2WLZA 2VDKB 1S9VA 1ZPLA 2FJHA 3LNFA 4EDWL 2UYLA 4M7JH 5F9WC 4XPFH 1KCVH 3D4ZA 4TS6A 3G7TA 3DMMD 5I1GL 3QWOA 5DS1A 5DLLA 1I7RB 3L5HA 4G8GA 4MXVE 1TKWB 4JY5H 1JRHL 4J6RH 1KCKA 1FG2B 3RPKA 2XWJB 2XV2A 3IT8D 5KVEH 4TQEL 1D5RA 1KGCD 1QLFA 2NMSA 3CFBB 3QDGE 1WISA 1XH1A 2QPSA 4R4FH 5KAQF 2CRMA 2DD8L 3V4PA 1IGMH 1KFAH 5CD3B 2J21A 3SYAA 3ARBA 2IG2H 2RBLA 3RHWK 4W4OA 4AQ8A 2XG4A 2EP6A 5K59F 3GSVB 4DEUA 4FFVD 4FG2A 4F8LA 1BJ1H 3O2DH 5FECA 2FIKB 5GGTL 1UADC 1ZV9A 1CFVH 3R19A 2A6DB 2UXTA 2YMXL 4Y16B 5IBLD 4YFLF 1AQHA 1TR7A 3E6HB 3D25B 5HHXL 2JJTC 3RTQC 5CF3A 3NRQA 4P2RE 2NY6B 1A5FH 3L1OL 1A3LL 1LD9B 1H3TA 4M8VA 3L5WA 4WNSA 3D69A 2Y7LA 2FIRT 1HIMH 5MENA 3EO9L 3ARBD 5EIIG 2PWEA 1RMFH 1FZMB 2R4SH 4OAWA 5HYQA 3JV4B 5B1BB 2OM5A 4S2SA 2IOOA 4E9QA 3MXWH 4R8WL 2EYSA 1MDTA 3T2QA 1MRFH 4DEWA 1L0YA 4LEEA 4N9GB 1YEFH 1ND0B 3QQXA 1NOLA 5EDSA 1GGCL 5B3SB 5J4MA 4N4YB 3E8VA 3T2PA 4YSOA 3X13A 4XO3A 2ATPB 3D34A 3SE4A 2O5ZH 3QUZA 3MV7A 4NFBA 5GRJH 3H4FA 5KVDE 2XYCA 3S36H 2QHRH 1FH5L 3IS0X 5KVEE 3C60C 4QT5A 2WKOF 1DP0A 1J0YA 1NCNA 4NO3A 1G1OA 1MHPH 1JPFA 2IDQA 2XN2A 3GB7B 5E8DL 3QWOB 1H6FA 3ZR5A 1HINL 4HJGB 3QH3A 4RZCB 4A2FA 4AK2A 4QRRA 5HHPA 2DQUH 4R5TA 3MFGB 3MFFA 4FQHB 3DJZA 2XT1B 3QUYD 4KKNA 3R8BB 2G75B 4FTVB 4HIXL 1XGYH 4WHYG 2WVUA 4IKIA 4CSTA 1FO0B 3O2VL 3VI4E 2DJSA 4PGEB 5JIQA 4Q6IA 1L9PA 5C2UB 1DVFD 1EH9A 1IBFA 1AACA 4AH2B 2HKFH 1KTDA 3R06B 1BX2B 5EN2A 3CUPB 1FNSL 1H5BA 1A14H 1HCZA 2DY2A 1OM3H 1MQKL 4K8RL 1JPEA 5T3ZH 3P0VH 5EZLA 4K71C 1X5MA 3WXVH 4G43A 2XG4B 4MJID 4UTBH 5I66B 4HPHA 1IL1A 5GGVY 5HI4D 3QUYA 3TTSA 1QHOA 2E4FA 1I7UA 5F1SA 2HN7A 2YD2A 3TWYA 2JJSC 1IE5A 1H0DA 1MLCB 2FQDA 2D8KA 2XX1A 4I85A 4X4ME 4J8RB 4Y16D 4CW1B 4FNQA 5DVLA 4PJFF 5ABZA 1VAHA 4L3CA 2GPZA 3CVCA 4RAVB 3HLKA 3U83A 5I1CL 1KEMH 4YSPA 2VQUA 4Y1AD 5JXED 1GGIH 4LKCB 1VGEH 1ZLVK 5B1CA 1GZHC 1MLBA 1OGAA 1RI8A 1ZHKA 3RL1B 2R2EB 4M61A 4YHLH 4NZTH 4HUCA 3KL5A 1TZ8A 4NZFA 3DSNB 5ALCL 4R2GD 1RL1A 1OAQH 1OGSA 2ZXCA 1CC3A 3L16A 4OD2B 4YEEA 3LDBC 1PLGL 2DAVA 1NFKA 1BA9A 1JG9A 1YMHB 4X8JB 1A6AA 3LAFA 5AYTA 4DZBA 3OJDA 3DRQB 4JHBA 4Q7DA 3X1EA 1HI6A 4Z7UF 4HMEA 4WI9A 3QR0A 4E42B 2H26B 2YN3A 3AG2B 1YMHA 3UZEC 3VXSD 2BVPA 4IRJD 4KH2A 3GJFA 1ZANH 2Q3ZA 4X0KA 3EIFA 1KJ2B 2E75C 2IO5A 3RGVD 5A6MA 1MG2C 1VEMA 1BF2A 1P7BA 1JXFA 4CMMA 2VDRH 1S2EA 1WRFA 2EE3A 4QTFA 1JDAA 3AGWA 3BAYA 3Q0HA 1MAMH 2NR6A 4MMXC 4KKRA 3NCYS 5DVOA 2ENJA 4LBEB 4LVEA 1LO2L 4DVRH 1OK8A 3ZSSA 4KTYA 2EABA 3PWLA 1XZ0B 2ZUSA 3MOQA 1RK0B 4U1NA 4XPFL 5M94B 4L0PB 2P5EA 5J0BA 1KJ2A 5K1JA 1MIMH 2K7QA 4PS8A 2EKJA 2KS0A 3K6DA 3DMMC 2B3RA 3HE7B 2FHCA 4IRJA 2W60B 1KIRA 2WLYA 3S0PA 4KV5E 4OQTL 1WC7A 1BREA 1FA4A 5JZ7C 5EZIL 1E6JH 1U3ZA 4WY7L 2GCYA 2Z34A 1WAEA 5AW2B 3I02A 3GMRB 1JDDA 4G3YL 1O9VA 2DQ6A 2I60L 1IGCH 3L95A 1LQSR 1MLBB 1OGAB 1TFHA 2A1WH 2E9JA 3GI8L 3CLWA 2AXHA 2BO0A 2AK1L 3EO9H 3BKMH 4TVPL 3VGGA 1XQ4A 2F2HA 4PW3A 4QRAA 4WZ9A 3BC9A 5EFIB 1JWMA 3L4ZA 4ONOA 1A3LH 1FYTD 2WSKA 3RZCB 5FYKD 3U4BH 2MPVA 3QIWA 4GRMB 1QRNE 3FU9A 4KUCD 4K5OA 2DWTA 2QEJA 2BP3A 4JLRB 3MJ7B 1L7IL 3VTAA 1DR9A 3GLDA 2QQNH 4NCC2 3LH9A 5DEZA 5EOTA 1DCLA 5TF0A 3U4EB 1IVLA 1S4IA 3V7MA 5GS0L 3T0BA 2ZYSA 4YXKH 3IMRA 3T0EC 5D8JH 3MRRA 1T7ZA 3RB7A 5ADOL 1TXKA 2N7BA 5F7WC 5EO1B 3TZVB 3GD1C 3IDGA 1F2QA 3NH7L 3H9ZA 1MY7A 2B1AH 3HE6B 5KS9E 4M3JA 2FRGP 3ZDXB 4ENZA 3S4SG 5IQMA 3NCXA 3ULUE 2MNWA 4JM2C 3BPNB 2I07B 3RPIB 4MRCA 2NTFA 2DB8A 2VL5A 1J87A 5EU6E 2EUWA 1QYGH 4BFGA 5IP4A 2B4CH 5I0DA 4R9HA 4RMVA 2WW8A 4OLWH 3ARWA 4X4XA 5HYJA 1KIRB 1E9PB 1MELA 1T6WA 2CKBL 3REVB 4KAQL 4KXCA 4ZMYA 3ZTEA 5KVDL 2Y7MA 2RGSA 1ECYA 5EC1B 2L8AA 4BZ1A 3CHQA 4EI5C 1H0DB 2IH3B 5AG8A 1EAQA 4HIHB 1U6AL 1T5XB 5D71H 1QLRB 5E6SB 4G42A 3QXVA 1FJ1B 2OW6A 5AVXB 1NC2A 4GRLA 5HHME 4P99A 4TVPD 1KT2B 1I8IA 1UJ3C 4HXAL 4I89A 2JTDA 5JHDA 3IFOA 2CGZA 1JZJA 2YR3A 3ERXA 1S7UB 3ZKMC 3N1GC 3BO8A 5CD3A 4O02A 4MA7L 3CHXA 3FN9A 3MV8D 5EBWA 3S2AA 1NDGA 2ZUYA 3HI6L 5BUGA 1FZMA 3MRHA 2NUTB 4R3SB 4YHML 1S7UA 4HQQL 5JNYA 2EDHA 2GK0B 2EDQA 4P2RB 1IGJA 4N2BA 2PW1A 2ITEA 4DIXA 1Y6MR 4UF7C 1PDKB 4JFFE 3QNFA 2AQ1A 1CF1A 2VW6A 4RMUA 2Q6WB 2NW2B 5HBBA 3DXAE 5IOPB 5HI4C 3H9HA 4ODTH 1A25A 3VXSB 3ZR6A 4KK9D 4ZNEE 1ZKAA 3OZLA 3D25A 3E1ZA 3MR9A 1O5PA 3FBKA 3OKNA 3T4AB 1NFDE 4QHKJ 4Y2OA 2FZ3B 5HI5C 3RJOA 1ACYH 4HJGA 3QZBA 5LG6A 1KCUL 1G5AA 4L8DA 5KVGE 3RWEA 3S8GB 1JPSH 3HPJA 4KTGA 3U1SL 1DQQB 2X6UA 6FABL 3GTNA 3D52A 3RBSA 3T3ME 3WTXA 4BA0A 4JFPB 3S34L 1GW6A 4U1KB 2FE0A 3V4VA 2DM3A 4QDGA 1IAIM 3FTGB 2BCMA 4HWZA 1F4AA 4XCEB 4AK1A 1V3MA 3G6JF 3BKCL 3CVHA 4HOMA 3K4AA 2XI9A 1NJ9A 4N28A 2ZKHL 2DM7A 1EJFA 2FLMA 3HPJB 3U1PA 5D93B 43CAA 3NJLA 4F8NA 5FAAA 1QLRA 5FFGA 3DBXA 2EDLA 1IGYA 2K6WA 3AAZA 3US1A 1I3GH 1YMMB 1EANA 3R4RA 3VNYA 3NDZE 5TQ0H 2ROYA 4Y16A 4PJHE 2FECI 1R5IB 2CA3A 2H7WA 5DJAA 4MJJA 2Q8BH 3U9UA 4XN8A 2A77L 1OAYL 1CCZA 2C7UB 3R7QA 4AM0Q 2CIIA 1FAKT 5J5EA 4POUB 3SDDA 2YK1H 1JIBA 1D7BA 2GK0A 4MDIB 5C0EB 3N9GL 4JN1H 5HHOB 3CD4A 4PRAB 2H2SD 1JCKA 4X6CE 3SE9L 3CU1A 2H1LM 1SLUA 4BSJA 3STBA 4DFIA 2E9WA 3WDHA 3VD1A 3FL7A 4I9WE 4LEXL 4GO8A 4Z7WA 1UM5L 3HZ3A 1LWJA 5A3IC 1EQWA 1IJ9A 1A2YA 5AUMB 1KELL 3UZVB 1HNFA 3QFJE 4ZMPA 4URKA 2YS4A 1ZHNB 3KPQB 2KZKA 3V4UH 1B4JL 5I26A 3VDBA 4BZ2L 1LK3L 2R7EA 5IUSA 3C8KA 1CDHA 2J1ZA 1V8HA 1T1XA 2QQKH 1IU1A 1RUKH 2OR7A 4E9RA 5DVNA 1AP2B 1RMFL 4DERA 3HZMA 4P3DB 2UWEA 3D87B 4U1LA 2AXFB 4H0GA 5L88L 4LPTA 3KCWA 3I6LE 1T21B 4TV3A 3HPLB 32C2B 4HG4K 1JF5A 3N04A 4KJQC 4LCWB 5JTWA 4CN6A 5MEQA 3IPEA 3IU4L 4NS0A 3H9SE 3MGOA 3UTPD 5D2NB 2AJVH 4A7VA 1NPJA 1BZ8A 4JQIH 2VMFA 1YPZF 5C71A 1NINA 4QHMA 2PP8A 1DJGA 2AXJA 4LIQE 3BH8B 2ADGA 4KMLB 3WKNA 4CDGC 5F7UA 1AGBB 3VFPB 3PY9A 2Q2LA 4O58H 4KQ0A 4OZ4A 5KVFH 1FN4B 1T1WB 2WBXA 3PHSA 3BH8A 4K23H 4PRBA 3ARGD 4MX7B 3RVUD 5DMIH 2WLIA 1MCCA 1KG0B 2X7LB 3S37H 3O3UN 5T1LD 1DUZB 1P5VB 5L9DL 2CKBH 1QLEL 4YHKL 4PJ7F 4BV1A 3A3YB 4P3WA 3WIHL 3KCPA 3QORD 1NAMA 4FZ8L 2A9DA 4ELME 1KSRA 1TTAA 2Y22A 5SWSD 3FB6A 4NQTA 5T5NG 4OZGB 5C6TL 3M8OH 2Y4SA 5DYOB 2IEPA 2YIHA 3Q8FA 1CE1H 5L7XH 2EIZA 1BM3L 1J18A 1T4KB 1X7TA 1DEEA 1HX0A 3G5ZB 2JI2A 1QFUH 1XSKA 2FBJL 1M7UA 4M4RB 4JRXE 4A7QA 4F8PA 5K1NA 4JO1L 4GI8A 5D6CA 4A66A 2RHEA 1RKRA 3FZUD 4FMKA 4UOJA 4KFMA 5HXMA 3MLTB 3CCHA 2WC7A 5IBLC 2Y1ZA 3I6LD 3UZVA 1IM3B 2P43B 2ZXGA 5INCB 1S9KC 1SDYA 1C9SA 4RLDA 4MA1B 1RURH 3KH3A 1IEBB 4OFQA 2FCBA 5DD0L 5FOBA 3HNTH 3W0WA 1KV3A 4RDQG 4M7KL 5E5RB 1CICA 1XCTA 1BFVH 4HGWA 2Y7NA 3VXRA 4OLYL 2CBOA 4RMSA 1RJZA 5EFIA 2FATL 2YD3A 3CMOH 4FCAA 4GSDL 2CK0L 3WLWD 4FHKA 2UWEB 4IK6A 5DMGC 1JK8A 5HDOA 1S3KH 4PJDE 3TBWB 4LLDB 4N5ED 5DC9B 1Z9NA 1MW2A 4F58L 5E5MA 4QF1B 4X6BA 2ARJA 2Y5QA 3RUGB 3IDIB 3QQ4B 5BQDA 3WELA 4NO0B 1YMMA 3S3JA 2MOGA 2Y7QA 2C9VA 3IDYB 2GI7A 4KPHL 5EB9A 5ETUA 3O45B 4P57A 4JFWA 1WIOA 2FHFA 3WHXB 1UD8A 3DNKA 4FFZA 4YAQB 3IJSB 3MRDA 1A1MB 1BQRA 1JXKA 3HAEH 4FQCH 3MJGX 4L29A 3WY4A 1GZPA 1T04B 3HNVL 5DMKB 3QR2A 1U8IB 2BRQA 2E3VA 4NQCB 3TU6A 1QTYT 5IW1A 5KEZA 1MFCL 2CLVB 3DVNA 3PQYD 3NRFA 2ZOTA 3MV7E 5G55A 4PV8B 4AXWA 4F33B 3F84A 3A67L 4MXQD 2JKTM 5JHBA 3AT9A 2NDGA 3QJUB 3PQYB 3TBTA 1K72A 4FQQB 3ESOA 3VD2A 4GLRI 2HMID 2D7TH 4YK4B 7CGTA 3DROB 4MZIA 5DFWH 4FCHA 1Z9LA 4Y4HA 1AQKH 2AI0L 3DURA 1MCWW 2ZKWA 3GSXA 3TF7C 3O4LE 4J3WA 4P5TB 1XBRA 3JTTB 3FQWA 1IEBA 2FNWA 3GBEA 1A6ZA 3WY3A 2EDKA 3SBQA 5CD5C 3TYFA 5JORA 3JZ7A 3OC5A 1Z2KA 4FJZA 4HA1A 4DW2L 3F58H 1A1OA 2LTQC 1R5WB 4N0FB 5DTFA 2X1QA 4Y16C 4Z0BH 3TA4D 3QNZA 1HE8A 5AKVA 1IGIH 3FSWA 4V2CB 4MQSB 2JXMB 4KZEH 3VI3E 3K6SA 3KS0J 4K5NA 3AWFA 1MQKH 5H37G 3DXAD 5EO1A 3KPRD 4FJYA 5BO1H 3TH3T 3MRGA 3D6GA 3I9IA 2WLLA 4MWFB 5L88H 4GP8B 4LLWA 4O2FB 4C57C 4EE2A 5FW8A 4Y2DD 4HX1A 3RVTC 5D96C 2YKLH 1TZAA 4MJIA 3NJVA 1MSPA 2J71A 1P5UB 4EUPG 1S8DA 3QUML 4BFKA 5I6XB 4HWUA 2QT6A 2PW2B 4W9IC 2HLAB 4X5XB 3UH8A 2JKJA 2CBMA 3NK3A 25C8L 2WCGA 3AT8A 2APVA 3NZHL 3NSJA 4B9KC 3BPOC 4LSVL 3NJJA 1YVLA 5GRZA 2OQJA 4I48A 4ABVA 1JZ6A 1RIUH 1HL4A 4RDQF 4AE1A 2R69L 3VH8B 5EF3A 5I6MA 2FGWH 3RGVC 3TCLA 2VR3A 1L0QA 2ZX7A 5LJYH 3NVQA 5D72L 4FNLH 3VD0A 1FL3A 5I1EL 4ZUSB 1BQLL 4YN3A 2CGYA 2Q8AL 3UTQA 3V0IA 1JCVA 1U33A 2E46A 1MREL 2J56A 3P9LA 4YZFF 1UXSB 2R8SL 3FONA 2BSSB 3ETSA 3BVDB 3WIAA 3CSYB 2HZHA 5HHNA 4BD4A 3P4LA 1I3GL 2VRKA 3TYFB 3QZLA 4HETA 2ADJA 2R0KL 3MA9H 3RX5A 2YGPA 4AZ8B 5DZOA 3VXQB 5I24A 2KLRA 4GRMA 2P26A 1XGZA 4J3OF 4J3VA 3MZGB 4OI9A 4X5PA 4Y2OB 2GJ6A 4AWJC 1TT6A 4FXLA 5K9OA 1L9NA 4BINA 1PYWA 3EJZD 2H1PH 3UMNA 5I0VA 2DKUA 2HSIA 2WJ5A 3PNWA 4GXUM 1MUJA 1YUHA 5EZOH 4H4NA 5E2TL 6PAZA 2SEBB 4XP6L 3I50H 3CZFA 2OBGA 3F7KA 3QPQC 3KHOA 2D2OA 3GO1L 1E5CA 3QJRB 1EUTA 3QUZB 2EVHA 3SY0B 2QR0B 3VWKA 4A2GA 5C86A 3V0WL 5FOJA 3E3QE 4IRZA 1P7QB 4GAGL 4X6FB 4IKKA 2QPEB 1B9ZA 1I7ZB 2BW4A 2P49B 3SY0A 3ZHNA 3FQRB 3EYQD 5I1AB 4OIBA 4OZHA 2H0EA 4U1MB 1V3KA 1PY0A 3ISRA 2NY4B 4TVSa 4AGOA 5GSRB 3AQYA 5HJ3B 7FABH 1E4XI 1LL1A 1NGPL 1VDGA 4JCWA 4QXGH 2IBZY 2D03H 5I23A 2J4WL 4G6JL 1IAOB 4OLEA 4YIQB 5IHZA 2KH2B 2W0FA 2WOBA 1ZLEA 3ENEA 1T1XB 1HHHA 4PJXE 2RCSH 2NUPA 1CD1B 1XGUB 3UL4A 1FZOB 2XBDA 2YD7A 3DUSA 3VXOA 5KYXA 1Q9KA 2B1HH 3IRCA 2UUDH 4XH2B 4M1GL 3RNKB 3IMVA 5AB1A 1NBQA 3APFA 3QRFM 4NO2A 2BSSA 4I0KA 3BD4A 4U3SB 3BZDA 1RVFH 2H6UA 1CTMA 3MLYH 2ODIA 4KJYB 2R4RL 3CFDB 3LRHA 3WBDA 1KTJA 3COOA 4PRNB 4GO9A 4YFLI 2OSYA 5T3XL 5AZ2L 1ES0A 2CDEA 3KWXA 3G5VA 2UZXB 4FQCL 4CVXA 4BQBA 4DGYH 1J8RA 2ZT9C 1GY1A 2ITDB 2ZICA 2XTSA 5GGQH 1JI1A 4Y4FC 3CHOA 4GEJA 2CHNA 3K6IA 4EDWH 3CBJB 5AW3B 4IRZH 4JRFA 4UQ9A 3OAUL 5B8CA 1J86A 2R23B 4MJHA 4NUJB 3SPGA 4MAUL 5EO0A 2NZ1A 1R3JB 4N8UA 4MMZA 2B4CL 2P28B 2BNQB 2EDNA 1AH1A 5HI3C 4F24A 2Z0UA 1H6EA 1AGEB 2D7QA 3FUIA 3VUAA 1T1ZB 1OALA 4R4FL 4LK4A 3MRNA 3WEBA 1QW8A 4U1LB 1WICA 5T3ZE 2YAFA 2VE6B 3VG0L 2UY6A 2PPCA 4U1MA 4XXCC 3H4HA 5DGRA 3EFFB 4GBXC 1A22B 1HXMA 3TO2A 2ZNWA 2HT4C 4OZFH 4ZD3H 1XF4B 1U58B 3L81A 3L5IA 2ZNXA 3GS4A 4OF0A 4GRWE 1Y1DA 1SEQL 3SQBA 4GRLD 3G6AB 1CLCA 5FM5O 3IETB 3LV3A 3EZ8A 2XYBA 4ZFZB 1PZ2A 3FFCB 4UNTA 4R7XA 4AEFA 4PP2A 5FPIA 2K6ZA 25C8H 2NNFA 1ECZA 4QRTB 3MRLB 3CPUA 5SWSB 4JFYB 4ZOBA 1NCUA 3R8QA 5EF0A 4D7BA 5I76B 2DH2A 1ITBB 1ETJA 3ESVF 3L3OA 2VR8A 3SKOA 1JVLA 2QADB 1U93A 4GG8A 5I8OL 5K9JH 4RETB 3SYCA 5D1ZC 1TU2B 1JGLL 2GBVA 5GSVB 3VAEA 2GEEA 4N8PA 3Q2WA 1U3HA 3CHSA 3IU4H 1VJSA 2AJ3B 4GEIA 1MFVA 1CFTB 5CU5A 3FO9B 1WAAF 1AR1C 2RMNA 4QY8B 4LVNC 2A6DA 4FYRA 2E8ZA 5C7XH 1F11B 5C09A 3FSZA 1KIPB 1O9ZA 5J13C 1TJGH 3O6FC 4HT1L 5L8JB 2XIIA 1KYUA 2J73A 4PRBB 5TJWK 1G43A 4NUJA 2WNKA 4JO4H 3IPFA 1UKSA 4ZS7H 4E42A 4EEEA 2J8UA 3IXTB 1ZT1B 2XRAH 1DVUA 3BX7C 3LIZA 3ASNB 1NEZB 2VM9A 3PQYE 1AXTH 2WQVA 2ZD0A 2OCFD 3FTUA 4PCYA 1P0SE 3K5SA 2X4TA 1U0QA 4APQD 1PCXA 1WT5A 3Q6FB 4WSJA 1D5IH 4OGQC 1RUQL 4KO5A 3GSRA 1I4FB 2QKIB 3P9MB 3O41B 3RZCA 3C5JA 4PRHE 4Y9GA 5EC2B 4K3HA 4M43H 4F80A 3TYGH 1EGJL 3N1QC 3B5GA 3ZYJA 3HG3A 3MRNB 3BKJL 4ZQKA 3ZQWA 4RSVA 1G9NC 1C12A 1JPTL 1S78D 4JFFA 3CPLB 3CX5J 3IDJB 3WTVA 1JF6A 2GIXA 1W0VA 3RGVB 3K1KC 4BZ1L 4YJZL 1VLXA 2BZCA 2DLFH 4U1IB 1S9WA 3VGHA 3FQXB 1ONQA 3KM1A 3NIGE 5EZPA 2HVKA 2P8PB 1ZSDA 1RURL 1HHKA 2FLRT 5J12B 3BQUB 5F6HI 3SYQA 2XZZA 4PR5A 4RGNE 3SE9H 3EJJX 5ID1A 4GY4A 2DN7A 3ME0A 2EECA 2D7MA 3EH1A 3OLEA 1N70A 1Q0XH 3BSGA 5CLZA 3AJ7A 1H5BB 4BIKA 4RWYL 1OCRB 3NAAL 4NKIL 3QCUH 3ULVE 1KXTB 4QY8A 2CBPA 4XVSH 3ULVD 4PY7B 4UT6H 4Y5VA 3PV6A 3U7YL 2JVUA 1J05B 3QIUC 3GDCA 4MCNA 1IARB 1BM7A 1U3HB 2F7OA 1M3JA 4Y5VB 4A2MA 1L9TA 1A4JA 4LLYB 4Z3FA 5I1IH 1M05B 5INDB 3EFDH 1KEGH 3MLVL 5IV2B 1NIAA 4NERA 1RIVL 1IEHA 1OAKL 4A2DA 1AQ8A 3I75A 3TJHC 4XI5C 1WAAE 5CM1A 2H0PA 5CGTA 4PV9A 1IM3A 5BZXA 1B0GB 5D2LE 5E4OA 2Y3NA 4YL9A 1FIGH 3IXTA 3KLQA 1SY6L 3EYUH 4NNPL 4RX4D 2GEQA 5FYKE 4KKBC 3KS0H 4J2XA 4GP4B 5I5RA 2F54E 4UOW0 3CFUA 4MQXD 2VR6A 2CJUH 3MV9D 4ORZC 2UZPA 1OANA 1S9YA 3RE0A 3OMNB 4PV9B 2APWA 4LCIL 1CYGA 1AD9A 1CDCA 3P4NB 4E41B 2JB5H 4RGND 5IVXF 3ESPA 3AM8A 3FQWB 3SSGA 1QI5A 1OEZW 1CU4H 2FL5B 4N0RA 4X7SH 4YLQT 4H1LA 3ZQXA 1T22B 3GMNB 4I18B 3QZWA 4JZNA 1FGNH 1XTMA 4F8TA 1ORSB 1ADQA 3TX4A 3MRCB 3V6FB 3G6JA 5I19H 1AZNA 2PUQT 3LKNA 4ZOEA 3L3OB 1Z9PA 4I4WA 4J3SA 2JK5B 4CSPA 1Z5LB 3TA3B 5FYLE 4JVUA 1YJDC 4IBYA 4JN2A 4QRPB 4AYEC 4UQEA 1E2VA 3LNHA 3A6CH 2EH8L 2PCXA 3C5SA 2ZAHA 3WKML 4EN3A 3W9EB 3VD4A 1SXNA 1V27A 3LMJL 4YVUA 4A37A 2XA8L 1UCBL 4RBPH 4OCMC 3ARGB 2YEZA 2Q87A 4DUVA 4KJYA 1HZKA 4XMVA 4EN3B 1II4E 3ARDD 3T2OA 2X4OA 3CVDA 3ZT6A 2OMTB 4FG6D 4QRPA 3TWCH 3FOLA 3DK2A 1F8TH 3HC4H 4HCRA 4NNYA 4CSSA 5IFAL 4Y1AA 1GOFA 3PJSA 1BVLA 3SCMC 3VM5A 2W8CA 4QCIB 4R7NB 4YE4H 2MSPA 5D1QB 5HYFA 4TSCH 3ILQD 1BOGB 4G82A 4XCFL 3RVWC 2WINB 5BRPA 4H1LG 2YUXA 2CK0H 2CZNA 3FCUB 3GJFH 3SE4C 1RAMA 4JY6A 1RP8A 4PLOB 4PV1C 4ZUVA 2VDQL 5D6DC 4NZTL 2ENYA 1MPAH 1NFIA 2PYEE 3ZDZF 3MO1A 5E8PA 1D9KB 1R3IL 2I07A 2ERJB 2CUAA 2E7MA 3OJMB 1QUNB 1I3UA 9PCYA 1Q94B 2XLLA 5CSZB 2X05A 3PAYA 4JFEA 4IIQA 1X44A 5EUOA 5IB1B 4WI2A 5DWUL 5FYJD 3EYOB 4KOBA 4Z7QF 2P45B 3OQRA 3D3VA 1AHKA 1XGRB 4HIEB 1U4EA 2CRZA 1PEWA 3BAWA 3C6LB 3CLEL 3QFJA 4NWTL 2KZWA 2OL3L 3RWEB 1F41A 1VZGA 3NIFB 1TSHA 3O6FA 2UVEA 1OT4A 2EXYD 4ANVA 3L5WB 1E4KC 2M26A 4LBAA 1S9VB 1LEKB 5G4OA 4ZAKD 3VDCA 3OAYK 1FLTX 1UYWL 3HS9A 3TTYA 1DVTA 2DIEA 2LR4A 1J1OL 1WAPA 4L37B 1CD1A 1XGUA 3OAYH 4FJ6A 4WK4B 2P80D 1RZKL 1T0NB 2WYIA 1D7CA 2C3VA 4YXHL 1K4DB 2IAMA 5DA4A 4GQ9H 4GB9A 2AQ2A 4LLQA 3QEUA 2UX7A 1RZPA 4LNVA 3DIFA 1YNLH 1P9MC 3IYLW 1VFOA 3RDTA 3RBGA 1E6OH 4WKXA 4JGNA 1TTCA 2VM3A 3N44B 1E6JL 3JWDL 4P4KB 1OTSD 4W68A 2VDNL 2YBRB 3KVQA 3MDJA 3B2XA 3R4DA 4ZFZA 3HE7D 4KQ3L 4RA0C 1IUZA 5DZNA 1OSZA 1ZLVH 4RWYH 5HP5A 5ITFA 3T77B 3C08L 2X2HA 3S96A 4D8OA 4H88L 1I1FA 2P80A 1LHZA 3VXOB 5KYXB 1NFIB 3LN9A 1KEGL 1JUFA 5FR3A 1YJDL 2E47A 2OXHA 1SEBB 1ICTA 1HL5A 2CLRA 2VERN 5FYJE 1EMTL 3WTSA 3C09C 5DJDB 3HPLA 4CC4A 3L13A