1YT4A

Crystal structure of tem-76 beta-lactamase at 1.4 angstrom resolution
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMGDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Consequences of the Inhibitor-Resistant Ser130Gly Substitution in TEM beta-Lactamase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Beta-lactamase TEM
total genus 97
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2005-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1yt4A00
3PTEA 1QMEA 3ITBA 4BENA 5F1FA 1W5DA 1JVJA 1W79A 4PM7A 3MZDA 4Y0TA 1IYSA 1IYOA 4S2IA 4Y0UA 1K38A 4E3KA 4YFMA 2WKHA 3GSGA 5GLDA 5TGFA 4EBNA 3LY4A 3OPRA 2E8IA 3MFDA 3JYIA 4OPQA 2EFUA 4KQQA 1NJ4A 5GHYA 2BG1A 4WEKA 1LL5A 2ZC6B 3UY6A 5EVIA 4DDYA 5M1AA 1TDGA 1AXBA 1N4OA 3MZEA 4P6BA 1SCWA 3ZGAB 3IH9A 3NC8A 2Y2MA 5HFOA 1IYQA 1KGGA 5A91A 4K0WA 3VOYA 4S2LA 3G35A 2XDMA 2C6WB 4OQIA 5CGWA 4BLMA 5EE8A 4X55A 4UHUA 2WGWA 1KE4A 4E3MA 1EROA 1LLBA 1BZAA 3FKVA 4BD1A 1J9MA 3G4PA 3A3IA 1DJCA 4NETA 4Y0OA 1MBLA 4HBUA 4QB8A 1CI8A 2VGKA 1IELA 3HLGA 5FSRA 3G32A 1OMEA 1W7FA 3G30A 4JKTA 5CECA 3WRZA 3CG5A 4ZDXA 5GLAA 3N4IA 4OP8A 3NIAA 5D3OA 1O07A 5AQ7A 5FQQA 1S6RA 1Q2PA 3UE1A 2G2UA 3PAGA 3SS5A 1K4FA 2WGVA 1K55A 4NK3A 3FKWA 5DF7A 3VFFA 3LY3A 5M18A 5TR7A 5I94A 3W4OA 2OV5A 3FWLA 5FAOA 2J8YA 3DW0A 3B3XA 3ZG0A 1ZG6A 1K54A 1HTZA 2ZC5B 2JCHA 4E3OA 1YM1A 2A3UA 3BRMA 3WWXA 2G2WA 1FSYA 1EI5A 3Q07A 2Q9NA 4EQIA 2P9VA 3BFDA 2ZC7A 4OLDA 3TSGA 3ZG7B 3MKFA 1W8YA 3HLCA 2ZC3B 1BTLA 3UNWA 4LV2A 4WZ5A 2H5SA 5CEDA 4RA7A 4QU3A 2DCFA 3IF6B 4K91A 2HDSA 2HP5A 4X56A 1LHYA 3IXGA 4XUZA 3TOIA 4ZAMA 1YQSA 2JBFA 3HLBA 3N8LA 5E2FA 3PBRA 4YINA 1NZUA 1EWZA 2HDUA 5HARA 3ZG9B 4RYEA 3ZNYA 1YT4A 3MXRA 3BEBA 3GV9A 3NY4A 3HLWA 3UDIA 2JE5A 4JXWA 1NY0A 3BFCA 1Y54A 1NYYA 5FI6A 3N8SA 1PZOA 4JPMA 4OONA 3QNBA 1XA1A 2XQZA 4MBHA 4P0MA 1SDNA 3PAEA 3G31A 3VP0A 4B88A 2ZC4B 4OLGA 4WM9A 2ZLYA 5CHJA 3O86A 4IVKA 1BUEA 1ZC2A 3VOZA 1MPLA 5FATA 4IEDA 3HLEA 3Q81A 3C5AA 4B4ZA 4C6YA 4RVAA 1WYCA 1BSGA 2QPNA 2Y2JA 4EWFA 2RCXA 4GD8A 1MWSA 3G34A 3NCKA 4GDNA 4KZAA 4JLFA 3VP4A 5EVIB 1JTDA 3E2KA 4PM6A 2P9VB 3N7WA 1JWVA 4R1GA 1E3UD 2UWXA 1E3UA 2XEPA 1CI9A 3CJMA 1K57A 2OLVA 3HLDA 1XP4A 4LV0A 2BLSA 4IVIA 4S2PA 2IWBA 2XLNA 3ZVWA 1LL9A 3ZHHA 3IWIA 1ALQA 4OOLA 4E6WA 1K6RA 4Z9QA 1MXOA 4C75A 4LCLA 2XGNA 4JXSA 2ZQDA 5EOEA 3IT9A 3IHBA 3SH9A 3DWZA 1KVLA 4JF5A 3V5MA 1YLJA 3IXHA 1JTGA 2WZXA 1O7EA 1S0WA 4DKIA 1TEMA 2J7VA 1CK3A 1K54C 1IKGA 1BLPA 1SHVA 5F82A 1XXMA 3SS4A 1G6AA 4B4XA 1RGZA 1YLZA 4N92A 3A3FA 4GD6A 4N9KA 4X69A 4DXBA 4OP5A 5EVID 5DTSA 4WZ5C 2WGWB 4ID4A 5EUAA 3FYZA 4GN2A 1MKIA 4U0TA 5JYPA 3SH7A 5AQ9A 2Y91A 4GKUA 2FFYA 2XFTA 3BLSA 2X71A 3LCEA 1RGYA 3UE3A 5JYOA 3Q7ZA 3IQAA 1GHMA 3FZCA 4KZ8A 2A49A 1ESUA 1K55C 2Y2HA 4UAAA 4X68A 3IHAA 5FQKA 3SOIA 3NDEA 1VM1A 1H8YA 4HESA 5HAQA 1GHPA 2EFXA 1HZOA 1HD8A 1N9BA 4KQOA 1FOFA 3BLMA 3ZCZA 3ZG5A 1YMXA 5CEBA 1DJBA 1K25A 5E2HA 4KQRA 3UPPA 2Y2PA 2QZ6A 1KGEA 1FCNA 3GQZA 5FQ9A 1PYYA 1XX2A 3QNCA 3RXWA 2WUQA 3W4PA 3BFGA 3P09A 4KZ9A 2Y2GA 4WZ4A 4IBRA 3DTMA 5F83A 4DDSA 3E2LA 2V1ZA 5KSCA 2XD1A 4WELA 1W8QA 3VP1A 4N9LA 5TFQA 3MKEA 2QMIA 2WK0A 3W4QA 2Y2KA 3NDGA 1Q2QA 3AGDA 3OC2A 3S1YA 4C3QA 4OKPA 1MWRA 4HBTA 5CGXA 1NXYA 1WYBA 5CRFA 4GZBA 1QMFA 2ZQ9A 4PMAA 4QD4A 2WKIA 2ZM8A 5U47A 3ITAA 3UO9A 4BD0A 3P98A 5HW3A 5CERA 5CTNA 1TDLA 3C4PA 3G2ZA 1K56A 4OPRA 4ZBEA 4ZTKA 3IXBA 3N6IA 5GL9A 4DE0A 1XGJA 4PM5A 2Z2MB 4EBPA 1K56D 4A5RA 1XKZA 2EX8A 3BFEA 5FQJA 1YLPA 2IWDA 4CJNA 1MWUA 1GHIA 1RP5A 3V3RA 4S2NC 5EPHA 3RXXA 4KZ6A 4R4SA 5CGSA 3TG9A 2HPBA 3PBTA 3WRTA 1ZKJA 3WS2A 2HP6A 5A90A 4EBLA 4BQMA 5DVAA 2ZM0A 3G2YA 4BL3A 4U3TA 3WS5A 4WYYA 3OPLA 3HLFA 1KE3A 4PM8A 4R3JA 1YLYA 4FSFA 4RX3A 1BULA 2R9WA 4KZ3A 1U60A 3VP2A 4F94A 5F1GA 4KZ7A 4DRTA 1K57C 3Q7VA 1XA7A 1DJAA 1L0EA 3ZVTA 1SDEA 4HEFA 3V50A 1IEMA 3WS4A 4E3JA 1BLHA 4S2MA 1FQGA 1DY6A 2VGJA 4OH0A 4OQGA 2P74A 1MY8A 3BECA 5HAPA 4CPKA 2H10A 5CXWA 5DF9A 3GR2A 3UPOA 3Q82A 2RL3A 3WS0A 3WS1A 3M2JA 4OQ0A 4BJPA 1ES2A 2J9OA 5GHXA 4N1HA 2Y59A 2WGIA 4L0LA 3S22A 1L0GA 3PBSA 3UPNA 2OLUA 4GNUA 3S4XA 1PW1A 4LV3A 1BT5A 1PW8A 4JF4A 1L0FA 3LEZA 4OOMA 4U0XA 2OSUA 3BM6A 1CEFA 1PWDA 3C4OA 3HVFA 1I5QA 3OCNA 5BOHA 3SH8A 4R23A 5FQIA 4JXVA 2Y2LA 3GVBA 1H5XA 3N8RA 4KZ5A 3HL9A 4JBFA 4S2OA 5FAQA 3MXSA 1IYPA 4E6XA 4OVDA 3EQVA 4WMCA 5KMWA 2XH9A 5EOOA 3VFHA 2ZQ7A 4S2JA 1NYMA 1HVBA 3HUOA 4WMCD 4E3NA 5J8XA 4FD8A 3A3DA 3VMAA 2ZMAA 3M2KA 2Y4AA 2XF3A 1ES5A 4Y7PA 4WEJA 4EV4A 3SS3A 4QJGA 3ZG8B 3M6HA 2GDNA 5IHVA 4ZJ2A 2Y2NA 4UA9A 3IXDA 3DWKA 5EVLA 2C5WB 5HAIA 3ZFZA 3OCLA 4OPZA 2WADA 2ZJ9A 4KZ4A 5CHMA 1L0DA 1GCEA 2DNSA 2Y2IA 1KVMA 1E4DA 4FCFA 1BLCA 2WKEA 4KG5A 1FCMA 3ZNTA 5EECA 2ZD8A 4OPYA 3VSLA 3Q7VB 3ISGA 4MNRA 4IBXA 3OPPA 4GB7A 2XK1A 5KZHA 3EQUA 2JC7A 1IKIA 1NRFA 4QHCA 2ZM2A 5FI2A 3IWQA 2X02A 5HX9A 5FASA 1PI4A 3PBNA 1KGFA 2ZQAA 2B5RA 2PBYA 3PBQA 3W8KA 3V3SA 1ZG4A 4GDBA 4ZJ1A 1PZPA 5KSHA 3NI9A 4QY5A 5E2EA 4N1XA 1ES4A 4Q8IA 1ONGA 1KDWA 2WZZA 1LI9A 1RCJA 2WAEA 5GLBA 1YLWA 1XGIA 2EX6A 4E3IA 5HL1A 2Z2LB 4S2NA 4E3LA 3AGEA 4M3KA 2XD5A 4FH4A 4WBGA 3OPHA 3CMZA 4BL2A 3Q1FA 2XR0A 1G68A 4LCMA 3UE0A 5AQAA 1KDSA 3QHYA 1XPBA 3UDXA 1WE4A 4RX2A 3IWOA 3CZDA 5GHZA 3LO7A 1PI5A 2EXAA 4LV1A 3C7UA 2X01A 2PU2A 4UA6A 3PBOA 3OZHA 4S2KA 2I72A 3ZDJA 3A3EA 1ONHA 4D2OA 5L2FA 1JWZA 5E2GA 1LI0A 5G18A 1FSWA 4X6TA 5A93A 1MWTA 2PU4A 1CEGA 4P87A 1GA0A 1SKFA 4PM9A 4OQHA 5CHUA 3MBZA 1L2SA 5FI7A 1JWPA 1FR1A 4JXGA 3VP3A 4EUZA 4LENA 2Y2OA 2J9PA 3UDFA 2FFFB 2EXBA 4R3BA 5M19A 1ES3A 2EX2A 5FDHA 4XXRA 3IH8A 1NZOA 1K4EA 1BLSA 5GLCA 4R0QA 2ZQ8A 4FH2A 4ZJ3A 3HREA 2HP9A 4DE3A 5DF8A 2R9XA 3IF6A 4P85A 4DE1A 1K6SA 3UN7A 4DXCA 1GA9A 1M40A 2EX9A 1PWCA 1YMSA 3V39A 2CC1A 2WYXA 5E43A 4DF6A 3D4FA 3O3VA 3M6BA 1I2WA 3HBRA 1PWGA 1FCOA 4K0XA 2HDQA 5DTTA 4KENB 3RJUA 3AGFA 4OOYA 2V2FF 3BFFA 3A3JA 3O88A 4QY6A 1ERMA 4MLLA 3GTCA 2H0TA 4X53A 1C3BA 3IF5A 3FV7A 4DE2A 3GRJA 1KE0A 1ERQA 3IF6C 4KG6A 4MBKA 4MBFA 3BYDA 4MEZA 4H8RA 3HUNA 5DTKA 1M6KA 2H0YA 2XFSA 4JF6A 4GOGA 1FR6A 2ZQCA 1E25A 4R4RA 1YLTA 2WAFA 2Y2QA 1H8ZA 3HUMA 3NBLA 1TVFA 3MZFA 5CTMA 1ESIA 4PPRA 5FA7A 4XUXA 5EVIC 3GMWA 3C7VA 4KZBA 3O87A 2IWCA 4O7DA 1PIOA 5A92A 1VQQA 2V20A 4UA7A 2DRWA 2Q9MA 3I7JA 5AQBA 5FAPA 2HDRA 4KG2A 3VSKA 1I2SA 2Y55A 1Z6FA 5FQMA
chains in the Genus database with same CATH superfamily
1QMEA 5F1FA 1W5DA 1JVJA 4MDZA 3NOPC 4Y0UA 3GSGA 1F98A 2W1TA 2E8IA 3MS6A 1T18A 2EFUA 1LL5A 5EVIA 1EW0A 4DDYA 1AXBA 3CLOA 2Y2MA 3W2ZA 1D1JA 5A91A 4S2LA 3G35A 3JPUA 5CGWA 1Z09A 3ULFA 4BLMA 2NUTC 3FKVA 5I5LA 3A3IA 5K5BA 2JKRI 4X1MA 5FSRA 1OMEA 4JKTA 4E04A 2YKHA 3CG5A 4ZDXA 4OP8A 3NIAA 1O07A 3UE1A 2VLGA 5FEFA 3PAGA 1K4FA 5DF7A 3LY3A 5I94A 3W4OA 2OV5A 3LIBA 5FAOA 2EWVA 1ZG6A 2H28A 1HTZA 3GECA 2A3UA 4NG2A 3WWXA 3ZG7B 3TSGA 4EU0A 3MKFA 4L9FA 3OBFA 4PAUA 2HDSA 3IXGA 2WKPA 2JBFA 5AVEA 4NEED 3N8LA 3KSHA 4RYEA 3DTIA 3BEBA 4IUHA 3NY4A 4WL9A 3BFCA 4I3IA 1NYYA 5FI6A 4JPMA 1HLUP 2XQZA 3VP0A 1ZTUA 4B88A 4D60A 2VKSA 1LSWA 1VETB 1MPLA 4IEDA 3Q81A 1JNUA 4EEUA 2RCXA 2VA0A 3R4KA 3E2KA 4HOIA 3EGXC 4NXFA 4R1GA 1N9NA 1XP4A 3ZVWA 4BMWA 4OOLA 2XGNA 4JXSA 4R3AA 5EOEA 4LFUA 3DWZA 4JF5A 4O01A 1LL8A 3V5MA 5AJGA 2CMNA 3MQ0A 1K54C 1XXMA 4B4XA 4GD6A 4O0PA 5EVID 4PHTA 5EUAA 4GN2A 1MKIA 4U0TA 4Y15A 4GS9A 5HPFA 3IQAA 4UAAA 1VM1A 1H8YA 4HESA 1GHPA 2EFXA 1N9BA 4BBTA 3BFGA 4KZ9A 4ZRRA 2V1ZA 1PFLA 2XD1A 4CLCB 4RQ9A 4WELA 4M4XA 3VP1A 2QMIA 3MSHA 3W4QA 3MR0A 1Q2QA 5HZHA 5CGXA 1WYBA 4QD4A 1H0MA 3ITAA 3T4LA 1TDLA 3BW6A 4ZBEA 4ZTKA 1S1ZA 4PM5A 3T4JA 2Z2MB 1K56D 1S1YA 4S2NC 5EPHA 3TG9A 4EETB 2PRFA 1S67L 1ZHHB 3U2AA 1ZKJA 1OTBA 5A90A 4G3KA 2JKGA 4U3TA 4WYYA 3NECA 4PM8A 1STZA 5F1GA 4Y5FA 1XA7A 1MC0A 1DJAA 3TE8A 3RTYA 1FILA 1IEMA 1P9WA 2JKFA 3UPOA 3M2JA 4KUKA 2K7SA 3QP5A 4GJ4A 3UPNA 2YKFA 2OWJA 3OCNA 5BOHA 3SH8A 1XJ2A 2HV1A 4MMNA 1H5XA 3N8RA 4KZ5A 3IX4A 5FAQA 3MXSA 1IYPA 3LI8A 4OVDA 3EQVA 5EVEA 1NYMA 1HVBA 3NJAA 4WMCD 1L3LA 4E3NA 2V1BA 4FD8A 4WEJA 4EV4A 3SS3A 4Q0JA 2HGVA 2GDNA 4ZJ2A 2VK3A 3IXDA 2W3HA 3ZFZA 1W63M 1N9LA 4Z1WA 5CHMA 1L0DA 3T1SA 2Y79A 4FCFA 2W1TB 4OPYA 1OTAA 3Q7VB 4IBXA 5KZHA 3KYEA 2X02A 5KMWA 3E4PA 4AFIA 3PBNA 4CLCA 4MN5A 4GDBA 4ZJ1A 5HSQA 1PZPA 4QY5A 1CF0A 1ES4A 3TJZC 3LGOA 4E3IA 5HL1A 2Z2LB 4WBGA 2XD5A 3MMHA 4FH4A 3D9YA 3KYZA 4ME4A 3UE0A 5AQAA 4RX2A 3CZDA 3LO7A 3DTEA 2X01A 2PU2A 3CAXA 2AVXA 3ZDJA 3UB7A 1ONHA 4D2OA 1S4SA 1MWTA 4PM9A 2PR6A 5FI7A 1FR1A 3VP3A 2FFFB 4R3BA 1ES3A 2EX2A 3UB6A 5FDHA 1K4EA 5GLCA 5AVFA 4DE1A 1K6SA 2EX9A 3KX0X 4HY8A 5E43A 5EM0A 2EWWA 3HBRA 2NUPC 3R7WA 3AGFA 5DJTA 3A3JA 3B47A 2I9VA 1ERMA 2QHKA 3FG8A 2L4RA 1C3BA 3UB5P 1KE0A 1H3QA 4HNBA 2ZQCA 1E25A 4R4RA 2M1CA 4HH3A 1TVFA 2VEAA 4XUXA 4KZBA 2R78A 1PIOA 5A92A 5J3WA 1S4RA 2K31A 2DRWA 3VSKA 5AQBA 4KG2A 2Y8HA 3Q7ZA 3PTEA 3ITBA 4KUOA 1W79A 2VV7A 1IYOA 4YFMA 5TGFA 2O9BA 1KOUA 3OPRA 4KQQA 2OAP1 5GHYA 4WEKA 3MZEA 4P6BA 3IH9A 5HFOA 1DP6A 4DN0A 1KGGA 3VOYA 1YSPA 4UHUA 2WGWA 2J3WA 2HF6A 4BD1A 1J9MA 3G4PA 4NETA 4QB8A 2VGKA 1IELA 3HLGA 4GHIB 1W7FA 5FQQA 5AQ7A 1S6RA 3CUEA 3BJNA 2WGVA 2IA2A 5FDSA 4HIAA 3B3XA 1K54A 2JCHA 4GCZA 5EV0A 1FSYA 2Q9NA 4EQ1A 1DP9A 2P9VA 4QWOA 3UNWA 2D01A 3BQ8A 4QU3A 3IF6B 2XROA 5DFXA 4X56A 4XUZA 1LHYA 3HLBA 1CQAA 2VV8A 5IS1A 5E2FA 1SKOB 3ZNYA 1YT4A 2E8JA 1LT0A 2A24B 3N8SA 4OONA 4MBHA 1XA1A 1SDNA 3PAEA 4WLAA 2ZLYA 5CHJA 4IVKA 2GNXA 1BUEA 3VOZA 3BQAA 5FATA 2ZMFA 3HLEA 1MKMA 1OT6A 2QPNA 2KLIA 1MWSA 3NCKA 4GDNA 4EERA 5A8BA 3HJIA 1CI9A 3CJMA 2VJWA 4IVIA 1LL9A 4Z9QA 4LCLA 3P7NA 2ZQDA 2BTFP 3EWKA 1VETA 5L10A 1VHMA 1YLJA 3S7NA 2WZXA 1TEMA 2J7VA 2XA7S 1CK3A 2PD8A 1IKGA 4BWIA 3NOTC 1YLZA 4N9KA 4X69A 5TBMB 5DTSA 4Y2FA 3T1XA 4B9OA 3A0VA 3FYZA 2FFYA 2XFTA 3BLSA 3LCEA 1GHMA 3FZCA 2A49A 2PHYA 4WUJA 3D3OA 3H7WB 3NDEA 4H6JB 3ZG5A 3ZCZA 1YMXA 3F1PA 1DP8A 5CEBA 1DJBA 5E2HA 4MN7A 1H8MA 2Y2PA 1FCNA 3GQZA 1PYYA 4DDSA 5KSCA 5TFQA 4HHDA 3MKEA 2Y2KA 3OC2A 3UB9A 5FEGA 4OKPA 1NXYA 5CRFA 1QMFA 2ZQ9A 3MXQA 2ZM8A 1V9ZA 3UO9A 3P98A 3LICA 5CERA 2Z6CA 3H9WA 4DE0A 3N6IA 1XGJA 1XKZA 3BFEA 5FQJA 1YLPA 1GHIA 1RP5A 2JKRM 3RXXA 4R4SA 3LIDA 2PBDP 3WS2A 2HP6A 3VE4A 4BBUA 1G6OA 2ZM0A 3OPLA 4CLCD 3HLFA 1YLYA 4FSFA 2R9WA 4KZ3A 3PXPA 1F2KA 4Y17A 4DRTA 1K57C 4HEFA 3DTKA 3LR4A 1FQGA 2VGJA 4OH0A 4EW7A 2P74A 3BECA 5KIZA 3H82A 5DJUA 2PAVP 3GR2A 1WA9A 2QWSA 3Q82A 3CPTA 4OQ0A 4BJPA 1ES2A 4MN6A 4R38A 3C2WA 3LR5A 4L0LA 2W27A 1L0GA 1PW1A 4LV3A 4JF4A 3LEZA 3DAVA 5FQIA 3GVBA 3HL9A 3SZTA 5F5YA 4E6XA 1MZUA 3T4OA 3VFHA 2ZQ7A 3HJKA 3A3DA 3VMAA 2ZMAA 3M2KA 4R70A 4Y7PA 4QJGA 2LB5A 4EXOA 2Z6DA 2Y2NA 4LPZA 2Q0OA 5HAIA 1G5UA 4OPZA 2WADA 2W3EA 3TW8A 1FIKA 2DNSA 1KVMA 3ZNTA 5EECA 2ZD8A 3IX8A 4MNRA 2QKPA 5FI2A 5HX9A 1NRFA 4QHCA 2B5RA 2PBYA 3GDIA 1LSVA 3SW1A 4L9GA 3OLOA 5KSHA 4N1XA 3C8CA 4Q8IA 1ONGA 1KDWA 4LLOB 1LI9A 2W3FA 2WAEA 5GLBA 3U4LP 1P9RA 2EX6A 2GJ3A 4E3LA 2B95A 3CMZA 2J80A 1KDSA 3UDXA 4WF0A 1WE4A 3EGDC 3IWOA 2I72A 3A3EA 4Q0HA 4FOFA 1JWZA 5E2GA 2ZMVA 1CEGA 3LI9A 1GA0A 2QYBA 2UV0E 4JXGA 3LIAA 2J9PA 3T12B 5M19A 3PR6A 4R0QA 5HDCA 4FH2A 4ZJ3A 3HREA 2HP9A 4L9EA 3IF6A 4P85A 3CUEC 5HPIA 4DXCA 1GA9A 2P04A 1OPXA 2WKRA 3H7WA 4DF6A 3D4FA 1I2WA 1OTIA 5DTTA 1OJGA 4KENB 4LRXC 3O88A 2KDKA 4MLLA 3T50A 4DE2A 3GRJA 5L07A 3BYDA 4MEZA 1J3WA 3HUNA 5DTKA 4DJ2A 3S7PA 1YLTA 3NBLA 3MZFA 5CTMA 1ESIA 4HJ4A 5EVIC 2GX5A 2IWCA 2V20A 4UEYA 3IBRA 4JGPA 2HDRA 1TS7A 3H82B 5FQMA 5HWVA 3MZDA 3F1NB 2WKHA 4EBNA 2OAQ1 1GSWA 2LB9A 1NJ4A 2BG1A 4F3LA 4XT2B 1TDGA 1GSVA 3ZGAB 3KSIA 2C6WB 4OQIA 1Y4OA 4NKPA 1XJ6A 1KE4A 1DJCA 1NRJA 4HBUA 1CI8A 1Y28A 4DJ3A 4FUWA 5GLAA 3N4IA 1T1AA 2G2UA 3SS5A 3VFFA 3KO6A 3B42A 4NK3A 5TR7A 3FWLA 3UB8A 3ZG0A 3LEQA 5J4EA 2ZC5B 4E3OA 1YM1A 4P6ZS 3BFDA 2ZC7A 1W8YA 3HLCA 3QP8A 2H5SA 5CEDA 4K91A 3TOIA 2HP5A 1A0KA 1YQSA 3BY9A 3NOUC 4YINA 1NZUA 4DMZA 5HARA 3ZG9B 4WN5A 4HP4A 3GV9A 2V8CA 3HLWA 2W3DA 3UDIA 2A2LA 2JE5A 2DMWA 4JXWA 1XJ4A 1Y54A 2QJ5A 4QPRA 3QNBA 4P0MA 3BWLA 3G31A 3IS2B 3C30A 4OLGA 1ZC2A 3OOVA 4JGOA 3LUQA 2VGLM 3UMEA 3C5AA 4B4ZA 4C6YA 4RVAA 1WYCA 1BSGA 4EWFA 4GD8A 4JLFA 3PYPA 4PM6A 3N7WA 4ETXA 1JWVA 2XEPA 1K57A 2OLVA 4LV0A 4S2PA 3LR3A 2BLSA 3MJQA 3O5YA 2IWBA 3ZHHA 4E6WA 3K3CA 1T1BA 1MXOA 3IHBA 3SH9A 2EA9A 3CI6A 5HWWA 3IXHA 1JTGA 1S0WA 1F5MA 5F82A 4HI4A 3SS4A 5IU1A 4DXBA 4F3LB 2VX8A 3P01A 1XFNA 4WZ5C 2WGWB 2JKTM 2OWHA 3KYQA 5EFWA 5JYPA 3SH7A 3T1RA 5AQ9A 3F1OA 4GKUA 1YSQA 3PHYA 4KZ8A 1K55C 2Y2HA 2ACGA 3IHAA 1P97A 1HD8A 4KQOA 2VV6A 3UPPA 1KGEA 2HZ5A 1XX2A 3RXWA 2WUQA 3W4PA 2Y2GA 2V1AA 3DTMA 3E2LA 2O9AA 4N9LA 2KX6A 2WK0A 2ZOIA 1MWRA 2HJ9C 3VV4A 5U47A 5HD5A 4BD0A 2FH5A 4OPRA 4IHQA 1K56A 2V8FA 3IBJA 4EEPA 4ARZB 1MWUA 3MFXA 1DRMA 4EBLA 4BQMA 5DVAA 3G2YA 4BL3A 3WS5A 4HP9A 2ZOHA 4O8GA 1KE3A 4R3JA 4RX3A 1BULA 1U60A 3VP2A 3F1OB 1TF1A 3Q7VA 1K0KA 3ZVTA 3V50A 3JVUA 4E3JA 1BLHA 3LFVA 4OQGA 4MCWA 5HAPA 2H10A 4EUVA 3WS1A 2J9OA 4N1HA 2WGIA 3MQOA 1PW8A 3FPVA 1L0FA 1D7EA 3S7QA 2OSUA 4PKYA 1CEFA 3HVFA 3UMDA 1I5QA 4PKYG 1IOUA 4JXVA 2Y2LA 3V67A 1N9OA 2QJ7A 2W1RA 4S2OA 1OTEA 5L8MA 4WMCA 5EOOA 4S2JA 2W3GA 5J8XA 1VB6A 4I39A 4Q0IA 3A0SA 5IHVA 1AWIA 4UA9A 3DWKA 2C5WB 2VZWA 2ZJ9A 4BBVA 2Y2IA 1E4DA 1BLCA 2WKEA 5HDDA 1FCMA 4YOFA 3E0YA 3OPPA 4GB7A 4I5SA 2XA7M 2XK1A 2PDRA 1IKIA 2ZM2A 1ODVA 3IWQA 5FASA 3PBQA 3W8KA 3K3DA 3ZYTA 1G28A 3G6OA 3NI9A 1RCJA 4GLQA 2O0YA 4JGRA 1TD5A 3B33A 3D72A 4M3KA 1X0OA 4BL2A 3Q1FA 2XR0A 3L7HA 3QHYA 1GSXA 4CLCC 3RFBA 2W0NA 5GHZA 1PI5A 1VEUB 3KSFA 4Y3IA 3PBOA 3OZHA 4S2KA 5G18A 1FSWA 4I3JA 4X6TA 2PU4A 4P87A 1SKFA 4OQHA 5CHUA 1JWPA 3NHQA 4LENA 3RH8B 2EXBA 3LR0A 4YWZA 3DBAA 4XXRA 1NZOA 4EESA 4DE3A 2R9XA 2V0WA 1XFQA 3UN7A 3V39A 2G7UA 1NLYA 2V0UA 1FCOA 4K0XA 4UQIM 2HDQA 3RJUA 2V2FF 2H0TA 3KSGA 2JN7A 3FPWA 4KG6A 4MBKA 4MBFA 1V9YA 1M6KA 2H0YA 1FR6A 4GHIA 1H8ZA 4ETZA 3T4TA 3C7VA 3O87A 1PRQA 3MF0A 4UA7A 5FAPA 3I7JA 4E3MA 3S1YA 1Z6FA 2J3TC 4BENA 1XJ3A 4PM7A 4Y0TA 1IYSA 4S2IA 1K38A 4E3KA 5GLDA 3LY4A 3MFDA 3JYIA 4OPQA 1YAXA 2ZC6B 3UY6A 5M1AA 1N4OA 1SCWA 3NC8A 1IYQA 4K0WA 2XDMA 4HJ3A 5EE8A 4X55A 2ZL1A 1EROA 2M7VA 1LLBA 1BZAA 4Y0OA 1MBLA 3G32A 3G30A 5CECA 3WRZA 5D3OA 2ZBBA 1Q2PA 1K55A 1S66L 3FKWA 5M18A 3ICYA 2J8YA 3DW0A 5G4ZA 3BRMA 2JKTI 2G2WA 1EI5A 3Q07A 4EQIA 1OTDA 4OLDA 2ZC3B 1BTLA 4LV2A 4WZ5A 5LBRA 4RA7A 2DCFA 3FC7A 3IX3A 4LGWA 4ZAMA 3PBRA 2O99A 1EWZA 2HDUA 3LIEA 5MC7A 3MXRA 3VE3A 3C38A 3CPTB 4G3VA 4CQHA 1NY0A 4I3AA 3QP1A 1PZOA 3CHWP 4B93A 2ZC4B 4WM9A 3R7WB 3O86A 4Y13A 4HH2A 5TBMA 4FTXA 2L0WA 4R6LA 2Y2JA 3S7OA 2GZAA 3G34A 1TS8A 4KZAA 2INWA 3VP4A 5EVIB 1JTDA 3MQQA 5HDSA 2P9VB 1E3UD 2UWXA 1E3UA 3T4KA 1SZVA 3HLDA 3F1NA 2XLNA 1ACFA 3IWIA 1ALQA 1K6RA 1PNEA 3A0RA 4C75A 3LIFA 1T1CA 3IT9A 1KVLA 1O7EA 4X25A 4DKIA 3EOIA 2A24A 3VOLA 2BASA 1BLPA 1IFQA 1SHVA 2J3TD 2B02A 3E98A 3UE6A 5CX7A 5DKKA 4H6JA 1G6AA 1RGZA 3JVVA 2PR5A 4N92A 3A3FA 3HCYA 4OP5A 4ID4A 5FL3A 2M7UA 2Y91A 2X71A 1RGYA 2L1MA 3UE3A 5JYOA 4ESPA 4IJGA 1ESUA 2P7JA 4X68A 4K08A 5FQKA 3SOIA 2VGLS 3EEAA 5HAQA 1HZOA 1FOFA 3BLMA 1OT9A 1UWNX 5TJJA 1K25A 2P08A 4KQRA 4CLCE 2QZ6A 5FQ9A 1BYWA 3QNCA 3P09A 4GW9A 4WZ4A 5F6AA 4IBRA 5F83A 5DKLA 1W8QA 1NWZA 4C3QA 3NDGA 3AGDA 4LRYC 1NLZA 4HBTA 1F9IA 4GS9B 2PYPA 4GZBA 3K2NA 5C5KA 4PMAA 1D06A 2WKIA 2ZL1B 3CITA 5HW3A 4G3WA 2HJEA 5CTNA 5G4YA 3C4PA 3G2ZA 5GL9A 3IXBA 4II7A 3E4OA 4EBPA 5L09A 4A5RA 2EX8A 2IWDA 4CJNA 4X1LA 3V3RA 4KZ6A 5CGSA 2HPBA 3PBTA 4I38A 3WRTA 5DFYA 1YPRA 4LRZE 4ARZA 1UWPX 3T1QB 4F94A 4KZ7A 1L0EA 1SDEA 5HD3A 3WS4A 3EEHA 4S2MA 1DY6A 1YKDA 2OOLA 1MY8A 3NULA 4CPKA 3F1PB 5CXWA 5DF9A 2RL3A 3WS0A 2PT7A 5GHXA 2XSSA 2Y59A 3S22A 3BY8A 3PBSA 2OLUA 4GNUA 3S4XA 3QP6A 1BT5A 4U0XA 4OOMA 3BM6A 3C4OA 1PWDA 3QP4A 4R23A 4JBFA 3T4SA 4UQIS 5HWTA 2XH9A 5HL6A 3HUOA 2PD7A 1P0ZA 3ZQ5A 2Y4AA 2XF3A 1ES5A 3ZG8B 3M6HA 4IUKA 5EVLA 3OCLA 3IS2A 2D02A 1LSXA 4KZ4A 1GCEA 2JHEA 2K2NA 4KG5A 2WKQA 3VSLA 3ISGA 2XRNA 3EQUA 2JC7A 1PI4A 1KGFA 2ZQAA 3V3SA 1ZG4A 1T19A 5E2EA 5J7EA 2WZZA 4JGQA 4YNRA 1YLWA 1XGIA 2FZ0A 5IT5A 4S2NA 5F69A 3AGEA 1TS0A 3OPHA 1G68A 4LCMA 1XPBA 2O9CA 3QP2A 2MJ6A 4LV1A 2EXAA 3C7UA 4HQAA 4UA6A 3L9KA 5L2FA 2KOIA 1LI0A 4KQDA 4NXBA 1UGUA 3E4QA 5A93A 3MBZA 1L2SA 3TRCA 4EUZA 1W63Q 2Y2OA 1VEUA 3UDFA 5F68A 3IH8A 1BLSA 1TS6A 2ZQ8A 3LYXA 4P6ZM 5DF8A 3T4QA 1M40A 5EM1A 1PWCA 3CWFA 1YMSA 2CC1A 2WYXA 3O3VA 3M6BA 1OJ5A 1PWGA 4XT2A 4OOYA 3BFFA 4QY6A 3GTCA 4NXGA 4X53A 4HJ6A 3IF5A 3FV7A 1ERQA 3IF6C 4H8RA 2XFSA 4JF6A 1CJFA 1SKOA 4GOGA 2B18A 4NXEA 2WAFA 2Y2QA 3HUMA 4PPRA 5FA7A 2PYRA 3GMWA 4O7DA 1VQQA 2Q9MA 2V9AA 1I2SA 2Y55A
chains in the Genus database with same CATH topology
3PTEA 1QMEA 3ITBA 4BENA 5F1FA 1W5DA 1JVJA 1W79A 4PM7A 3MZDA 4Y0TA 1IYSA 1IYOA 4S2IA 4Y0UA 1K38A 4E3KA 4YFMA 2WKHA 3GSGA 5GLDA 5TGFA 4EBNA 3LY4A 3OPRA 2E8IA 3MFDA 3JYIA 4OPQA 2EFUA 4KQQA 1NJ4A 5GHYA 2BG1A 4WEKA 1LL5A 2ZC6B 3UY6A 5EVIA 4DDYA 5M1AA 1TDGA 1AXBA 1N4OA 3MZEA 4P6BA 1SCWA 3ZGAB 3IH9A 3NC8A 2Y2MA 5HFOA 1IYQA 1KGGA 5A91A 4K0WA 3VOYA 4S2LA 3G35A 2XDMA 2C6WB 4OQIA 5CGWA 4BLMA 5EE8A 4X55A 4UHUA 2WGWA 1KE4A 4E3MA 1EROA 1LLBA 1BZAA 3FKVA 4BD1A 1J9MA 3G4PA 3A3IA 1DJCA 4NETA 4Y0OA 1MBLA 4HBUA 4QB8A 1CI8A 2VGKA 1IELA 3HLGA 5FSRA 3G32A 1OMEA 1W7FA 3G30A 4JKTA 5CECA 3WRZA 3CG5A 4ZDXA 5GLAA 3N4IA 4OP8A 3NIAA 5D3OA 1O07A 5AQ7A 5FQQA 1S6RA 1Q2PA 3UE1A 2G2UA 3PAGA 3SS5A 1K4FA 2WGVA 1K55A 4NK3A 3FKWA 5DF7A 3VFFA 3LY3A 5M18A 5TR7A 5I94A 3W4OA 2OV5A 3FWLA 5FAOA 2J8YA 3DW0A 3B3XA 3ZG0A 1ZG6A 1K54A 1HTZA 2ZC5B 2JCHA 4E3OA 1YM1A 2A3UA 3BRMA 3WWXA 2G2WA 1FSYA 1EI5A 3Q07A 2Q9NA 4EQIA 2P9VA 3BFDA 2ZC7A 4OLDA 3TSGA 3ZG7B 3MKFA 1W8YA 3HLCA 2ZC3B 1BTLA 3UNWA 4LV2A 4WZ5A 2H5SA 5CEDA 4RA7A 4QU3A 2DCFA 3IF6B 4K91A 2HDSA 2HP5A 4X56A 1LHYA 3IXGA 4XUZA 3TOIA 4ZAMA 1YQSA 2JBFA 3HLBA 3N8LA 5E2FA 3PBRA 4YINA 1NZUA 1EWZA 2HDUA 5HARA 3ZG9B 4RYEA 3ZNYA 1YT4A 3MXRA 3BEBA 3GV9A 3NY4A 3HLWA 3UDIA 2JE5A 4JXWA 1NY0A 3BFCA 1Y54A 1NYYA 5FI6A 3N8SA 1PZOA 4JPMA 4OONA 3QNBA 1XA1A 2XQZA 4MBHA 4P0MA 1SDNA 3PAEA 3G31A 3VP0A 4B88A 2ZC4B 4OLGA 4WM9A 2ZLYA 5CHJA 3O86A 4IVKA 1BUEA 1ZC2A 3VOZA 1MPLA 5FATA 4IEDA 3HLEA 3Q81A 3C5AA 4B4ZA 4C6YA 4RVAA 1WYCA 1BSGA 2QPNA 2Y2JA 4EWFA 2RCXA 4GD8A 1MWSA 3G34A 3NCKA 4GDNA 4KZAA 4JLFA 3VP4A 5EVIB 1JTDA 3E2KA 4PM6A 2P9VB 3N7WA 1JWVA 4R1GA 1E3UD 2UWXA 1E3UA 2XEPA 1CI9A 3CJMA 1K57A 2OLVA 3HLDA 1XP4A 4LV0A 2BLSA 4IVIA 4S2PA 2IWBA 2XLNA 3ZVWA 1LL9A 3ZHHA 3IWIA 1ALQA 4OOLA 4E6WA 1K6RA 4Z9QA 1MXOA 4C75A 4LCLA 2XGNA 4JXSA 2ZQDA 5EOEA 3IT9A 3IHBA 3SH9A 3DWZA 1KVLA 4JF5A 3V5MA 1YLJA 3IXHA 1JTGA 2WZXA 1O7EA 1S0WA 4DKIA 1TEMA 2J7VA 1CK3A 1K54C 1IKGA 1BLPA 1SHVA 5F82A 1XXMA 3SS4A 1G6AA 4B4XA 1RGZA 1YLZA 4N92A 3A3FA 4GD6A 4N9KA 4X69A 4DXBA 4OP5A 5EVID 5DTSA 4WZ5C 2WGWB 4ID4A 5EUAA 3FYZA 4GN2A 1MKIA 4U0TA 5JYPA 3SH7A 5AQ9A 2Y91A 4GKUA 2FFYA 2XFTA 3BLSA 2X71A 3LCEA 1RGYA 3UE3A 5JYOA 3Q7ZA 3IQAA 1GHMA 3FZCA 4KZ8A 2A49A 1ESUA 1K55C 2Y2HA 4UAAA 4X68A 3IHAA 5FQKA 3SOIA 3NDEA 1VM1A 1H8YA 4HESA 5HAQA 1GHPA 2EFXA 1HZOA 1HD8A 1N9BA 4KQOA 1FOFA 3BLMA 3ZCZA 3ZG5A 1YMXA 5CEBA 1DJBA 1K25A 5E2HA 4KQRA 3UPPA 2Y2PA 2QZ6A 1KGEA 1FCNA 3GQZA 5FQ9A 1PYYA 1XX2A 3QNCA 3RXWA 2WUQA 3W4PA 3BFGA 3P09A 4KZ9A 2Y2GA 4WZ4A 4IBRA 3DTMA 5F83A 4DDSA 3E2LA 2V1ZA 5KSCA 2XD1A 4WELA 1W8QA 3VP1A 4N9LA 5TFQA 3MKEA 2QMIA 2WK0A 3W4QA 2Y2KA 3NDGA 1Q2QA 3AGDA 3OC2A 3S1YA 4C3QA 4OKPA 1MWRA 4HBTA 5CGXA 1NXYA 1WYBA 5CRFA 4GZBA 1QMFA 2ZQ9A 4PMAA 4QD4A 2WKIA 2ZM8A 5U47A 3ITAA 3UO9A 4BD0A 3P98A 5HW3A 5CERA 5CTNA 1TDLA 3C4PA 3G2ZA 1K56A 4OPRA 4ZBEA 4ZTKA 3IXBA 3N6IA 5GL9A 4DE0A 1XGJA 4PM5A 2Z2MB 4EBPA 1K56D 4A5RA 1XKZA 2EX8A 3BFEA 5FQJA 1YLPA 2IWDA 4CJNA 1MWUA 1GHIA 1RP5A 3V3RA 4S2NC 5EPHA 3RXXA 4KZ6A 4R4SA 5CGSA 3TG9A 2HPBA 3PBTA 3WRTA 1ZKJA 3WS2A 2HP6A 5A90A 4EBLA 4BQMA 5DVAA 2ZM0A 3G2YA 4BL3A 4U3TA 3WS5A 4WYYA 3OPLA 3HLFA 1KE3A 4PM8A 4R3JA 1YLYA 4FSFA 4RX3A 1BULA 2R9WA 4KZ3A 1U60A 3VP2A 4F94A 5F1GA 4KZ7A 4DRTA 1K57C 3Q7VA 1XA7A 1DJAA 1L0EA 3ZVTA 1SDEA 4HEFA 3V50A 1IEMA 3WS4A 4E3JA 1BLHA 4S2MA 1FQGA 1DY6A 2VGJA 4OH0A 4OQGA 2P74A 1MY8A 3BECA 5HAPA 4CPKA 2H10A 5CXWA 5DF9A 3GR2A 3UPOA 3Q82A 2RL3A 3WS0A 3WS1A 3M2JA 4OQ0A 4BJPA 1ES2A 2J9OA 5GHXA 4N1HA 2Y59A 2WGIA 4L0LA 3S22A 1L0GA 3PBSA 3UPNA 2OLUA 4GNUA 3S4XA 1PW1A 4LV3A 1BT5A 1PW8A 4JF4A 1L0FA 3LEZA 4OOMA 4U0XA 2OSUA 3BM6A 1CEFA 1PWDA 3C4OA 3HVFA 1I5QA 3OCNA 5BOHA 3SH8A 4R23A 5FQIA 4JXVA 2Y2LA 3GVBA 1H5XA 3N8RA 4KZ5A 3HL9A 4JBFA 4S2OA 5FAQA 3MXSA 1IYPA 4E6XA 4OVDA 3EQVA 4WMCA 5KMWA 2XH9A 5EOOA 3VFHA 2ZQ7A 4S2JA 1NYMA 1HVBA 3HUOA 4WMCD 4E3NA 5J8XA 4FD8A 3A3DA 3VMAA 2ZMAA 3M2KA 2Y4AA 2XF3A 1ES5A 4Y7PA 4WEJA 4EV4A 3SS3A 4QJGA 3ZG8B 3M6HA 2GDNA 5IHVA 4ZJ2A 2Y2NA 4UA9A 3IXDA 3DWKA 5EVLA 2C5WB 5HAIA 3ZFZA 3OCLA 4OPZA 2WADA 2ZJ9A 4KZ4A 5CHMA 1L0DA 1GCEA 2DNSA 2Y2IA 1KVMA 1E4DA 4FCFA 1BLCA 2WKEA 4KG5A 1FCMA 3ZNTA 5EECA 2ZD8A 4OPYA 3VSLA 3Q7VB 3ISGA 4MNRA 4IBXA 3OPPA 4GB7A 2XK1A 5KZHA 3EQUA 2JC7A 1IKIA 1NRFA 4QHCA 2ZM2A 5FI2A 3IWQA 2X02A 5HX9A 5FASA 1PI4A 3PBNA 1KGFA 2ZQAA 2B5RA 2PBYA 3PBQA 3W8KA 3V3SA 1ZG4A 4GDBA 4ZJ1A 1PZPA 5KSHA 3NI9A 4QY5A 5E2EA 4N1XA 1ES4A 4Q8IA 1ONGA 1KDWA 2WZZA 1LI9A 1RCJA 2WAEA 5GLBA 1YLWA 1XGIA 2EX6A 4E3IA 5HL1A 2Z2LB 4S2NA 4E3LA 3AGEA 4M3KA 2XD5A 4FH4A 4WBGA 3OPHA 3CMZA 4BL2A 3Q1FA 2XR0A 1G68A 4LCMA 3UE0A 5AQAA 1KDSA 3QHYA 1XPBA 3UDXA 1WE4A 4RX2A 3IWOA 3CZDA 5GHZA 3LO7A 1PI5A 2EXAA 4LV1A 3C7UA 2X01A 2PU2A 4UA6A 3PBOA 3OZHA 4S2KA 2I72A 3ZDJA 3A3EA 1ONHA 4D2OA 5L2FA 1JWZA 5E2GA 1LI0A 5G18A 1FSWA 4X6TA 5A93A 1MWTA 2PU4A 1CEGA 4P87A 1GA0A 1SKFA 4PM9A 4OQHA 5CHUA 3MBZA 1L2SA 5FI7A 1JWPA 1FR1A 4JXGA 3VP3A 4EUZA 4LENA 2Y2OA 2J9PA 3UDFA 2FFFB 2EXBA 4R3BA 5M19A 1ES3A 2EX2A 5FDHA 4XXRA 3IH8A 1NZOA 1K4EA 1BLSA 5GLCA 4R0QA 2ZQ8A 4FH2A 4ZJ3A 3HREA 2HP9A 4DE3A 5DF8A 2R9XA 3IF6A 4P85A 4DE1A 1K6SA 3UN7A 4DXCA 1GA9A 1M40A 2EX9A 1PWCA 1YMSA 3V39A 2CC1A 2WYXA 5E43A 4DF6A 3D4FA 3O3VA 3M6BA 1I2WA 3HBRA 1PWGA 1FCOA 4K0XA 2HDQA 5DTTA 4KENB 3RJUA 3AGFA 4OOYA 2V2FF 3BFFA 3A3JA 3O88A 4QY6A 1ERMA 4MLLA 3GTCA 2H0TA 4X53A 1C3BA 3IF5A 3FV7A 4DE2A 3GRJA 1KE0A 1ERQA 3IF6C 4KG6A 4MBKA 4MBFA 3BYDA 4MEZA 4H8RA 3HUNA 5DTKA 1M6KA 2H0YA 2XFSA 4JF6A 4GOGA 1FR6A 2ZQCA 1E25A 4R4RA 1YLTA 2WAFA 2Y2QA 1H8ZA 3HUMA 3NBLA 1TVFA 3MZFA 5CTMA 1ESIA 4PPRA 5FA7A 4XUXA 5EVIC 3GMWA 3C7VA 4KZBA 3O87A 2IWCA 4O7DA 1PIOA 5A92A 1VQQA 2V20A 4UA7A 2DRWA 2Q9MA 3I7JA 5AQBA 5FAPA 2HDRA 4KG2A 3VSKA 1I2SA 2Y55A 1Z6FA 5FQMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PTE A;  1QME A;  3ITB A;  4BEN A;  5F1F A;  1W5D A;  1JVJ A;  1W79 A;  4PM7 A;  3MZD A;  4Y0T A;  1IYS A;  1IYO A;  4S2I A;  4Y0U A;  1K38 A;  4E3K A;  4YFM A;  2WKH A;  3GSG A;  5GLD A;  5TGF A;  4EBN A;  3LY4 A;  3OPR A;  2E8I A;  3MFD A;  3JYI A;  4OPQ A;  2EFU A;  4KQQ A;  1NJ4 A;  5GHY A;  2BG1 A;  4WEK A;  1LL5 A;  2ZC6 B;  3UY6 A;  5EVI A;  4DDY A;  5M1A A;  1TDG A;  1AXB A;  1N4O A;  3MZE A;  4P6B A;  1SCW A;  3ZGA B;  3IH9 A;  3NC8 A;  2Y2M A;  5HFO A;  1IYQ A;  1KGG A;  5A91 A;  4K0W A;  3VOY A;  4S2L A;  3G35 A;  2XDM A;  2C6W B;  4OQI A;  5CGW A;  4BLM A;  5EE8 A;  4X55 A;  4UHU A;  2WGW A;  1KE4 A;  4E3M A;  1ERO A;  1LLB A;  1BZA A;  3FKV A;  4BD1 A;  1J9M A;  3G4P A;  3A3I A;  1DJC A;  4NET A;  4Y0O A;  1MBL A;  4HBU A;  4QB8 A;  1CI8 A;  2VGK A;  1IEL A;  3HLG A;  5FSR A;  3G32 A;  1OME A;  1W7F A;  3G30 A;  4JKT A;  5CEC A;  3WRZ A;  3CG5 A;  4ZDX A;  5GLA A;  3N4I A;  4OP8 A;  3NIA A;  5D3O A;  1O07 A;  5AQ7 A;  5FQQ A;  1S6R A;  1Q2P A;  3UE1 A;  2G2U A;  3PAG A;  3SS5 A;  1K4F A;  2WGV A;  1K55 A;  4NK3 A;  3FKW A;  5DF7 A;  3VFF A;  3LY3 A;  5M18 A;  5TR7 A;  5I94 A;  3W4O A;  2OV5 A;  3FWL A;  5FAO A;  2J8Y A;  3DW0 A;  3B3X A;  3ZG0 A;  1ZG6 A;  1K54 A;  1HTZ A;  2ZC5 B;  2JCH A;  4E3O A;  1YM1 A;  2A3U A;  3BRM A;  3WWX A;  2G2W A;  1FSY A;  1EI5 A;  3Q07 A;  2Q9N A;  4EQI A;  2P9V A;  3BFD A;  2ZC7 A;  4OLD A;  3TSG A;  3ZG7 B;  3MKF A;  1W8Y A;  3HLC A;  2ZC3 B;  1BTL A;  3UNW A;  4LV2 A;  4WZ5 A;  2H5S A;  5CED A;  4RA7 A;  4QU3 A;  2DCF A;  3IF6 B;  4K91 A;  2HDS A;  2HP5 A;  4X56 A;  1LHY A;  3IXG A;  4XUZ A;  3TOI A;  4ZAM A;  1YQS A;  2JBF A;  3HLB A;  3N8L A;  5E2F A;  3PBR A;  4YIN A;  1NZU A;  1EWZ A;  2HDU A;  5HAR A;  3ZG9 B;  4RYE A;  3ZNY A;  1YT4 A;  3MXR A;  3BEB A;  3GV9 A;  3NY4 A;  3HLW A;  3UDI A;  2JE5 A;  4JXW A;  1NY0 A;  3BFC A;  1Y54 A;  1NYY A;  5FI6 A;  3N8S A;  1PZO A;  4JPM A;  4OON A;  3QNB A;  1XA1 A;  2XQZ A;  4MBH A;  4P0M A;  1SDN A;  3PAE A;  3G31 A;  3VP0 A;  4B88 A;  2ZC4 B;  4OLG A;  4WM9 A;  2ZLY A;  5CHJ A;  3O86 A;  4IVK A;  1BUE A;  1ZC2 A;  3VOZ A;  1MPL A;  5FAT A;  4IED A;  3HLE A;  3Q81 A;  3C5A A;  4B4Z A;  4C6Y A;  4RVA A;  1WYC A;  1BSG A;  2QPN A;  2Y2J A;  4EWF A;  2RCX A;  4GD8 A;  1MWS A;  3G34 A;  3NCK A;  4GDN A;  4KZA A;  4JLF A;  3VP4 A;  5EVI B;  1JTD A;  3E2K A;  4PM6 A;  2P9V B;  3N7W A;  1JWV A;  4R1G A;  1E3U D;  2UWX A;  1E3U A;  2XEP A;  1CI9 A;  3CJM A;  1K57 A;  2OLV A;  3HLD A;  1XP4 A;  4LV0 A;  2BLS A;  4IVI A;  4S2P A;  2IWB A;  2XLN A;  3ZVW A;  1LL9 A;  3ZHH A;  3IWI A;  1ALQ A;  4OOL A;  4E6W A;  1K6R A;  4Z9Q A;  1MXO A;  4C75 A;  4LCL A;  2XGN A;  4JXS A;  2ZQD A;  5EOE A;  3IT9 A;  3IHB A;  3SH9 A;  3DWZ A;  1KVL A;  4JF5 A;  3V5M A;  1YLJ A;  3IXH A;  1JTG A;  2WZX A;  1O7E A;  1S0W A;  4DKI A;  1TEM A;  2J7V A;  1CK3 A;  1K54 C;  1IKG A;  1BLP A;  1SHV A;  5F82 A;  1XXM A;  3SS4 A;  1G6A A;  4B4X A;  1RGZ A;  1YLZ A;  4N92 A;  3A3F A;  4GD6 A;  4N9K A;  4X69 A;  4DXB A;  4OP5 A;  5EVI D;  5DTS A;  4WZ5 C;  2WGW B;  4ID4 A;  5EUA A;  3FYZ A;  4GN2 A;  1MKI A;  4U0T A;  5JYP A;  3SH7 A;  5AQ9 A;  2Y91 A;  4GKU A;  2FFY A;  2XFT A;  3BLS A;  2X71 A;  3LCE A;  1RGY A;  3UE3 A;  5JYO A;  3Q7Z A;  3IQA A;  1GHM A;  3FZC A;  4KZ8 A;  2A49 A;  1ESU A;  1K55 C;  2Y2H A;  4UAA A;  4X68 A;  3IHA A;  5FQK A;  3SOI A;  3NDE A;  1VM1 A;  1H8Y A;  4HES A;  5HAQ A;  1GHP A;  2EFX A;  1HZO A;  1HD8 A;  1N9B A;  4KQO A;  1FOF A;  3BLM A;  3ZCZ A;  3ZG5 A;  1YMX A;  5CEB A;  1DJB A;  1K25 A;  5E2H A;  4KQR A;  3UPP A;  2Y2P A;  2QZ6 A;  1KGE A;  1FCN A;  3GQZ A;  5FQ9 A;  1PYY A;  1XX2 A;  3QNC A;  3RXW A;  2WUQ A;  3W4P A;  3BFG A;  3P09 A;  4KZ9 A;  2Y2G A;  4WZ4 A;  4IBR A;  3DTM A;  5F83 A;  4DDS A;  3E2L A;  2V1Z A;  5KSC A;  2XD1 A;  4WEL A;  1W8Q A;  3VP1 A;  4N9L A;  5TFQ A;  3MKE A;  2QMI A;  2WK0 A;  3W4Q A;  2Y2K A;  3NDG A;  1Q2Q A;  3AGD A;  3OC2 A;  3S1Y A;  4C3Q A;  4OKP A;  1MWR A;  4HBT A;  5CGX A;  1NXY A;  1WYB A;  5CRF A;  4GZB A;  1QMF A;  2ZQ9 A;  4PMA A;  4QD4 A;  2WKI A;  2ZM8 A;  5U47 A;  3ITA A;  3UO9 A;  4BD0 A;  3P98 A;  5HW3 A;  5CER A;  5CTN A;  1TDL A;  3C4P A;  3G2Z A;  1K56 A;  4OPR A;  4ZBE A;  4ZTK A;  3IXB A;  3N6I A;  5GL9 A;  4DE0 A;  1XGJ A;  4PM5 A;  2Z2M B;  4EBP A;  1K56 D;  4A5R A;  1XKZ A;  2EX8 A;  3BFE A;  5FQJ A;  1YLP A;  2IWD A;  4CJN A;  1MWU A;  1GHI A;  1RP5 A;  3V3R A;  4S2N C;  5EPH A;  3RXX A;  4KZ6 A;  4R4S A;  5CGS A;  3TG9 A;  2HPB A;  3PBT A;  3WRT A;  1ZKJ A;  3WS2 A;  2HP6 A;  5A90 A;  4EBL A;  4BQM A;  5DVA A;  2ZM0 A;  3G2Y A;  4BL3 A;  4U3T A;  3WS5 A;  4WYY A;  3OPL A;  3HLF A;  1KE3 A;  4PM8 A;  4R3J A;  1YLY A;  4FSF A;  4RX3 A;  1BUL A;  2R9W A;  4KZ3 A;  1U60 A;  3VP2 A;  4F94 A;  5F1G A;  4KZ7 A;  4DRT A;  1K57 C;  3Q7V A;  1XA7 A;  1DJA A;  1L0E A;  3ZVT A;  1SDE A;  4HEF A;  3V50 A;  1IEM A;  3WS4 A;  4E3J A;  1BLH A;  4S2M A;  1FQG A;  1DY6 A;  2VGJ A;  4OH0 A;  4OQG A;  2P74 A;  1MY8 A;  3BEC A;  5HAP A;  4CPK A;  2H10 A;  5CXW A;  5DF9 A;  3GR2 A;  3UPO A;  3Q82 A;  2RL3 A;  3WS0 A;  3WS1 A;  3M2J A;  4OQ0 A;  4BJP A;  1ES2 A;  2J9O A;  5GHX A;  4N1H A;  2Y59 A;  2WGI A;  4L0L A;  3S22 A;  1L0G A;  3PBS A;  3UPN A;  2OLU A;  4GNU A;  3S4X A;  1PW1 A;  4LV3 A;  1BT5 A;  1PW8 A;  4JF4 A;  1L0F A;  3LEZ A;  4OOM A;  4U0X A;  2OSU A;  3BM6 A;  1CEF A;  1PWD A;  3C4O A;  3HVF A;  1I5Q A;  3OCN A;  5BOH A;  3SH8 A;  4R23 A;  5FQI A;  4JXV A;  2Y2L A;  3GVB A;  1H5X A;  3N8R A;  4KZ5 A;  3HL9 A;  4JBF A;  4S2O A;  5FAQ A;  3MXS A;  1IYP A;  4E6X A;  4OVD A;  3EQV A;  4WMC A;  5KMW A;  2XH9 A;  5EOO A;  3VFH A;  2ZQ7 A;  4S2J A;  1NYM A;  1HVB A;  3HUO A;  4WMC D;  4E3N A;  5J8X A;  4FD8 A;  3A3D A;  3VMA A;  2ZMA A;  3M2K A;  2Y4A A;  2XF3 A;  1ES5 A;  4Y7P A;  4WEJ A;  4EV4 A;  3SS3 A;  4QJG A;  3ZG8 B;  3M6H A;  2GDN A;  5IHV A;  4ZJ2 A;  2Y2N A;  4UA9 A;  3IXD A;  3DWK A;  5EVL A;  2C5W B;  5HAI A;  3ZFZ A;  3OCL A;  4OPZ A;  2WAD A;  2ZJ9 A;  4KZ4 A;  5CHM A;  1L0D A;  1GCE A;  2DNS A;  2Y2I A;  1KVM A;  1E4D A;  4FCF A;  1BLC A;  2WKE A;  4KG5 A;  1FCM A;  3ZNT A;  5EEC A;  2ZD8 A;  4OPY A;  3VSL A;  3Q7V B;  3ISG A;  4MNR A;  4IBX A;  3OPP A;  4GB7 A;  2XK1 A;  5KZH A;  3EQU A;  2JC7 A;  1IKI A;  1NRF A;  4QHC A;  2ZM2 A;  5FI2 A;  3IWQ A;  2X02 A;  5HX9 A;  5FAS A;  1PI4 A;  3PBN A;  1KGF A;  2ZQA A;  2B5R A;  2PBY A;  3PBQ A;  3W8K A;  3V3S A;  1ZG4 A;  4GDB A;  4ZJ1 A;  1PZP A;  5KSH A;  3NI9 A;  4QY5 A;  5E2E A;  4N1X A;  1ES4 A;  4Q8I A;  1ONG A;  1KDW A;  2WZZ A;  1LI9 A;  1RCJ A;  2WAE A;  5GLB A;  1YLW A;  1XGI A;  2EX6 A;  4E3I A;  5HL1 A;  2Z2L B;  4S2N A;  4E3L A;  3AGE A;  4M3K A;  2XD5 A;  4FH4 A;  4WBG A;  3OPH A;  3CMZ A;  4BL2 A;  3Q1F A;  2XR0 A;  1G68 A;  4LCM A;  3UE0 A;  5AQA A;  1KDS A;  3QHY A;  1XPB A;  3UDX A;  1WE4 A;  4RX2 A;  3IWO A;  3CZD A;  5GHZ A;  3LO7 A;  1PI5 A;  2EXA A;  4LV1 A;  3C7U A;  2X01 A;  2PU2 A;  4UA6 A;  3PBO A;  3OZH A;  4S2K A;  2I72 A;  3ZDJ A;  3A3E A;  1ONH A;  4D2O A;  5L2F A;  1JWZ A;  5E2G A;  1LI0 A;  5G18 A;  1FSW A;  4X6T A;  5A93 A;  1MWT A;  2PU4 A;  1CEG A;  4P87 A;  1GA0 A;  1SKF A;  4PM9 A;  4OQH A;  5CHU A;  3MBZ A;  1L2S A;  5FI7 A;  1JWP A;  1FR1 A;  4JXG A;  3VP3 A;  4EUZ A;  4LEN A;  2Y2O A;  2J9P A;  3UDF A;  2FFF B;  2EXB A;  4R3B A;  5M19 A;  1ES3 A;  2EX2 A;  5FDH A;  4XXR A;  3IH8 A;  1NZO A;  1K4E A;  1BLS A;  5GLC A;  4R0Q A;  2ZQ8 A;  4FH2 A;  4ZJ3 A;  3HRE A;  2HP9 A;  4DE3 A;  5DF8 A;  2R9X A;  3IF6 A;  4P85 A;  4DE1 A;  1K6S A;  3UN7 A;  4DXC A;  1GA9 A;  1M40 A;  2EX9 A;  1PWC A;  1YMS A;  3V39 A;  2CC1 A;  2WYX A;  5E43 A;  4DF6 A;  3D4F A;  3O3V A;  3M6B A;  1I2W A;  3HBR A;  1PWG A;  1FCO A;  4K0X A;  2HDQ A;  5DTT A;  4KEN B;  3RJU A;  3AGF A;  4OOY A;  2V2F F;  3BFF A;  3A3J A;  3O88 A;  4QY6 A;  1ERM A;  4MLL A;  3GTC A;  2H0T A;  4X53 A;  1C3B A;  3IF5 A;  3FV7 A;  4DE2 A;  3GRJ A;  1KE0 A;  1ERQ A;  3IF6 C;  4KG6 A;  4MBK A;  4MBF A;  3BYD A;  4MEZ A;  4H8R A;  3HUN A;  5DTK A;  1M6K A;  2H0Y A;  2XFS A;  4JF6 A;  4GOG A;  1FR6 A;  2ZQC A;  1E25 A;  4R4R A;  1YLT A;  2WAF A;  2Y2Q A;  1H8Z A;  3HUM A;  3NBL A;  1TVF A;  3MZF A;  5CTM A;  1ESI A;  4PPR A;  5FA7 A;  4XUX A;  5EVI C;  3GMW A;  3C7V A;  4KZB A;  3O87 A;  2IWC A;  4O7D A;  1PIO A;  5A92 A;  1VQQ A;  2V20 A;  4UA7 A;  2DRW A;  2Q9M A;  3I7J A;  5AQB A;  5FAP A;  2HDR A;  4KG2 A;  3VSK A;  1I2S A;  2Y55 A;  1Z6F A;  5FQM A; 
#chains in the Genus database with same CATH topology
 1QME A;  5F1F A;  1W5D A;  1JVJ A;  4MDZ A;  3NOP C;  4Y0U A;  3GSG A;  1F98 A;  2W1T A;  2E8I A;  3MS6 A;  1T18 A;  2EFU A;  1LL5 A;  5EVI A;  1EW0 A;  4DDY A;  1AXB A;  3CLO A;  2Y2M A;  3W2Z A;  1D1J A;  5A91 A;  4S2L A;  3G35 A;  3JPU A;  5CGW A;  1Z09 A;  3ULF A;  4BLM A;  2NUT C;  3FKV A;  5I5L A;  3A3I A;  5K5B A;  2JKR I;  4X1M A;  5FSR A;  1OME A;  4JKT A;  4E04 A;  2YKH A;  3CG5 A;  4ZDX A;  4OP8 A;  3NIA A;  1O07 A;  3UE1 A;  2VLG A;  5FEF A;  3PAG A;  1K4F A;  5DF7 A;  3LY3 A;  5I94 A;  3W4O A;  2OV5 A;  3LIB A;  5FAO A;  2EWV A;  1ZG6 A;  2H28 A;  1HTZ A;  3GEC A;  2A3U A;  4NG2 A;  3WWX A;  3ZG7 B;  3TSG A;  4EU0 A;  3MKF A;  4L9F A;  3OBF A;  4PAU A;  2HDS A;  3IXG A;  2WKP A;  2JBF A;  5AVE A;  4NEE D;  3N8L A;  3KSH A;  4RYE A;  3DTI A;  3BEB A;  4IUH A;  3NY4 A;  4WL9 A;  3BFC A;  4I3I A;  1NYY A;  5FI6 A;  4JPM A;  1HLU P;  2XQZ A;  3VP0 A;  1ZTU A;  4B88 A;  4D60 A;  2VKS A;  1LSW A;  1VET B;  1MPL A;  4IED A;  3Q81 A;  1JNU A;  4EEU A;  2RCX A;  2VA0 A;  3R4K A;  3E2K A;  4HOI A;  3EGX C;  4NXF A;  4R1G A;  1N9N A;  1XP4 A;  3ZVW A;  4BMW A;  4OOL A;  2XGN A;  4JXS A;  4R3A A;  5EOE A;  4LFU A;  3DWZ A;  4JF5 A;  4O01 A;  1LL8 A;  3V5M A;  5AJG A;  2CMN A;  3MQ0 A;  1K54 C;  1XXM A;  4B4X A;  4GD6 A;  4O0P A;  5EVI D;  4PHT A;  5EUA A;  4GN2 A;  1MKI A;  4U0T A;  4Y15 A;  4GS9 A;  5HPF A;  3IQA A;  4UAA A;  1VM1 A;  1H8Y A;  4HES A;  1GHP A;  2EFX A;  1N9B A;  4BBT A;  3BFG A;  4KZ9 A;  4ZRR A;  2V1Z A;  1PFL A;  2XD1 A;  4CLC B;  4RQ9 A;  4WEL A;  4M4X A;  3VP1 A;  2QMI A;  3MSH A;  3W4Q A;  3MR0 A;  1Q2Q A;  5HZH A;  5CGX A;  1WYB A;  4QD4 A;  1H0M A;  3ITA A;  3T4L A;  1TDL A;  3BW6 A;  4ZBE A;  4ZTK A;  1S1Z A;  4PM5 A;  3T4J A;  2Z2M B;  1K56 D;  1S1Y A;  4S2N C;  5EPH A;  3TG9 A;  4EET B;  2PRF A;  1S67 L;  1ZHH B;  3U2A A;  1ZKJ A;  1OTB A;  5A90 A;  4G3K A;  2JKG A;  4U3T A;  4WYY A;  3NEC A;  4PM8 A;  1STZ A;  5F1G A;  4Y5F A;  1XA7 A;  1MC0 A;  1DJA A;  3TE8 A;  3RTY A;  1FIL A;  1IEM A;  1P9W A;  2JKF A;  3UPO A;  3M2J A;  4KUK A;  2K7S A;  3QP5 A;  4GJ4 A;  3UPN A;  2YKF A;  2OWJ A;  3OCN A;  5BOH A;  3SH8 A;  1XJ2 A;  2HV1 A;  4MMN A;  1H5X A;  3N8R A;  4KZ5 A;  3IX4 A;  5FAQ A;  3MXS A;  1IYP A;  3LI8 A;  4OVD A;  3EQV A;  5EVE A;  1NYM A;  1HVB A;  3NJA A;  4WMC D;  1L3L A;  4E3N A;  2V1B A;  4FD8 A;  4WEJ A;  4EV4 A;  3SS3 A;  4Q0J A;  2HGV A;  2GDN A;  4ZJ2 A;  2VK3 A;  3IXD A;  2W3H A;  3ZFZ A;  1W63 M;  1N9L A;  4Z1W A;  5CHM A;  1L0D A;  3T1S A;  2Y79 A;  4FCF A;  2W1T B;  4OPY A;  1OTA A;  3Q7V B;  4IBX A;  5KZH A;  3KYE A;  2X02 A;  5KMW A;  3E4P A;  4AFI A;  3PBN A;  4CLC A;  4MN5 A;  4GDB A;  4ZJ1 A;  5HSQ A;  1PZP A;  4QY5 A;  1CF0 A;  1ES4 A;  3TJZ C;  3LGO A;  4E3I A;  5HL1 A;  2Z2L B;  4WBG A;  2XD5 A;  3MMH A;  4FH4 A;  3D9Y A;  3KYZ A;  4ME4 A;  3UE0 A;  5AQA A;  4RX2 A;  3CZD A;  3LO7 A;  3DTE A;  2X01 A;  2PU2 A;  3CAX A;  2AVX A;  3ZDJ A;  3UB7 A;  1ONH A;  4D2O A;  1S4S A;  1MWT A;  4PM9 A;  2PR6 A;  5FI7 A;  1FR1 A;  3VP3 A;  2FFF B;  4R3B A;  1ES3 A;  2EX2 A;  3UB6 A;  5FDH A;  1K4E A;  5GLC A;  5AVF A;  4DE1 A;  1K6S A;  2EX9 A;  3KX0 X;  4HY8 A;  5E43 A;  5EM0 A;  2EWW A;  3HBR A;  2NUP C;  3R7W A;  3AGF A;  5DJT A;  3A3J A;  3B47 A;  2I9V A;  1ERM A;  2QHK A;  3FG8 A;  2L4R A;  1C3B A;  3UB5 P;  1KE0 A;  1H3Q A;  4HNB A;  2ZQC A;  1E25 A;  4R4R A;  2M1C A;  4HH3 A;  1TVF A;  2VEA A;  4XUX A;  4KZB A;  2R78 A;  1PIO A;  5A92 A;  5J3W A;  1S4R A;  2K31 A;  2DRW A;  3VSK A;  5AQB A;  4KG2 A;  2Y8H A;  3Q7Z A;  3PTE A;  3ITB A;  4KUO A;  1W79 A;  2VV7 A;  1IYO A;  4YFM A;  5TGF A;  2O9B A;  1KOU A;  3OPR A;  4KQQ A;  2OAP 1;  5GHY A;  4WEK A;  3MZE A;  4P6B A;  3IH9 A;  5HFO A;  1DP6 A;  4DN0 A;  1KGG A;  3VOY A;  1YSP A;  4UHU A;  2WGW A;  2J3W A;  2HF6 A;  4BD1 A;  1J9M A;  3G4P A;  4NET A;  4QB8 A;  2VGK A;  1IEL A;  3HLG A;  4GHI B;  1W7F A;  5FQQ A;  5AQ7 A;  1S6R A;  3CUE A;  3BJN A;  2WGV A;  2IA2 A;  5FDS A;  4HIA A;  3B3X A;  1K54 A;  2JCH A;  4GCZ A;  5EV0 A;  1FSY A;  2Q9N A;  4EQ1 A;  1DP9 A;  2P9V A;  4QWO A;  3UNW A;  2D01 A;  3BQ8 A;  4QU3 A;  3IF6 B;  2XRO A;  5DFX A;  4X56 A;  4XUZ A;  1LHY A;  3HLB A;  1CQA A;  2VV8 A;  5IS1 A;  5E2F A;  1SKO B;  3ZNY A;  1YT4 A;  2E8J A;  1LT0 A;  2A24 B;  3N8S A;  4OON A;  4MBH A;  1XA1 A;  1SDN A;  3PAE A;  4WLA A;  2ZLY A;  5CHJ A;  4IVK A;  2GNX A;  1BUE A;  3VOZ A;  3BQA A;  5FAT A;  2ZMF A;  3HLE A;  1MKM A;  1OT6 A;  2QPN A;  2KLI A;  1MWS A;  3NCK A;  4GDN A;  4EER A;  5A8B A;  3HJI A;  1CI9 A;  3CJM A;  2VJW A;  4IVI A;  1LL9 A;  4Z9Q A;  4LCL A;  3P7N A;  2ZQD A;  2BTF P;  3EWK A;  1VET A;  5L10 A;  1VHM A;  1YLJ A;  3S7N A;  2WZX A;  1TEM A;  2J7V A;  2XA7 S;  1CK3 A;  2PD8 A;  1IKG A;  4BWI A;  3NOT C;  1YLZ A;  4N9K A;  4X69 A;  5TBM B;  5DTS A;  4Y2F A;  3T1X A;  4B9O A;  3A0V A;  3FYZ A;  2FFY A;  2XFT A;  3BLS A;  3LCE A;  1GHM A;  3FZC A;  2A49 A;  2PHY A;  4WUJ A;  3D3O A;  3H7W B;  3NDE A;  4H6J B;  3ZG5 A;  3ZCZ A;  1YMX A;  3F1P A;  1DP8 A;  5CEB A;  1DJB A;  5E2H A;  4MN7 A;  1H8M A;  2Y2P A;  1FCN A;  3GQZ A;  1PYY A;  4DDS A;  5KSC A;  5TFQ A;  4HHD A;  3MKE A;  2Y2K A;  3OC2 A;  3UB9 A;  5FEG A;  4OKP A;  1NXY A;  5CRF A;  1QMF A;  2ZQ9 A;  3MXQ A;  2ZM8 A;  1V9Z A;  3UO9 A;  3P98 A;  3LIC A;  5CER A;  2Z6C A;  3H9W A;  4DE0 A;  3N6I A;  1XGJ A;  1XKZ A;  3BFE A;  5FQJ A;  1YLP A;  1GHI A;  1RP5 A;  2JKR M;  3RXX A;  4R4S A;  3LID A;  2PBD P;  3WS2 A;  2HP6 A;  3VE4 A;  4BBU A;  1G6O A;  2ZM0 A;  3OPL A;  4CLC D;  3HLF A;  1YLY A;  4FSF A;  2R9W A;  4KZ3 A;  3PXP A;  1F2K A;  4Y17 A;  4DRT A;  1K57 C;  4HEF A;  3DTK A;  3LR4 A;  1FQG A;  2VGJ A;  4OH0 A;  4EW7 A;  2P74 A;  3BEC A;  5KIZ A;  3H82 A;  5DJU A;  2PAV P;  3GR2 A;  1WA9 A;  2QWS A;  3Q82 A;  3CPT A;  4OQ0 A;  4BJP A;  1ES2 A;  4MN6 A;  4R38 A;  3C2W A;  3LR5 A;  4L0L A;  2W27 A;  1L0G A;  1PW1 A;  4LV3 A;  4JF4 A;  3LEZ A;  3DAV A;  5FQI A;  3GVB A;  3HL9 A;  3SZT A;  5F5Y A;  4E6X A;  1MZU A;  3T4O A;  3VFH A;  2ZQ7 A;  3HJK A;  3A3D A;  3VMA A;  2ZMA A;  3M2K A;  4R70 A;  4Y7P A;  4QJG A;  2LB5 A;  4EXO A;  2Z6D A;  2Y2N A;  4LPZ A;  2Q0O A;  5HAI A;  1G5U A;  4OPZ A;  2WAD A;  2W3E A;  3TW8 A;  1FIK A;  2DNS A;  1KVM A;  3ZNT A;  5EEC A;  2ZD8 A;  3IX8 A;  4MNR A;  2QKP A;  5FI2 A;  5HX9 A;  1NRF A;  4QHC A;  2B5R A;  2PBY A;  3GDI A;  1LSV A;  3SW1 A;  4L9G A;  3OLO A;  5KSH A;  4N1X A;  3C8C A;  4Q8I A;  1ONG A;  1KDW A;  4LLO B;  1LI9 A;  2W3F A;  2WAE A;  5GLB A;  3U4L P;  1P9R A;  2EX6 A;  2GJ3 A;  4E3L A;  2B95 A;  3CMZ A;  2J80 A;  1KDS A;  3UDX A;  4WF0 A;  1WE4 A;  3EGD C;  3IWO A;  2I72 A;  3A3E A;  4Q0H A;  4FOF A;  1JWZ A;  5E2G A;  2ZMV A;  1CEG A;  3LI9 A;  1GA0 A;  2QYB A;  2UV0 E;  4JXG A;  3LIA A;  2J9P A;  3T12 B;  5M19 A;  3PR6 A;  4R0Q A;  5HDC A;  4FH2 A;  4ZJ3 A;  3HRE A;  2HP9 A;  4L9E A;  3IF6 A;  4P85 A;  3CUE C;  5HPI A;  4DXC A;  1GA9 A;  2P04 A;  1OPX A;  2WKR A;  3H7W A;  4DF6 A;  3D4F A;  1I2W A;  1OTI A;  5DTT A;  1OJG A;  4KEN B;  4LRX C;  3O88 A;  2KDK A;  4MLL A;  3T50 A;  4DE2 A;  3GRJ A;  5L07 A;  3BYD A;  4MEZ A;  1J3W A;  3HUN A;  5DTK A;  4DJ2 A;  3S7P A;  1YLT A;  3NBL A;  3MZF A;  5CTM A;  1ESI A;  4HJ4 A;  5EVI C;  2GX5 A;  2IWC A;  2V20 A;  4UEY A;  3IBR A;  4JGP A;  2HDR A;  1TS7 A;  3H82 B;  5FQM A;  5HWV A;  3MZD A;  3F1N B;  2WKH A;  4EBN A;  2OAQ 1;  1GSW A;  2LB9 A;  1NJ4 A;  2BG1 A;  4F3L A;  4XT2 B;  1TDG A;  1GSV A;  3ZGA B;  3KSI A;  2C6W B;  4OQI A;  1Y4O A;  4NKP A;  1XJ6 A;  1KE4 A;  1DJC A;  1NRJ A;  4HBU A;  1CI8 A;  1Y28 A;  4DJ3 A;  4FUW A;  5GLA A;  3N4I A;  1T1A A;  2G2U A;  3SS5 A;  3VFF A;  3KO6 A;  3B42 A;  4NK3 A;  5TR7 A;  3FWL A;  3UB8 A;  3ZG0 A;  3LEQ A;  5J4E A;  2ZC5 B;  4E3O A;  1YM1 A;  4P6Z S;  3BFD A;  2ZC7 A;  1W8Y A;  3HLC A;  3QP8 A;  2H5S A;  5CED A;  4K91 A;  3TOI A;  2HP5 A;  1A0K A;  1YQS A;  3BY9 A;  3NOU C;  4YIN A;  1NZU A;  4DMZ A;  5HAR A;  3ZG9 B;  4WN5 A;  4HP4 A;  3GV9 A;  2V8C A;  3HLW A;  2W3D A;  3UDI A;  2A2L A;  2JE5 A;  2DMW A;  4JXW A;  1XJ4 A;  1Y54 A;  2QJ5 A;  4QPR A;  3QNB A;  4P0M A;  3BWL A;  3G31 A;  3IS2 B;  3C30 A;  4OLG A;  1ZC2 A;  3OOV A;  4JGO A;  3LUQ A;  2VGL M;  3UME A;  3C5A A;  4B4Z A;  4C6Y A;  4RVA A;  1WYC A;  1BSG A;  4EWF A;  4GD8 A;  4JLF A;  3PYP A;  4PM6 A;  3N7W A;  4ETX A;  1JWV A;  2XEP A;  1K57 A;  2OLV A;  4LV0 A;  4S2P A;  3LR3 A;  2BLS A;  3MJQ A;  3O5Y A;  2IWB A;  3ZHH A;  4E6W A;  3K3C A;  1T1B A;  1MXO A;  3IHB A;  3SH9 A;  2EA9 A;  3CI6 A;  5HWW A;  3IXH A;  1JTG A;  1S0W A;  1F5M A;  5F82 A;  4HI4 A;  3SS4 A;  5IU1 A;  4DXB A;  4F3L B;  2VX8 A;  3P01 A;  1XFN A;  4WZ5 C;  2WGW B;  2JKT M;  2OWH A;  3KYQ A;  5EFW A;  5JYP A;  3SH7 A;  3T1R A;  5AQ9 A;  3F1O A;  4GKU A;  1YSQ A;  3PHY A;  4KZ8 A;  1K55 C;  2Y2H A;  2ACG A;  3IHA A;  1P97 A;  1HD8 A;  4KQO A;  2VV6 A;  3UPP A;  1KGE A;  2HZ5 A;  1XX2 A;  3RXW A;  2WUQ A;  3W4P A;  2Y2G A;  2V1A A;  3DTM A;  3E2L A;  2O9A A;  4N9L A;  2KX6 A;  2WK0 A;  2ZOI A;  1MWR A;  2HJ9 C;  3VV4 A;  5U47 A;  5HD5 A;  4BD0 A;  2FH5 A;  4OPR A;  4IHQ A;  1K56 A;  2V8F A;  3IBJ A;  4EEP A;  4ARZ B;  1MWU A;  3MFX A;  1DRM A;  4EBL A;  4BQM A;  5DVA A;  3G2Y A;  4BL3 A;  3WS5 A;  4HP9 A;  2ZOH A;  4O8G A;  1KE3 A;  4R3J A;  4RX3 A;  1BUL A;  1U60 A;  3VP2 A;  3F1O B;  1TF1 A;  3Q7V A;  1K0K A;  3ZVT A;  3V50 A;  3JVU A;  4E3J A;  1BLH A;  3LFV A;  4OQG A;  4MCW A;  5HAP A;  2H10 A;  4EUV A;  3WS1 A;  2J9O A;  4N1H A;  2WGI A;  3MQO A;  1PW8 A;  3FPV A;  1L0F A;  1D7E A;  3S7Q A;  2OSU A;  4PKY A;  1CEF A;  3HVF A;  3UMD A;  1I5Q A;  4PKY G;  1IOU A;  4JXV A;  2Y2L A;  3V67 A;  1N9O A;  2QJ7 A;  2W1R A;  4S2O A;  1OTE A;  5L8M A;  4WMC A;  5EOO A;  4S2J A;  2W3G A;  5J8X A;  1VB6 A;  4I39 A;  4Q0I A;  3A0S A;  5IHV A;  1AWI A;  4UA9 A;  3DWK A;  2C5W B;  2VZW A;  2ZJ9 A;  4BBV A;  2Y2I A;  1E4D A;  1BLC A;  2WKE A;  5HDD A;  1FCM A;  4YOF A;  3E0Y A;  3OPP A;  4GB7 A;  4I5S A;  2XA7 M;  2XK1 A;  2PDR A;  1IKI A;  2ZM2 A;  1ODV A;  3IWQ A;  5FAS A;  3PBQ A;  3W8K A;  3K3D A;  3ZYT A;  1G28 A;  3G6O A;  3NI9 A;  1RCJ A;  4GLQ A;  2O0Y A;  4JGR A;  1TD5 A;  3B33 A;  3D72 A;  4M3K A;  1X0O A;  4BL2 A;  3Q1F A;  2XR0 A;  3L7H A;  3QHY A;  1GSX A;  4CLC C;  3RFB A;  2W0N A;  5GHZ A;  1PI5 A;  1VEU B;  3KSF A;  4Y3I A;  3PBO A;  3OZH A;  4S2K A;  5G18 A;  1FSW A;  4I3J A;  4X6T A;  2PU4 A;  4P87 A;  1SKF A;  4OQH A;  5CHU A;  1JWP A;  3NHQ A;  4LEN A;  3RH8 B;  2EXB A;  3LR0 A;  4YWZ A;  3DBA A;  4XXR A;  1NZO A;  4EES A;  4DE3 A;  2R9X A;  2V0W A;  1XFQ A;  3UN7 A;  3V39 A;  2G7U A;  1NLY A;  2V0U A;  1FCO A;  4K0X A;  4UQI M;  2HDQ A;  3RJU A;  2V2F F;  2H0T A;  3KSG A;  2JN7 A;  3FPW A;  4KG6 A;  4MBK A;  4MBF A;  1V9Y A;  1M6K A;  2H0Y A;  1FR6 A;  4GHI A;  1H8Z A;  4ETZ A;  3T4T A;  3C7V A;  3O87 A;  1PRQ A;  3MF0 A;  4UA7 A;  5FAP A;  3I7J A;  4E3M A;  3S1Y A;  1Z6F A;  2J3T C;  4BEN A;  1XJ3 A;  4PM7 A;  4Y0T A;  1IYS A;  4S2I A;  1K38 A;  4E3K A;  5GLD A;  3LY4 A;  3MFD A;  3JYI A;  4OPQ A;  1YAX A;  2ZC6 B;  3UY6 A;  5M1A A;  1N4O A;  1SCW A;  3NC8 A;  1IYQ A;  4K0W A;  2XDM A;  4HJ3 A;  5EE8 A;  4X55 A;  2ZL1 A;  1ERO A;  2M7V A;  1LLB A;  1BZA A;  4Y0O A;  1MBL A;  3G32 A;  3G30 A;  5CEC A;  3WRZ A;  5D3O A;  2ZBB A;  1Q2P A;  1K55 A;  1S66 L;  3FKW A;  5M18 A;  3ICY A;  2J8Y A;  3DW0 A;  5G4Z A;  3BRM A;  2JKT I;  2G2W A;  1EI5 A;  3Q07 A;  4EQI A;  1OTD A;  4OLD A;  2ZC3 B;  1BTL A;  4LV2 A;  4WZ5 A;  5LBR A;  4RA7 A;  2DCF A;  3FC7 A;  3IX3 A;  4LGW A;  4ZAM A;  3PBR A;  2O99 A;  1EWZ A;  2HDU A;  3LIE A;  5MC7 A;  3MXR A;  3VE3 A;  3C38 A;  3CPT B;  4G3V A;  4CQH A;  1NY0 A;  4I3A A;  3QP1 A;  1PZO A;  3CHW P;  4B93 A;  2ZC4 B;  4WM9 A;  3R7W B;  3O86 A;  4Y13 A;  4HH2 A;  5TBM A;  4FTX A;  2L0W A;  4R6L A;  2Y2J A;  3S7O A;  2GZA A;  3G34 A;  1TS8 A;  4KZA A;  2INW A;  3VP4 A;  5EVI B;  1JTD A;  3MQQ A;  5HDS A;  2P9V B;  1E3U D;  2UWX A;  1E3U A;  3T4K A;  1SZV A;  3HLD A;  3F1N A;  2XLN A;  1ACF A;  3IWI A;  1ALQ A;  1K6R A;  1PNE A;  3A0R A;  4C75 A;  3LIF A;  1T1C A;  3IT9 A;  1KVL A;  1O7E A;  4X25 A;  4DKI A;  3EOI A;  2A24 A;  3VOL A;  2BAS A;  1BLP A;  1IFQ A;  1SHV A;  2J3T D;  2B02 A;  3E98 A;  3UE6 A;  5CX7 A;  5DKK A;  4H6J A;  1G6A A;  1RGZ A;  3JVV A;  2PR5 A;  4N92 A;  3A3F A;  3HCY A;  4OP5 A;  4ID4 A;  5FL3 A;  2M7U A;  2Y91 A;  2X71 A;  1RGY A;  2L1M A;  3UE3 A;  5JYO A;  4ESP A;  4IJG A;  1ESU A;  2P7J A;  4X68 A;  4K08 A;  5FQK A;  3SOI A;  2VGL S;  3EEA A;  5HAQ A;  1HZO A;  1FOF A;  3BLM A;  1OT9 A;  1UWN X;  5TJJ A;  1K25 A;  2P08 A;  4KQR A;  4CLC E;  2QZ6 A;  5FQ9 A;  1BYW A;  3QNC A;  3P09 A;  4GW9 A;  4WZ4 A;  5F6A A;  4IBR A;  5F83 A;  5DKL A;  1W8Q A;  1NWZ A;  4C3Q A;  3NDG A;  3AGD A;  4LRY C;  1NLZ A;  4HBT A;  1F9I A;  4GS9 B;  2PYP A;  4GZB A;  3K2N A;  5C5K A;  4PMA A;  1D06 A;  2WKI A;  2ZL1 B;  3CIT A;  5HW3 A;  4G3W A;  2HJE A;  5CTN A;  5G4Y A;  3C4P A;  3G2Z A;  5GL9 A;  3IXB A;  4II7 A;  3E4O A;  4EBP A;  5L09 A;  4A5R A;  2EX8 A;  2IWD A;  4CJN A;  4X1L A;  3V3R A;  4KZ6 A;  5CGS A;  2HPB A;  3PBT A;  4I38 A;  3WRT A;  5DFY A;  1YPR A;  4LRZ E;  4ARZ A;  1UWP X;  3T1Q B;  4F94 A;  4KZ7 A;  1L0E A;  1SDE A;  5HD3 A;  3WS4 A;  3EEH A;  4S2M A;  1DY6 A;  1YKD A;  2OOL A;  1MY8 A;  3NUL A;  4CPK A;  3F1P B;  5CXW A;  5DF9 A;  2RL3 A;  3WS0 A;  2PT7 A;  5GHX A;  2XSS A;  2Y59 A;  3S22 A;  3BY8 A;  3PBS A;  2OLU A;  4GNU A;  3S4X A;  3QP6 A;  1BT5 A;  4U0X A;  4OOM A;  3BM6 A;  3C4O A;  1PWD A;  3QP4 A;  4R23 A;  4JBF A;  3T4S A;  4UQI S;  5HWT A;  2XH9 A;  5HL6 A;  3HUO A;  2PD7 A;  1P0Z A;  3ZQ5 A;  2Y4A A;  2XF3 A;  1ES5 A;  3ZG8 B;  3M6H A;  4IUK A;  5EVL A;  3OCL A;  3IS2 A;  2D02 A;  1LSX A;  4KZ4 A;  1GCE A;  2JHE A;  2K2N A;  4KG5 A;  2WKQ A;  3VSL A;  3ISG A;  2XRN A;  3EQU A;  2JC7 A;  1PI4 A;  1KGF A;  2ZQA A;  3V3S A;  1ZG4 A;  1T19 A;  5E2E A;  5J7E A;  2WZZ A;  4JGQ A;  4YNR A;  1YLW A;  1XGI A;  2FZ0 A;  5IT5 A;  4S2N A;  5F69 A;  3AGE A;  1TS0 A;  3OPH A;  1G68 A;  4LCM A;  1XPB A;  2O9C A;  3QP2 A;  2MJ6 A;  4LV1 A;  2EXA A;  3C7U A;  4HQA A;  4UA6 A;  3L9K A;  5L2F A;  2KOI A;  1LI0 A;  4KQD A;  4NXB A;  1UGU A;  3E4Q A;  5A93 A;  3MBZ A;  1L2S A;  3TRC A;  4EUZ A;  1W63 Q;  2Y2O A;  1VEU A;  3UDF A;  5F68 A;  3IH8 A;  1BLS A;  1TS6 A;  2ZQ8 A;  3LYX A;  4P6Z M;  5DF8 A;  3T4Q A;  1M40 A;  5EM1 A;  1PWC A;  3CWF A;  1YMS A;  2CC1 A;  2WYX A;  3O3V A;  3M6B A;  1OJ5 A;  1PWG A;  4XT2 A;  4OOY A;  3BFF A;  4QY6 A;  3GTC A;  4NXG A;  4X53 A;  4HJ6 A;  3IF5 A;  3FV7 A;  1ERQ A;  3IF6 C;  4H8R A;  2XFS A;  4JF6 A;  1CJF A;  1SKO A;  4GOG A;  2B18 A;  4NXE A;  2WAF A;  2Y2Q A;  3HUM A;  4PPR A;  5FA7 A;  2PYR A;  3GMW A;  4O7D A;  1VQQ A;  2Q9M A;  2V9A A;  1I2S A;  2Y55 A; 
#chains in the Genus database with same CATH homology
 3PTE A;  1QME A;  3ITB A;  4BEN A;  5F1F A;  1W5D A;  1JVJ A;  1W79 A;  4PM7 A;  3MZD A;  4Y0T A;  1IYS A;  1IYO A;  4S2I A;  4Y0U A;  1K38 A;  4E3K A;  4YFM A;  2WKH A;  3GSG A;  5GLD A;  5TGF A;  4EBN A;  3LY4 A;  3OPR A;  2E8I A;  3MFD A;  3JYI A;  4OPQ A;  2EFU A;  4KQQ A;  1NJ4 A;  5GHY A;  2BG1 A;  4WEK A;  1LL5 A;  2ZC6 B;  3UY6 A;  5EVI A;  4DDY A;  5M1A A;  1TDG A;  1AXB A;  1N4O A;  3MZE A;  4P6B A;  1SCW A;  3ZGA B;  3IH9 A;  3NC8 A;  2Y2M A;  5HFO A;  1IYQ A;  1KGG A;  5A91 A;  4K0W A;  3VOY A;  4S2L A;  3G35 A;  2XDM A;  2C6W B;  4OQI A;  5CGW A;  4BLM A;  5EE8 A;  4X55 A;  4UHU A;  2WGW A;  1KE4 A;  4E3M A;  1ERO A;  1LLB A;  1BZA A;  3FKV A;  4BD1 A;  1J9M A;  3G4P A;  3A3I A;  1DJC A;  4NET A;  4Y0O A;  1MBL A;  4HBU A;  4QB8 A;  1CI8 A;  2VGK A;  1IEL A;  3HLG A;  5FSR A;  3G32 A;  1OME A;  1W7F A;  3G30 A;  4JKT A;  5CEC A;  3WRZ A;  3CG5 A;  4ZDX A;  5GLA A;  3N4I A;  4OP8 A;  3NIA A;  5D3O A;  1O07 A;  5AQ7 A;  5FQQ A;  1S6R A;  1Q2P A;  3UE1 A;  2G2U A;  3PAG A;  3SS5 A;  1K4F A;  2WGV A;  1K55 A;  4NK3 A;  3FKW A;  5DF7 A;  3VFF A;  3LY3 A;  5M18 A;  5TR7 A;  5I94 A;  3W4O A;  2OV5 A;  3FWL A;  5FAO A;  2J8Y A;  3DW0 A;  3B3X A;  3ZG0 A;  1ZG6 A;  1K54 A;  1HTZ A;  2ZC5 B;  2JCH A;  4E3O A;  1YM1 A;  2A3U A;  3BRM A;  3WWX A;  2G2W A;  1FSY A;  1EI5 A;  3Q07 A;  2Q9N A;  4EQI A;  2P9V A;  3BFD A;  2ZC7 A;  4OLD A;  3TSG A;  3ZG7 B;  3MKF A;  1W8Y A;  3HLC A;  2ZC3 B;  1BTL A;  3UNW A;  4LV2 A;  4WZ5 A;  2H5S A;  5CED A;  4RA7 A;  4QU3 A;  2DCF A;  3IF6 B;  4K91 A;  2HDS A;  2HP5 A;  4X56 A;  1LHY A;  3IXG A;  4XUZ A;  3TOI A;  4ZAM A;  1YQS A;  2JBF A;  3HLB A;  3N8L A;  5E2F A;  3PBR A;  4YIN A;  1NZU A;  1EWZ A;  2HDU A;  5HAR A;  3ZG9 B;  4RYE A;  3ZNY A;  1YT4 A;  3MXR A;  3BEB A;  3GV9 A;  3NY4 A;  3HLW A;  3UDI A;  2JE5 A;  4JXW A;  1NY0 A;  3BFC A;  1Y54 A;  1NYY A;  5FI6 A;  3N8S A;  1PZO A;  4JPM A;  4OON A;  3QNB A;  1XA1 A;  2XQZ A;  4MBH A;  4P0M A;  1SDN A;  3PAE A;  3G31 A;  3VP0 A;  4B88 A;  2ZC4 B;  4OLG A;  4WM9 A;  2ZLY A;  5CHJ A;  3O86 A;  4IVK A;  1BUE A;  1ZC2 A;  3VOZ A;  1MPL A;  5FAT A;  4IED A;  3HLE A;  3Q81 A;  3C5A A;  4B4Z A;  4C6Y A;  4RVA A;  1WYC A;  1BSG A;  2QPN A;  2Y2J A;  4EWF A;  2RCX A;  4GD8 A;  1MWS A;  3G34 A;  3NCK A;  4GDN A;  4KZA A;  4JLF A;  3VP4 A;  5EVI B;  1JTD A;  3E2K A;  4PM6 A;  2P9V B;  3N7W A;  1JWV A;  4R1G A;  1E3U D;  2UWX A;  1E3U A;  2XEP A;  1CI9 A;  3CJM A;  1K57 A;  2OLV A;  3HLD A;  1XP4 A;  4LV0 A;  2BLS A;  4IVI A;  4S2P A;  2IWB A;  2XLN A;  3ZVW A;  1LL9 A;  3ZHH A;  3IWI A;  1ALQ A;  4OOL A;  4E6W A;  1K6R A;  4Z9Q A;  1MXO A;  4C75 A;  4LCL A;  2XGN A;  4JXS A;  2ZQD A;  5EOE A;  3IT9 A;  3IHB A;  3SH9 A;  3DWZ A;  1KVL A;  4JF5 A;  3V5M A;  1YLJ A;  3IXH A;  1JTG A;  2WZX A;  1O7E A;  1S0W A;  4DKI A;  1TEM A;  2J7V A;  1CK3 A;  1K54 C;  1IKG A;  1BLP A;  1SHV A;  5F82 A;  1XXM A;  3SS4 A;  1G6A A;  4B4X A;  1RGZ A;  1YLZ A;  4N92 A;  3A3F A;  4GD6 A;  4N9K A;  4X69 A;  4DXB A;  4OP5 A;  5EVI D;  5DTS A;  4WZ5 C;  2WGW B;  4ID4 A;  5EUA A;  3FYZ A;  4GN2 A;  1MKI A;  4U0T A;  5JYP A;  3SH7 A;  5AQ9 A;  2Y91 A;  4GKU A;  2FFY A;  2XFT A;  3BLS A;  2X71 A;  3LCE A;  1RGY A;  3UE3 A;  5JYO A;  3Q7Z A;  3IQA A;  1GHM A;  3FZC A;  4KZ8 A;  2A49 A;  1ESU A;  1K55 C;  2Y2H A;  4UAA A;  4X68 A;  3IHA A;  5FQK A;  3SOI A;  3NDE A;  1VM1 A;  1H8Y A;  4HES A;  5HAQ A;  1GHP A;  2EFX A;  1HZO A;  1HD8 A;  1N9B A;  4KQO A;  1FOF A;  3BLM A;  3ZCZ A;  3ZG5 A;  1YMX A;  5CEB A;  1DJB A;  1K25 A;  5E2H A;  4KQR A;  3UPP A;  2Y2P A;  2QZ6 A;  1KGE A;  1FCN A;  3GQZ A;  5FQ9 A;  1PYY A;  1XX2 A;  3QNC A;  3RXW A;  2WUQ A;  3W4P A;  3BFG A;  3P09 A;  4KZ9 A;  2Y2G A;  4WZ4 A;  4IBR A;  3DTM A;  5F83 A;  4DDS A;  3E2L A;  2V1Z A;  5KSC A;  2XD1 A;  4WEL A;  1W8Q A;  3VP1 A;  4N9L A;  5TFQ A;  3MKE A;  2QMI A;  2WK0 A;  3W4Q A;  2Y2K A;  3NDG A;  1Q2Q A;  3AGD A;  3OC2 A;  3S1Y A;  4C3Q A;  4OKP A;  1MWR A;  4HBT A;  5CGX A;  1NXY A;  1WYB A;  5CRF A;  4GZB A;  1QMF A;  2ZQ9 A;  4PMA A;  4QD4 A;  2WKI A;  2ZM8 A;  5U47 A;  3ITA A;  3UO9 A;  4BD0 A;  3P98 A;  5HW3 A;  5CER A;  5CTN A;  1TDL A;  3C4P A;  3G2Z A;  1K56 A;  4OPR A;  4ZBE A;  4ZTK A;  3IXB A;  3N6I A;  5GL9 A;  4DE0 A;  1XGJ A;  4PM5 A;  2Z2M B;  4EBP A;  1K56 D;  4A5R A;  1XKZ A;  2EX8 A;  3BFE A;  5FQJ A;  1YLP A;  2IWD A;  4CJN A;  1MWU A;  1GHI A;  1RP5 A;  3V3R A;  4S2N C;  5EPH A;  3RXX A;  4KZ6 A;  4R4S A;  5CGS A;  3TG9 A;  2HPB A;  3PBT A;  3WRT A;  1ZKJ A;  3WS2 A;  2HP6 A;  5A90 A;  4EBL A;  4BQM A;  5DVA A;  2ZM0 A;  3G2Y A;  4BL3 A;  4U3T A;  3WS5 A;  4WYY A;  3OPL A;  3HLF A;  1KE3 A;  4PM8 A;  4R3J A;  1YLY A;  4FSF A;  4RX3 A;  1BUL A;  2R9W A;  4KZ3 A;  1U60 A;  3VP2 A;  4F94 A;  5F1G A;  4KZ7 A;  4DRT A;  1K57 C;  3Q7V A;  1XA7 A;  1DJA A;  1L0E A;  3ZVT A;  1SDE A;  4HEF A;  3V50 A;  1IEM A;  3WS4 A;  4E3J A;  1BLH A;  4S2M A;  1FQG A;  1DY6 A;  2VGJ A;  4OH0 A;  4OQG A;  2P74 A;  1MY8 A;  3BEC A;  5HAP A;  4CPK A;  2H10 A;  5CXW A;  5DF9 A;  3GR2 A;  3UPO A;  3Q82 A;  2RL3 A;  3WS0 A;  3WS1 A;  3M2J A;  4OQ0 A;  4BJP A;  1ES2 A;  2J9O A;  5GHX A;  4N1H A;  2Y59 A;  2WGI A;  4L0L A;  3S22 A;  1L0G A;  3PBS A;  3UPN A;  2OLU A;  4GNU A;  3S4X A;  1PW1 A;  4LV3 A;  1BT5 A;  1PW8 A;  4JF4 A;  1L0F A;  3LEZ A;  4OOM A;  4U0X A;  2OSU A;  3BM6 A;  1CEF A;  1PWD A;  3C4O A;  3HVF A;  1I5Q A;  3OCN A;  5BOH A;  3SH8 A;  4R23 A;  5FQI A;  4JXV A;  2Y2L A;  3GVB A;  1H5X A;  3N8R A;  4KZ5 A;  3HL9 A;  4JBF A;  4S2O A;  5FAQ A;  3MXS A;  1IYP A;  4E6X A;  4OVD A;  3EQV A;  4WMC A;  5KMW A;  2XH9 A;  5EOO A;  3VFH A;  2ZQ7 A;  4S2J A;  1NYM A;  1HVB A;  3HUO A;  4WMC D;  4E3N A;  5J8X A;  4FD8 A;  3A3D A;  3VMA A;  2ZMA A;  3M2K A;  2Y4A A;  2XF3 A;  1ES5 A;  4Y7P A;  4WEJ A;  4EV4 A;  3SS3 A;  4QJG A;  3ZG8 B;  3M6H A;  2GDN A;  5IHV A;  4ZJ2 A;  2Y2N A;  4UA9 A;  3IXD A;  3DWK A;  5EVL A;  2C5W B;  5HAI A;  3ZFZ A;  3OCL A;  4OPZ A;  2WAD A;  2ZJ9 A;  4KZ4 A;  5CHM A;  1L0D A;  1GCE A;  2DNS A;  2Y2I A;  1KVM A;  1E4D A;  4FCF A;  1BLC A;  2WKE A;  4KG5 A;  1FCM A;  3ZNT A;  5EEC A;  2ZD8 A;  4OPY A;  3VSL A;  3Q7V B;  3ISG A;  4MNR A;  4IBX A;  3OPP A;  4GB7 A;  2XK1 A;  5KZH A;  3EQU A;  2JC7 A;  1IKI A;  1NRF A;  4QHC A;  2ZM2 A;  5FI2 A;  3IWQ A;  2X02 A;  5HX9 A;  5FAS A;  1PI4 A;  3PBN A;  1KGF A;  2ZQA A;  2B5R A;  2PBY A;  3PBQ A;  3W8K A;  3V3S A;  1ZG4 A;  4GDB A;  4ZJ1 A;  1PZP A;  5KSH A;  3NI9 A;  4QY5 A;  5E2E A;  4N1X A;  1ES4 A;  4Q8I A;  1ONG A;  1KDW A;  2WZZ A;  1LI9 A;  1RCJ A;  2WAE A;  5GLB A;  1YLW A;  1XGI A;  2EX6 A;  4E3I A;  5HL1 A;  2Z2L B;  4S2N A;  4E3L A;  3AGE A;  4M3K A;  2XD5 A;  4FH4 A;  4WBG A;  3OPH A;  3CMZ A;  4BL2 A;  3Q1F A;  2XR0 A;  1G68 A;  4LCM A;  3UE0 A;  5AQA A;  1KDS A;  3QHY A;  1XPB A;  3UDX A;  1WE4 A;  4RX2 A;  3IWO A;  3CZD A;  5GHZ A;  3LO7 A;  1PI5 A;  2EXA A;  4LV1 A;  3C7U A;  2X01 A;  2PU2 A;  4UA6 A;  3PBO A;  3OZH A;  4S2K A;  2I72 A;  3ZDJ A;  3A3E A;  1ONH A;  4D2O A;  5L2F A;  1JWZ A;  5E2G A;  1LI0 A;  5G18 A;  1FSW A;  4X6T A;  5A93 A;  1MWT A;  2PU4 A;  1CEG A;  4P87 A;  1GA0 A;  1SKF A;  4PM9 A;  4OQH A;  5CHU A;  3MBZ A;  1L2S A;  5FI7 A;  1JWP A;  1FR1 A;  4JXG A;  3VP3 A;  4EUZ A;  4LEN A;  2Y2O A;  2J9P A;  3UDF A;  2FFF B;  2EXB A;  4R3B A;  5M19 A;  1ES3 A;  2EX2 A;  5FDH A;  4XXR A;  3IH8 A;  1NZO A;  1K4E A;  1BLS A;  5GLC A;  4R0Q A;  2ZQ8 A;  4FH2 A;  4ZJ3 A;  3HRE A;  2HP9 A;  4DE3 A;  5DF8 A;  2R9X A;  3IF6 A;  4P85 A;  4DE1 A;  1K6S A;  3UN7 A;  4DXC A;  1GA9 A;  1M40 A;  2EX9 A;  1PWC A;  1YMS A;  3V39 A;  2CC1 A;  2WYX A;  5E43 A;  4DF6 A;  3D4F A;  3O3V A;  3M6B A;  1I2W A;  3HBR A;  1PWG A;  1FCO A;  4K0X A;  2HDQ A;  5DTT A;  4KEN B;  3RJU A;  3AGF A;  4OOY A;  2V2F F;  3BFF A;  3A3J A;  3O88 A;  4QY6 A;  1ERM A;  4MLL A;  3GTC A;  2H0T A;  4X53 A;  1C3B A;  3IF5 A;  3FV7 A;  4DE2 A;  3GRJ A;  1KE0 A;  1ERQ A;  3IF6 C;  4KG6 A;  4MBK A;  4MBF A;  3BYD A;  4MEZ A;  4H8R A;  3HUN A;  5DTK A;  1M6K A;  2H0Y A;  2XFS A;  4JF6 A;  4GOG A;  1FR6 A;  2ZQC A;  1E25 A;  4R4R A;  1YLT A;  2WAF A;  2Y2Q A;  1H8Z A;  3HUM A;  3NBL A;  1TVF A;  3MZF A;  5CTM A;  1ESI A;  4PPR A;  5FA7 A;  4XUX A;  5EVI C;  3GMW A;  3C7V A;  4KZB A;  3O87 A;  2IWC A;  4O7D A;  1PIO A;  5A92 A;  1VQQ A;  2V20 A;  4UA7 A;  2DRW A;  2Q9M A;  3I7J A;  5AQB A;  5FAP A;  2HDR A;  4KG2 A;  3VSK A;  1I2S A;  2Y55 A;  1Z6F A;  5FQM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...