1YT2A

Crystal structure of the unliganded form of grp94, the er hsp90: basis for nucleotide-induced conformational change, grp94n apo crystal
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
265
structure length
225
Chain Sequence
SEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTEKTVWDWELMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoplasmin
publication title Structure of Unliganded GRP94, the Endoplasmic Reticulum Hsp90: BASIS FOR NUCLEOTIDE-INDUCED CONFORMATIONAL CHANGE
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Chaperone
total genus 70
structure length 225
sequence length 265
ec nomenclature
pdb deposition date 2005-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1yt2A00
2WERA 3TZ0A 1EA6A 3PEHA 5FWKA 2XABA 4L93A 4HYMA 4XKAA 4AWPA 3EKRA 4LPBA 5D7RA 4CWOA 3G7BA 5F3KA 3T0HA 1GJVA 1YC3A 3ZKBA 3HYYA 5CTXA 4V25A 2UWDA 1KZNA 2E0AA 2XDKA 2YE3A 2XCMA 2YE9A 4R3MA 4EEHA 5CTUA 4XITA 3FT8A 4CE1A 1THNA 4NH9A 5GGZA 3O6OA 4EM7A 4YKRA 4FMTA 1R62A 1I5AA 2YKBA 1YT0A 4ASFA 4ASBA 3D2RA 4XTJA 4AWOA 1I5BA 1TIDA 1UY6A 2K5BA 3R91A 4MPEA 3HZ1A 3VHDA 3Q5JA 3GIGA 2WEPA 4PL9A 2XD6A 5D6QA 2C2AA 4EMVA 2YK2A 4QPKA 3MNRP 4ASGA 3ZKDA 5CPHA 2IWSA 2Q8HA 2ZDXA 1UYFA 5M4NA 2XDSA 4B7PA 2XDUA 2HCHA 4EGHA 1QYEA 3GIGB 5J6AA 4KSGA 4MP7A 1H7SA 2BSMA 1BGQA 5CTWA 3R4NA 4YKQA 3HHUA 4E01A 5M4KA 1YS3A 3FT5A 2EXLA 3BMYA 2FWYA 4HY6A 3H4LA 5J71A 5FNFA 4XKKA 5M4EA 2XJJA 2YJXA 3C11A 1Z5BA 3FV5A 3Q5KA 1GKXA 2WI4A 3A0YA 3U67A 4JAVA 5CTYA 4XIRA 3TUHA 4EFUA 1TC0A 3R4PA 4H85A 4H7QA 3U2DA 2BU2A 4XD8A 4CWRA 4O07A 1ZXNA 1UYEA 2IOPA 3A0ZA 4FCRA 3B27A 4CWPA 3A0RA 1YERA 4O04A 2YGFA 3K97A 4GT8A 2YK9A 3TTZA 1YC4A 2CH4A 2VCJA 2CCUA 2YKIA 4URLA 2Q8FA 4XKOA 1Z59A 2VW5A 3WQ9A 1OSFA 3A0XA 3EHJA 1TILA 4KP4A 4KTNA 4XIPA 1TBWA 1U2OA 1I58A 3PEJA 2Q8IA 4MBCA 4K4OA 5FNCA 4WUCA 4U7OA 3CGYA 1BYQA 4U7NA 4KFGA 1UYHA 4BQJA 1AH6A 4JQLA 1UY7A 2YJWA 1BKNA 4EGIA 3LNUA 3QDDA 4P7AA 3C0EA 2WI6A 4GGLA 2PNRA 4HYPA 4LWGA 3INXA 4AS9A 4XCLA 2AKPA 4AWQA 3SL2A 2BREA 2YE5A 4MOTA 1Y8OA 4DUHA 3VHAA 2WI3A 4YKXA 3ZXOA 2YI6A 4NH7A 5M4MA 4R3AA 2XJXA 3VADA 3TZ5A 1YSRA 4E00A 2IOQA 4YKUA 1Y8PA 2IORA 4W7TA 3T2SA 2BU7A 2YKEA 1KIJA 2HG1A 3B24A 3RLRA 4JAUA 4JASA 3INWA 1Y8NA 3K99A 2O1VA 1YC1A 5M4PA 4LP0A 2YEDA 5IDJA 4LWFA 4U93A 4YKWA 3HZ5A 2BU8A 4GCZA 4V26A 3U2KA 1ZWHA 2YI0A 3D0BA 4L90A 2XHRA 3BM9A 2YI7A 1ZW9A 2QF6A 2YEEA 3ZM7A 4BQGA 4FCPA 1Z5CA 1TH8A 3EHGA 1US7A 4YKTA 1JM6A 4PU9A 2YE8A 4CWFA 1YT1A 4URNA 4O0BA 4ZKIA 4B6CA 2IWXA 3T1KA 2BU6A 5C93A 4HXZA 2YEIA 3QTFA 1Y4UA 5D7CA 2GFDA 3OMUA 3CRLA 4CWNA 1QY8A 3OW6A 2JJCA 1NHIA 4MB9A 4HZ0A 1AMWA 3R92A 1UYIA 1I5DA 2YE2A 4P8OA 4L8ZA 3R4MA 1UYGA 4H81A 4URMA 1B63A 1MX0A 1S14A 4XIQA 3RKZA 2WI5A 3RLPA 2FYPA 2FWZA 2BT0A 2O1UA 3EHHA 3D36A 3VHCA 3O0IA 3WHAA 5BOCA 4L91A 2BRCA 3Q5LA 4QPJA 3EKOA 1L0OA 4DZYA 4BIZA 1NHJA 4BAEA 1B62A 1U0ZA 3B25A 5BODA 4MP2A 3LPSA 4CWSA 2ZDYA 1Y4SA 4MPCA 2XDLA 4YKYA 2YGEA 1YSZA 4KSHA 4UROA 4FCQA 2XX2A 4BXIA 1UY8A 2VCIA 4CWQA 1I5CA 1UYCA 2YE7A 4XDMA 3HEKA 3NMQA 3K98A 2BYHA 4XCJA 3O2FA 2Q8GA 1BXDA 1PVGA 2YEFA 3OWBA 4BIUA 4NH8A 5FNDA 2O1WA 3T0ZA 1UYDA 4XC0A 4ZVIA 3K60A 2QFOA 3A0TA 2XHXA 2YKCA 4LWEA 3CWVA 3ZXQA 4EGKA 3EHFA 2YEHA 3G75A 2H55A 2VWCA 2YE4A 3DGEA 5IN9A 3HYZA 4PRXA 3RLQA 2YEAA 3G7EA 1I59A 4CWTA 4X9LA 4LWHA 4O05A 4YKZA 5F5RA 1AJ6A 5D7DA 4O09A 3TZ4A 3A0WA 3CRKA 1UY9A 2Q2EB 3T10A 4EFTA 4GEEA 2IWUA 4ASAA 1YT2A 2CG9A 1MU5A 1A4HA 4LWIA 1H7UA 2XJGA 4XE2A 3OWDA 2HKJA 4MPNA 2YI5A 3KE6A 4FPPA 1GKZA 1EI1A 4WUDA 1UYLA 4HXWA 1AH8A 2GQPA 1UYMA 4I3HA 2XX4A 3TZ2A 1Z5AA 2H8MA 4GFNA 2XDXA 3GIEA 5CF0A 2WI7A 1ZXMA 4R1FA 3B28A 1ID0A 4E02A 1TC6A 1YESA 1S16A 4PRVA 2YGAA 3OPDA 3B26A 2YEGA 5M4HA 3R4OA 2ESAA 4WUBA 2YEBA 2JKIA 5D6PA 2ZBKB 4CE3A 2XHTA 1YETA 3CGZA 3JZ3A 2XK2A 1QZRA 4HY1A 1UYKA 2YECA 2YEJA 2QG2A 3H80A 4HZ5A 4L94A 4Q20A 2YE6A 4I5SA 2BZ5A 3IEDA 5IDMA 2BTZA 2YKJA 2CGFA 3GIFA 2WI2A 2XX5A 4KQVA 4CE2A 2CCSA 2FXSA 4GQTA 2CCTA 1B3QA 2BYIA 2WI1A 2BU5A 5L3JA 2ZKJA 1NHHA 2QG0A 2WEQA 1AM1A
chains in the Genus database with same CATH superfamily
2WERA 3TZ0A 1EA6A 3PEHA 5FWKA 2XABA 4L93A 4HYMA 4XKAA 4AWPA 3EKRA 4LPBA 5D7RA 4CWOA 3G7BA 5F3KA 3T0HA 1GJVA 1YC3A 3ZKBA 3HYYA 5CTXA 4V25A 2UWDA 1KZNA 2E0AA 2XDKA 2YE3A 2XCMA 2YE9A 4R3MA 4EEHA 5CTUA 4XITA 3FT8A 4CE1A 1THNA 4NH9A 5GGZA 3O6OA 4EM7A 4YKRA 4FMTA 1R62A 1I5AA 2YKBA 1YT0A 4ASFA 4ASBA 3D2RA 4XTJA 4AWOA 1I5BA 1TIDA 1UY6A 2K5BA 3R91A 4MPEA 3HZ1A 3VHDA 3Q5JA 3GIGA 2WEPA 4PL9A 2XD6A 5D6QA 2C2AA 4EMVA 2YK2A 4QPKA 3MNRP 2HHIA 4ASGA 3ZKDA 5CPHA 2IWSA 2Q8HA 2ZDXA 1UYFA 5M4NA 2XDSA 4B7PA 2XDUA 2HCHA 4EGHA 1QYEA 3GIGB 5J6AA 4KSGA 4MP7A 1H7SA 2BSMA 1BGQA 5CTWA 3S5TA 3R4NA 4YKQA 3HHUA 4E01A 5M4KA 1YS3A 3FT5A 2EXLA 3BMYA 2FWYA 4HY6A 3H4LA 5J71A 5FNFA 4XKKA 5M4EA 2XJJA 2YJXA 3C11A 1Z5BA 3FV5A 3Q5KA 1GKXA 2WI4A 3A0YA 3U67A 4JAVA 5CTYA 4XIRA 3TUHA 4EFUA 1F51A 1TC0A 3R4PA 4H85A 4H7QA 3U2DA 2BU2A 4XD8A 4CWRA 4O07A 1ZXNA 1UYEA 2IOPA 3A0ZA 4FCRA 3B27A 4CWPA 3A0RA 1YERA 4O04A 2YGFA 3CYGA 3K97A 4GT8A 2YK9A 3TTZA 1YC4A 2CH4A 2VCJA 2CCUA 2YKIA 4URLA 2Q8FA 4XKOA 1Z59A 2VW5A 3WQ9A 1OSFA 3A0XA 3EHJA 1TILA 4KP4A 4KTNA 4XIPA 1TBWA 1U2OA 1I58A 3PEJA 2Q8IA 4MBCA 4K4OA 5FNCA 4WUCA 4U7OA 3CGYA 1BYQA 4U7NA 4KFGA 1UYHA 4BQJA 1AH6A 4JQLA 1UY7A 2YJWA 1BKNA 4EGIA 3LNUA 3QDDA 4P7AA 3C0EA 2WI6A 4GGLA 2PNRA 4HYPA 4LWGA 3INXA 4AS9A 4XCLA 2AKPA 4AWQA 2C1GA 3SL2A 2BREA 2YE5A 4MOTA 1Y8OA 4DUHA 3VHAA 2WI3A 4YKXA 3ZXOA 2YI6A 4NH7A 5M4MA 4R3AA 2XJXA 3VADA 3TZ5A 1YSRA 4E00A 2IOQA 4YKUA 1Y8PA 2IORA 4W7TA 3T2SA 2BU7A 2YKEA 1KIJA 2HG1A 3B24A 3RLRA 4JAUA 4JASA 3INWA 1Y8NA 3K99A 2O1VA 1YC1A 5M4PA 4LP0A 2YEDA 5IDJA 4LWFA 4U93A 4YKWA 3HZ5A 2BU8A 4GCZA 4V26A 3U2KA 1ZWHA 2YI0A 3D0BA 4L90A 2XHRA 3BM9A 2YI7A 1ZW9A 3LMMA 2QF6A 2YEEA 3ZM7A 4BQGA 4FCPA 1Z5CA 1TH8A 3EHGA 1US7A 4YKTA 1JM6A 4PU9A 2YE8A 4CWFA 1YT1A 4URNA 4O0BA 4ZKIA 4B6CA 2IWXA 3T1KA 2BU6A 5C93A 4HXZA 2YEIA 3QTFA 1Y4UA 5D7CA 2GFDA 3OMUA 3CRLA 4CWNA 1QY8A 2FTKA 3OW6A 2JJCA 1NHIA 4MB9A 4HZ0A 1AMWA 3R92A 1UYIA 1I5DA 2YE2A 4P8OA 4L8ZA 3R4MA 1UYGA 4H81A 4URMA 1B63A 1MX0A 1S14A 4XIQA 3RKZA 2WI5A 3RLPA 2FYPA 2FWZA 2BT0A 2O1UA 3EHHA 3D36A 3VHCA 3O0IA 3WHAA 5BOCA 4L91A 2BRCA 3Q5LA 4QPJA 3EKOA 1L0OA 4DZYA 4BIZA 1NHJA 4BAEA 1B62A 1U0ZA 3B25A 5BODA 4MP2A 3LPSA 4CWSA 2ZDYA 1Y4SA 4MPCA 2XDLA 4YKYA 2YGEA 1YSZA 4KSHA 4UROA 4FCQA 2XX2A 4BXIA 1UY8A 2VCIA 4CWQA 1I5CA 1UYCA 2YE7A 4XDMA 3HEKA 3NMQA 3K98A 2BYHA 4XCJA 3O2FA 2Q8GA 1BXDA 1PVGA 2YEFA 3OWBA 4BIUA 4NH8A 4E72A 5FNDA 2O1WA 3T0ZA 1UYDA 4XC0A 4ZVIA 3K60A 2QFOA 3A0TA 2XHXA 2YKCA 4LWEA 3CWVA 3ZXQA 1IXMA 4EGKA 3EHFA 2YEHA 3G75A 2H55A 5JENA 2VWCA 2YE4A 3DGEA 5IN9A 3HYZA 4PRXA 3RLQA 2YEAA 3G7EA 1I59A 4CWTA 4X9LA 4LWHA 4O05A 4YKZA 5F5RA 1AJ6A 5D7DA 4O09A 3TZ4A 3A0WA 3CRKA 1UY9A 2Q2EB 3T10A 4EFTA 4GEEA 2IWUA 4ASAA 1YT2A 2CG9A 1MU5A 1A4HA 4LWIA 1H7UA 2XJGA 4XE2A 3OWDA 2HKJA 4MPNA 2YI5A 3KE6A 4FPPA 1GKZA 1EI1A 4WUDA 1UYLA 4HXWA 1AH8A 2GQPA 1UYMA 4I3HA 2XX4A 3TZ2A 1Z5AA 2H8MA 4GFNA 2XDXA 3GIEA 5CF0A 2WI7A 1ZXMA 4R1FA 3B28A 1ID0A 4E02A 1TC6A 1YESA 1S16A 4PRVA 2YGAA 3OPDA 3B26A 2C1IA 2YEGA 5M4HA 3R4OA 2ESAA 4WUBA 2YEBA 2JKIA 5D6PA 2ZBKB 4CE3A 2XHTA 1YETA 3CGZA 3JZ3A 2XK2A 1QZRA 4HY1A 1UYKA 2YECA 2YEJA 2QG2A 3H80A 4HZ5A 4L94A 4Q20A 2YE6A 4I5SA 2BZ5A 3IEDA 5IDMA 2BTZA 2YKJA 2CGFA 3GIFA 2WI2A 2XX5A 4KQVA 4CE2A 2CCSA 2FXSA 4GQTA 2CCTA 1B3QA 2BYIA 2WI1A 2BU5A 5L3JA 2ZKJA 1NHHA 2QG0A 2WEQA 1AM1A
chains in the Genus database with same CATH topology
2WERA 3TZ0A 1EA6A 3PEHA 5FWKA 2XABA 4L93A 4HYMA 4XKAA 4AWPA 3EKRA 4LPBA 5D7RA 4CWOA 3G7BA 5F3KA 3T0HA 1GJVA 1YC3A 3ZKBA 3HYYA 5CTXA 4V25A 2UWDA 1KZNA 2E0AA 2XDKA 2YE3A 2XCMA 2YE9A 4R3MA 4EEHA 5CTUA 4XITA 3FT8A 4CE1A 1THNA 4NH9A 5GGZA 3O6OA 4EM7A 4YKRA 4FMTA 1R62A 1I5AA 2YKBA 1YT0A 4ASFA 4ASBA 3D2RA 4XTJA 4AWOA 1I5BA 1TIDA 1UY6A 2K5BA 3R91A 4MPEA 3HZ1A 3VHDA 3Q5JA 3GIGA 2WEPA 4PL9A 2XD6A 5D6QA 2C2AA 4EMVA 2YK2A 4QPKA 3MNRP 4ASGA 3ZKDA 5CPHA 2IWSA 2Q8HA 2ZDXA 1UYFA 5M4NA 2XDSA 4B7PA 2XDUA 2HCHA 4EGHA 1QYEA 3GIGB 5J6AA 4KSGA 4MP7A 1H7SA 2BSMA 1BGQA 5CTWA 3R4NA 4YKQA 3HHUA 4E01A 5M4KA 1YS3A 3FT5A 2EXLA 3BMYA 2FWYA 4HY6A 3H4LA 5J71A 5FNFA 4XKKA 5M4EA 2XJJA 2YJXA 3C11A 1Z5BA 3FV5A 3Q5KA 1GKXA 2WI4A 3A0YA 3U67A 4JAVA 5CTYA 4XIRA 3TUHA 4EFUA 1TC0A 3R4PA 4H85A 4H7QA 3U2DA 2BU2A 4XD8A 4CWRA 4O07A 1ZXNA 1UYEA 2IOPA 3A0ZA 4FCRA 3B27A 4CWPA 3A0RA 1YERA 4O04A 2YGFA 3K97A 4GT8A 2YK9A 3TTZA 1YC4A 2CH4A 2VCJA 2CCUA 2YKIA 4URLA 2Q8FA 4XKOA 1Z59A 2VW5A 3WQ9A 1OSFA 3A0XA 3EHJA 1TILA 4KP4A 4KTNA 4XIPA 1TBWA 1U2OA 1I58A 3PEJA 2Q8IA 4MBCA 4K4OA 5FNCA 4WUCA 4U7OA 3CGYA 1BYQA 4U7NA 4KFGA 1UYHA 4BQJA 1AH6A 4JQLA 1UY7A 2YJWA 1BKNA 4EGIA 3LNUA 3QDDA 4P7AA 3C0EA 2WI6A 4GGLA 2PNRA 4HYPA 4LWGA 3INXA 4AS9A 4XCLA 2AKPA 4AWQA 3SL2A 2BREA 2YE5A 4MOTA 1Y8OA 4DUHA 3VHAA 2WI3A 4YKXA 3ZXOA 2YI6A 4NH7A 5M4MA 4R3AA 2XJXA 3VADA 3TZ5A 1YSRA 4E00A 2IOQA 4YKUA 1Y8PA 2IORA 4W7TA 3T2SA 2BU7A 2YKEA 1KIJA 2HG1A 3B24A 3RLRA 4JAUA 4JASA 3INWA 1Y8NA 3K99A 2O1VA 1YC1A 5M4PA 4LP0A 2YEDA 5IDJA 4LWFA 4U93A 4YKWA 3HZ5A 2BU8A 4GCZA 4V26A 3U2KA 1ZWHA 2YI0A 3D0BA 4L90A 2XHRA 3BM9A 2YI7A 1ZW9A 2QF6A 2YEEA 3ZM7A 4BQGA 4FCPA 1Z5CA 1TH8A 3EHGA 1US7A 4YKTA 1JM6A 4PU9A 2YE8A 4CWFA 1YT1A 4URNA 4O0BA 4ZKIA 4B6CA 2IWXA 3T1KA 2BU6A 5C93A 4HXZA 2YEIA 3QTFA 1Y4UA 5D7CA 2GFDA 3OMUA 3CRLA 4CWNA 1QY8A 3OW6A 2JJCA 1NHIA 4MB9A 4HZ0A 1AMWA 3R92A 1UYIA 1I5DA 2YE2A 4P8OA 4L8ZA 3R4MA 1UYGA 4H81A 4URMA 1B63A 1MX0A 1S14A 4XIQA 3RKZA 2WI5A 3RLPA 2FYPA 2FWZA 2BT0A 2O1UA 3EHHA 3D36A 3VHCA 3O0IA 3WHAA 5BOCA 4L91A 2BRCA 3Q5LA 4QPJA 3EKOA 1L0OA 4DZYA 4BIZA 1NHJA 4BAEA 1B62A 1U0ZA 3B25A 5BODA 4MP2A 3LPSA 4CWSA 2ZDYA 1Y4SA 4MPCA 2XDLA 4YKYA 2YGEA 1YSZA 4KSHA 4UROA 4FCQA 2XX2A 4BXIA 1UY8A 2VCIA 4CWQA 1I5CA 1UYCA 2YE7A 4XDMA 3HEKA 3NMQA 3K98A 2BYHA 4XCJA 3O2FA 2Q8GA 1BXDA 1PVGA 2YEFA 3OWBA 4BIUA 4NH8A 5FNDA 2O1WA 3T0ZA 1UYDA 4XC0A 4ZVIA 3K60A 2QFOA 3A0TA 2XHXA 2YKCA 4LWEA 3CWVA 3ZXQA 4EGKA 3EHFA 2YEHA 3G75A 2H55A 2VWCA 2YE4A 3DGEA 5IN9A 3HYZA 4PRXA 3RLQA 2YEAA 3G7EA 1I59A 4CWTA 4X9LA 4LWHA 4O05A 4YKZA 5F5RA 1AJ6A 5D7DA 4O09A 3TZ4A 3A0WA 3CRKA 1UY9A 2Q2EB 3T10A 4EFTA 4GEEA 2IWUA 4ASAA 1YT2A 2CG9A 1MU5A 1A4HA 4LWIA 1H7UA 2XJGA 4XE2A 3OWDA 2HKJA 4MPNA 2YI5A 3KE6A 4FPPA 1GKZA 1EI1A 4WUDA 1UYLA 4HXWA 1AH8A 2GQPA 1UYMA 4I3HA 2XX4A 3TZ2A 1Z5AA 2H8MA 4GFNA 2XDXA 3GIEA 5CF0A 2WI7A 1ZXMA 4R1FA 3B28A 1ID0A 4E02A 1TC6A 1YESA 1S16A 4PRVA 2YGAA 3OPDA 3B26A 2YEGA 5M4HA 3R4OA 2ESAA 4WUBA 2YEBA 2JKIA 5D6PA 2ZBKB 4CE3A 2XHTA 1YETA 3CGZA 3JZ3A 2XK2A 1QZRA 4HY1A 1UYKA 2YECA 2YEJA 2QG2A 3H80A 4HZ5A 4L94A 4Q20A 2YE6A 4I5SA 2BZ5A 3IEDA 5IDMA 2BTZA 2YKJA 2CGFA 3GIFA 2WI2A 2XX5A 4KQVA 4CE2A 2CCSA 2FXSA 4GQTA 2CCTA 1B3QA 2BYIA 2WI1A 2BU5A 5L3JA 2ZKJA 1NHHA 2QG0A 2WEQA 1AM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WER A;  3TZ0 A;  1EA6 A;  3PEH A;  5FWK A;  2XAB A;  4L93 A;  4HYM A;  4XKA A;  4AWP A;  3EKR A;  4LPB A;  5D7R A;  4CWO A;  3G7B A;  5F3K A;  3T0H A;  1GJV A;  1YC3 A;  3ZKB A;  3HYY A;  5CTX A;  4V25 A;  2UWD A;  1KZN A;  2E0A A;  2XDK A;  2YE3 A;  2XCM A;  2YE9 A;  4R3M A;  4EEH A;  5CTU A;  4XIT A;  3FT8 A;  4CE1 A;  1THN A;  4NH9 A;  5GGZ A;  3O6O A;  4EM7 A;  4YKR A;  4FMT A;  1R62 A;  1I5A A;  2YKB A;  1YT0 A;  4ASF A;  4ASB A;  3D2R A;  4XTJ A;  4AWO A;  1I5B A;  1TID A;  1UY6 A;  2K5B A;  3R91 A;  4MPE A;  3HZ1 A;  3VHD A;  3Q5J A;  3GIG A;  2WEP A;  4PL9 A;  2XD6 A;  5D6Q A;  2C2A A;  4EMV A;  2YK2 A;  4QPK A;  3MNR P;  4ASG A;  3ZKD A;  5CPH A;  2IWS A;  2Q8H A;  2ZDX A;  1UYF A;  5M4N A;  2XDS A;  4B7P A;  2XDU A;  2HCH A;  4EGH A;  1QYE A;  3GIG B;  5J6A A;  4KSG A;  4MP7 A;  1H7S A;  2BSM A;  1BGQ A;  5CTW A;  3R4N A;  4YKQ A;  3HHU A;  4E01 A;  5M4K A;  1YS3 A;  3FT5 A;  2EXL A;  3BMY A;  2FWY A;  4HY6 A;  3H4L A;  5J71 A;  5FNF A;  4XKK A;  5M4E A;  2XJJ A;  2YJX A;  3C11 A;  1Z5B A;  3FV5 A;  3Q5K A;  1GKX A;  2WI4 A;  3A0Y A;  3U67 A;  4JAV A;  5CTY A;  4XIR A;  3TUH A;  4EFU A;  1TC0 A;  3R4P A;  4H85 A;  4H7Q A;  3U2D A;  2BU2 A;  4XD8 A;  4CWR A;  4O07 A;  1ZXN A;  1UYE A;  2IOP A;  3A0Z A;  4FCR A;  3B27 A;  4CWP A;  3A0R A;  1YER A;  4O04 A;  2YGF A;  3K97 A;  4GT8 A;  2YK9 A;  3TTZ A;  1YC4 A;  2CH4 A;  2VCJ A;  2CCU A;  2YKI A;  4URL A;  2Q8F A;  4XKO A;  1Z59 A;  2VW5 A;  3WQ9 A;  1OSF A;  3A0X A;  3EHJ A;  1TIL A;  4KP4 A;  4KTN A;  4XIP A;  1TBW A;  1U2O A;  1I58 A;  3PEJ A;  2Q8I A;  4MBC A;  4K4O A;  5FNC A;  4WUC A;  4U7O A;  3CGY A;  1BYQ A;  4U7N A;  4KFG A;  1UYH A;  4BQJ A;  1AH6 A;  4JQL A;  1UY7 A;  2YJW A;  1BKN A;  4EGI A;  3LNU A;  3QDD A;  4P7A A;  3C0E A;  2WI6 A;  4GGL A;  2PNR A;  4HYP A;  4LWG A;  3INX A;  4AS9 A;  4XCL A;  2AKP A;  4AWQ A;  3SL2 A;  2BRE A;  2YE5 A;  4MOT A;  1Y8O A;  4DUH A;  3VHA A;  2WI3 A;  4YKX A;  3ZXO A;  2YI6 A;  4NH7 A;  5M4M A;  4R3A A;  2XJX A;  3VAD A;  3TZ5 A;  1YSR A;  4E00 A;  2IOQ A;  4YKU A;  1Y8P A;  2IOR A;  4W7T A;  3T2S A;  2BU7 A;  2YKE A;  1KIJ A;  2HG1 A;  3B24 A;  3RLR A;  4JAU A;  4JAS A;  3INW A;  1Y8N A;  3K99 A;  2O1V A;  1YC1 A;  5M4P A;  4LP0 A;  2YED A;  5IDJ A;  4LWF A;  4U93 A;  4YKW A;  3HZ5 A;  2BU8 A;  4GCZ A;  4V26 A;  3U2K A;  1ZWH A;  2YI0 A;  3D0B A;  4L90 A;  2XHR A;  3BM9 A;  2YI7 A;  1ZW9 A;  2QF6 A;  2YEE A;  3ZM7 A;  4BQG A;  4FCP A;  1Z5C A;  1TH8 A;  3EHG A;  1US7 A;  4YKT A;  1JM6 A;  4PU9 A;  2YE8 A;  4CWF A;  1YT1 A;  4URN A;  4O0B A;  4ZKI A;  4B6C A;  2IWX A;  3T1K A;  2BU6 A;  5C93 A;  4HXZ A;  2YEI A;  3QTF A;  1Y4U A;  5D7C A;  2GFD A;  3OMU A;  3CRL A;  4CWN A;  1QY8 A;  3OW6 A;  2JJC A;  1NHI A;  4MB9 A;  4HZ0 A;  1AMW A;  3R92 A;  1UYI A;  1I5D A;  2YE2 A;  4P8O A;  4L8Z A;  3R4M A;  1UYG A;  4H81 A;  4URM A;  1B63 A;  1MX0 A;  1S14 A;  4XIQ A;  3RKZ A;  2WI5 A;  3RLP A;  2FYP A;  2FWZ A;  2BT0 A;  2O1U A;  3EHH A;  3D36 A;  3VHC A;  3O0I A;  3WHA A;  5BOC A;  4L91 A;  2BRC A;  3Q5L A;  4QPJ A;  3EKO A;  1L0O A;  4DZY A;  4BIZ A;  1NHJ A;  4BAE A;  1B62 A;  1U0Z A;  3B25 A;  5BOD A;  4MP2 A;  3LPS A;  4CWS A;  2ZDY A;  1Y4S A;  4MPC A;  2XDL A;  4YKY A;  2YGE A;  1YSZ A;  4KSH A;  4URO A;  4FCQ A;  2XX2 A;  4BXI A;  1UY8 A;  2VCI A;  4CWQ A;  1I5C A;  1UYC A;  2YE7 A;  4XDM A;  3HEK A;  3NMQ A;  3K98 A;  2BYH A;  4XCJ A;  3O2F A;  2Q8G A;  1BXD A;  1PVG A;  2YEF A;  3OWB A;  4BIU A;  4NH8 A;  5FND A;  2O1W A;  3T0Z A;  1UYD A;  4XC0 A;  4ZVI A;  3K60 A;  2QFO A;  3A0T A;  2XHX A;  2YKC A;  4LWE A;  3CWV A;  3ZXQ A;  4EGK A;  3EHF A;  2YEH A;  3G75 A;  2H55 A;  2VWC A;  2YE4 A;  3DGE A;  5IN9 A;  3HYZ A;  4PRX A;  3RLQ A;  2YEA A;  3G7E A;  1I59 A;  4CWT A;  4X9L A;  4LWH A;  4O05 A;  4YKZ A;  5F5R A;  1AJ6 A;  5D7D A;  4O09 A;  3TZ4 A;  3A0W A;  3CRK A;  1UY9 A;  2Q2E B;  3T10 A;  4EFT A;  4GEE A;  2IWU A;  4ASA A;  1YT2 A;  2CG9 A;  1MU5 A;  1A4H A;  4LWI A;  1H7U A;  2XJG A;  4XE2 A;  3OWD A;  2HKJ A;  4MPN A;  2YI5 A;  3KE6 A;  4FPP A;  1GKZ A;  1EI1 A;  4WUD A;  1UYL A;  4HXW A;  1AH8 A;  2GQP A;  1UYM A;  4I3H A;  2XX4 A;  3TZ2 A;  1Z5A A;  2H8M A;  4GFN A;  2XDX A;  3GIE A;  5CF0 A;  2WI7 A;  1ZXM A;  4R1F A;  3B28 A;  1ID0 A;  4E02 A;  1TC6 A;  1YES A;  1S16 A;  4PRV A;  2YGA A;  3OPD A;  3B26 A;  2YEG A;  5M4H A;  3R4O A;  2ESA A;  4WUB A;  2YEB A;  2JKI A;  5D6P A;  2ZBK B;  4CE3 A;  2XHT A;  1YET A;  3CGZ A;  3JZ3 A;  2XK2 A;  1QZR A;  4HY1 A;  1UYK A;  2YEC A;  2YEJ A;  2QG2 A;  3H80 A;  4HZ5 A;  4L94 A;  4Q20 A;  2YE6 A;  4I5S A;  2BZ5 A;  3IED A;  5IDM A;  2BTZ A;  2YKJ A;  2CGF A;  3GIF A;  2WI2 A;  2XX5 A;  4KQV A;  4CE2 A;  2CCS A;  2FXS A;  4GQT A;  2CCT A;  1B3Q A;  2BYI A;  2WI1 A;  2BU5 A;  5L3J A;  2ZKJ A;  1NHH A;  2QG0 A;  2WEQ A;  1AM1 A; 
#chains in the Genus database with same CATH topology
 2WER A;  3TZ0 A;  1EA6 A;  3PEH A;  5FWK A;  2XAB A;  4L93 A;  4HYM A;  4XKA A;  4AWP A;  3EKR A;  4LPB A;  5D7R A;  4CWO A;  3G7B A;  5F3K A;  3T0H A;  1GJV A;  1YC3 A;  3ZKB A;  3HYY A;  5CTX A;  4V25 A;  2UWD A;  1KZN A;  2E0A A;  2XDK A;  2YE3 A;  2XCM A;  2YE9 A;  4R3M A;  4EEH A;  5CTU A;  4XIT A;  3FT8 A;  4CE1 A;  1THN A;  4NH9 A;  5GGZ A;  3O6O A;  4EM7 A;  4YKR A;  4FMT A;  1R62 A;  1I5A A;  2YKB A;  1YT0 A;  4ASF A;  4ASB A;  3D2R A;  4XTJ A;  4AWO A;  1I5B A;  1TID A;  1UY6 A;  2K5B A;  3R91 A;  4MPE A;  3HZ1 A;  3VHD A;  3Q5J A;  3GIG A;  2WEP A;  4PL9 A;  2XD6 A;  5D6Q A;  2C2A A;  4EMV A;  2YK2 A;  4QPK A;  3MNR P;  2HHI A;  4ASG A;  3ZKD A;  5CPH A;  2IWS A;  2Q8H A;  2ZDX A;  1UYF A;  5M4N A;  2XDS A;  4B7P A;  2XDU A;  2HCH A;  4EGH A;  1QYE A;  3GIG B;  5J6A A;  4KSG A;  4MP7 A;  1H7S A;  2BSM A;  1BGQ A;  5CTW A;  3S5T A;  3R4N A;  4YKQ A;  3HHU A;  4E01 A;  5M4K A;  1YS3 A;  3FT5 A;  2EXL A;  3BMY A;  2FWY A;  4HY6 A;  3H4L A;  5J71 A;  5FNF A;  4XKK A;  5M4E A;  2XJJ A;  2YJX A;  3C11 A;  1Z5B A;  3FV5 A;  3Q5K A;  1GKX A;  2WI4 A;  3A0Y A;  3U67 A;  4JAV A;  5CTY A;  4XIR A;  3TUH A;  4EFU A;  1F51 A;  1TC0 A;  3R4P A;  4H85 A;  4H7Q A;  3U2D A;  2BU2 A;  4XD8 A;  4CWR A;  4O07 A;  1ZXN A;  1UYE A;  2IOP A;  3A0Z A;  4FCR A;  3B27 A;  4CWP A;  3A0R A;  1YER A;  4O04 A;  2YGF A;  3CYG A;  3K97 A;  4GT8 A;  2YK9 A;  3TTZ A;  1YC4 A;  2CH4 A;  2VCJ A;  2CCU A;  2YKI A;  4URL A;  2Q8F A;  4XKO A;  1Z59 A;  2VW5 A;  3WQ9 A;  1OSF A;  3A0X A;  3EHJ A;  1TIL A;  4KP4 A;  4KTN A;  4XIP A;  1TBW A;  1U2O A;  1I58 A;  3PEJ A;  2Q8I A;  4MBC A;  4K4O A;  5FNC A;  4WUC A;  4U7O A;  3CGY A;  1BYQ A;  4U7N A;  4KFG A;  1UYH A;  4BQJ A;  1AH6 A;  4JQL A;  1UY7 A;  2YJW A;  1BKN A;  4EGI A;  3LNU A;  3QDD A;  4P7A A;  3C0E A;  2WI6 A;  4GGL A;  2PNR A;  4HYP A;  4LWG A;  3INX A;  4AS9 A;  4XCL A;  2AKP A;  4AWQ A;  2C1G A;  3SL2 A;  2BRE A;  2YE5 A;  4MOT A;  1Y8O A;  4DUH A;  3VHA A;  2WI3 A;  4YKX A;  3ZXO A;  2YI6 A;  4NH7 A;  5M4M A;  4R3A A;  2XJX A;  3VAD A;  3TZ5 A;  1YSR A;  4E00 A;  2IOQ A;  4YKU A;  1Y8P A;  2IOR A;  4W7T A;  3T2S A;  2BU7 A;  2YKE A;  1KIJ A;  2HG1 A;  3B24 A;  3RLR A;  4JAU A;  4JAS A;  3INW A;  1Y8N A;  3K99 A;  2O1V A;  1YC1 A;  5M4P A;  4LP0 A;  2YED A;  5IDJ A;  4LWF A;  4U93 A;  4YKW A;  3HZ5 A;  2BU8 A;  4GCZ A;  4V26 A;  3U2K A;  1ZWH A;  2YI0 A;  3D0B A;  4L90 A;  2XHR A;  3BM9 A;  2YI7 A;  1ZW9 A;  3LMM A;  2QF6 A;  2YEE A;  3ZM7 A;  4BQG A;  4FCP A;  1Z5C A;  1TH8 A;  3EHG A;  1US7 A;  4YKT A;  1JM6 A;  4PU9 A;  2YE8 A;  4CWF A;  1YT1 A;  4URN A;  4O0B A;  4ZKI A;  4B6C A;  2IWX A;  3T1K A;  2BU6 A;  5C93 A;  4HXZ A;  2YEI A;  3QTF A;  1Y4U A;  5D7C A;  2GFD A;  3OMU A;  3CRL A;  4CWN A;  1QY8 A;  2FTK A;  3OW6 A;  2JJC A;  1NHI A;  4MB9 A;  4HZ0 A;  1AMW A;  3R92 A;  1UYI A;  1I5D A;  2YE2 A;  4P8O A;  4L8Z A;  3R4M A;  1UYG A;  4H81 A;  4URM A;  1B63 A;  1MX0 A;  1S14 A;  4XIQ A;  3RKZ A;  2WI5 A;  3RLP A;  2FYP A;  2FWZ A;  2BT0 A;  2O1U A;  3EHH A;  3D36 A;  3VHC A;  3O0I A;  3WHA A;  5BOC A;  4L91 A;  2BRC A;  3Q5L A;  4QPJ A;  3EKO A;  1L0O A;  4DZY A;  4BIZ A;  1NHJ A;  4BAE A;  1B62 A;  1U0Z A;  3B25 A;  5BOD A;  4MP2 A;  3LPS A;  4CWS A;  2ZDY A;  1Y4S A;  4MPC A;  2XDL A;  4YKY A;  2YGE A;  1YSZ A;  4KSH A;  4URO A;  4FCQ A;  2XX2 A;  4BXI A;  1UY8 A;  2VCI A;  4CWQ A;  1I5C A;  1UYC A;  2YE7 A;  4XDM A;  3HEK A;  3NMQ A;  3K98 A;  2BYH A;  4XCJ A;  3O2F A;  2Q8G A;  1BXD A;  1PVG A;  2YEF A;  3OWB A;  4BIU A;  4NH8 A;  4E72 A;  5FND A;  2O1W A;  3T0Z A;  1UYD A;  4XC0 A;  4ZVI A;  3K60 A;  2QFO A;  3A0T A;  2XHX A;  2YKC A;  4LWE A;  3CWV A;  3ZXQ A;  1IXM A;  4EGK A;  3EHF A;  2YEH A;  3G75 A;  2H55 A;  5JEN A;  2VWC A;  2YE4 A;  3DGE A;  5IN9 A;  3HYZ A;  4PRX A;  3RLQ A;  2YEA A;  3G7E A;  1I59 A;  4CWT A;  4X9L A;  4LWH A;  4O05 A;  4YKZ A;  5F5R A;  1AJ6 A;  5D7D A;  4O09 A;  3TZ4 A;  3A0W A;  3CRK A;  1UY9 A;  2Q2E B;  3T10 A;  4EFT A;  4GEE A;  2IWU A;  4ASA A;  1YT2 A;  2CG9 A;  1MU5 A;  1A4H A;  4LWI A;  1H7U A;  2XJG A;  4XE2 A;  3OWD A;  2HKJ A;  4MPN A;  2YI5 A;  3KE6 A;  4FPP A;  1GKZ A;  1EI1 A;  4WUD A;  1UYL A;  4HXW A;  1AH8 A;  2GQP A;  1UYM A;  4I3H A;  2XX4 A;  3TZ2 A;  1Z5A A;  2H8M A;  4GFN A;  2XDX A;  3GIE A;  5CF0 A;  2WI7 A;  1ZXM A;  4R1F A;  3B28 A;  1ID0 A;  4E02 A;  1TC6 A;  1YES A;  1S16 A;  4PRV A;  2YGA A;  3OPD A;  3B26 A;  2C1I A;  2YEG A;  5M4H A;  3R4O A;  2ESA A;  4WUB A;  2YEB A;  2JKI A;  5D6P A;  2ZBK B;  4CE3 A;  2XHT A;  1YET A;  3CGZ A;  3JZ3 A;  2XK2 A;  1QZR A;  4HY1 A;  1UYK A;  2YEC A;  2YEJ A;  2QG2 A;  3H80 A;  4HZ5 A;  4L94 A;  4Q20 A;  2YE6 A;  4I5S A;  2BZ5 A;  3IED A;  5IDM A;  2BTZ A;  2YKJ A;  2CGF A;  3GIF A;  2WI2 A;  2XX5 A;  4KQV A;  4CE2 A;  2CCS A;  2FXS A;  4GQT A;  2CCT A;  1B3Q A;  2BYI A;  2WI1 A;  2BU5 A;  5L3J A;  2ZKJ A;  1NHH A;  2QG0 A;  2WEQ A;  1AM1 A; 
#chains in the Genus database with same CATH homology
 2WER A;  3TZ0 A;  1EA6 A;  3PEH A;  5FWK A;  2XAB A;  4L93 A;  4HYM A;  4XKA A;  4AWP A;  3EKR A;  4LPB A;  5D7R A;  4CWO A;  3G7B A;  5F3K A;  3T0H A;  1GJV A;  1YC3 A;  3ZKB A;  3HYY A;  5CTX A;  4V25 A;  2UWD A;  1KZN A;  2E0A A;  2XDK A;  2YE3 A;  2XCM A;  2YE9 A;  4R3M A;  4EEH A;  5CTU A;  4XIT A;  3FT8 A;  4CE1 A;  1THN A;  4NH9 A;  5GGZ A;  3O6O A;  4EM7 A;  4YKR A;  4FMT A;  1R62 A;  1I5A A;  2YKB A;  1YT0 A;  4ASF A;  4ASB A;  3D2R A;  4XTJ A;  4AWO A;  1I5B A;  1TID A;  1UY6 A;  2K5B A;  3R91 A;  4MPE A;  3HZ1 A;  3VHD A;  3Q5J A;  3GIG A;  2WEP A;  4PL9 A;  2XD6 A;  5D6Q A;  2C2A A;  4EMV A;  2YK2 A;  4QPK A;  3MNR P;  4ASG A;  3ZKD A;  5CPH A;  2IWS A;  2Q8H A;  2ZDX A;  1UYF A;  5M4N A;  2XDS A;  4B7P A;  2XDU A;  2HCH A;  4EGH A;  1QYE A;  3GIG B;  5J6A A;  4KSG A;  4MP7 A;  1H7S A;  2BSM A;  1BGQ A;  5CTW A;  3R4N A;  4YKQ A;  3HHU A;  4E01 A;  5M4K A;  1YS3 A;  3FT5 A;  2EXL A;  3BMY A;  2FWY A;  4HY6 A;  3H4L A;  5J71 A;  5FNF A;  4XKK A;  5M4E A;  2XJJ A;  2YJX A;  3C11 A;  1Z5B A;  3FV5 A;  3Q5K A;  1GKX A;  2WI4 A;  3A0Y A;  3U67 A;  4JAV A;  5CTY A;  4XIR A;  3TUH A;  4EFU A;  1TC0 A;  3R4P A;  4H85 A;  4H7Q A;  3U2D A;  2BU2 A;  4XD8 A;  4CWR A;  4O07 A;  1ZXN A;  1UYE A;  2IOP A;  3A0Z A;  4FCR A;  3B27 A;  4CWP A;  3A0R A;  1YER A;  4O04 A;  2YGF A;  3K97 A;  4GT8 A;  2YK9 A;  3TTZ A;  1YC4 A;  2CH4 A;  2VCJ A;  2CCU A;  2YKI A;  4URL A;  2Q8F A;  4XKO A;  1Z59 A;  2VW5 A;  3WQ9 A;  1OSF A;  3A0X A;  3EHJ A;  1TIL A;  4KP4 A;  4KTN A;  4XIP A;  1TBW A;  1U2O A;  1I58 A;  3PEJ A;  2Q8I A;  4MBC A;  4K4O A;  5FNC A;  4WUC A;  4U7O A;  3CGY A;  1BYQ A;  4U7N A;  4KFG A;  1UYH A;  4BQJ A;  1AH6 A;  4JQL A;  1UY7 A;  2YJW A;  1BKN A;  4EGI A;  3LNU A;  3QDD A;  4P7A A;  3C0E A;  2WI6 A;  4GGL A;  2PNR A;  4HYP A;  4LWG A;  3INX A;  4AS9 A;  4XCL A;  2AKP A;  4AWQ A;  3SL2 A;  2BRE A;  2YE5 A;  4MOT A;  1Y8O A;  4DUH A;  3VHA A;  2WI3 A;  4YKX A;  3ZXO A;  2YI6 A;  4NH7 A;  5M4M A;  4R3A A;  2XJX A;  3VAD A;  3TZ5 A;  1YSR A;  4E00 A;  2IOQ A;  4YKU A;  1Y8P A;  2IOR A;  4W7T A;  3T2S A;  2BU7 A;  2YKE A;  1KIJ A;  2HG1 A;  3B24 A;  3RLR A;  4JAU A;  4JAS A;  3INW A;  1Y8N A;  3K99 A;  2O1V A;  1YC1 A;  5M4P A;  4LP0 A;  2YED A;  5IDJ A;  4LWF A;  4U93 A;  4YKW A;  3HZ5 A;  2BU8 A;  4GCZ A;  4V26 A;  3U2K A;  1ZWH A;  2YI0 A;  3D0B A;  4L90 A;  2XHR A;  3BM9 A;  2YI7 A;  1ZW9 A;  2QF6 A;  2YEE A;  3ZM7 A;  4BQG A;  4FCP A;  1Z5C A;  1TH8 A;  3EHG A;  1US7 A;  4YKT A;  1JM6 A;  4PU9 A;  2YE8 A;  4CWF A;  1YT1 A;  4URN A;  4O0B A;  4ZKI A;  4B6C A;  2IWX A;  3T1K A;  2BU6 A;  5C93 A;  4HXZ A;  2YEI A;  3QTF A;  1Y4U A;  5D7C A;  2GFD A;  3OMU A;  3CRL A;  4CWN A;  1QY8 A;  3OW6 A;  2JJC A;  1NHI A;  4MB9 A;  4HZ0 A;  1AMW A;  3R92 A;  1UYI A;  1I5D A;  2YE2 A;  4P8O A;  4L8Z A;  3R4M A;  1UYG A;  4H81 A;  4URM A;  1B63 A;  1MX0 A;  1S14 A;  4XIQ A;  3RKZ A;  2WI5 A;  3RLP A;  2FYP A;  2FWZ A;  2BT0 A;  2O1U A;  3EHH A;  3D36 A;  3VHC A;  3O0I A;  3WHA A;  5BOC A;  4L91 A;  2BRC A;  3Q5L A;  4QPJ A;  3EKO A;  1L0O A;  4DZY A;  4BIZ A;  1NHJ A;  4BAE A;  1B62 A;  1U0Z A;  3B25 A;  5BOD A;  4MP2 A;  3LPS A;  4CWS A;  2ZDY A;  1Y4S A;  4MPC A;  2XDL A;  4YKY A;  2YGE A;  1YSZ A;  4KSH A;  4URO A;  4FCQ A;  2XX2 A;  4BXI A;  1UY8 A;  2VCI A;  4CWQ A;  1I5C A;  1UYC A;  2YE7 A;  4XDM A;  3HEK A;  3NMQ A;  3K98 A;  2BYH A;  4XCJ A;  3O2F A;  2Q8G A;  1BXD A;  1PVG A;  2YEF A;  3OWB A;  4BIU A;  4NH8 A;  5FND A;  2O1W A;  3T0Z A;  1UYD A;  4XC0 A;  4ZVI A;  3K60 A;  2QFO A;  3A0T A;  2XHX A;  2YKC A;  4LWE A;  3CWV A;  3ZXQ A;  4EGK A;  3EHF A;  2YEH A;  3G75 A;  2H55 A;  2VWC A;  2YE4 A;  3DGE A;  5IN9 A;  3HYZ A;  4PRX A;  3RLQ A;  2YEA A;  3G7E A;  1I59 A;  4CWT A;  4X9L A;  4LWH A;  4O05 A;  4YKZ A;  5F5R A;  1AJ6 A;  5D7D A;  4O09 A;  3TZ4 A;  3A0W A;  3CRK A;  1UY9 A;  2Q2E B;  3T10 A;  4EFT A;  4GEE A;  2IWU A;  4ASA A;  1YT2 A;  2CG9 A;  1MU5 A;  1A4H A;  4LWI A;  1H7U A;  2XJG A;  4XE2 A;  3OWD A;  2HKJ A;  4MPN A;  2YI5 A;  3KE6 A;  4FPP A;  1GKZ A;  1EI1 A;  4WUD A;  1UYL A;  4HXW A;  1AH8 A;  2GQP A;  1UYM A;  4I3H A;  2XX4 A;  3TZ2 A;  1Z5A A;  2H8M A;  4GFN A;  2XDX A;  3GIE A;  5CF0 A;  2WI7 A;  1ZXM A;  4R1F A;  3B28 A;  1ID0 A;  4E02 A;  1TC6 A;  1YES A;  1S16 A;  4PRV A;  2YGA A;  3OPD A;  3B26 A;  2YEG A;  5M4H A;  3R4O A;  2ESA A;  4WUB A;  2YEB A;  2JKI A;  5D6P A;  2ZBK B;  4CE3 A;  2XHT A;  1YET A;  3CGZ A;  3JZ3 A;  2XK2 A;  1QZR A;  4HY1 A;  1UYK A;  2YEC A;  2YEJ A;  2QG2 A;  3H80 A;  4HZ5 A;  4L94 A;  4Q20 A;  2YE6 A;  4I5S A;  2BZ5 A;  3IED A;  5IDM A;  2BTZ A;  2YKJ A;  2CGF A;  3GIF A;  2WI2 A;  2XX5 A;  4KQV A;  4CE2 A;  2CCS A;  2FXS A;  4GQT A;  2CCT A;  1B3Q A;  2BYI A;  2WI1 A;  2BU5 A;  5L3J A;  2ZKJ A;  1NHH A;  2QG0 A;  2WEQ A;  1AM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...