1YT4A

Crystal structure of tem-76 beta-lactamase at 1.4 angstrom resolution
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMGDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Consequences of the Inhibitor-Resistant Ser130Gly Substitution in TEM beta-Lactamase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Beta-lactamase TEM
total genus 97
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2005-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1yt4A00
5GLAA 2CC1A 2HP5A 2FFYA 3IWOA 2WKEA 1XPBA 3ZHHA 5E43A 5HW3A 1S6RA 4DDYA 1W8YA 3PBTA 5GHXA 1KE4A 1PZOA 1MY8A 2EX9A 4B4XA 2ZC4B 3ITAA 4IVIA 2H0YA 4XXRA 3VP2A 2ZJ9A 4E3KA 2ZC6B 3CMZA 3QNCA 4P0MA 1K4EA 3FKVA 2V1ZA 3MZEA 4HBTA 4LV1A 2H10A 1MWRA 3EQVA 3IXGA 4E3MA 1CI9A 1PWDA 5FASA 4ZAMA 3HBRA 3Q7VA 2G2WA 1K38A 5FQMA 1TDLA 3CJMA 3M2KA 4X55A 4UHUA 4FH2A 3C4OA 1G68A 3G34A 4S2MA 3ZG9B 4WBGA 3A3JA 5EVIB 1SDEA 2XDMA 2X01A 1L0EA 5FI6A 2WGIA 4JF5A 1L0DA 3SH8A 2C6WB 4X69A 2OLVA 4N1XA 1MKIA 4ID4A 3HLBA 1JTDA 2BG1A 1BZAA 1L0GA 1K54A 2ZQDA 5FA7A 4X68A 4LENA 3GRJA 4F94A 1GHIA 3V39A 3OZHA 3DWZA 4KZBA 3P09A 1JWZA 3O88A 1LL5A 3NC8A 1ES4A 4IVKA 4RX2A 3N8SA 2H0TA 3OC2A 4S2OA 1C3BA 2JE5A 4B88A 4X56A 1FCMA 2Q9MA 4R3JA 1ALQA 2PU2A 3ZCZA 1I2WA 2OLUA 3IF6B 1W7FA 4IEDA 1K55C 4OVDA 5EVIA 2UWXA 2ZQ9A 5M1AA 1XX2A 2J9OA 2EX8A 3G35A 2EXBA 1LI0A 3M6BA 3UPPA 3DTMA 1FCOA 5KSHA 1MXOA 1KVMA 1JTGA 1MWUA 4JXGA 5CGWA 5DF7A 2IWBA 2WAFA 4JBFA 5AQAA 1K56A 1VQQA 4WMCD 4E3LA 2R9XA 4RYEA 4WEKA 1W8QA 1PIOA 2VGKA 3IXHA 4N9LA 3Q81A 2EX6A 1LI9A 4IBRA 3NY4A 5A92A 1PW1A 4JXSA 2DRWA 3BFCA 3VOYA 1KDSA 4GDBA 5F83A 2XGNA 3GSGA 2P9VB 2Y2LA 3C5AA 1RP5A 3OPPA 4EV4A 2ZQCA 4Y7PA 1SDNA 4MBHA 3N6IA 3ZDJA 5F1FA 1E4DA 2XFTA 4K91A 1TVFA 4MLLA 5EVID 3QNBA 3HUOA 2Y2KA 5CGXA 1CI8A 5HX9A 4KG6A 1ES3A 4BQMA 1JWVA 1LL9A 5FI2A 2IWDA 2OV5A 2E8IA 4CJNA 1WYCA 3IHBA 4PPRA 3UE1A 1ERQA 1DJCA 1YLWA 2WGWA 2G2UA 3N8RA 3IWQA 2WKIA 2EX2A 3BLMA 1Z6FA 5AQ7A 5AQBA 1M40A 5CXWA 4S2JA 4DE2A 1MWTA 4OPYA 4OONA 2Y2JA 3HLCA 4GN2A 4S2LA 2DNSA 5EECA 4CPKA 1PWCA 3A3FA 3B3XA 1K6SA 2Y4AA 3HVFA 3NBLA 3NIAA 4OP5A 3UDIA 2Y2NA 4N1HA 2XR0A 1O7EA 4YFMA 5A91A 1L2SA 5E2EA 2PBYA 3CZDA 1EI5A 3RXWA 2XD1A 4Y0OA 3HUNA 1DY6A 3MBZA 4EBPA 1IYOA 4LV2A 1YM1A 4D2OA 1BULA 1NJ4A 1NZUA 5GHZA 1FR1A 3WS4A 3V50A 1KE0A 1IEMA 3EQUA 5KZHA 1FQGA 3MXSA 1LHYA 4OQHA 2HDSA 2ZLYA 2HDQA 4KQOA 1MPLA 3Q07A 4BJPA 4ZDXA 4LV0A 3P98A 5E2GA 4QHCA 3OPLA 4BD1A 3V5MA 3ZVTA 3LY3A 2BLSA 3M6HA 4ZJ1A 1TDGA 1HZOA 2P9VA 2WUQA 2HDRA 1W79A 1ESIA 5IHVA 2GDNA 4JXVA 3A3EA 4MBFA 4GOGA 1MBLA 5TFQA 3PBNA 3GMWA 4S2PA 4U0TA 2WZXA 1SCWA 5GL9A 1XGIA 1ES2A 5FAQA 3HLDA 4R23A 4FCFA 5E2FA 3BM6A 4JF6A 4QY6A 5CTMA 3W4QA 4PM9A 1KGGA 5CHJA 2Q9NA 5GLBA 3LY4A 1BUEA 2XEPA 1LLBA 5HAPA 2A49A 4OQ0A 3OPRA 3Q7VB 4UA6A 2I72A 4WM9A 3FWLA 4BD0A 5FDHA 3IHAA 1PW8A 3S22A 4KZ4A 5CEBA 5A93A 3C4PA 2HDUA 5JYPA 3V3RA 3MFDA 5D3OA 4PM5A 2WADA 2PU4A 3BEBA 3IXBA 4X53A 3ZG0A 4WEJA 3ISGA 5TR7A 1IKGA 1BSGA 1RGYA 1N9BA 5FQJA 4IBXA 1ESUA 1HTZA 3CG5A 3IH9A 3O86A 4DXCA 3C7VA 4QB8A 5L2FA 3M2JA 4DE3A 3BLSA 1DJAA 5M19A 1N4OA 2X02A 2ZC5B 3NCKA 3N4IA 4MBKA 5DTSA 4OH0A 3WWXA 4R4SA 2Y2GA 5CECA 3ZG8B 5EUAA 4A5RA 2JCHA 1PWGA 1K57C 3AGEA 3PAGA 4OLDA 2IWCA 3BFEA 2ZD8A 3FYZA 3UDXA 4FSFA 5HAQA 5CERA 5U47A 5HAIA 5EVLA 1XA1A 3VP3A 4ZTKA 5GLDA 3IF5A 1YMXA 1NZOA 3SS5A 4S2KA 5E2HA 1IYSA 4BL3A 4OQIA 5FQIA 5TGFA 1FSWA 4KG2A 4GDNA 4NK3A 4LV3A 3UN7A 4UA9A 3LO7A 3SH7A 3O3VA 1JWPA 2ZC3B 4FH4A 4EBLA 3ZG5A 3O87A 3TOIA 2WKHA 4H8RA 2V20A 4GKUA 2XD5A 3WRTA 3HLEA 2ZM0A 5GLCA 3RXXA 3TG9A 4DKIA 5DTTA 4GZBA 1K56D 4WMCA 5M18A 4OOMA 1SHVA 3BFFA 4RX3A 4QU3A 2OSUA 3GVBA 4S2NC 1RCJA 1BLHA 4O7DA 2XF3A 3W4OA 3QHYA 3GQZA 3FKWA 5DTKA 1J9MA 2Z2LB 1E3UA 4DE0A 1H8ZA 4DXBA 2J8YA 3UY6A 3UO9A 3IH8A 4OKPA 3UE0A 2P74A 4KG5A 2QPNA 3Q1FA 4XUZA 4RA7A 1CEGA 3HLFA 1EWZA 2DCFA 3AGFA 1GHMA 4FD8A 5FAOA 2FFFB 3UE3A 4KZ3A 3UPOA 4C75A 2J7VA 2Z2MB 1K54C 3D4FA 4KQRA 1PI4A 3VFHA 3SH9A 3VSKA 1EROA 3SOIA 3SS4A 1K57A 4KZ5A 5KSCA 4DRTA 3S1YA 3ITBA 4QD4A 4WELA 3G4PA 3WRZA 1O07A 3MZFA 3OPHA 5EPHA 1KE3A 1XA7A 1H8YA 5HARA 1ONGA 4KENB 4R4RA 1I5QA 3A3IA 4PM7A 2XLNA 4OP8A 1BLSA 2HPBA 4OPRA 4E3OA 4S2NA 5EVIC 3LEZA 1QMEA 3ZVWA 1FSYA 5CTNA 2EFUA 2QZ6A 2ZMAA 2ZQAA 3MXRA 3VP4A 4P87A 2H5SA 4GNUA 5J8XA 4HEFA 4UA7A 1YT4A 1NXYA 2WYXA 1XP4A 4JPMA 1L0FA 3BECA 2QMIA 4S2IA 3G30A 3E2LA 4DE1A 1XXMA 3PAEA 3WS5A 3WS0A 1IELA 3ZG7B 2JBFA 1NRFA 3N7WA 4JLFA 2ZM8A 1S0WA 2Y2QA 5CGSA 4JXWA 1YLYA 5EOEA 5EOOA 1I2SA 1BT5A 1TEMA 2XH9A 3OCNA 4PM6A 3SS3A 5FQ9A 4N9KA 3UNWA 3BYDA 3WS1A 4JF4A 1ONHA 4M3KA 4JKTA 4WZ4A 3HLWA 4EBNA 1JVJA 1YMSA 3PBRA 3GTCA 5EE8A 5FAPA 5FSRA 1FR6A 1W5DA 4KZ9A 3AGDA 4ZJ3A 1KGFA 5CRFA 1YLTA 1IYPA 3GR2A 5DF9A 3VSLA 1K4FA 3NI9A 2Y2HA 2VGJA 1H5XA 4E6XA 4RVAA 4UAAA 1ZG4A 4OOYA 1AXBA 3VP1A 5A90A 1M6KA 3N8LA 1BTLA 2ZQ7A 4R0QA 4BLMA 3DWKA 2V2FF 4KZAA 1GA0A 4EWFA 1KVLA 2Y2PA 3PTEA 3IWIA 3NDEA 2RL3A 3VFFA 3VP0A 4GD8A 4EQIA 1E25A 1OMEA 4R3BA 4WYYA 3IF6C 5FQKA 3ZNYA 1RGZA 3WS2A 4OPZA 4K0WA 3S4XA 2C5WB 2Y2IA 1Q2PA 1K6RA 4OQGA 4KZ7A 3VMAA 1IYQA 1PZPA 1BLPA 5JYOA 1GCEA 3HREA 3Q82A 4QY5A 1ZG6A 1YLZA 5FI7A 3VOZA 4GD6A 1CK3A 5CHUA 4PMAA 4WZ5C 3UPNA 3ZNTA 5F82A 4U3TA 4B4ZA 4BL2A 3G2ZA 1Q2QA 5FQQA 3MZDA 1U60A 2ZC7A 2WAEA 3G32A 1YLPA 4HESA 3V3SA 2Y91A 2J9PA 4QJGA 4P85A 4E6WA 1ZKJA 2XFSA 2ZQ8A 1BLCA 5KMWA 5F1GA 2A3UA 3W4PA 4LCMA 3FV7A 5CEDA 2EXAA 2WK0A 1CEFA 4LCLA 4L0LA 1ES5A 1G6AA 4HBUA 1PYYA 4OOLA 2R9WA 4DF6A 4OPQA 5CHMA 4C6YA 4Y0TA 4E3NA 1DJBA 1MWSA 1HD8A 1FOFA 4C3QA 4GB7A 1YQSA 3IT9A 3BFDA 3C7UA 4U0XA 3TSGA 3I7JA 5HFOA 1FCNA 1WYBA 3HUMA 3Q7ZA 4WZ5A 1QMFA 4DDSA 3A3DA 4K0XA 3BFGA 4ZJ2A 3LCEA 4MEZA 5DF8A 2RCXA 3ZFZA 2HP9A 2WGWB 5AQ9A 4E3IA 5HL1A 2EFXA 1VM1A 3PBQA 4BENA 3JYIA 1IKIA 3E2KA 4PM8A 5G18A 4KZ8A 3HLGA 4NETA 3MKEA 3UDFA 1KGEA 2XQZA 1XGJA 1K25A 3ZGAB 2Y59A 4X6TA 1ZC2A 5BOHA 4EUZA 3IF6A 1K55A 3W8KA 1Y54A 1KDWA 5DVAA 5FATA 2WZZA 4KZ6A 2Y2OA 4Y0UA 1E3UD 4MNRA 3IXDA 1NYMA 2Y2MA 5I94A 3DW0A 3RJUA 4Z9QA 4OLGA 2JC7A 2X71A 4ZBEA 1YLJA 2Y55A 3IQAA 4YINA 3G2YA 2HP6A 3G31A 3MKFA 1NY0A 2XK1A 4KQQA 4Q8IA 5GHYA 3GV9A 3PBOA 4P6BA 1GHPA 1WE4A 1XKZA 1ERMA 4N92A 3BRMA 4XUXA 1PI5A 3FZCA 2ZM2A 3PBSA 1SKFA 2WGVA 3OCLA 1NYYA 1HVBA 4R1GA 4E3JA 2B5RA 3HL9A 1GA9A 3NDGA
chains in the Genus database with same CATH superfamily
5GLAA 4MDZA 3IX3A 1S6RA 4GLQA 1KE4A 4YNRA 2ZC4B 1D06A 3VP2A 3QNCA 4E3MA 3PHYA 1CI9A 1PWDA 2G2WA 5FQMA 1TDLA 5J4EA 2W3EA 3UB9A 1G68A 2X01A 1L0EA 5FI6A 1D7EA 2WGIA 4Y13A 4N1XA 2ZQDA 5FA7A 4X68A 4LENA 2QWSA 3E98A 3NOPC 3DWZA 4KZBA 1MC0A 3N8SA 2VV6A 1C3BA 2EWVA 4R3JA 5TBMA 1K55C 4OVDA 5EVIA 2ZQ9A 5M1AA 2KOIA 2GJ3A 2ZL1A 3G35A 3BQ8A 1MXOA 1KVMA 5DF7A 2WAFA 4JBFA 5AQAA 4WMCD 1GSXA 2R9XA 4RYEA 3IXHA 3K3DA 3NY4A 5A92A 4JXSA 4GS9A 2P9VB 1RP5A 3ZDJA 2CMNA 2V8CA 4ARZA 2PT7A 3CPTB 4KG6A 1ES3A 4BQMA 1ZHHB 5G4ZA 1Z09A 1DJCA 2WGWA 4Q0HA 2JKRM 3N8RA 2WKIA 5AJGA 3BLMA 5AQBA 1NLZA 2UV0E 3T4LA 4DE2A 1MWTA 2Y2JA 3HLCA 4GN2A 3PXPA 1PWCA 3A3FA 3B3XA 1K6SA 2Y4AA 3NBLA 1H0MA 2VKSA 2Y2NA 1F98A 3ULFA 4Y0OA 1DY6A 3MBZA 1IYOA 1BULA 1NZUA 5GHZA 1G5UA 4FUWA 3EQUA 1FQGA 2GX5A 1TD5A 1LHYA 2ZLYA 1PNEA 1MPLA 3Q07A 3IBJA 4LV0A 3P98A 2VA0A 3ZVTA 3M6HA 1TDGA 2GDNA 3A3EA 1N9OA 5TFQA 3G6OA 4S2PA 4U0TA 4B93A 1SCWA 3E4QA 1S4SA 3HLDA 4MN7A 3BM6A 4QY6A 5GLBA 4UA6A 3OPRA 3F1NA 4BD0A 1PW8A 4HJ3A 4FTXA 3EGXC 4X53A 1J3WA 3ZG0A 1IKGA 1RGYA 1GSVA 1N9BA 3CHWP 4X25A 4G3KA 4IBXA 3QP1A 3M2JA 5M19A 2X02A 3NCKA 3N4IA 4MBKA 3C2WA 4OH0A 3WWXA 1PWGA 5TJJA 4FSFA 3VP3A 5HDCA 3IF5A 1OTAA 3LR3A 4KG2A 4GDNA 3UN7A 3SH7A 1JWPA 2VZWA 1OTBA 3ZG5A 4I3AA 5DJUA 2V20A 4GKUA 3T1QB 3RXXA 1K56D 3T1SA 4S2NC 4O8GA 3GQZA 5DTKA 4Q0IA 2P74A 3H82B 3F1OB 3AGFA 4FD8A 3D4FA 4KQRA 2QHKA 3SOIA 1L3LA 1K57A 5KSCA 4DRTA 2YKFA 3ITBA 4WN5A 3E0YA 1O07A 3VV4A 1KE3A 1H8YA 2PYPA 1I5QA 4QPRA 1LSXA 4OPRA 4S2NA 3ZVWA 1QMEA 1W63M 2ZMAA 3OLOA 1TS0A 1YT4A 2B02A 4S2IA 1T1CA 3WS0A 1IELA 3ZG7B 3N7WA 4JLFA 2ZM8A 4PHTA 1TEMA 3T1XA 2XH9A 4PM6A 3SS3A 5FQ9A 3UNWA 1CQAA 1ONHA 4Y15A 4JKTA 4RQ9A 1JVJA 3CUEC 3V67A 5FSRA 5EE8A 3AGDA 4Y3IA 2Y2HA 2ZMFA 4UAAA 1ZG4A 1AXBA 1BTLA 2HV1A 2V2FF 3KX0X 3NDEA 4GD8A 4R3BA 3IF6C 5FQKA 1RGZA 4DJ3A 4K0WA 1WA9A 5DKLA 2KX6A 1Q2PA 1K6RA 4KZ7A 3C38A 4GJ4A 3KO6A 1BLPA 1GCEA 3Q82A 4B9OA 5HWTA 1H8MA 2YKHA 4BL2A 3UPNA 2W1TA 3MZDA 2WAEA 1S1YA 4IUKA 2A3UA 4I38A 1F5MA 2EXAA 1CEFA 2VV7A 1ES5A 1G6AA 4HBUA 4OOLA 1YPRA 4OPQA 4HP9A 4C6YA 4E3NA 1DJBA 2QKPA 1FOFA 1YQSA 3MMHA 1WYBA 4WZ5A 2JN7A 3LCEA 5DF8A 2RCXA 1VM1A 3PBQA 5G18A 3JYIA 3HLGA 1LL8A 2Y59A 3RH8B 3IX8A 3LYXA 5TBMB 2V0WA 2Y2OA 4HH3A 5L07A 1NYMA 3RJUA 4Z9QA 5L8MA 4WL9A 3G2YA 4EEPA 4KQQA 1XKZA 4XUXA 2HJ9C 2ZM2A 4I39A 1HVBA 2P7JA 4E3JA 1XFNA 2B5RA 3LGOA 2XSSA 5EM0A 3WRTA 2CC1A 2VGLS 2FFYA 3IWOA 1XPBA 3ZHHA 5E43A 1OTEA 1PZOA 1MY8A 5F6AA 1NRJA 4B4XA 4XXRA 2ZC6B 4L9FA 1K4EA 3FKVA 4HBTA 3EQVA 3T4KA 4ZAMA 2GZAA 1K38A 4X55A 2OWHA 3UB7A 2J3WA 3ZG9B 3A3JA 2XDMA 3A0SA 4LRYC 3VE4A 2KDKA 3SH8A 4X69A 3CPTA 2KLIA 3HLBA 1JTDA 3F1PA 4F94A 3GRJA 1GHIA 3V39A 1DP8A 3H9WA 3O88A 3NC8A 2W3FA 1ES4A 3T4QA 4IVKA 2H0TA 3OC2A 5L10A 2JE5A 1FCMA 1ALQA 3ZCZA 1W7FA 4IEDA 2ACGA 3BWLA 3DTMA 4JXGA 2IWBA 2R78A 1W8QA 1PIOA 2VGKA 4N9LA 3Q81A 3A0VA 2PD8A 3VOYA 1KDSA 5F83A 3GSGA 4Z1WA 1XJ2A 4EV4A 3B33A 1SDNA 4MBHA 3N6IA 5F1FA 1E4DA 3OBFA 1GSWA 2XRNA 4K91A 2V9AA 3BQAA 2V1BA 5IT5A 4EQ1A 5FI2A 2V0UA 3UE1A 2G2UA 1Z6FA 4WLAA 1M40A 5CXWA 4OPYA 4S2LA 2DNSA 5EECA 3S7PA 3NIAA 3UDIA 4N1HA 2XR0A 1TS6A 4YFMA 5A91A 2PBYA 1TS7A 5AVFA 1YM1A 4F3LA 3UB8A 3WS4A 1KE0A 4OQHA 2HDSA 4HJ6A 3OPLA 2WUQA 5HL6A 3DTKA 4GOGA 3UB6A 1XJ6A 4I3JA 2WZXA 5FAQA 4FCFA 5E2FA 2HZ5A 5CTMA 3W4QA 4DMZA 5FDSA 3LY4A 1BUEA 2XEPA 5DFXA 2I72A 3S22A 5CEBA 3C4PA 2HDUA 3V3RA 4LFUA 4PM5A 2WADA 3IXBA 3MQOA 1BSGA 3IH9A 4DXCA 3MJQA 5L2FA 2ZMVA 1W63Q 1N4OA 3EOIA 2ZC5B 5DTSA 2Y2GA 3SW1A 3ZG8B 5EUAA 1XJ4A 1K57C 3AGEA 3UMEA 3NECA 3UDXA 4JGRA 2PDRA 3NOUC 3CWFA 3CUEA 1XA1A 5GLDA 4HI4A 1YMXA 3UE6A 4S2KA 3DTIA 1FSWA 1P9WA 4UA9A 3LO7A 1VEUB 5IS1A 4EETB 4H8RA 4LGWA 2XD5A 3QP4A 5DTTA 4P6ZS 1RCJA 1BLHA 4O7DA 2J3TC 3QHYA 3FKWA 2Z2LB 1UGUA 4OKPA 2O0YA 3Q1FA 4RA7A 2JKRI 2DCFA 3L7HA 2J7VA 2Z2MB 3VSKA 2JKTI 1EROA 4KZ5A 3S1YA 3G4PA 3WRZA 4PAUA 3MZFA 2HF6A 2DMWA 1XA7A 5HARA 1ONGA 4KENB 1FILA 3A3IA 2A24A 4OP8A 2HPBA 4E3OA 3LEZA 1VETA 2EFUA 2QZ6A 4P87A 5HPFA 4CLCE 4GNUA 4WF0A 4UA7A 2VJWA 1XP4A 4JPMA 4R3AA 4IHQA 2QMIA 4LRXC 3G30A 4M4XA 1UWPX 2OOLA 3LIAA 2JBFA 1NRFA 5EOEA 3QP8A 3EGDC 2J3TD 4O01A 4M3KA 1XJ3A 3P01A 3BY9A 1S66L 3GTCA 5FAPA 1FR6A 1W5DA 5DF9A 5CRFA 1YLTA 3S7NA 3VSLA 3T12B 4E6XA 3NOTC 4WUJA 3VP1A 5A90A 4Q0JA 4NEED 4EWFA 4P6ZM 2Y2PA 4BBVA 1E25A 1OMEA 4WYYA 3ZNYA 2O9BA 4H6JB 1JNUA 2ZL1B 2Y2IA 1S1ZA 3VOLA 2VX8A 3MXQA 3QP2A 1MZUA 3U2AA 3LIDA 5JYOA 5DFYA 1ZG6A 1A0KA 3VOZA 4L9EA 3H7WA 5CHUA 4PMAA 5F82A 2VGLM 4U3TA 5HWWA 3G2ZA 1Q2QA 1U60A 3G32A 3IBRA 4HESA 3FC7A 4E6WA 2XFSA 5EFWA 1OJ5A 4UQIM 5F1GA 3W4PA 5CEDA 4LCLA 5CHMA 5HD5A 3IT9A 3VE3A 1OTDA 3I7JA 4HP4A 5HFOA 4GW9A 1T1AA 5FEFA 3K3CA 3T50A 3ZFZA 2HP9A 5AQ9A 4E04A 4E3IA 5HL1A 1IKIA 4PM8A 2QJ7A 3UDFA 1KGEA 2XQZA 3B47A 1LSWA 3ZGAB 1ZC2A 1K55A 1Y54A 5FATA 1CF0A 1SKOB 4Y0UA 4HQAA 3S7QA 3IXDA 5I94A 2PR6A 4OLGA 2X71A 2Y55A 4UEYA 3NHQA 2HP6A 1NY0A 1OPXA 4Q8IA 5GHYA 3PBOA 4P6BA 1WE4A 4N92A 3PBSA 4R1GA 4HHDA 3HL9A 1GA9A 3NDGA 5HPIA 2WKEA 5G4YA 5HW3A 1W8YA 4NXBA 3CITA 4YOFA 3ITAA 2H0YA 3CMZA 2EWWA 4X1MA 4I5SA 4LV1A 4JGQA 2NUTC 4R6LA 2P08A 5FASA 4O0PA 3CJMA 4FH2A 3G34A 4S2MA 5EVIB 1L0DA 2C6WB 2OLVA 3LICA 3JVUA 2QJ5A 2BG1A 1BZAA 1BYWA 1S67L 2PHYA 1K54A 3MFXA 1TF1A 4YWZA 3P09A 1JWZA 1IOUA 4B88A 3D9YA 2Q9MA 1I2WA 2OLUA 2UWXA 1XX2A 5KSHA 3M6BA 4NXEA 2PYRA 1MWUA 1DP6A 1VQQA 4BWIA 4CLCC 2EX6A 4IBRA 1PW1A 3LR4A 3BFCA 4GDBA 3C5AA 3R7WA 3OPPA 4QWOA 3F1PB 1TVFA 4MLLA 2A24B 5AVEA 4HNBA 3KYQA 1JWVA 1YKDA 2E8IA 1FIKA 4CJNA 4EW7A 3IHBA 4PPRA 4DJ2A 1VEUA 3KSGA 2EX2A 3TRCA 4S2JA 3C30A 2D01A 2JKFA 4CPKA 2BASA 3HVFA 3RTYA 1O7EA 5E2EA 3CZDA 2G7UA 1EI5A 4Y5FA 1NWZA 3HUNA 4EBPA 4LV2A 4D2OA 1NJ4A 1FR1A 3T1RA 3V50A 3EEHA 1IEMA 1MKMA 1ZTUA 4KQOA 4ZDXA 3V5MA 3LY3A 3KSFA 2BLSA 4ZJ1A 1HZOA 2P9VA 1T19A 1W79A 4JXVA 1MBLA 3IX4A 3GMWA 3HJIA 2O9CA 5GL9A 1XGIA 3BW6A 1ES2A 4ETXA 2L4RA 2ZBBA 1KGGA 2Q9NA 1N9NA 1LLBA 5HAPA 2A49A 4OQ0A 4WM9A 3FWLA 4EERA 4KZ4A 1VHMA 2E8JA 2JKTM 4GS9B 3O5YA 4WEJA 3ISGA 1SKOA 5FQJA 1ESUA 3O86A 4QB8A 4G3WA 3TE8A 3PYPA 4R4SA 4OLDA 5C5KA 4EUVA 2IWCA 3BFEA 4K08A 5HAQA 5U47A 1N9LA 3LR5A 4ZTKA 1NZOA 5E2HA 2ZOHA 1IYSA 3DBAA 4OQIA 5TGFA 4NK3A 4LV3A 4KUOA 3NJAA 4AFIA 4GHIA 4EBLA 4CLCA 3O87A 3TOIA 2W0NA 2WKHA 5DJTA 3ICYA 3HLEA 2ZM0A 5GLCA 3TG9A 4DKIA 4GZBA 5M18A 4IUHA 3NULA 4OOMA 4QU3A 1Y28A 2XF3A 1F2KA 1J9MA 4DE0A 3UE0A 3P7NA 2QPNA 1KOUA 1EWZA 2M1CA 1GHMA 3UE3A 4KZ3A 3UPOA 3UMDA 5EV0A 4KQDA 1PI4A 3VFHA 4Y2FA 5L09A 3SS4A 5CX7A 2BTFP 4WELA 3D72A 3T4SA 2PRFA 5EPHA 5K5BA 4Y17A 4PM7A 1BLSA 5HDDA 5EVIC 4MMNA 2K31A 4EXOA 4JGPA 3VP4A 3MXRA 5J8XA 2WYXA 1L0FA 2OWJA 3E2LA 3BY8A 1XXMA 3T4JA 4PKYG 1S0WA 3W2ZA 5CGSA 4JXWA 5EOOA 1BT5A 3OCNA 1YSPA 3WS1A 3E4OA 1YMSA 3KSHA 3PBRA 3LUQA 1IFQA 1KGFA 3GR2A 2VGJA 3LI8A 4L9GA 2M7VA 4OOYA 2VEAA 1M6KA 3N8LA 3MF0A 3DWKA 4KZAA 2FH5A 3IWIA 2PD7A 4EQIA 4OPZA 3S4XA 2JKGA 3CLOA 2C5WB 1DP9A 3HREA 3L9KA 4QY5A 5EVEA 5FI7A 4XT2B 4GD6A 1CK3A 1ODVA 4WZ5C 3ZNTA 4B4ZA 2EA9A 5MC7A 2B95A 1YLPA 1XFQA 2HJEA 4P85A 4QJGA 5IU1A 1ZKJA 1BLCA 1K0KA 1YAXA 2WK0A 2Y79A 1PYYA 4GHIB 4DF6A 4JGOA 5I5LA 3T4TA 4Y0TA 4GCZA 4GB7A 4I3IA 3BFDA 1VETB 3R4KA 1FCNA 3HCYA 1QMFA 4DDSA 4K0XA 3BFGA 4MEZA 3SZTA 2EFXA 4BENA 2K2NA 4KZ8A 3MKEA 1K25A 4X6TA 3BJNA 4EUZA 5DKKA 2W1RA 3W8KA 1KDWA 3QP6A 2WZZA 3KYZA 2GNXA 3DW0A 1UWNX 1G6OA 2PR5A 1YLJA 3IQAA 2B18A 4YINA 3MKFA 3GECA 1GHPA 1ERMA 2INWA 5J3WA 1PI5A 3FZCA 1SKFA 3OCLA 1LSVA 2XA7M 1CEGA 2HP5A 4NKPA 3QP5A 3LIEA 4DDYA 3PBTA 5GHXA 2EX9A 2PBDP 4IVIA 2ZJ9A 4E3KA 4P0MA 2V1ZA 3MZEA 2H10A 1MWRA 3IXGA 3HBRA 3Q7VA 3U4LP 3M2KA 4UHUA 4BBTA 3C4OA 4WBGA 3EWKA 4KUKA 1SDEA 4JF5A 1MKIA 4ID4A 1L0GA 4FOFA 2VLGA 3OZHA 2WKQA 3GDIA 1LL5A 5FEGA 4RX2A 4LLOB 1T1BA 4S2OA 4ZRRA 4X56A 2PU2A 1V9YA 3IF6B 1TS8A 4HOIA 2J80A 2J9OA 2EX8A 2EXBA 1LI0A 3UPPA 1FCOA 1JTGA 5CGWA 2NUPC 4X1LA 1PFLA 1K56A 3JPUA 4E3LA 1F9IA 5F69A 1CJFA 4WEKA 2PAVP 5A8BA 1LI9A 2DRWA 4R38A 2VV8A 2XGNA 2Y2LA 3JVVA 2ZQCA 3MS6A 1V9ZA 4Y7PA 2XFTA 5EVID 3QNBA 3HUOA 2Y2KA 4EU0A 5CGXA 1CI8A 5HX9A 1LL9A 2IWDA 2OV5A 2OAP1 5J7EA 1WYCA 1ERQA 1YLWA 3IWQA 3ZYTA 5AQ7A 2OAQ1 4MN6A 4OONA 3K2NA 5F68A 1T18A 5EM1A 2D02A 4R70A 4OP5A 3H7WB 2Z6DA 5F5YA 1L2SA 1SZVA 3RXWA 2XD1A 2QYBA 5KZHA 3FPWA 4F3LB 3MXSA 2HDQA 4BJPA 4UQIS 5E2GA 4QHCA 4BD1A 2HDRA 1ESIA 5IHVA 2LB5A 3CAXA 4MBFA 3TJZC 1X0OA 4NG2A 3T4OA 3PBNA 3RFBA 4R23A 3KYEA 4JF6A 4PM9A 4H6JA 5CHJA 4G3VA 2W27A 3Q7VB 1AWIA 4DN0A 1PRQA 3LFVA 1H3QA 3IHAA 2O99A 5FDHA 3OOVA 3LIFA 5A93A 5HWVA 5JYPA 3MFDA 5D3OA 2Y8HA 2W1TB 2K7SA 4LRZE 2PU4A 3BEBA 2Z6CA 1EW0A 5TR7A 1HTZA 3CG5A 2WKRA 3C7VA 4MCWA 1P9RA 3TW8A 4DE3A 3BLSA 3DTEA 1DJAA 5CECA 4II7A 2I9VA 4A5RA 2JCHA 3PAGA 3FYZA 2ZD8A 5CERA 3F1OA 5HAIA 5EVLA 5HDSA 3LR0A 1STZA 2WKPA 4HH2A 3SS5A 1DRMA 3D3OA 2V1AA 4BL3A 5FQIA 2L1MA 3O3VA 2ZC3B 4FH4A 4NXGA 3DAVA 1P97A 4EEUA 4WMCA 4CLCB 4ESPA 1SHVA 3BFFA 4RX3A 2OSUA 3GVBA 2JHEA 3B42A 3W4OA 1E3UA 1H8ZA 4DXBA 2J8YA 1OJGA 3UY6A 3UO9A 3IH8A 2P04A 4KG5A 5KIZA 2H28A 4XUZA 2XROA 3HLFA 2AVXA 2HGVA 3HJKA 5FAOA 2FFFB 4C75A 1K54C 3SH9A 5FL3A 1OT6A 4QD4A 3A0RA 3OPHA 1S4RA 3IS2A 4R4RA 2A2LA 3MQQA 2MJ6A 2XLNA 3MQ0A 3H82A 1FSYA 5CTNA 4LPZA 3R7WB 2ZQAA 3E4PA 4D60A 4PKYA 2H5SA 3UB5P 4HEFA 1NXYA 3BECA 4DE1A 3PAEA 4CLCD 3WS5A 3F1NB 2Q0OA 2Y2QA 1G28A 3FG8A 1YLYA 1I2SA 4N9KA 3BYDA 4JF4A 2VK3A 4WZ4A 3HLWA 4EBNA 3MSHA 2XA7S 3MR0A 4IJGA 3LI9A 4KZ9A 4ZJ3A 1IYPA 2W3GA 1K4FA 3NI9A 1H5XA 4RVAA 2W3HA 4CQHA 2ZQ7A 3IS2B 4R0QA 4BLMA 1GA0A 1KVLA 3VFFA 3VP0A 1D1JA 2RL3A 3CI6A 5HSQA 1HLUP 3WS2A 1ACFA 4OQGA 3VMAA 1IYQA 4ME4A 1PZPA 2M7UA 1OT9A 3C8CA 1YLZA 3LEQA 5FQQA 2ZC7A 4XT2A 5HD3A 3V3SA 2Y91A 2J9PA 4ETZA 2ZOIA 2ZQ8A 5KMWA 1P0ZA 4LCMA 3FV7A 2O9AA 4L0LA 2R9WA 1LT0A 4ARZB 3FPVA 1MWSA 1HD8A 2FZ0A 4C3QA 2L0WA 3C7UA 4U0XA 3TSGA 2W3DA 3Q7ZA 3HUMA 3A3DA 3ZQ5A 3LIBA 4ZJ2A 5LBRA 2IA2A 2WGWB 3E2KA 3PR6A 4NETA 3S7OA 1XGJA 5BOHA 3IF6A 4NXFA 5DVAA 3EEAA 5HZHA 4KZ6A 1E3UD 4MNRA 1YSQA 2Y2MA 1VB6A 2JC7A 1OTIA 4EESA 4ZBEA 2V8FA 3KSIA 3G31A 4BBUA 4BMWA 4HY8A 2LB9A 2XK1A 4MN5A 3GV9A 1NLYA 3BRMA 4HJ4A 4HIAA 2WGVA 1NYYA 1Y4OA 3PTEA
chains in the Genus database with same CATH topology
5GLAA 2CC1A 2HP5A 2FFYA 3IWOA 2WKEA 1XPBA 3ZHHA 5E43A 5HW3A 1S6RA 4DDYA 1W8YA 3PBTA 5GHXA 1KE4A 1PZOA 1MY8A 2EX9A 4B4XA 2ZC4B 3ITAA 4IVIA 2H0YA 4XXRA 3VP2A 2ZJ9A 4E3KA 2ZC6B 3CMZA 3QNCA 4P0MA 1K4EA 3FKVA 2V1ZA 3MZEA 4HBTA 4LV1A 2H10A 1MWRA 3EQVA 3IXGA 4E3MA 1CI9A 1PWDA 5FASA 4ZAMA 3HBRA 3Q7VA 2G2WA 1K38A 5FQMA 1TDLA 3CJMA 3M2KA 4X55A 4UHUA 4FH2A 3C4OA 1G68A 3G34A 4S2MA 3ZG9B 4WBGA 3A3JA 5EVIB 1SDEA 2XDMA 2X01A 1L0EA 5FI6A 2WGIA 4JF5A 1L0DA 3SH8A 2C6WB 4X69A 2OLVA 4N1XA 1MKIA 4ID4A 3HLBA 1JTDA 2BG1A 1BZAA 1L0GA 1K54A 2ZQDA 5FA7A 4X68A 4LENA 3GRJA 4F94A 1GHIA 3V39A 3OZHA 3DWZA 4KZBA 3P09A 1JWZA 3O88A 1LL5A 3NC8A 1ES4A 4IVKA 4RX2A 3N8SA 2H0TA 3OC2A 4S2OA 1C3BA 2JE5A 4B88A 4X56A 1FCMA 2Q9MA 4R3JA 1ALQA 2PU2A 3ZCZA 1I2WA 2OLUA 3IF6B 1W7FA 4IEDA 1K55C 4OVDA 5EVIA 2UWXA 2ZQ9A 5M1AA 1XX2A 2J9OA 2EX8A 3G35A 2EXBA 1LI0A 3M6BA 3UPPA 3DTMA 1FCOA 5KSHA 1MXOA 1KVMA 1JTGA 1MWUA 4JXGA 5CGWA 5DF7A 2IWBA 2WAFA 4JBFA 5AQAA 1K56A 1VQQA 4WMCD 4E3LA 2R9XA 4RYEA 4WEKA 1W8QA 1PIOA 2VGKA 3IXHA 4N9LA 3Q81A 2EX6A 1LI9A 4IBRA 3NY4A 5A92A 1PW1A 4JXSA 2DRWA 3BFCA 3VOYA 1KDSA 4GDBA 5F83A 2XGNA 3GSGA 2P9VB 2Y2LA 3C5AA 1RP5A 3OPPA 4EV4A 2ZQCA 4Y7PA 1SDNA 4MBHA 3N6IA 3ZDJA 5F1FA 1E4DA 2XFTA 4K91A 1TVFA 4MLLA 5EVID 3QNBA 3HUOA 2Y2KA 5CGXA 1CI8A 5HX9A 4KG6A 1ES3A 4BQMA 1JWVA 1LL9A 5FI2A 2IWDA 2OV5A 2E8IA 4CJNA 1WYCA 3IHBA 4PPRA 3UE1A 1ERQA 1DJCA 1YLWA 2WGWA 2G2UA 3N8RA 3IWQA 2WKIA 2EX2A 3BLMA 1Z6FA 5AQ7A 5AQBA 1M40A 5CXWA 4S2JA 4DE2A 1MWTA 4OPYA 4OONA 2Y2JA 3HLCA 4GN2A 4S2LA 2DNSA 5EECA 4CPKA 1PWCA 3A3FA 3B3XA 1K6SA 2Y4AA 3HVFA 3NBLA 3NIAA 4OP5A 3UDIA 2Y2NA 4N1HA 2XR0A 1O7EA 4YFMA 5A91A 1L2SA 5E2EA 2PBYA 3CZDA 1EI5A 3RXWA 2XD1A 4Y0OA 3HUNA 1DY6A 3MBZA 4EBPA 1IYOA 4LV2A 1YM1A 4D2OA 1BULA 1NJ4A 1NZUA 5GHZA 1FR1A 3WS4A 3V50A 1KE0A 1IEMA 3EQUA 5KZHA 1FQGA 3MXSA 1LHYA 4OQHA 2HDSA 2ZLYA 2HDQA 4KQOA 1MPLA 3Q07A 4BJPA 4ZDXA 4LV0A 3P98A 5E2GA 4QHCA 3OPLA 4BD1A 3V5MA 3ZVTA 3LY3A 2BLSA 3M6HA 4ZJ1A 1TDGA 1HZOA 2P9VA 2WUQA 2HDRA 1W79A 1ESIA 5IHVA 2GDNA 4JXVA 3A3EA 4MBFA 4GOGA 1MBLA 5TFQA 3PBNA 3GMWA 4S2PA 4U0TA 2WZXA 1SCWA 5GL9A 1XGIA 1ES2A 5FAQA 3HLDA 4R23A 4FCFA 5E2FA 3BM6A 4JF6A 4QY6A 5CTMA 3W4QA 4PM9A 1KGGA 5CHJA 2Q9NA 5GLBA 3LY4A 1BUEA 2XEPA 1LLBA 5HAPA 2A49A 4OQ0A 3OPRA 3Q7VB 4UA6A 2I72A 4WM9A 3FWLA 4BD0A 5FDHA 3IHAA 1PW8A 3S22A 4KZ4A 5CEBA 5A93A 3C4PA 2HDUA 5JYPA 3V3RA 3MFDA 5D3OA 4PM5A 2WADA 2PU4A 3BEBA 3IXBA 4X53A 3ZG0A 4WEJA 3ISGA 5TR7A 1IKGA 1BSGA 1RGYA 1N9BA 5FQJA 4IBXA 1ESUA 1HTZA 3CG5A 3IH9A 3O86A 4DXCA 3C7VA 4QB8A 5L2FA 3M2JA 4DE3A 3BLSA 1DJAA 5M19A 1N4OA 2X02A 2ZC5B 3NCKA 3N4IA 4MBKA 5DTSA 4OH0A 3WWXA 4R4SA 2Y2GA 5CECA 3ZG8B 5EUAA 4A5RA 2JCHA 1PWGA 1K57C 3AGEA 3PAGA 4OLDA 2IWCA 3BFEA 2ZD8A 3FYZA 3UDXA 4FSFA 5HAQA 5CERA 5U47A 5HAIA 5EVLA 1XA1A 3VP3A 4ZTKA 5GLDA 3IF5A 1YMXA 1NZOA 3SS5A 4S2KA 5E2HA 1IYSA 4BL3A 4OQIA 5FQIA 5TGFA 1FSWA 4KG2A 4GDNA 4NK3A 4LV3A 3UN7A 4UA9A 3LO7A 3SH7A 3O3VA 1JWPA 2ZC3B 4FH4A 4EBLA 3ZG5A 3O87A 3TOIA 2WKHA 4H8RA 2V20A 4GKUA 2XD5A 3WRTA 3HLEA 2ZM0A 5GLCA 3RXXA 3TG9A 4DKIA 5DTTA 4GZBA 1K56D 4WMCA 5M18A 4OOMA 1SHVA 3BFFA 4RX3A 4QU3A 2OSUA 3GVBA 4S2NC 1RCJA 1BLHA 4O7DA 2XF3A 3W4OA 3QHYA 3GQZA 3FKWA 5DTKA 1J9MA 2Z2LB 1E3UA 4DE0A 1H8ZA 4DXBA 2J8YA 3UY6A 3UO9A 3IH8A 4OKPA 3UE0A 2P74A 4KG5A 2QPNA 3Q1FA 4XUZA 4RA7A 1CEGA 3HLFA 1EWZA 2DCFA 3AGFA 1GHMA 4FD8A 5FAOA 2FFFB 3UE3A 4KZ3A 3UPOA 4C75A 2J7VA 2Z2MB 1K54C 3D4FA 4KQRA 1PI4A 3VFHA 3SH9A 3VSKA 1EROA 3SOIA 3SS4A 1K57A 4KZ5A 5KSCA 4DRTA 3S1YA 3ITBA 4QD4A 4WELA 3G4PA 3WRZA 1O07A 3MZFA 3OPHA 5EPHA 1KE3A 1XA7A 1H8YA 5HARA 1ONGA 4KENB 4R4RA 1I5QA 3A3IA 4PM7A 2XLNA 4OP8A 1BLSA 2HPBA 4OPRA 4E3OA 4S2NA 5EVIC 3LEZA 1QMEA 3ZVWA 1FSYA 5CTNA 2EFUA 2QZ6A 2ZMAA 2ZQAA 3MXRA 3VP4A 4P87A 2H5SA 4GNUA 5J8XA 4HEFA 4UA7A 1YT4A 1NXYA 2WYXA 1XP4A 4JPMA 1L0FA 3BECA 2QMIA 4S2IA 3G30A 3E2LA 4DE1A 1XXMA 3PAEA 3WS5A 3WS0A 1IELA 3ZG7B 2JBFA 1NRFA 3N7WA 4JLFA 2ZM8A 1S0WA 2Y2QA 5CGSA 4JXWA 1YLYA 5EOEA 5EOOA 1I2SA 1BT5A 1TEMA 2XH9A 3OCNA 4PM6A 3SS3A 5FQ9A 4N9KA 3UNWA 3BYDA 3WS1A 4JF4A 1ONHA 4M3KA 4JKTA 4WZ4A 3HLWA 4EBNA 1JVJA 1YMSA 3PBRA 3GTCA 5EE8A 5FAPA 5FSRA 1FR6A 1W5DA 4KZ9A 3AGDA 4ZJ3A 1KGFA 5CRFA 1YLTA 1IYPA 3GR2A 5DF9A 3VSLA 1K4FA 3NI9A 2Y2HA 2VGJA 1H5XA 4E6XA 4RVAA 4UAAA 1ZG4A 4OOYA 1AXBA 3VP1A 5A90A 1M6KA 3N8LA 1BTLA 2ZQ7A 4R0QA 4BLMA 3DWKA 2V2FF 4KZAA 1GA0A 4EWFA 1KVLA 2Y2PA 3PTEA 3IWIA 3NDEA 2RL3A 3VFFA 3VP0A 4GD8A 4EQIA 1E25A 1OMEA 4R3BA 4WYYA 3IF6C 5FQKA 3ZNYA 1RGZA 3WS2A 4OPZA 4K0WA 3S4XA 2C5WB 2Y2IA 1Q2PA 1K6RA 4OQGA 4KZ7A 3VMAA 1IYQA 1PZPA 1BLPA 5JYOA 1GCEA 3HREA 3Q82A 4QY5A 1ZG6A 1YLZA 5FI7A 3VOZA 4GD6A 1CK3A 5CHUA 4PMAA 4WZ5C 3UPNA 3ZNTA 5F82A 4U3TA 4B4ZA 4BL2A 3G2ZA 1Q2QA 5FQQA 3MZDA 1U60A 2ZC7A 2WAEA 3G32A 1YLPA 4HESA 3V3SA 2Y91A 2J9PA 4QJGA 4P85A 4E6WA 1ZKJA 2XFSA 2ZQ8A 1BLCA 5KMWA 5F1GA 2A3UA 3W4PA 4LCMA 3FV7A 5CEDA 2EXAA 2WK0A 1CEFA 4LCLA 4L0LA 1ES5A 1G6AA 4HBUA 1PYYA 4OOLA 2R9WA 4DF6A 4OPQA 5CHMA 4C6YA 4Y0TA 4E3NA 1DJBA 1MWSA 1HD8A 1FOFA 4C3QA 4GB7A 1YQSA 3IT9A 3BFDA 3C7UA 4U0XA 3TSGA 3I7JA 5HFOA 1FCNA 1WYBA 3HUMA 3Q7ZA 4WZ5A 1QMFA 4DDSA 3A3DA 4K0XA 3BFGA 4ZJ2A 3LCEA 4MEZA 5DF8A 2RCXA 3ZFZA 2HP9A 2WGWB 5AQ9A 4E3IA 5HL1A 2EFXA 1VM1A 3PBQA 4BENA 3JYIA 1IKIA 3E2KA 4PM8A 5G18A 4KZ8A 3HLGA 4NETA 3MKEA 3UDFA 1KGEA 2XQZA 1XGJA 1K25A 3ZGAB 2Y59A 4X6TA 1ZC2A 5BOHA 4EUZA 3IF6A 1K55A 3W8KA 1Y54A 1KDWA 5DVAA 5FATA 2WZZA 4KZ6A 2Y2OA 4Y0UA 1E3UD 4MNRA 3IXDA 1NYMA 2Y2MA 5I94A 3DW0A 3RJUA 4Z9QA 4OLGA 2JC7A 2X71A 4ZBEA 1YLJA 2Y55A 3IQAA 4YINA 3G2YA 2HP6A 3G31A 3MKFA 1NY0A 2XK1A 4KQQA 4Q8IA 5GHYA 3GV9A 3PBOA 4P6BA 1GHPA 1WE4A 1XKZA 1ERMA 4N92A 3BRMA 4XUXA 1PI5A 3FZCA 2ZM2A 3PBSA 1SKFA 2WGVA 3OCLA 1NYYA 1HVBA 4R1GA 4E3JA 2B5RA 3HL9A 1GA9A 3NDGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GLA A;  2CC1 A;  2HP5 A;  2FFY A;  3IWO A;  2WKE A;  1XPB A;  3ZHH A;  5E43 A;  5HW3 A;  1S6R A;  4DDY A;  1W8Y A;  3PBT A;  5GHX A;  1KE4 A;  1PZO A;  1MY8 A;  2EX9 A;  4B4X A;  2ZC4 B;  3ITA A;  4IVI A;  2H0Y A;  4XXR A;  3VP2 A;  2ZJ9 A;  4E3K A;  2ZC6 B;  3CMZ A;  3QNC A;  4P0M A;  1K4E A;  3FKV A;  2V1Z A;  3MZE A;  4HBT A;  4LV1 A;  2H10 A;  1MWR A;  3EQV A;  3IXG A;  4E3M A;  1CI9 A;  1PWD A;  5FAS A;  4ZAM A;  3HBR A;  3Q7V A;  2G2W A;  1K38 A;  5FQM A;  1TDL A;  3CJM A;  3M2K A;  4X55 A;  4UHU A;  4FH2 A;  3C4O A;  1G68 A;  3G34 A;  4S2M A;  3ZG9 B;  4WBG A;  3A3J A;  5EVI B;  1SDE A;  2XDM A;  2X01 A;  1L0E A;  5FI6 A;  2WGI A;  4JF5 A;  1L0D A;  3SH8 A;  2C6W B;  4X69 A;  2OLV A;  4N1X A;  1MKI A;  4ID4 A;  3HLB A;  1JTD A;  2BG1 A;  1BZA A;  1L0G A;  1K54 A;  2ZQD A;  5FA7 A;  4X68 A;  4LEN A;  3GRJ A;  4F94 A;  1GHI A;  3V39 A;  3OZH A;  3DWZ A;  4KZB A;  3P09 A;  1JWZ A;  3O88 A;  1LL5 A;  3NC8 A;  1ES4 A;  4IVK A;  4RX2 A;  3N8S A;  2H0T A;  3OC2 A;  4S2O A;  1C3B A;  2JE5 A;  4B88 A;  4X56 A;  1FCM A;  2Q9M A;  4R3J A;  1ALQ A;  2PU2 A;  3ZCZ A;  1I2W A;  2OLU A;  3IF6 B;  1W7F A;  4IED A;  1K55 C;  4OVD A;  5EVI A;  2UWX A;  2ZQ9 A;  5M1A A;  1XX2 A;  2J9O A;  2EX8 A;  3G35 A;  2EXB A;  1LI0 A;  3M6B A;  3UPP A;  3DTM A;  1FCO A;  5KSH A;  1MXO A;  1KVM A;  1JTG A;  1MWU A;  4JXG A;  5CGW A;  5DF7 A;  2IWB A;  2WAF A;  4JBF A;  5AQA A;  1K56 A;  1VQQ A;  4WMC D;  4E3L A;  2R9X A;  4RYE A;  4WEK A;  1W8Q A;  1PIO A;  2VGK A;  3IXH A;  4N9L A;  3Q81 A;  2EX6 A;  1LI9 A;  4IBR A;  3NY4 A;  5A92 A;  1PW1 A;  4JXS A;  2DRW A;  3BFC A;  3VOY A;  1KDS A;  4GDB A;  5F83 A;  2XGN A;  3GSG A;  2P9V B;  2Y2L A;  3C5A A;  1RP5 A;  3OPP A;  4EV4 A;  2ZQC A;  4Y7P A;  1SDN A;  4MBH A;  3N6I A;  3ZDJ A;  5F1F A;  1E4D A;  2XFT A;  4K91 A;  1TVF A;  4MLL A;  5EVI D;  3QNB A;  3HUO A;  2Y2K A;  5CGX A;  1CI8 A;  5HX9 A;  4KG6 A;  1ES3 A;  4BQM A;  1JWV A;  1LL9 A;  5FI2 A;  2IWD A;  2OV5 A;  2E8I A;  4CJN A;  1WYC A;  3IHB A;  4PPR A;  3UE1 A;  1ERQ A;  1DJC A;  1YLW A;  2WGW A;  2G2U A;  3N8R A;  3IWQ A;  2WKI A;  2EX2 A;  3BLM A;  1Z6F A;  5AQ7 A;  5AQB A;  1M40 A;  5CXW A;  4S2J A;  4DE2 A;  1MWT A;  4OPY A;  4OON A;  2Y2J A;  3HLC A;  4GN2 A;  4S2L A;  2DNS A;  5EEC A;  4CPK A;  1PWC A;  3A3F A;  3B3X A;  1K6S A;  2Y4A A;  3HVF A;  3NBL A;  3NIA A;  4OP5 A;  3UDI A;  2Y2N A;  4N1H A;  2XR0 A;  1O7E A;  4YFM A;  5A91 A;  1L2S A;  5E2E A;  2PBY A;  3CZD A;  1EI5 A;  3RXW A;  2XD1 A;  4Y0O A;  3HUN A;  1DY6 A;  3MBZ A;  4EBP A;  1IYO A;  4LV2 A;  1YM1 A;  4D2O A;  1BUL A;  1NJ4 A;  1NZU A;  5GHZ A;  1FR1 A;  3WS4 A;  3V50 A;  1KE0 A;  1IEM A;  3EQU A;  5KZH A;  1FQG A;  3MXS A;  1LHY A;  4OQH A;  2HDS A;  2ZLY A;  2HDQ A;  4KQO A;  1MPL A;  3Q07 A;  4BJP A;  4ZDX A;  4LV0 A;  3P98 A;  5E2G A;  4QHC A;  3OPL A;  4BD1 A;  3V5M A;  3ZVT A;  3LY3 A;  2BLS A;  3M6H A;  4ZJ1 A;  1TDG A;  1HZO A;  2P9V A;  2WUQ A;  2HDR A;  1W79 A;  1ESI A;  5IHV A;  2GDN A;  4JXV A;  3A3E A;  4MBF A;  4GOG A;  1MBL A;  5TFQ A;  3PBN A;  3GMW A;  4S2P A;  4U0T A;  2WZX A;  1SCW A;  5GL9 A;  1XGI A;  1ES2 A;  5FAQ A;  3HLD A;  4R23 A;  4FCF A;  5E2F A;  3BM6 A;  4JF6 A;  4QY6 A;  5CTM A;  3W4Q A;  4PM9 A;  1KGG A;  5CHJ A;  2Q9N A;  5GLB A;  3LY4 A;  1BUE A;  2XEP A;  1LLB A;  5HAP A;  2A49 A;  4OQ0 A;  3OPR A;  3Q7V B;  4UA6 A;  2I72 A;  4WM9 A;  3FWL A;  4BD0 A;  5FDH A;  3IHA A;  1PW8 A;  3S22 A;  4KZ4 A;  5CEB A;  5A93 A;  3C4P A;  2HDU A;  5JYP A;  3V3R A;  3MFD A;  5D3O A;  4PM5 A;  2WAD A;  2PU4 A;  3BEB A;  3IXB A;  4X53 A;  3ZG0 A;  4WEJ A;  3ISG A;  5TR7 A;  1IKG A;  1BSG A;  1RGY A;  1N9B A;  5FQJ A;  4IBX A;  1ESU A;  1HTZ A;  3CG5 A;  3IH9 A;  3O86 A;  4DXC A;  3C7V A;  4QB8 A;  5L2F A;  3M2J A;  4DE3 A;  3BLS A;  1DJA A;  5M19 A;  1N4O A;  2X02 A;  2ZC5 B;  3NCK A;  3N4I A;  4MBK A;  5DTS A;  4OH0 A;  3WWX A;  4R4S A;  2Y2G A;  5CEC A;  3ZG8 B;  5EUA A;  4A5R A;  2JCH A;  1PWG A;  1K57 C;  3AGE A;  3PAG A;  4OLD A;  2IWC A;  3BFE A;  2ZD8 A;  3FYZ A;  3UDX A;  4FSF A;  5HAQ A;  5CER A;  5U47 A;  5HAI A;  5EVL A;  1XA1 A;  3VP3 A;  4ZTK A;  5GLD A;  3IF5 A;  1YMX A;  1NZO A;  3SS5 A;  4S2K A;  5E2H A;  1IYS A;  4BL3 A;  4OQI A;  5FQI A;  5TGF A;  1FSW A;  4KG2 A;  4GDN A;  4NK3 A;  4LV3 A;  3UN7 A;  4UA9 A;  3LO7 A;  3SH7 A;  3O3V A;  1JWP A;  2ZC3 B;  4FH4 A;  4EBL A;  3ZG5 A;  3O87 A;  3TOI A;  2WKH A;  4H8R A;  2V20 A;  4GKU A;  2XD5 A;  3WRT A;  3HLE A;  2ZM0 A;  5GLC A;  3RXX A;  3TG9 A;  4DKI A;  5DTT A;  4GZB A;  1K56 D;  4WMC A;  5M18 A;  4OOM A;  1SHV A;  3BFF A;  4RX3 A;  4QU3 A;  2OSU A;  3GVB A;  4S2N C;  1RCJ A;  1BLH A;  4O7D A;  2XF3 A;  3W4O A;  3QHY A;  3GQZ A;  3FKW A;  5DTK A;  1J9M A;  2Z2L B;  1E3U A;  4DE0 A;  1H8Z A;  4DXB A;  2J8Y A;  3UY6 A;  3UO9 A;  3IH8 A;  4OKP A;  3UE0 A;  2P74 A;  4KG5 A;  2QPN A;  3Q1F A;  4XUZ A;  4RA7 A;  1CEG A;  3HLF A;  1EWZ A;  2DCF A;  3AGF A;  1GHM A;  4FD8 A;  5FAO A;  2FFF B;  3UE3 A;  4KZ3 A;  3UPO A;  4C75 A;  2J7V A;  2Z2M B;  1K54 C;  3D4F A;  4KQR A;  1PI4 A;  3VFH A;  3SH9 A;  3VSK A;  1ERO A;  3SOI A;  3SS4 A;  1K57 A;  4KZ5 A;  5KSC A;  4DRT A;  3S1Y A;  3ITB A;  4QD4 A;  4WEL A;  3G4P A;  3WRZ A;  1O07 A;  3MZF A;  3OPH A;  5EPH A;  1KE3 A;  1XA7 A;  1H8Y A;  5HAR A;  1ONG A;  4KEN B;  4R4R A;  1I5Q A;  3A3I A;  4PM7 A;  2XLN A;  4OP8 A;  1BLS A;  2HPB A;  4OPR A;  4E3O A;  4S2N A;  5EVI C;  3LEZ A;  1QME A;  3ZVW A;  1FSY A;  5CTN A;  2EFU A;  2QZ6 A;  2ZMA A;  2ZQA A;  3MXR A;  3VP4 A;  4P87 A;  2H5S A;  4GNU A;  5J8X A;  4HEF A;  4UA7 A;  1YT4 A;  1NXY A;  2WYX A;  1XP4 A;  4JPM A;  1L0F A;  3BEC A;  2QMI A;  4S2I A;  3G30 A;  3E2L A;  4DE1 A;  1XXM A;  3PAE A;  3WS5 A;  3WS0 A;  1IEL A;  3ZG7 B;  2JBF A;  1NRF A;  3N7W A;  4JLF A;  2ZM8 A;  1S0W A;  2Y2Q A;  5CGS A;  4JXW A;  1YLY A;  5EOE A;  5EOO A;  1I2S A;  1BT5 A;  1TEM A;  2XH9 A;  3OCN A;  4PM6 A;  3SS3 A;  5FQ9 A;  4N9K A;  3UNW A;  3BYD A;  3WS1 A;  4JF4 A;  1ONH A;  4M3K A;  4JKT A;  4WZ4 A;  3HLW A;  4EBN A;  1JVJ A;  1YMS A;  3PBR A;  3GTC A;  5EE8 A;  5FAP A;  5FSR A;  1FR6 A;  1W5D A;  4KZ9 A;  3AGD A;  4ZJ3 A;  1KGF A;  5CRF A;  1YLT A;  1IYP A;  3GR2 A;  5DF9 A;  3VSL A;  1K4F A;  3NI9 A;  2Y2H A;  2VGJ A;  1H5X A;  4E6X A;  4RVA A;  4UAA A;  1ZG4 A;  4OOY A;  1AXB A;  3VP1 A;  5A90 A;  1M6K A;  3N8L A;  1BTL A;  2ZQ7 A;  4R0Q A;  4BLM A;  3DWK A;  2V2F F;  4KZA A;  1GA0 A;  4EWF A;  1KVL A;  2Y2P A;  3PTE A;  3IWI A;  3NDE A;  2RL3 A;  3VFF A;  3VP0 A;  4GD8 A;  4EQI A;  1E25 A;  1OME A;  4R3B A;  4WYY A;  3IF6 C;  5FQK A;  3ZNY A;  1RGZ A;  3WS2 A;  4OPZ A;  4K0W A;  3S4X A;  2C5W B;  2Y2I A;  1Q2P A;  1K6R A;  4OQG A;  4KZ7 A;  3VMA A;  1IYQ A;  1PZP A;  1BLP A;  5JYO A;  1GCE A;  3HRE A;  3Q82 A;  4QY5 A;  1ZG6 A;  1YLZ A;  5FI7 A;  3VOZ A;  4GD6 A;  1CK3 A;  5CHU A;  4PMA A;  4WZ5 C;  3UPN A;  3ZNT A;  5F82 A;  4U3T A;  4B4Z A;  4BL2 A;  3G2Z A;  1Q2Q A;  5FQQ A;  3MZD A;  1U60 A;  2ZC7 A;  2WAE A;  3G32 A;  1YLP A;  4HES A;  3V3S A;  2Y91 A;  2J9P A;  4QJG A;  4P85 A;  4E6W A;  1ZKJ A;  2XFS A;  2ZQ8 A;  1BLC A;  5KMW A;  5F1G A;  2A3U A;  3W4P A;  4LCM A;  3FV7 A;  5CED A;  2EXA A;  2WK0 A;  1CEF A;  4LCL A;  4L0L A;  1ES5 A;  1G6A A;  4HBU A;  1PYY A;  4OOL A;  2R9W A;  4DF6 A;  4OPQ A;  5CHM A;  4C6Y A;  4Y0T A;  4E3N A;  1DJB A;  1MWS A;  1HD8 A;  1FOF A;  4C3Q A;  4GB7 A;  1YQS A;  3IT9 A;  3BFD A;  3C7U A;  4U0X A;  3TSG A;  3I7J A;  5HFO A;  1FCN A;  1WYB A;  3HUM A;  3Q7Z A;  4WZ5 A;  1QMF A;  4DDS A;  3A3D A;  4K0X A;  3BFG A;  4ZJ2 A;  3LCE A;  4MEZ A;  5DF8 A;  2RCX A;  3ZFZ A;  2HP9 A;  2WGW B;  5AQ9 A;  4E3I A;  5HL1 A;  2EFX A;  1VM1 A;  3PBQ A;  4BEN A;  3JYI A;  1IKI A;  3E2K A;  4PM8 A;  5G18 A;  4KZ8 A;  3HLG A;  4NET A;  3MKE A;  3UDF A;  1KGE A;  2XQZ A;  1XGJ A;  1K25 A;  3ZGA B;  2Y59 A;  4X6T A;  1ZC2 A;  5BOH A;  4EUZ A;  3IF6 A;  1K55 A;  3W8K A;  1Y54 A;  1KDW A;  5DVA A;  5FAT A;  2WZZ A;  4KZ6 A;  2Y2O A;  4Y0U A;  1E3U D;  4MNR A;  3IXD A;  1NYM A;  2Y2M A;  5I94 A;  3DW0 A;  3RJU A;  4Z9Q A;  4OLG A;  2JC7 A;  2X71 A;  4ZBE A;  1YLJ A;  2Y55 A;  3IQA A;  4YIN A;  3G2Y A;  2HP6 A;  3G31 A;  3MKF A;  1NY0 A;  2XK1 A;  4KQQ A;  4Q8I A;  5GHY A;  3GV9 A;  3PBO A;  4P6B A;  1GHP A;  1WE4 A;  1XKZ A;  1ERM A;  4N92 A;  3BRM A;  4XUX A;  1PI5 A;  3FZC A;  2ZM2 A;  3PBS A;  1SKF A;  2WGV A;  3OCL A;  1NYY A;  1HVB A;  4R1G A;  4E3J A;  2B5R A;  3HL9 A;  1GA9 A;  3NDG A; 
#chains in the Genus database with same CATH topology
 5GLA A;  4MDZ A;  3IX3 A;  1S6R A;  4GLQ A;  1KE4 A;  4YNR A;  2ZC4 B;  1D06 A;  3VP2 A;  3QNC A;  4E3M A;  3PHY A;  1CI9 A;  1PWD A;  2G2W A;  5FQM A;  1TDL A;  5J4E A;  2W3E A;  3UB9 A;  1G68 A;  2X01 A;  1L0E A;  5FI6 A;  1D7E A;  2WGI A;  4Y13 A;  4N1X A;  2ZQD A;  5FA7 A;  4X68 A;  4LEN A;  2QWS A;  3E98 A;  3NOP C;  3DWZ A;  4KZB A;  1MC0 A;  3N8S A;  2VV6 A;  1C3B A;  2EWV A;  4R3J A;  5TBM A;  1K55 C;  4OVD A;  5EVI A;  2ZQ9 A;  5M1A A;  2KOI A;  2GJ3 A;  2ZL1 A;  3G35 A;  3BQ8 A;  1MXO A;  1KVM A;  5DF7 A;  2WAF A;  4JBF A;  5AQA A;  4WMC D;  1GSX A;  2R9X A;  4RYE A;  3IXH A;  3K3D A;  3NY4 A;  5A92 A;  4JXS A;  4GS9 A;  2P9V B;  1RP5 A;  3ZDJ A;  2CMN A;  2V8C A;  4ARZ A;  2PT7 A;  3CPT B;  4KG6 A;  1ES3 A;  4BQM A;  1ZHH B;  5G4Z A;  1Z09 A;  1DJC A;  2WGW A;  4Q0H A;  2JKR M;  3N8R A;  2WKI A;  5AJG A;  3BLM A;  5AQB A;  1NLZ A;  2UV0 E;  3T4L A;  4DE2 A;  1MWT A;  2Y2J A;  3HLC A;  4GN2 A;  3PXP A;  1PWC A;  3A3F A;  3B3X A;  1K6S A;  2Y4A A;  3NBL A;  1H0M A;  2VKS A;  2Y2N A;  1F98 A;  3ULF A;  4Y0O A;  1DY6 A;  3MBZ A;  1IYO A;  1BUL A;  1NZU A;  5GHZ A;  1G5U A;  4FUW A;  3EQU A;  1FQG A;  2GX5 A;  1TD5 A;  1LHY A;  2ZLY A;  1PNE A;  1MPL A;  3Q07 A;  3IBJ A;  4LV0 A;  3P98 A;  2VA0 A;  3ZVT A;  3M6H A;  1TDG A;  2GDN A;  3A3E A;  1N9O A;  5TFQ A;  3G6O A;  4S2P A;  4U0T A;  4B93 A;  1SCW A;  3E4Q A;  1S4S A;  3HLD A;  4MN7 A;  3BM6 A;  4QY6 A;  5GLB A;  4UA6 A;  3OPR A;  3F1N A;  4BD0 A;  1PW8 A;  4HJ3 A;  4FTX A;  3EGX C;  4X53 A;  1J3W A;  3ZG0 A;  1IKG A;  1RGY A;  1GSV A;  1N9B A;  3CHW P;  4X25 A;  4G3K A;  4IBX A;  3QP1 A;  3M2J A;  5M19 A;  2X02 A;  3NCK A;  3N4I A;  4MBK A;  3C2W A;  4OH0 A;  3WWX A;  1PWG A;  5TJJ A;  4FSF A;  3VP3 A;  5HDC A;  3IF5 A;  1OTA A;  3LR3 A;  4KG2 A;  4GDN A;  3UN7 A;  3SH7 A;  1JWP A;  2VZW A;  1OTB A;  3ZG5 A;  4I3A A;  5DJU A;  2V20 A;  4GKU A;  3T1Q B;  3RXX A;  1K56 D;  3T1S A;  4S2N C;  4O8G A;  3GQZ A;  5DTK A;  4Q0I A;  2P74 A;  3H82 B;  3F1O B;  3AGF A;  4FD8 A;  3D4F A;  4KQR A;  2QHK A;  3SOI A;  1L3L A;  1K57 A;  5KSC A;  4DRT A;  2YKF A;  3ITB A;  4WN5 A;  3E0Y A;  1O07 A;  3VV4 A;  1KE3 A;  1H8Y A;  2PYP A;  1I5Q A;  4QPR A;  1LSX A;  4OPR A;  4S2N A;  3ZVW A;  1QME A;  1W63 M;  2ZMA A;  3OLO A;  1TS0 A;  1YT4 A;  2B02 A;  4S2I A;  1T1C A;  3WS0 A;  1IEL A;  3ZG7 B;  3N7W A;  4JLF A;  2ZM8 A;  4PHT A;  1TEM A;  3T1X A;  2XH9 A;  4PM6 A;  3SS3 A;  5FQ9 A;  3UNW A;  1CQA A;  1ONH A;  4Y15 A;  4JKT A;  4RQ9 A;  1JVJ A;  3CUE C;  3V67 A;  5FSR A;  5EE8 A;  3AGD A;  4Y3I A;  2Y2H A;  2ZMF A;  4UAA A;  1ZG4 A;  1AXB A;  1BTL A;  2HV1 A;  2V2F F;  3KX0 X;  3NDE A;  4GD8 A;  4R3B A;  3IF6 C;  5FQK A;  1RGZ A;  4DJ3 A;  4K0W A;  1WA9 A;  5DKL A;  2KX6 A;  1Q2P A;  1K6R A;  4KZ7 A;  3C38 A;  4GJ4 A;  3KO6 A;  1BLP A;  1GCE A;  3Q82 A;  4B9O A;  5HWT A;  1H8M A;  2YKH A;  4BL2 A;  3UPN A;  2W1T A;  3MZD A;  2WAE A;  1S1Y A;  4IUK A;  2A3U A;  4I38 A;  1F5M A;  2EXA A;  1CEF A;  2VV7 A;  1ES5 A;  1G6A A;  4HBU A;  4OOL A;  1YPR A;  4OPQ A;  4HP9 A;  4C6Y A;  4E3N A;  1DJB A;  2QKP A;  1FOF A;  1YQS A;  3MMH A;  1WYB A;  4WZ5 A;  2JN7 A;  3LCE A;  5DF8 A;  2RCX A;  1VM1 A;  3PBQ A;  5G18 A;  3JYI A;  3HLG A;  1LL8 A;  2Y59 A;  3RH8 B;  3IX8 A;  3LYX A;  5TBM B;  2V0W A;  2Y2O A;  4HH3 A;  5L07 A;  1NYM A;  3RJU A;  4Z9Q A;  5L8M A;  4WL9 A;  3G2Y A;  4EEP A;  4KQQ A;  1XKZ A;  4XUX A;  2HJ9 C;  2ZM2 A;  4I39 A;  1HVB A;  2P7J A;  4E3J A;  1XFN A;  2B5R A;  3LGO A;  2XSS A;  5EM0 A;  3WRT A;  2CC1 A;  2VGL S;  2FFY A;  3IWO A;  1XPB A;  3ZHH A;  5E43 A;  1OTE A;  1PZO A;  1MY8 A;  5F6A A;  1NRJ A;  4B4X A;  4XXR A;  2ZC6 B;  4L9F A;  1K4E A;  3FKV A;  4HBT A;  3EQV A;  3T4K A;  4ZAM A;  2GZA A;  1K38 A;  4X55 A;  2OWH A;  3UB7 A;  2J3W A;  3ZG9 B;  3A3J A;  2XDM A;  3A0S A;  4LRY C;  3VE4 A;  2KDK A;  3SH8 A;  4X69 A;  3CPT A;  2KLI A;  3HLB A;  1JTD A;  3F1P A;  4F94 A;  3GRJ A;  1GHI A;  3V39 A;  1DP8 A;  3H9W A;  3O88 A;  3NC8 A;  2W3F A;  1ES4 A;  3T4Q A;  4IVK A;  2H0T A;  3OC2 A;  5L10 A;  2JE5 A;  1FCM A;  1ALQ A;  3ZCZ A;  1W7F A;  4IED A;  2ACG A;  3BWL A;  3DTM A;  4JXG A;  2IWB A;  2R78 A;  1W8Q A;  1PIO A;  2VGK A;  4N9L A;  3Q81 A;  3A0V A;  2PD8 A;  3VOY A;  1KDS A;  5F83 A;  3GSG A;  4Z1W A;  1XJ2 A;  4EV4 A;  3B33 A;  1SDN A;  4MBH A;  3N6I A;  5F1F A;  1E4D A;  3OBF A;  1GSW A;  2XRN A;  4K91 A;  2V9A A;  3BQA A;  2V1B A;  5IT5 A;  4EQ1 A;  5FI2 A;  2V0U A;  3UE1 A;  2G2U A;  1Z6F A;  4WLA A;  1M40 A;  5CXW A;  4OPY A;  4S2L A;  2DNS A;  5EEC A;  3S7P A;  3NIA A;  3UDI A;  4N1H A;  2XR0 A;  1TS6 A;  4YFM A;  5A91 A;  2PBY A;  1TS7 A;  5AVF A;  1YM1 A;  4F3L A;  3UB8 A;  3WS4 A;  1KE0 A;  4OQH A;  2HDS A;  4HJ6 A;  3OPL A;  2WUQ A;  5HL6 A;  3DTK A;  4GOG A;  3UB6 A;  1XJ6 A;  4I3J A;  2WZX A;  5FAQ A;  4FCF A;  5E2F A;  2HZ5 A;  5CTM A;  3W4Q A;  4DMZ A;  5FDS A;  3LY4 A;  1BUE A;  2XEP A;  5DFX A;  2I72 A;  3S22 A;  5CEB A;  3C4P A;  2HDU A;  3V3R A;  4LFU A;  4PM5 A;  2WAD A;  3IXB A;  3MQO A;  1BSG A;  3IH9 A;  4DXC A;  3MJQ A;  5L2F A;  2ZMV A;  1W63 Q;  1N4O A;  3EOI A;  2ZC5 B;  5DTS A;  2Y2G A;  3SW1 A;  3ZG8 B;  5EUA A;  1XJ4 A;  1K57 C;  3AGE A;  3UME A;  3NEC A;  3UDX A;  4JGR A;  2PDR A;  3NOU C;  3CWF A;  3CUE A;  1XA1 A;  5GLD A;  4HI4 A;  1YMX A;  3UE6 A;  4S2K A;  3DTI A;  1FSW A;  1P9W A;  4UA9 A;  3LO7 A;  1VEU B;  5IS1 A;  4EET B;  4H8R A;  4LGW A;  2XD5 A;  3QP4 A;  5DTT A;  4P6Z S;  1RCJ A;  1BLH A;  4O7D A;  2J3T C;  3QHY A;  3FKW A;  2Z2L B;  1UGU A;  4OKP A;  2O0Y A;  3Q1F A;  4RA7 A;  2JKR I;  2DCF A;  3L7H A;  2J7V A;  2Z2M B;  3VSK A;  2JKT I;  1ERO A;  4KZ5 A;  3S1Y A;  3G4P A;  3WRZ A;  4PAU A;  3MZF A;  2HF6 A;  2DMW A;  1XA7 A;  5HAR A;  1ONG A;  4KEN B;  1FIL A;  3A3I A;  2A24 A;  4OP8 A;  2HPB A;  4E3O A;  3LEZ A;  1VET A;  2EFU A;  2QZ6 A;  4P87 A;  5HPF A;  4CLC E;  4GNU A;  4WF0 A;  4UA7 A;  2VJW A;  1XP4 A;  4JPM A;  4R3A A;  4IHQ A;  2QMI A;  4LRX C;  3G30 A;  4M4X A;  1UWP X;  2OOL A;  3LIA A;  2JBF A;  1NRF A;  5EOE A;  3QP8 A;  3EGD C;  2J3T D;  4O01 A;  4M3K A;  1XJ3 A;  3P01 A;  3BY9 A;  1S66 L;  3GTC A;  5FAP A;  1FR6 A;  1W5D A;  5DF9 A;  5CRF A;  1YLT A;  3S7N A;  3VSL A;  3T12 B;  4E6X A;  3NOT C;  4WUJ A;  3VP1 A;  5A90 A;  4Q0J A;  4NEE D;  4EWF A;  4P6Z M;  2Y2P A;  4BBV A;  1E25 A;  1OME A;  4WYY A;  3ZNY A;  2O9B A;  4H6J B;  1JNU A;  2ZL1 B;  2Y2I A;  1S1Z A;  3VOL A;  2VX8 A;  3MXQ A;  3QP2 A;  1MZU A;  3U2A A;  3LID A;  5JYO A;  5DFY A;  1ZG6 A;  1A0K A;  3VOZ A;  4L9E A;  3H7W A;  5CHU A;  4PMA A;  5F82 A;  2VGL M;  4U3T A;  5HWW A;  3G2Z A;  1Q2Q A;  1U60 A;  3G32 A;  3IBR A;  4HES A;  3FC7 A;  4E6W A;  2XFS A;  5EFW A;  1OJ5 A;  4UQI M;  5F1G A;  3W4P A;  5CED A;  4LCL A;  5CHM A;  5HD5 A;  3IT9 A;  3VE3 A;  1OTD A;  3I7J A;  4HP4 A;  5HFO A;  4GW9 A;  1T1A A;  5FEF A;  3K3C A;  3T50 A;  3ZFZ A;  2HP9 A;  5AQ9 A;  4E04 A;  4E3I A;  5HL1 A;  1IKI A;  4PM8 A;  2QJ7 A;  3UDF A;  1KGE A;  2XQZ A;  3B47 A;  1LSW A;  3ZGA B;  1ZC2 A;  1K55 A;  1Y54 A;  5FAT A;  1CF0 A;  1SKO B;  4Y0U A;  4HQA A;  3S7Q A;  3IXD A;  5I94 A;  2PR6 A;  4OLG A;  2X71 A;  2Y55 A;  4UEY A;  3NHQ A;  2HP6 A;  1NY0 A;  1OPX A;  4Q8I A;  5GHY A;  3PBO A;  4P6B A;  1WE4 A;  4N92 A;  3PBS A;  4R1G A;  4HHD A;  3HL9 A;  1GA9 A;  3NDG A;  5HPI A;  2WKE A;  5G4Y A;  5HW3 A;  1W8Y A;  4NXB A;  3CIT A;  4YOF A;  3ITA A;  2H0Y A;  3CMZ A;  2EWW A;  4X1M A;  4I5S A;  4LV1 A;  4JGQ A;  2NUT C;  4R6L A;  2P08 A;  5FAS A;  4O0P A;  3CJM A;  4FH2 A;  3G34 A;  4S2M A;  5EVI B;  1L0D A;  2C6W B;  2OLV A;  3LIC A;  3JVU A;  2QJ5 A;  2BG1 A;  1BZA A;  1BYW A;  1S67 L;  2PHY A;  1K54 A;  3MFX A;  1TF1 A;  4YWZ A;  3P09 A;  1JWZ A;  1IOU A;  4B88 A;  3D9Y A;  2Q9M A;  1I2W A;  2OLU A;  2UWX A;  1XX2 A;  5KSH A;  3M6B A;  4NXE A;  2PYR A;  1MWU A;  1DP6 A;  1VQQ A;  4BWI A;  4CLC C;  2EX6 A;  4IBR A;  1PW1 A;  3LR4 A;  3BFC A;  4GDB A;  3C5A A;  3R7W A;  3OPP A;  4QWO A;  3F1P B;  1TVF A;  4MLL A;  2A24 B;  5AVE A;  4HNB A;  3KYQ A;  1JWV A;  1YKD A;  2E8I A;  1FIK A;  4CJN A;  4EW7 A;  3IHB A;  4PPR A;  4DJ2 A;  1VEU A;  3KSG A;  2EX2 A;  3TRC A;  4S2J A;  3C30 A;  2D01 A;  2JKF A;  4CPK A;  2BAS A;  3HVF A;  3RTY A;  1O7E A;  5E2E A;  3CZD A;  2G7U A;  1EI5 A;  4Y5F A;  1NWZ A;  3HUN A;  4EBP A;  4LV2 A;  4D2O A;  1NJ4 A;  1FR1 A;  3T1R A;  3V50 A;  3EEH A;  1IEM A;  1MKM A;  1ZTU A;  4KQO A;  4ZDX A;  3V5M A;  3LY3 A;  3KSF A;  2BLS A;  4ZJ1 A;  1HZO A;  2P9V A;  1T19 A;  1W79 A;  4JXV A;  1MBL A;  3IX4 A;  3GMW A;  3HJI A;  2O9C A;  5GL9 A;  1XGI A;  3BW6 A;  1ES2 A;  4ETX A;  2L4R A;  2ZBB A;  1KGG A;  2Q9N A;  1N9N A;  1LLB A;  5HAP A;  2A49 A;  4OQ0 A;  4WM9 A;  3FWL A;  4EER A;  4KZ4 A;  1VHM A;  2E8J A;  2JKT M;  4GS9 B;  3O5Y A;  4WEJ A;  3ISG A;  1SKO A;  5FQJ A;  1ESU A;  3O86 A;  4QB8 A;  4G3W A;  3TE8 A;  3PYP A;  4R4S A;  4OLD A;  5C5K A;  4EUV A;  2IWC A;  3BFE A;  4K08 A;  5HAQ A;  5U47 A;  1N9L A;  3LR5 A;  4ZTK A;  1NZO A;  5E2H A;  2ZOH A;  1IYS A;  3DBA A;  4OQI A;  5TGF A;  4NK3 A;  4LV3 A;  4KUO A;  3NJA A;  4AFI A;  4GHI A;  4EBL A;  4CLC A;  3O87 A;  3TOI A;  2W0N A;  2WKH A;  5DJT A;  3ICY A;  3HLE A;  2ZM0 A;  5GLC A;  3TG9 A;  4DKI A;  4GZB A;  5M18 A;  4IUH A;  3NUL A;  4OOM A;  4QU3 A;  1Y28 A;  2XF3 A;  1F2K A;  1J9M A;  4DE0 A;  3UE0 A;  3P7N A;  2QPN A;  1KOU A;  1EWZ A;  2M1C A;  1GHM A;  3UE3 A;  4KZ3 A;  3UPO A;  3UMD A;  5EV0 A;  4KQD A;  1PI4 A;  3VFH A;  4Y2F A;  5L09 A;  3SS4 A;  5CX7 A;  2BTF P;  4WEL A;  3D72 A;  3T4S A;  2PRF A;  5EPH A;  5K5B A;  4Y17 A;  4PM7 A;  1BLS A;  5HDD A;  5EVI C;  4MMN A;  2K31 A;  4EXO A;  4JGP A;  3VP4 A;  3MXR A;  5J8X A;  2WYX A;  1L0F A;  2OWJ A;  3E2L A;  3BY8 A;  1XXM A;  3T4J A;  4PKY G;  1S0W A;  3W2Z A;  5CGS A;  4JXW A;  5EOO A;  1BT5 A;  3OCN A;  1YSP A;  3WS1 A;  3E4O A;  1YMS A;  3KSH A;  3PBR A;  3LUQ A;  1IFQ A;  1KGF A;  3GR2 A;  2VGJ A;  3LI8 A;  4L9G A;  2M7V A;  4OOY A;  2VEA A;  1M6K A;  3N8L A;  3MF0 A;  3DWK A;  4KZA A;  2FH5 A;  3IWI A;  2PD7 A;  4EQI A;  4OPZ A;  3S4X A;  2JKG A;  3CLO A;  2C5W B;  1DP9 A;  3HRE A;  3L9K A;  4QY5 A;  5EVE A;  5FI7 A;  4XT2 B;  4GD6 A;  1CK3 A;  1ODV A;  4WZ5 C;  3ZNT A;  4B4Z A;  2EA9 A;  5MC7 A;  2B95 A;  1YLP A;  1XFQ A;  2HJE A;  4P85 A;  4QJG A;  5IU1 A;  1ZKJ A;  1BLC A;  1K0K A;  1YAX A;  2WK0 A;  2Y79 A;  1PYY A;  4GHI B;  4DF6 A;  4JGO A;  5I5L A;  3T4T A;  4Y0T A;  4GCZ A;  4GB7 A;  4I3I A;  3BFD A;  1VET B;  3R4K A;  1FCN A;  3HCY A;  1QMF A;  4DDS A;  4K0X A;  3BFG A;  4MEZ A;  3SZT A;  2EFX A;  4BEN A;  2K2N A;  4KZ8 A;  3MKE A;  1K25 A;  4X6T A;  3BJN A;  4EUZ A;  5DKK A;  2W1R A;  3W8K A;  1KDW A;  3QP6 A;  2WZZ A;  3KYZ A;  2GNX A;  3DW0 A;  1UWN X;  1G6O A;  2PR5 A;  1YLJ A;  3IQA A;  2B18 A;  4YIN A;  3MKF A;  3GEC A;  1GHP A;  1ERM A;  2INW A;  5J3W A;  1PI5 A;  3FZC A;  1SKF A;  3OCL A;  1LSV A;  2XA7 M;  1CEG A;  2HP5 A;  4NKP A;  3QP5 A;  3LIE A;  4DDY A;  3PBT A;  5GHX A;  2EX9 A;  2PBD P;  4IVI A;  2ZJ9 A;  4E3K A;  4P0M A;  2V1Z A;  3MZE A;  2H10 A;  1MWR A;  3IXG A;  3HBR A;  3Q7V A;  3U4L P;  3M2K A;  4UHU A;  4BBT A;  3C4O A;  4WBG A;  3EWK A;  4KUK A;  1SDE A;  4JF5 A;  1MKI A;  4ID4 A;  1L0G A;  4FOF A;  2VLG A;  3OZH A;  2WKQ A;  3GDI A;  1LL5 A;  5FEG A;  4RX2 A;  4LLO B;  1T1B A;  4S2O A;  4ZRR A;  4X56 A;  2PU2 A;  1V9Y A;  3IF6 B;  1TS8 A;  4HOI A;  2J80 A;  2J9O A;  2EX8 A;  2EXB A;  1LI0 A;  3UPP A;  1FCO A;  1JTG A;  5CGW A;  2NUP C;  4X1L A;  1PFL A;  1K56 A;  3JPU A;  4E3L A;  1F9I A;  5F69 A;  1CJF A;  4WEK A;  2PAV P;  5A8B A;  1LI9 A;  2DRW A;  4R38 A;  2VV8 A;  2XGN A;  2Y2L A;  3JVV A;  2ZQC A;  3MS6 A;  1V9Z A;  4Y7P A;  2XFT A;  5EVI D;  3QNB A;  3HUO A;  2Y2K A;  4EU0 A;  5CGX A;  1CI8 A;  5HX9 A;  1LL9 A;  2IWD A;  2OV5 A;  2OAP 1;  5J7E A;  1WYC A;  1ERQ A;  1YLW A;  3IWQ A;  3ZYT A;  5AQ7 A;  2OAQ 1;  4MN6 A;  4OON A;  3K2N A;  5F68 A;  1T18 A;  5EM1 A;  2D02 A;  4R70 A;  4OP5 A;  3H7W B;  2Z6D A;  5F5Y A;  1L2S A;  1SZV A;  3RXW A;  2XD1 A;  2QYB A;  5KZH A;  3FPW A;  4F3L B;  3MXS A;  2HDQ A;  4BJP A;  4UQI S;  5E2G A;  4QHC A;  4BD1 A;  2HDR A;  1ESI A;  5IHV A;  2LB5 A;  3CAX A;  4MBF A;  3TJZ C;  1X0O A;  4NG2 A;  3T4O A;  3PBN A;  3RFB A;  4R23 A;  3KYE A;  4JF6 A;  4PM9 A;  4H6J A;  5CHJ A;  4G3V A;  2W27 A;  3Q7V B;  1AWI A;  4DN0 A;  1PRQ A;  3LFV A;  1H3Q A;  3IHA A;  2O99 A;  5FDH A;  3OOV A;  3LIF A;  5A93 A;  5HWV A;  5JYP A;  3MFD A;  5D3O A;  2Y8H A;  2W1T B;  2K7S A;  4LRZ E;  2PU4 A;  3BEB A;  2Z6C A;  1EW0 A;  5TR7 A;  1HTZ A;  3CG5 A;  2WKR A;  3C7V A;  4MCW A;  1P9R A;  3TW8 A;  4DE3 A;  3BLS A;  3DTE A;  1DJA A;  5CEC A;  4II7 A;  2I9V A;  4A5R A;  2JCH A;  3PAG A;  3FYZ A;  2ZD8 A;  5CER A;  3F1O A;  5HAI A;  5EVL A;  5HDS A;  3LR0 A;  1STZ A;  2WKP A;  4HH2 A;  3SS5 A;  1DRM A;  3D3O A;  2V1A A;  4BL3 A;  5FQI A;  2L1M A;  3O3V A;  2ZC3 B;  4FH4 A;  4NXG A;  3DAV A;  1P97 A;  4EEU A;  4WMC A;  4CLC B;  4ESP A;  1SHV A;  3BFF A;  4RX3 A;  2OSU A;  3GVB A;  2JHE A;  3B42 A;  3W4O A;  1E3U A;  1H8Z A;  4DXB A;  2J8Y A;  1OJG A;  3UY6 A;  3UO9 A;  3IH8 A;  2P04 A;  4KG5 A;  5KIZ A;  2H28 A;  4XUZ A;  2XRO A;  3HLF A;  2AVX A;  2HGV A;  3HJK A;  5FAO A;  2FFF B;  4C75 A;  1K54 C;  3SH9 A;  5FL3 A;  1OT6 A;  4QD4 A;  3A0R A;  3OPH A;  1S4R A;  3IS2 A;  4R4R A;  2A2L A;  3MQQ A;  2MJ6 A;  2XLN A;  3MQ0 A;  3H82 A;  1FSY A;  5CTN A;  4LPZ A;  3R7W B;  2ZQA A;  3E4P A;  4D60 A;  4PKY A;  2H5S A;  3UB5 P;  4HEF A;  1NXY A;  3BEC A;  4DE1 A;  3PAE A;  4CLC D;  3WS5 A;  3F1N B;  2Q0O A;  2Y2Q A;  1G28 A;  3FG8 A;  1YLY A;  1I2S A;  4N9K A;  3BYD A;  4JF4 A;  2VK3 A;  4WZ4 A;  3HLW A;  4EBN A;  3MSH A;  2XA7 S;  3MR0 A;  4IJG A;  3LI9 A;  4KZ9 A;  4ZJ3 A;  1IYP A;  2W3G A;  1K4F A;  3NI9 A;  1H5X A;  4RVA A;  2W3H A;  4CQH A;  2ZQ7 A;  3IS2 B;  4R0Q A;  4BLM A;  1GA0 A;  1KVL A;  3VFF A;  3VP0 A;  1D1J A;  2RL3 A;  3CI6 A;  5HSQ A;  1HLU P;  3WS2 A;  1ACF A;  4OQG A;  3VMA A;  1IYQ A;  4ME4 A;  1PZP A;  2M7U A;  1OT9 A;  3C8C A;  1YLZ A;  3LEQ A;  5FQQ A;  2ZC7 A;  4XT2 A;  5HD3 A;  3V3S A;  2Y91 A;  2J9P A;  4ETZ A;  2ZOI A;  2ZQ8 A;  5KMW A;  1P0Z A;  4LCM A;  3FV7 A;  2O9A A;  4L0L A;  2R9W A;  1LT0 A;  4ARZ B;  3FPV A;  1MWS A;  1HD8 A;  2FZ0 A;  4C3Q A;  2L0W A;  3C7U A;  4U0X A;  3TSG A;  2W3D A;  3Q7Z A;  3HUM A;  3A3D A;  3ZQ5 A;  3LIB A;  4ZJ2 A;  5LBR A;  2IA2 A;  2WGW B;  3E2K A;  3PR6 A;  4NET A;  3S7O A;  1XGJ A;  5BOH A;  3IF6 A;  4NXF A;  5DVA A;  3EEA A;  5HZH A;  4KZ6 A;  1E3U D;  4MNR A;  1YSQ A;  2Y2M A;  1VB6 A;  2JC7 A;  1OTI A;  4EES A;  4ZBE A;  2V8F A;  3KSI A;  3G31 A;  4BBU A;  4BMW A;  4HY8 A;  2LB9 A;  2XK1 A;  4MN5 A;  3GV9 A;  1NLY A;  3BRM A;  4HJ4 A;  4HIA A;  2WGV A;  1NYY A;  1Y4O A;  3PTE A; 
#chains in the Genus database with same CATH homology
 5GLA A;  2CC1 A;  2HP5 A;  2FFY A;  3IWO A;  2WKE A;  1XPB A;  3ZHH A;  5E43 A;  5HW3 A;  1S6R A;  4DDY A;  1W8Y A;  3PBT A;  5GHX A;  1KE4 A;  1PZO A;  1MY8 A;  2EX9 A;  4B4X A;  2ZC4 B;  3ITA A;  4IVI A;  2H0Y A;  4XXR A;  3VP2 A;  2ZJ9 A;  4E3K A;  2ZC6 B;  3CMZ A;  3QNC A;  4P0M A;  1K4E A;  3FKV A;  2V1Z A;  3MZE A;  4HBT A;  4LV1 A;  2H10 A;  1MWR A;  3EQV A;  3IXG A;  4E3M A;  1CI9 A;  1PWD A;  5FAS A;  4ZAM A;  3HBR A;  3Q7V A;  2G2W A;  1K38 A;  5FQM A;  1TDL A;  3CJM A;  3M2K A;  4X55 A;  4UHU A;  4FH2 A;  3C4O A;  1G68 A;  3G34 A;  4S2M A;  3ZG9 B;  4WBG A;  3A3J A;  5EVI B;  1SDE A;  2XDM A;  2X01 A;  1L0E A;  5FI6 A;  2WGI A;  4JF5 A;  1L0D A;  3SH8 A;  2C6W B;  4X69 A;  2OLV A;  4N1X A;  1MKI A;  4ID4 A;  3HLB A;  1JTD A;  2BG1 A;  1BZA A;  1L0G A;  1K54 A;  2ZQD A;  5FA7 A;  4X68 A;  4LEN A;  3GRJ A;  4F94 A;  1GHI A;  3V39 A;  3OZH A;  3DWZ A;  4KZB A;  3P09 A;  1JWZ A;  3O88 A;  1LL5 A;  3NC8 A;  1ES4 A;  4IVK A;  4RX2 A;  3N8S A;  2H0T A;  3OC2 A;  4S2O A;  1C3B A;  2JE5 A;  4B88 A;  4X56 A;  1FCM A;  2Q9M A;  4R3J A;  1ALQ A;  2PU2 A;  3ZCZ A;  1I2W A;  2OLU A;  3IF6 B;  1W7F A;  4IED A;  1K55 C;  4OVD A;  5EVI A;  2UWX A;  2ZQ9 A;  5M1A A;  1XX2 A;  2J9O A;  2EX8 A;  3G35 A;  2EXB A;  1LI0 A;  3M6B A;  3UPP A;  3DTM A;  1FCO A;  5KSH A;  1MXO A;  1KVM A;  1JTG A;  1MWU A;  4JXG A;  5CGW A;  5DF7 A;  2IWB A;  2WAF A;  4JBF A;  5AQA A;  1K56 A;  1VQQ A;  4WMC D;  4E3L A;  2R9X A;  4RYE A;  4WEK A;  1W8Q A;  1PIO A;  2VGK A;  3IXH A;  4N9L A;  3Q81 A;  2EX6 A;  1LI9 A;  4IBR A;  3NY4 A;  5A92 A;  1PW1 A;  4JXS A;  2DRW A;  3BFC A;  3VOY A;  1KDS A;  4GDB A;  5F83 A;  2XGN A;  3GSG A;  2P9V B;  2Y2L A;  3C5A A;  1RP5 A;  3OPP A;  4EV4 A;  2ZQC A;  4Y7P A;  1SDN A;  4MBH A;  3N6I A;  3ZDJ A;  5F1F A;  1E4D A;  2XFT A;  4K91 A;  1TVF A;  4MLL A;  5EVI D;  3QNB A;  3HUO A;  2Y2K A;  5CGX A;  1CI8 A;  5HX9 A;  4KG6 A;  1ES3 A;  4BQM A;  1JWV A;  1LL9 A;  5FI2 A;  2IWD A;  2OV5 A;  2E8I A;  4CJN A;  1WYC A;  3IHB A;  4PPR A;  3UE1 A;  1ERQ A;  1DJC A;  1YLW A;  2WGW A;  2G2U A;  3N8R A;  3IWQ A;  2WKI A;  2EX2 A;  3BLM A;  1Z6F A;  5AQ7 A;  5AQB A;  1M40 A;  5CXW A;  4S2J A;  4DE2 A;  1MWT A;  4OPY A;  4OON A;  2Y2J A;  3HLC A;  4GN2 A;  4S2L A;  2DNS A;  5EEC A;  4CPK A;  1PWC A;  3A3F A;  3B3X A;  1K6S A;  2Y4A A;  3HVF A;  3NBL A;  3NIA A;  4OP5 A;  3UDI A;  2Y2N A;  4N1H A;  2XR0 A;  1O7E A;  4YFM A;  5A91 A;  1L2S A;  5E2E A;  2PBY A;  3CZD A;  1EI5 A;  3RXW A;  2XD1 A;  4Y0O A;  3HUN A;  1DY6 A;  3MBZ A;  4EBP A;  1IYO A;  4LV2 A;  1YM1 A;  4D2O A;  1BUL A;  1NJ4 A;  1NZU A;  5GHZ A;  1FR1 A;  3WS4 A;  3V50 A;  1KE0 A;  1IEM A;  3EQU A;  5KZH A;  1FQG A;  3MXS A;  1LHY A;  4OQH A;  2HDS A;  2ZLY A;  2HDQ A;  4KQO A;  1MPL A;  3Q07 A;  4BJP A;  4ZDX A;  4LV0 A;  3P98 A;  5E2G A;  4QHC A;  3OPL A;  4BD1 A;  3V5M A;  3ZVT A;  3LY3 A;  2BLS A;  3M6H A;  4ZJ1 A;  1TDG A;  1HZO A;  2P9V A;  2WUQ A;  2HDR A;  1W79 A;  1ESI A;  5IHV A;  2GDN A;  4JXV A;  3A3E A;  4MBF A;  4GOG A;  1MBL A;  5TFQ A;  3PBN A;  3GMW A;  4S2P A;  4U0T A;  2WZX A;  1SCW A;  5GL9 A;  1XGI A;  1ES2 A;  5FAQ A;  3HLD A;  4R23 A;  4FCF A;  5E2F A;  3BM6 A;  4JF6 A;  4QY6 A;  5CTM A;  3W4Q A;  4PM9 A;  1KGG A;  5CHJ A;  2Q9N A;  5GLB A;  3LY4 A;  1BUE A;  2XEP A;  1LLB A;  5HAP A;  2A49 A;  4OQ0 A;  3OPR A;  3Q7V B;  4UA6 A;  2I72 A;  4WM9 A;  3FWL A;  4BD0 A;  5FDH A;  3IHA A;  1PW8 A;  3S22 A;  4KZ4 A;  5CEB A;  5A93 A;  3C4P A;  2HDU A;  5JYP A;  3V3R A;  3MFD A;  5D3O A;  4PM5 A;  2WAD A;  2PU4 A;  3BEB A;  3IXB A;  4X53 A;  3ZG0 A;  4WEJ A;  3ISG A;  5TR7 A;  1IKG A;  1BSG A;  1RGY A;  1N9B A;  5FQJ A;  4IBX A;  1ESU A;  1HTZ A;  3CG5 A;  3IH9 A;  3O86 A;  4DXC A;  3C7V A;  4QB8 A;  5L2F A;  3M2J A;  4DE3 A;  3BLS A;  1DJA A;  5M19 A;  1N4O A;  2X02 A;  2ZC5 B;  3NCK A;  3N4I A;  4MBK A;  5DTS A;  4OH0 A;  3WWX A;  4R4S A;  2Y2G A;  5CEC A;  3ZG8 B;  5EUA A;  4A5R A;  2JCH A;  1PWG A;  1K57 C;  3AGE A;  3PAG A;  4OLD A;  2IWC A;  3BFE A;  2ZD8 A;  3FYZ A;  3UDX A;  4FSF A;  5HAQ A;  5CER A;  5U47 A;  5HAI A;  5EVL A;  1XA1 A;  3VP3 A;  4ZTK A;  5GLD A;  3IF5 A;  1YMX A;  1NZO A;  3SS5 A;  4S2K A;  5E2H A;  1IYS A;  4BL3 A;  4OQI A;  5FQI A;  5TGF A;  1FSW A;  4KG2 A;  4GDN A;  4NK3 A;  4LV3 A;  3UN7 A;  4UA9 A;  3LO7 A;  3SH7 A;  3O3V A;  1JWP A;  2ZC3 B;  4FH4 A;  4EBL A;  3ZG5 A;  3O87 A;  3TOI A;  2WKH A;  4H8R A;  2V20 A;  4GKU A;  2XD5 A;  3WRT A;  3HLE A;  2ZM0 A;  5GLC A;  3RXX A;  3TG9 A;  4DKI A;  5DTT A;  4GZB A;  1K56 D;  4WMC A;  5M18 A;  4OOM A;  1SHV A;  3BFF A;  4RX3 A;  4QU3 A;  2OSU A;  3GVB A;  4S2N C;  1RCJ A;  1BLH A;  4O7D A;  2XF3 A;  3W4O A;  3QHY A;  3GQZ A;  3FKW A;  5DTK A;  1J9M A;  2Z2L B;  1E3U A;  4DE0 A;  1H8Z A;  4DXB A;  2J8Y A;  3UY6 A;  3UO9 A;  3IH8 A;  4OKP A;  3UE0 A;  2P74 A;  4KG5 A;  2QPN A;  3Q1F A;  4XUZ A;  4RA7 A;  1CEG A;  3HLF A;  1EWZ A;  2DCF A;  3AGF A;  1GHM A;  4FD8 A;  5FAO A;  2FFF B;  3UE3 A;  4KZ3 A;  3UPO A;  4C75 A;  2J7V A;  2Z2M B;  1K54 C;  3D4F A;  4KQR A;  1PI4 A;  3VFH A;  3SH9 A;  3VSK A;  1ERO A;  3SOI A;  3SS4 A;  1K57 A;  4KZ5 A;  5KSC A;  4DRT A;  3S1Y A;  3ITB A;  4QD4 A;  4WEL A;  3G4P A;  3WRZ A;  1O07 A;  3MZF A;  3OPH A;  5EPH A;  1KE3 A;  1XA7 A;  1H8Y A;  5HAR A;  1ONG A;  4KEN B;  4R4R A;  1I5Q A;  3A3I A;  4PM7 A;  2XLN A;  4OP8 A;  1BLS A;  2HPB A;  4OPR A;  4E3O A;  4S2N A;  5EVI C;  3LEZ A;  1QME A;  3ZVW A;  1FSY A;  5CTN A;  2EFU A;  2QZ6 A;  2ZMA A;  2ZQA A;  3MXR A;  3VP4 A;  4P87 A;  2H5S A;  4GNU A;  5J8X A;  4HEF A;  4UA7 A;  1YT4 A;  1NXY A;  2WYX A;  1XP4 A;  4JPM A;  1L0F A;  3BEC A;  2QMI A;  4S2I A;  3G30 A;  3E2L A;  4DE1 A;  1XXM A;  3PAE A;  3WS5 A;  3WS0 A;  1IEL A;  3ZG7 B;  2JBF A;  1NRF A;  3N7W A;  4JLF A;  2ZM8 A;  1S0W A;  2Y2Q A;  5CGS A;  4JXW A;  1YLY A;  5EOE A;  5EOO A;  1I2S A;  1BT5 A;  1TEM A;  2XH9 A;  3OCN A;  4PM6 A;  3SS3 A;  5FQ9 A;  4N9K A;  3UNW A;  3BYD A;  3WS1 A;  4JF4 A;  1ONH A;  4M3K A;  4JKT A;  4WZ4 A;  3HLW A;  4EBN A;  1JVJ A;  1YMS A;  3PBR A;  3GTC A;  5EE8 A;  5FAP A;  5FSR A;  1FR6 A;  1W5D A;  4KZ9 A;  3AGD A;  4ZJ3 A;  1KGF A;  5CRF A;  1YLT A;  1IYP A;  3GR2 A;  5DF9 A;  3VSL A;  1K4F A;  3NI9 A;  2Y2H A;  2VGJ A;  1H5X A;  4E6X A;  4RVA A;  4UAA A;  1ZG4 A;  4OOY A;  1AXB A;  3VP1 A;  5A90 A;  1M6K A;  3N8L A;  1BTL A;  2ZQ7 A;  4R0Q A;  4BLM A;  3DWK A;  2V2F F;  4KZA A;  1GA0 A;  4EWF A;  1KVL A;  2Y2P A;  3PTE A;  3IWI A;  3NDE A;  2RL3 A;  3VFF A;  3VP0 A;  4GD8 A;  4EQI A;  1E25 A;  1OME A;  4R3B A;  4WYY A;  3IF6 C;  5FQK A;  3ZNY A;  1RGZ A;  3WS2 A;  4OPZ A;  4K0W A;  3S4X A;  2C5W B;  2Y2I A;  1Q2P A;  1K6R A;  4OQG A;  4KZ7 A;  3VMA A;  1IYQ A;  1PZP A;  1BLP A;  5JYO A;  1GCE A;  3HRE A;  3Q82 A;  4QY5 A;  1ZG6 A;  1YLZ A;  5FI7 A;  3VOZ A;  4GD6 A;  1CK3 A;  5CHU A;  4PMA A;  4WZ5 C;  3UPN A;  3ZNT A;  5F82 A;  4U3T A;  4B4Z A;  4BL2 A;  3G2Z A;  1Q2Q A;  5FQQ A;  3MZD A;  1U60 A;  2ZC7 A;  2WAE A;  3G32 A;  1YLP A;  4HES A;  3V3S A;  2Y91 A;  2J9P A;  4QJG A;  4P85 A;  4E6W A;  1ZKJ A;  2XFS A;  2ZQ8 A;  1BLC A;  5KMW A;  5F1G A;  2A3U A;  3W4P A;  4LCM A;  3FV7 A;  5CED A;  2EXA A;  2WK0 A;  1CEF A;  4LCL A;  4L0L A;  1ES5 A;  1G6A A;  4HBU A;  1PYY A;  4OOL A;  2R9W A;  4DF6 A;  4OPQ A;  5CHM A;  4C6Y A;  4Y0T A;  4E3N A;  1DJB A;  1MWS A;  1HD8 A;  1FOF A;  4C3Q A;  4GB7 A;  1YQS A;  3IT9 A;  3BFD A;  3C7U A;  4U0X A;  3TSG A;  3I7J A;  5HFO A;  1FCN A;  1WYB A;  3HUM A;  3Q7Z A;  4WZ5 A;  1QMF A;  4DDS A;  3A3D A;  4K0X A;  3BFG A;  4ZJ2 A;  3LCE A;  4MEZ A;  5DF8 A;  2RCX A;  3ZFZ A;  2HP9 A;  2WGW B;  5AQ9 A;  4E3I A;  5HL1 A;  2EFX A;  1VM1 A;  3PBQ A;  4BEN A;  3JYI A;  1IKI A;  3E2K A;  4PM8 A;  5G18 A;  4KZ8 A;  3HLG A;  4NET A;  3MKE A;  3UDF A;  1KGE A;  2XQZ A;  1XGJ A;  1K25 A;  3ZGA B;  2Y59 A;  4X6T A;  1ZC2 A;  5BOH A;  4EUZ A;  3IF6 A;  1K55 A;  3W8K A;  1Y54 A;  1KDW A;  5DVA A;  5FAT A;  2WZZ A;  4KZ6 A;  2Y2O A;  4Y0U A;  1E3U D;  4MNR A;  3IXD A;  1NYM A;  2Y2M A;  5I94 A;  3DW0 A;  3RJU A;  4Z9Q A;  4OLG A;  2JC7 A;  2X71 A;  4ZBE A;  1YLJ A;  2Y55 A;  3IQA A;  4YIN A;  3G2Y A;  2HP6 A;  3G31 A;  3MKF A;  1NY0 A;  2XK1 A;  4KQQ A;  4Q8I A;  5GHY A;  3GV9 A;  3PBO A;  4P6B A;  1GHP A;  1WE4 A;  1XKZ A;  1ERM A;  4N92 A;  3BRM A;  4XUX A;  1PI5 A;  3FZC A;  2ZM2 A;  3PBS A;  1SKF A;  2WGV A;  3OCL A;  1NYY A;  1HVB A;  4R1G A;  4E3J A;  2B5R A;  3HL9 A;  1GA9 A;  3NDG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...