1YT4A

Crystal structure of tem-76 beta-lactamase at 1.4 angstrom resolution
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMGDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase TEM
publication title Structural Consequences of the Inhibitor-Resistant Ser130Gly Substitution in TEM beta-Lactamase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 97
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2005-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1yt4A00
2WGWA 4OPRA 2ZQCA 4EWFA 4E3OA 2R9WA 4UAAA 3G31A 3RJUA 5CEDA 4HEFA 1JWPA 4LCMA 2ZC6B 3UDFA 4EV4A 4E3NA 1NZOA 2WGIA 3A3IA 2H5SA 2C5WB 4JXSA 1XGJA 4BQMA 1ERMA 2Y55A 4BL2A 5HAPA 2XDMA 5FATA 2XR0A 1SHVA 2OLUA 5GHZA 3EQUA 3PBSA 3UPPA 1XA7A 2Z2MB 1M40A 4L0LA 3HUNA 5AQBA 4RX2A 3WS0A 3SS3A 4OP5A 1IEMA 4OPZA 5M18A 1ES5A 5TGFA 1CEFA 1XPBA 4OLGA 5DF9A 3PBOA 1TEMA 5A90A 3FKVA 5FQMA 1IKIA 1CEGA 1PWCA 3O86A 5FAPA 1FSYA 4C75A 2Y2MA 4PM7A 1MPLA 3DTMA 1BLHA 1JWVA 4DE0A 1YLPA 5HARA 2WGVA 1ZG6A 5CHMA 4ZDXA 3C4OA 1GHMA 1Q2QA 4S2JA 4DF6A 3IF5A 2XK1A 4Y0UA 3OC2A 3NY4A 4MBKA 2ZQ7A 3HUOA 5FQQA 3PTEA 1E25A 4GNUA 2ZLYA 1K6SA 1RCJA 4WEKA 3ZHHA 1ES4A 3ZG8B 1FR1A 3BFDA 3G32A 2WKIA 1MWTA 3DW0A 2Y2OA 2RL3A 4WYYA 4ZJ3A 4UA6A 5TR7A 4B88A 3W4QA 4BD1A 5DF8A 4S2OA 1ESUA 4E3LA 3OPPA 3IXHA 5EVID 2CC1A 4S2NC 3PBTA 2XFTA 4YINA 1W8QA 3MBZA 1PZOA 3RXXA 1VM1A 3PAEA 4R1GA 3CMZA 5E2GA 2WAFA 2B5RA 1W7FA 4P87A 4WZ5A 1K25A 4BLMA 3NCKA 4E3KA 1EI5A 2GDNA 2XLNA 2Y2QA 2ZD8A 4HBUA 3BM6A 2WZXA 3PBRA 4LENA 4FD8A 4DDSA 3IWQA 3VMAA 1DJBA 4FCFA 1K4FA 1BLCA 4UA9A 5A91A 1XGIA 2EX9A 3G4PA 4LCLA 3BFEA 3HBRA 3M6HA 4OKPA 2Z2LB 2ZC3B 1KVLA 4X53A 4IVKA 4FSFA 4ZAMA 3WRTA 2Q9NA 1ZG4A 2WAEA 2H0TA 4O7DA 2OLVA 4N9LA 4S2IA 3UE3A 2EX2A 2WZZA 3GVBA 4IVIA 4KZAA 1ES3A 1IYOA 3CZDA 1JVJA 5FI7A 3W4PA 4B4ZA 4OH0A 3VP2A 2ZC5B 1YLJA 3AGFA 4U0TA 4OP8A 3V5MA 5F82A 2G2UA 2WYXA 3NIAA 1TDGA 3HLCA 3OCNA 5GHXA 1YM1A 3ZNYA 5FA7A 1IYSA 3Q81A 2R9XA 3UO9A 3NDEA 1J9MA 3P09A 2FFYA 5EVLA 2ZM0A 5FQJA 2WKHA 1SCWA 2Y2JA 3WS2A 3QNBA 4X69A 3RXWA 5M19A 5G18A 4K91A 4NK3A 4DXBA 2VGJA 2QPNA 1LL9A 1S0WA 2J7VA 3IF6B 3GQZA 4P85A 1M6KA 3UY6A 1CK3A 1GA0A 5FAOA 3WRZA 3BLSA 3LY3A 4OONA 1PIOA 1LL5A 2Y2LA 3VFHA 4H8RA 3C4PA 5FASA 4X55A 3SH8A 4QD4A 5EOEA 2RCXA 2WKEA 5FI6A 4KZ8A 4KZ7A 4PM5A 1GCEA 3AGEA 3VOZA 5F1FA 5CHUA 1I5QA 1BLSA 1LHYA 1H8ZA 2EXAA 3M2JA 4KQRA 5GLBA 3LEZA 2X01A 4RVAA 3BECA 3S22A 5E2EA 3IWIA 1KDWA 2V2FF 4RA7A 3M6BA 2JC7A 3OPLA 4Y7PA 1K54C 3N8LA 2DCFA 3GV9A 3FKWA 1WE4A 4OOLA 5FQKA 1DJAA 1NZUA 4E6WA 4JF4A 1FOFA 4IBXA 4JXGA 3O87A 3UDXA 3ZG0A 4DKIA 4EUZA 4GOGA 5GHYA 4EQIA 3Q7VB 5AQ9A 4CPKA 1FCOA 4OQIA 3E2KA 4MNRA 2J9PA 1CI8A 1XP4A 1BLPA 2HP5A 2ZQ9A 5BOHA 3A3JA 3MKEA 1IYQA 4GD8A 3W4OA 1KE4A 1SDEA 5CECA 4S2KA 3HL9A 1WYCA 3OCLA 2E8IA 3V39A 3IH8A 1HZOA 5DVAA 1ONHA 4ZBEA 1ONGA 4KZ4A 3OPRA 3GRJA 4R3BA 4R23A 1ERQA 3V3RA 1K57A 3IH9A 1S6RA 1OMEA 4EBLA 2PU4A 2BLSA 1JTDA 2HDSA 5HX9A 3BFCA 4X68A 2QMIA 3MZDA 1YMSA 4E3MA 3HLGA 2P74A 5M1AA 3VP0A 4E3IA 2Y4AA 3VOYA 2WK0A 4KG5A 3V50A 3ISGA 4KQQA 5FQIA 4WM9A 2H0YA 3A3FA 5EECA 4K0XA 1H5XA 3HREA 5EVIC 3BRMA 5A93A 5HW3A 3PBNA 3IWOA 3ZGAB 3IXDA 2ZMAA 1E4DA 4S2LA 1O07A 2BG1A 1N4OA 1MWUA 3SS5A 3ZFZA 5AQAA 2XD1A 1YLTA 4OPQA 3MXSA 3Q7ZA 2HDUA 3BEBA 1PZPA 1G68A 4WBGA 2EX8A 4LV0A 3C7UA 5DF7A 1L0FA 3G30A 2XH9A 5D3OA 4B4XA 2HDQA 1Q2PA 2OV5A 2Q9MA 4PMAA 4DE2A 4LV3A 3CG5A 3E2LA 3TOIA 4C6YA 2WUQA 4NETA 2JCHA 1I2SA 4QJGA 3LO7A 2EXBA 2EFUA 1DY6A 3G2ZA 5JYPA 1XKZA 2ZQ8A 3N8RA 1QMFA 1DJCA 2WADA 4GN2A 3HLEA 4R0QA 1SKFA 4LV1A 3V3SA 3ZVTA 3G35A 1G6AA 3Q1FA 2Y2IA 3MKFA 4K0WA 2VGKA 2DNSA 3QNCA 3S4XA 2FFFB 3ZCZA 3SH9A 4PM9A 1NYYA 5F1GA 1E3UA 1O7EA 2HP6A 3GMWA 4QHCA 4WMCA 3UPOA 3EQVA 3HLDA 3IF6A 4ID4A 3BLMA 4GKUA 5EVIB 4EBNA 1CI9A 2XFSA 1FCNA 3LY4A 4M3KA 4P0MA 3HLWA 4KG2A 5GLDA 4KG6A 5EUAA 3PBQA 2A3UA 5E43A 2XEPA 1BZAA 4XUZA 3GSGA 5E2HA 5FQ9A 1I2WA 1MY8A 3O3VA 4JXVA 3IHAA 5KMWA 2ZQDA 1XA1A 2IWDA 4QU3A 4DXCA 1H8YA 4RX3A 4OQ0A 1QMEA 4BENA 1N9BA 1SDNA 4C3QA 3N6IA 1YLYA 5CXWA 1BT5A 4GDNA 5EOOA 3DWZA 4JF5A 3WS4A 2Y2NA 1GHPA 1IKGA 1JTGA 3UE0A 4WZ4A 1W79A 4DDYA 3GR2A 3HLFA 4MBHA 1RP5A 1PI5A 3C5AA 4JLFA 1KE3A 2X71A 4JXWA 5CRFA 2XGNA 4GDBA 3HLBA 2JE5A 2P9VB 1K56A 1VQQA 3VP4A 4OQHA 3VFFA 4XUXA 4Q8IA 5FDHA 1YLWA 3Q7VA 1L0GA 3M2KA 4JF6A 5CTNA 1EROA 2I72A 1PYYA 5DTKA 4KQOA 1FQGA 4N92A 1KE0A 4QY5A 5HFOA 5TFQA 2Y91A 2PU2A 3LCEA 1PI4A 1MWSA 3TSGA 3ZG5A 4N1HA 4YFMA 4R3JA 5FAQA 1KGEA 5KSCA 4X56A 2EX6A 3ZDJA 1W5DA 4P6BA 3MZFA 4XXRA 5U47A 1MKIA 3D4FA 3B3XA 4MBFA 4JKTA 3IXBA 5FSRA 1KDSA 4Z9QA 5CGXA 1XXMA 2X02A 2XQZA 4KZ5A 2WGWB 3CJMA 4KZ3A 1ZKJA 2V20A 1EWZA 3I7JA 1NRFA 3ZG7B 1TVFA 1YMXA 1Z6FA 5KSHA 5CTMA 3FV7A 4OLDA 3O88A 1PW1A 1PW8A 4WZ5C 2ZJ9A 3ITAA 4KENB 4BL3A 1K55A 2QZ6A 2V1ZA 4E3JA 4ZJ1A 3SOIA 5CGWA 2H10A 1JWZA 3BFGA 5GLCA 4OQGA 1L0EA 4ZJ2A 1K54A 2IWCA 3ITBA 1K4EA 1MBLA 4EBPA 5CERA 2ZC4B 3UPNA 3DWKA 1FCMA 2PBYA 4OOMA 4Y0OA 1BULA 1KGFA 3WWXA 3ZVWA 3ZNTA 1NJ4A 3IXGA 1XX2A 2Y59A 4DRTA 1ESIA 3VP3A 4D2OA 1BSGA 4FH4A 2OSUA 3MFDA 2HDRA 1RGZA 3HUMA 2ZQAA 3AGDA 5L2FA 4RYEA 3N8SA 1MXOA 3NI9A 1ES2A 3NDGA 1HD8A 3C7VA 4MEZA 4S2MA 5EPHA 3OPHA 4OOYA 3GTCA 3MXRA 2JBFA 2ZC7A 4KZ9A 3SH7A 5HL1A 1FSWA 1E3UD 4QB8A 4DE1A 1W8YA 3IF6C 4KZBA 4F94A 4WMCD 5HAIA 2J8YA 3OZHA 3UDIA 1LI0A 5JYOA 4MLLA 5F83A 4U3TA 3FWLA 5E2FA 2C6WB 4N1XA 3IQAA 1ALQA 4PM8A 4S2PA 1LLBA 1BUEA 1PWDA 4GB7A 4BJPA 4JBFA 1NYMA 3BFFA 1FR6A 4PPRA 5EVIA 1ZC2A 2HP9A 4U0XA 2A49A 2J9OA 4S2NA 5KZHA 4Y0TA 4DE3A 1GA9A 3MZEA 1PWGA 5CGSA 3VSKA 3NBLA 4WELA 5CEBA 1L2SA 3A3EA 3HVFA 3JYIA 5GLAA 1Y54A 5HAQA 5CHJA 1IELA 2Y2PA 2ZM2A 4UHUA 4OVDA 2Y2HA 5GL9A 3WS1A 4FH2A 3FZCA 1MWRA 1L0DA 3P98A 5DTSA 4WEJA 2UWXA 4E6XA 1HTZA 3N7WA 4ZTKA 3IT9A 3PAGA 3UE1A 4CJNA 1RGYA 3QHYA 4JPMA 1K56D 1YLZA 3Q82A 4HESA 4OPYA 3VP1A 4GZBA 4X6TA 2ZM8A 1NY0A 5I94A 2XD5A 3G2YA 4IBRA 4KZ6A 4HBTA 3VSLA 1KVMA 1TDLA 3TG9A 5IHVA 4R4SA 5FI2A 1AXBA 5A92A 3W8KA 2P9VA 3BYDA 3IHBA 1C3BA 2Y2KA 1KGGA 2Y2GA 4N9KA 4QY6A 1WYBA 1NXYA 5DTTA 4PM6A 4R4RA 3ZG9B 3Q07A 1U60A 2G2WA 1HVBA 3SS4A 1LI9A 5AQ7A 4LV2A 1YT4A 3A3DA 1GHIA 3NC8A 4GD6A 2IWBA 3S1YA 3UN7A 1K57C 4A5RA 2XF3A 3G34A 4UA7A 5EE8A 3UNWA 1IYPA 2DRWA 2HPBA 1K6RA 1K38A 1BTLA 3N4IA 1K55C 5J8XA 3FYZA 4IEDA 2EFXA 4BD0A 3WS5A 1YQSA
chains in the Genus database with same CATH superfamily
4EWFA 4ME4A 4UAAA 4HEFA 1JWPA 2ZC6B 3UDFA 3A3IA 2H5SA 4BL2A 4QWOA 4H6JA 5GHZA 3EQUA 3HUNA 4EU0A 3SS3A 2YKFA 1CEFA 5F69A 4OLGA 3PBOA 2BASA 1UWNX 5FQMA 1IKIA 4I5SA 2VGLM 3LIAA 1FSYA 1OTEA 4PM7A 1ZG6A 1OTBA 5CHMA 4ZDXA 4S2JA 3IF5A 1YSQA 2XK1A 3NY4A 2ZQ7A 3HUOA 3ZG8B 3FPVA 4BD1A 1H3QA 3UB8A 2L0WA 3PBTA 2VEAA 4R3AA 2WAFA 4BLMA 1K25A 2JKTI 2Y2QA 2ZD8A 4LENA 3IWQA 3CLOA 4UA9A 5EFWA 4I39A 3BFEA 2OAQ1 4OKPA 2Z2LB 2AVXA 4IVKA 1CF0A 4ZAMA 1ZG4A 4HIAA 2H0TA 4O7DA 4N9LA 2WZZA 4O8GA 1JVJA 1OJGA 2ZBBA 5DKKA 3VP2A 5F82A 2G2UA 2PRFA 3NIAA 1OTIA 3ZNYA 2PR5A 3Q81A 3UO9A 3P09A 1JNUA 5EVLA 5FQJA 2WKHA 4NKPA 5G18A 4K91A 2VGJA 2QPNA 2J7VA 2W3DA 3IX3A 1CK3A 5FAOA 4MN5A 3WRZA 3BLSA 1LL5A 2Y2LA 4PAUA 3PR6A 3C4PA 5FASA 1GCEA 5CHUA 5G4YA 1LT0A 4RVAA 2P7JA 2QJ5A 3IX8A 1T18A 4Y7PA 3OPLA 3MXQA 3FKWA 1ZTUA 3TJZC 4JF4A 2GX5A 3O87A 4DKIA 2PBDP 1XP4A 2HP5A 2ZQ9A 5BOHA 3A3JA 3MKEA 2HZ5A 4S2KA 1WYCA 3IH8A 5DVAA 5L10A 3SZTA 3IH9A 4EBLA 2PU4A 3BFCA 1TS0A 1YMSA 2Y79A 2P74A 2Y4AA 5HL6A 1WA9A 4KQQA 2XSSA 5EECA 3JPUA 3HREA 3D72A 3ZGAB 1O07A 1MWUA 3ZFZA 5AQAA 4UEYA 2XD1A 1YLTA 3MXSA 4BWIA 1PZPA 2Z6CA 5HD3A 5DF7A 3G30A 4EERA 4B4XA 4NG2A 4LV3A 3CG5A 2LB9A 2WUQA 5AVFA 2OAP1 4NETA 5DFXA 2JCHA 2VKSA 2EXBA 2EFUA 1DY6A 3UB7A 1DJCA 3MQQA 1SKFA 2QKPA 4R6LA 2OOLA 3ZVTA 1G6AA 2VLGA 3Q1FA 3B33A 4K0WA 1OTDA 3D3OA 4NEED 5F1GA 1E3UA 3H7WB 3JVVA 3UPOA 3L7HA 4O01A 2W3HA 4M3KA 1FCNA 3HLWA 2KX6A 2MJ6A 2A3UA 2PHYA 2W3FA 1H8YA 2W27A 1GSWA 1SDNA 5DKLA 3DWZA 2ZL1B 3H9WA 1CJFA 1GHPA 4P6ZM 3EGXC 4WZ4A 1W79A 3GR2A 4JGQA 4LRZE 4JXWA 4GDBA 3HLBA 2JE5A 2P9VB 1YLWA 3BWLA 1L0GA 5DTKA 1MKMA 5HFOA 2PU2A 3LCEA 1LSXA 1MWSA 1T1AA 5FAQA 4X56A 4P6BA 3C2WA 3D4FA 3IXBA 2JKRM 4Z9QA 4R38A 3CJMA 4HI4A 2ACGA 3ZQ5A 1TVFA 3FV7A 5DJUA 3CITA 4WZ5C 2ZJ9A 4G3KA 1K55A 5CGWA 3QP4A 3BJNA 4ZJ2A 2IWCA 5C5KA 1MBLA 3DWKA 4Y0OA 1BULA 3WWXA 3KSHA 3ZNTA 1NJ4A 4DRTA 1BSGA 4FH4A 2OSUA 3MFDA 2HDRA 1RGZA 3HUMA 3AGDA 1P97A 3N8SA 3NDGA 3C7VA 2J3WA 3GTCA 3MXRA 4EESA 3L9KA 4YNRA 1W8YA 3UDIA 1LI0A 5JYOA 5F5YA 3FWLA 2C6WB 3IQAA 3H7WA 1BUEA 1S1ZA 4PPRA 4F3LB 3BFFA 5EM0A 1DP8A 4HP4A 2HP9A 2A49A 4KUOA 3QP8A 5L07A 4S2NA 3A0VA 5K5BA 1GA9A 3MZEA 1PWGA 2PD8A 3NBLA 4EEPA 5CEBA 5HAQA 2A2LA 3HVFA 5GLAA 1XJ6A 4EEUA 4UHUA 2Y2PA 3WS1A 4WEJA 2G7UA 3U4LP 1ACFA 3UE1A 1RGYA 2VGLS 3VP1A 4X6TA 5CX7A 4IBRA 1UWPX 2P9VA 1C3BA 4N9KA 4QY6A 2KOIA 1D1JA 1STZA 1NXYA 4PM6A 2G2WA 4NXFA 1LI9A 5AQ7A 4LV2A 1HLUP 3A3DA 4GD6A 4DMZA 3E98A 1KOUA 3UN7A 3QP5A 3G34A 1IYPA 4MDZA 2ZOHA 3T4JA 5J8XA 4IEDA 2EFXA 4YWZA 3WS5A 4E6XA 4E3OA 3NOPC 4GLQA 1NZOA 2WGIA 1FILA 1XGJA 1ERMA 2Y55A 5FATA 2XR0A 3E4PA 3UPPA 2XROA 2Z2MB 1M40A 4LPZA 4RX2A 4OP5A 1IEMA 5F6AA 1ES5A 1XPBA 2FZ0A 3PXPA 2Y2MA 1MPLA 1BLHA 4HHDA 5HARA 3C4OA 1GHMA 1Q2QA 4Y0UA 1S4RA 3OC2A 4MBKA 5FQQA 1E25A 4WEKA 1ES4A 4O0PA 3DW0A 4ZJ3A 5TR7A 3W4QA 5EVID 1OT6A 1W8QA 3GDIA 3MBZA 3RXXA 4F3LA 5E2GA 5FDSA 2B18A 1W7FA 4WZ5A 4P87A 1T1BA 2XLNA 3IBJA 3T4LA 4HBUA 4F94A 1DJBA 1K4FA 1BLCA 5A91A 2QWSA 2PAVP 1XGIA 3G4PA 3RH8B 4WN5A 3R4KA 4FSFA 4LGWA 3T1SA 1PRQA 2WAEA 4S2IA 3UE3A 2EA9A 1P9RA 4IVIA 3MQOA 3CZDA 5FI7A 4OH0A 3QP1A 2ZC5B 3AGFA 2WKQA 3LIEA 4FUWA 1TDGA 3IBRA 5FA7A 3C30A 4HH2A 2W3GA 2ZM0A 1SCWA 3WS2A 5M19A 1PFLA 1LL9A 1S0WA 3T12B 3GQZA 3UY6A 4OONA 1PIOA 4H8RA 5J4EA 5EOEA 4GCZA 2WKEA 3AGEA 1I5QA 1BLSA 1LHYA 3M2JA 4IHQA 2PR6A 2X01A 1YAXA 3BECA 3IWIA 4IUHA 1K54C 2XA7M 3HCYA 3N8LA 3GV9A 4D60A 1WE4A 3MSHA 4ETXA 4E6WA 4IBXA 1OPXA 2V0WA 4JXGA 3K3CA 3P7NA 3UMDA 4EQIA 5AQ9A 5MC7A 4R70A 4CPKA 1FCOA 4X1LA 5HWTA 4CQHA 3W4OA 2XRNA 4Z1WA 1S4SA 3OCLA 3V39A 3KYEA 2GZAA 3LFVA 3GRJA 4R23A 3V3RA 3OLOA 1NLZA 4HOIA 5TBMB 2HDSA 2JKGA 5L8MA 3HLGA 4E3IA 3VOYA 1G6OA 2WK0A 4KG5A 4WLAA 3ISGA 5FQIA 3A0RA 3A3FA 1H5XA 5EVIC 3BRMA 5A93A 5HW3A 3PBNA 5AVEA 1E4DA 2IA2A 3LUQA 2HDUA 4PHTA 2O99A 4WBGA 5HD5A 1ZHHB 4GJ4A 2BTFP 4I38A 4P6ZS 2XH9A 5D3OA 3B47A 2HDQA 3OBFA 4PMAA 3NOTC 3S7PA 5FEGA 5HDCA 1VHMA 2Z6DA 1OTAA 3T4OA 2CMNA 3VE4A 3V3SA 2Y2IA 3MKFA 3LICA 3LI8A 4WF0A 1IOUA 2FFFB 3SH9A 1F98A 4RQ9A 3GMWA 4XT2B 3EQVA 4ID4A 2V9AA 4NXBA 5EVIB 1CI9A 2XFSA 1X0OA 4P0MA 5GLDA 3KX0X 5E43A 1NRJA 5FQ9A 3NJAA 4QU3A 4DXCA 4BENA 1YLYA 2P08A 1XJ2A 3CUEC 2V1BA 1IKGA 2PD7A 1JTGA 3UE0A 4QPRA 1PI5A 4MCWA 1KE3A 2X71A 5CRFA 3SW1A 2XGNA 5FEFA 2QHKA 1XJ4A 3KSIA 5FDHA 5HPFA 4JF6A 3UE6A 2PT7A 1EROA 2I72A 1PYYA 3VV4A 5HDDA 1FQGA 5TFQA 1PI4A 1W5DA 1MKIA 1XFNA 5TBMA 1KDSA 2XQZA 4KZ5A 2WGWB 4KZ3A 1ZKJA 3ZG7B 1MZUA 5IU1A 4KENB 4BL3A 2V1ZA 4E3JA 4ZJ1A 3SOIA 2H10A 1L0EA 2I9VA 1K54A 4L9GA 2GNXA 2HV1A 1K4EA 4EBPA 5CERA 1N9NA 2ZC4B 3ZVWA 2W0NA 1XX2A 2Y59A 2A24B 4LRXC 1W63M 1GSVA 2DMWA 4RYEA 1ES2A 4MEZA 3OPHA 2B02A 4OOYA 4DE1A 1H0MA 3IF6C 2M1CA 5HAIA 1V9YA 2J8YA 2PDRA 4MLLA 5F83A 5E2FA 3DAVA 1PNEA 1ALQA 4K08A 3HJIA 4XT2A 1NYMA 5EVIA 3T1XA 3CI6A 2J9OA 5KZHA 4DE3A 4NXGA 2KDKA 4PKYG 3K2NA 4EXOA 1Y54A 2Y8HA 4HJ4A 5GL9A 3FZCA 4FOFA 3P98A 1XFQA 3PAGA 1G28A 4HNBA 3G2YA 3OOVA 4HBTA 3LR4A 1KVMA 1TDLA 3TG9A 4R4SA 5FI2A 3R7WB 2VV8A 4R4RA 4HH3A 3SS4A 1K57C 2XF3A 4B9OA 2HPBA 1K38A 3F1PB 4L9FA 2GJ3A 2V0UA 2WGWA 4OPRA 3ZYTA 1SZVA 2VJWA 2R9WA 4WUJA 3G31A 3RJUA 3MF0A 4EV4A 4E3NA 4ETZA 2V8CA 1SHVA 2OLUA 3CUEA 1XA7A 4LFUA 4OPZA 5M18A 1TEMA 5A90A 2VZWA 2VA0A 3FC7A 1T1CA 2A24A 3EOIA 4C75A 3DTMA 1G5UA 1JWVA 3VOLA 4DE0A 1ODVA 4ZRRA 4DF6A 4IUKA 3PTEA 4GNUA 2ZLYA 1K6SA 5EVEA 3ZHHA 4M4XA 1FR1A 3G32A 2WKIA 3A0SA 2Y2OA 2RL3A 1T19A 4WYYA 2H28A 1YKDA 3CPTB 2JKFA 4S2OA 1ESUA 4EUVA 3OPPA 2CC1A 1YPRA 2XFTA 4YINA 5HWWA 1VM1A 3PAEA 3CMZA 2B5RA 3NCKA 4E3KA 1EI5A 2GDNA 2O9BA 3BM6A 3PBRA 2ZMFA 5EV0A 3HBRA 3M6HA 2XA7S 1FIKA 4X53A 4X1MA 3LR0A 3MR0A 1P0ZA 1IYOA 3W4PA 3T4SA 1YLJA 1MC0A 3S7OA 3VE3A 2W1RA 3R7WA 1S67L 4BBTA 3OCNA 1YM1A 1IYSA 2R9XA 2J3TC 3NDEA 2FFYA 2Y2JA 3QNBA 4X69A 3E4OA 3RXWA 4NK3A 3F1OB 1M6KA 5DFYA 1GA0A 1SKOB 1EW0A 3LY3A 3VFHA 3F1PA 4QD4A 2O9AA 3T4TA 4KZ7A 2LB5A 3VOZA 2NUPC 2JHEA 4KQRA 4X25A 5DJTA 5TJJA 2ZOIA 2HF6A 2JKTM 2V2FF 4RA7A 3M6BA 2JC7A 2QJ7A 1DJAA 1NZUA 4G3VA 1FOFA 3NULA 4DN0A 1YSPA 4GOGA 5GHYA 3E2KA 4MNRA 2K31A 4GD8A 1KE4A 5CECA 2E8IA 4KQDA 3NECA 1HZOA 1ONHA 4AFIA 4KZ4A 5HPIA 3OPRA 4R3BA 1N9LA 1ERQA 1K57A 1OMEA 4GW9A 5HX9A 2QMIA 3MZDA 3CPTA 4IJGA 4E3MA 3MS6A 5M1AA 3U2AA 4WM9A 1OJ5A 4LRYC 3PYPA 3IWOA 5IS1A 4S2LA 2BG1A 1N4OA 2FH5A 4E04A 4EW7A 2W3EA 3BEBA 4FTXA 1TF1A 3C7UA 3MMHA 1GSXA 3T1QB 2L4RA 2Q9MA 4DE2A 1N9OA 4C6YA 2D01A 1TS6A 1I2SA 4QJGA 3FG8A 5JYPA 1XKZA 2WADA 4R0QA 4LV1A 3QP2A 3ZCZA 1NYYA 1O7EA 3BQAA 1NLYA 3HLDA 3K3DA 5HSQA 3F1OA 4EBNA 3LY4A 1SKOA 4ARZA 3KSGA 5F68A 2XEPA 3CHWP 1F5MA 3GSGA 1I2WA 1MY8A 4JXVA 5KMWA 3IHAA 3RFBA 4RX3A 2INWA 1QMEA 1IFQA 2WKPA 3CWFA 2D02A 4JF5A 4MBHA 3C5AA 4JLFA 3DTKA 1VQQA 3VP4A 3VFFA 4NXEA 4XUXA 4Q8IA 5CTNA 1AWIA 2PYPA 4QY5A 1KE0A 3ICYA 4HY8A 3ZG5A 4YFMA 2PYRA 3EGDC 5KSCA 2EX6A 3MZFA 4MBFA 4HQAA 1XXMA 2X02A 3TE8A 2V20A 1Z6FA 5KSHA 5CTMA 3F1NB 4OLDA 1PW8A 2QZ6A 4Q0HA 1TD5A 2M7UA 1JWZA 3BFGA 5GLCA 4OQGA 3E0YA 4UQIM 1KGFA 4Y13A 5AJGA 1ESIA 3JVUA 2B95A 2ZQAA 1MXOA 3NI9A 1TS7A 4I3AA 5EPHA 2JBFA 2ZC7A 4KZ9A 3SH7A 4QB8A 4JGPA 2UV0E 4WMCD 4KUKA 4U3TA 1Y4OA 1DRMA 1PWDA 4JBFA 4U0XA 4GS9B 4Y0TA 1TS8A 2W1TB 5CGSA 3VSKA 4WELA 1L2SA 4CLCE 5CHJA 1IELA 3UB9A 2V8FA 4OVDA 4YOFA 3LR3A 4FH2A 4WL9A 1L0DA 2UWXA 1HTZA 3N7WA 4CJNA 3IT9A 4JPMA 1K56D 1YLZA 2VK3A 4CLCC 2HJEA 4OPYA 3E4QA 4GZBA 1NY0A 5I94A 2XD5A 3T4KA 3VSLA 5IHVA 1AXBA 3W8KA 3BYDA 3O5YA 2Y2KA 2EWWA 3ZG9B 3Q07A 1U60A 1HVBA 4Y5FA 5J3WA 1GHIA 2IWBA 3S1YA 4GHIB 4A5RA 5EE8A 2DRWA 3BY9A 1BTLA 3N4IA 1K55C 3FYZA 4BD0A 2ZQCA 5CEDA 4LCMA 3F1NA 4DJ3A 4JXSA 2C5WB 5HAPA 4BQMA 1VEUB 2XDMA 2ZMVA 3PBSA 4L0LA 5AQBA 3WS0A 1F9IA 5TGFA 4CLCB 3PHYA 3KYQA 3EEAA 5DF9A 3FKVA 1V9ZA 1CEGA 1PWCA 3O86A 5FAPA 2OWHA 2O0YA 2JN7A 3FPWA 1YLPA 3KYZA 2WGVA 3S4XA 5KIZA 1RCJA 3BFDA 1MWTA 4Y3IA 2M7VA 4UA6A 4B88A 5DF8A 4E3LA 3IXHA 2L1MA 4MN7A 4S2NC 3BQ8A 4PKYA 1PZOA 1OT9A 4R1GA 4BBVA 3UB5P 4GS9A 3G6OA 1P9WA 4DDSA 2WZXA 3MFXA 4FD8A 3VMAA 2W1TA 4FCFA 2O9CA 2EX9A 4LCLA 2E8JA 2ZC3B 1KVLA 3LI9A 4HJ6A 3WRTA 3IX4A 2Q9NA 4MMNA 2OLVA 2EX2A 3DTEA 3GVBA 4KZAA 1ES3A 4B4ZA 4U0TA 4OP8A 3V5MA 2WYXA 2R78A 3HLCA 3LEQA 5GHXA 4I3IA 3HJKA 1J9MA 3LIBA 2J3TD 3C8CA 4DXBA 3IF6B 5I5LA 3P01A 4P85A 4GHIA 3S7NA 4X55A 3SH8A 2RCXA 5FI6A 4KZ8A 4PM5A 5F1FA 3DTIA 2K7SA 1H8ZA 2EXAA 5GLBA 2WKRA 3LR5A 3LEZA 4Y17A 3S22A 5E2EA 1DP9A 1KDWA 1VEUA 3B42A 3EEHA 2DCFA 5A8BA 4OOLA 3DBAA 4BMWA 5FQKA 4CLCA 1UGUA 4ESPA 3UDXA 3ZG0A 4EUZA 3Q7VB 4OQIA 2J9PA 1CI8A 1BLPA 2J80A 1IYQA 1SDEA 1W63Q 5J7EA 3HL9A 3MQ0A 2QYBA 4ZBEA 1ONGA 1J3WA 1S6RA 2BLSA 1JTDA 4X68A 3T50A 3VP0A 2NUTC 3V50A 3GECA 2H0YA 1VETB 4K0XA 3IXDA 2ZMAA 5L09A 3SS5A 4OPQA 1H8MA 3Q7ZA 1G68A 2EX8A 4LV0A 4MN6A 1L0FA 3CAXA 1Q2PA 2OV5A 3E2LA 3LO7A 1NWZA 3NHQA 3G2ZA 4HP9A 2ZQ8A 5G4ZA 3N8RA 1QMFA 4GN2A 4EETB 3HLEA 3QP6A 3G35A 3H82B 2VGKA 2DNSA 4DJ2A 3QNCA 1L3LA 4PM9A 4JGOA 3T1RA 3TRCA 2HP6A 4QHCA 4WMCA 3IF6A 2V1AA 3BLMA 4GKUA 4KG2A 4KG6A 5EUAA 3PBQA 5HDSA 1BZAA 4XUZA 5E2HA 5HWVA 3O3VA 4ARZB 2ZQDA 1XA1A 2IWDA 2ZL1A 4B93A 4OQ0A 4UQIS 1N9BA 4C3QA 3N6IA 5CXWA 1BT5A 4GDNA 2VX8A 5EOOA 3WS4A 2Y2NA 1BYWA 5LBRA 4Q0JA 4DDYA 3HLFA 4I3JA 3RTYA 1RP5A 1A0KA 3NOUC 3UMEA 1K56A 4OQHA 3Q7VA 3M2KA 4KQOA 4N92A 2Y91A 3TSGA 4N1HA 4R3JA 1KGEA 3C38A 3ZDJA 4XXRA 3TW8A 5U47A 3B3XA 1LL8A 4JKTA 2OWJA 5FSRA 3BW6A 5CGXA 2HJ9C 3IS2B 3UB6A 1EWZA 3I7JA 1D06A 1NRFA 2K2NA 1K0KA 1YMXA 3O88A 1PW1A 1VETA 4G3WA 3ITAA 3ULFA 4BBUA 4H6JB 1F2KA 3LIFA 3ITBA 3UPNA 1FCMA 2PBYA 4OOMA 3IXGA 3KSFA 4II7A 3W2ZA 4L9EA 3VP3A 4D2OA 3S7QA 5L2FA 2VV7A 1HD8A 3V67A 4S2MA 5IT5A 5HL1A 1FSWA 1E3UD 1DP6A 3H82A 4KZBA 3T4QA 4Q0IA 1Z09A 3OZHA 3MJQA 1CQAA 4N1XA 4PM8A 4S2PA 1S1YA 1LLBA 5FL3A 1D7EA 4GB7A 2KLIA 2JKRI 4BJPA 1Y28A 1FR6A 5HZHA 1ZC2A 2VV6A 4HJ3A 1XJ3A 3JYIA 3A3EA 2ZM2A 2Y2HA 1MWRA 5DTSA 4ZTKA 4Y15A 5EM1A 3KO6A 3QHYA 4HESA 2YKHA 3Q82A 3LIDA 2ZM8A 4CLCD 4KZ6A 4LLOB 2Q0OA 4JGRA 4EQ1A 5A92A 3IHBA 2Y2GA 1KGGA 2HGVA 1WYBA 2P04A 5DTTA 3EWKA 3BY8A 2EWVA 1S66L 3LGOA 3D9YA 1YT4A 4Y2FA 3NC8A 4UA7A 3UNWA 3LYXA 1K6RA 1LSVA 1LSWA 1VB6A 3TOIA 3IS2A 1YQSA
chains in the Genus database with same CATH topology
2WGWA 4OPRA 2ZQCA 4EWFA 4E3OA 2R9WA 4UAAA 3G31A 3RJUA 5CEDA 4HEFA 1JWPA 4LCMA 2ZC6B 3UDFA 4EV4A 4E3NA 1NZOA 2WGIA 3A3IA 2H5SA 2C5WB 4JXSA 1XGJA 4BQMA 1ERMA 2Y55A 4BL2A 5HAPA 2XDMA 5FATA 2XR0A 1SHVA 2OLUA 5GHZA 3EQUA 3PBSA 3UPPA 1XA7A 2Z2MB 1M40A 4L0LA 3HUNA 5AQBA 4RX2A 3WS0A 3SS3A 4OP5A 1IEMA 4OPZA 5M18A 1ES5A 5TGFA 1CEFA 1XPBA 4OLGA 5DF9A 3PBOA 1TEMA 5A90A 3FKVA 5FQMA 1IKIA 1CEGA 1PWCA 3O86A 5FAPA 1FSYA 4C75A 2Y2MA 4PM7A 1MPLA 3DTMA 1BLHA 1JWVA 4DE0A 1YLPA 5HARA 2WGVA 1ZG6A 5CHMA 4ZDXA 3C4OA 1GHMA 1Q2QA 4S2JA 4DF6A 3IF5A 2XK1A 4Y0UA 3OC2A 3NY4A 4MBKA 2ZQ7A 3HUOA 5FQQA 3PTEA 1E25A 4GNUA 2ZLYA 1K6SA 1RCJA 4WEKA 3ZHHA 1ES4A 3ZG8B 1FR1A 3BFDA 3G32A 2WKIA 1MWTA 3DW0A 2Y2OA 2RL3A 4WYYA 4ZJ3A 4UA6A 5TR7A 4B88A 3W4QA 4BD1A 5DF8A 4S2OA 1ESUA 4E3LA 3OPPA 3IXHA 5EVID 2CC1A 4S2NC 3PBTA 2XFTA 4YINA 1W8QA 3MBZA 1PZOA 3RXXA 1VM1A 3PAEA 4R1GA 3CMZA 5E2GA 2WAFA 2B5RA 1W7FA 4P87A 4WZ5A 1K25A 4BLMA 3NCKA 4E3KA 1EI5A 2GDNA 2XLNA 2Y2QA 2ZD8A 4HBUA 3BM6A 2WZXA 3PBRA 4LENA 4FD8A 4DDSA 3IWQA 3VMAA 1DJBA 4FCFA 1K4FA 1BLCA 4UA9A 5A91A 1XGIA 2EX9A 3G4PA 4LCLA 3BFEA 3HBRA 3M6HA 4OKPA 2Z2LB 2ZC3B 1KVLA 4X53A 4IVKA 4FSFA 4ZAMA 3WRTA 2Q9NA 1ZG4A 2WAEA 2H0TA 4O7DA 2OLVA 4N9LA 4S2IA 3UE3A 2EX2A 2WZZA 3GVBA 4IVIA 4KZAA 1ES3A 1IYOA 3CZDA 1JVJA 5FI7A 3W4PA 4B4ZA 4OH0A 3VP2A 2ZC5B 1YLJA 3AGFA 4U0TA 4OP8A 3V5MA 5F82A 2G2UA 2WYXA 3NIAA 1TDGA 3HLCA 3OCNA 5GHXA 1YM1A 3ZNYA 5FA7A 1IYSA 3Q81A 2R9XA 3UO9A 3NDEA 1J9MA 3P09A 2FFYA 5EVLA 2ZM0A 5FQJA 2WKHA 1SCWA 2Y2JA 3WS2A 3QNBA 4X69A 3RXWA 5M19A 5G18A 4K91A 4NK3A 4DXBA 2VGJA 2QPNA 1LL9A 1S0WA 2J7VA 3IF6B 3GQZA 4P85A 1M6KA 3UY6A 1CK3A 1GA0A 5FAOA 3WRZA 3BLSA 3LY3A 4OONA 1PIOA 1LL5A 2Y2LA 3VFHA 4H8RA 3C4PA 5FASA 4X55A 3SH8A 4QD4A 5EOEA 2RCXA 2WKEA 5FI6A 4KZ8A 4KZ7A 4PM5A 1GCEA 3AGEA 3VOZA 5F1FA 5CHUA 1I5QA 1BLSA 1LHYA 1H8ZA 2EXAA 3M2JA 4KQRA 5GLBA 3LEZA 2X01A 4RVAA 3BECA 3S22A 5E2EA 3IWIA 1KDWA 2V2FF 4RA7A 3M6BA 2JC7A 3OPLA 4Y7PA 1K54C 3N8LA 2DCFA 3GV9A 3FKWA 1WE4A 4OOLA 5FQKA 1DJAA 1NZUA 4E6WA 4JF4A 1FOFA 4IBXA 4JXGA 3O87A 3UDXA 3ZG0A 4DKIA 4EUZA 4GOGA 5GHYA 4EQIA 3Q7VB 5AQ9A 4CPKA 1FCOA 4OQIA 3E2KA 4MNRA 2J9PA 1CI8A 1XP4A 1BLPA 2HP5A 2ZQ9A 5BOHA 3A3JA 3MKEA 1IYQA 4GD8A 3W4OA 1KE4A 1SDEA 5CECA 4S2KA 3HL9A 1WYCA 3OCLA 2E8IA 3V39A 3IH8A 1HZOA 5DVAA 1ONHA 4ZBEA 1ONGA 4KZ4A 3OPRA 3GRJA 4R3BA 4R23A 1ERQA 3V3RA 1K57A 3IH9A 1S6RA 1OMEA 4EBLA 2PU4A 2BLSA 1JTDA 2HDSA 5HX9A 3BFCA 4X68A 2QMIA 3MZDA 1YMSA 4E3MA 3HLGA 2P74A 5M1AA 3VP0A 4E3IA 2Y4AA 3VOYA 2WK0A 4KG5A 3V50A 3ISGA 4KQQA 5FQIA 4WM9A 2H0YA 3A3FA 5EECA 4K0XA 1H5XA 3HREA 5EVIC 3BRMA 5A93A 5HW3A 3PBNA 3IWOA 3ZGAB 3IXDA 2ZMAA 1E4DA 4S2LA 1O07A 2BG1A 1N4OA 1MWUA 3SS5A 3ZFZA 5AQAA 2XD1A 1YLTA 4OPQA 3MXSA 3Q7ZA 2HDUA 3BEBA 1PZPA 1G68A 4WBGA 2EX8A 4LV0A 3C7UA 5DF7A 1L0FA 3G30A 2XH9A 5D3OA 4B4XA 2HDQA 1Q2PA 2OV5A 2Q9MA 4PMAA 4DE2A 4LV3A 3CG5A 3E2LA 3TOIA 4C6YA 2WUQA 4NETA 2JCHA 1I2SA 4QJGA 3LO7A 2EXBA 2EFUA 1DY6A 3G2ZA 5JYPA 1XKZA 2ZQ8A 3N8RA 1QMFA 1DJCA 2WADA 4GN2A 3HLEA 4R0QA 1SKFA 4LV1A 3V3SA 3ZVTA 3G35A 1G6AA 3Q1FA 2Y2IA 3MKFA 4K0WA 2VGKA 2DNSA 3QNCA 3S4XA 2FFFB 3ZCZA 3SH9A 4PM9A 1NYYA 5F1GA 1E3UA 1O7EA 2HP6A 3GMWA 4QHCA 4WMCA 3UPOA 3EQVA 3HLDA 3IF6A 4ID4A 3BLMA 4GKUA 5EVIB 4EBNA 1CI9A 2XFSA 1FCNA 3LY4A 4M3KA 4P0MA 3HLWA 4KG2A 5GLDA 4KG6A 5EUAA 3PBQA 2A3UA 5E43A 2XEPA 1BZAA 4XUZA 3GSGA 5E2HA 5FQ9A 1I2WA 1MY8A 3O3VA 4JXVA 3IHAA 5KMWA 2ZQDA 1XA1A 2IWDA 4QU3A 4DXCA 1H8YA 4RX3A 4OQ0A 1QMEA 4BENA 1N9BA 1SDNA 4C3QA 3N6IA 1YLYA 5CXWA 1BT5A 4GDNA 5EOOA 3DWZA 4JF5A 3WS4A 2Y2NA 1GHPA 1IKGA 1JTGA 3UE0A 4WZ4A 1W79A 4DDYA 3GR2A 3HLFA 4MBHA 1RP5A 1PI5A 3C5AA 4JLFA 1KE3A 2X71A 4JXWA 5CRFA 2XGNA 4GDBA 3HLBA 2JE5A 2P9VB 1K56A 1VQQA 3VP4A 4OQHA 3VFFA 4XUXA 4Q8IA 5FDHA 1YLWA 3Q7VA 1L0GA 3M2KA 4JF6A 5CTNA 1EROA 2I72A 1PYYA 5DTKA 4KQOA 1FQGA 4N92A 1KE0A 4QY5A 5HFOA 5TFQA 2Y91A 2PU2A 3LCEA 1PI4A 1MWSA 3TSGA 3ZG5A 4N1HA 4YFMA 4R3JA 5FAQA 1KGEA 5KSCA 4X56A 2EX6A 3ZDJA 1W5DA 4P6BA 3MZFA 4XXRA 5U47A 1MKIA 3D4FA 3B3XA 4MBFA 4JKTA 3IXBA 5FSRA 1KDSA 4Z9QA 5CGXA 1XXMA 2X02A 2XQZA 4KZ5A 2WGWB 3CJMA 4KZ3A 1ZKJA 2V20A 1EWZA 3I7JA 1NRFA 3ZG7B 1TVFA 1YMXA 1Z6FA 5KSHA 5CTMA 3FV7A 4OLDA 3O88A 1PW1A 1PW8A 4WZ5C 2ZJ9A 3ITAA 4KENB 4BL3A 1K55A 2QZ6A 2V1ZA 4E3JA 4ZJ1A 3SOIA 5CGWA 2H10A 1JWZA 3BFGA 5GLCA 4OQGA 1L0EA 4ZJ2A 1K54A 2IWCA 3ITBA 1K4EA 1MBLA 4EBPA 5CERA 2ZC4B 3UPNA 3DWKA 1FCMA 2PBYA 4OOMA 4Y0OA 1BULA 1KGFA 3WWXA 3ZVWA 3ZNTA 1NJ4A 3IXGA 1XX2A 2Y59A 4DRTA 1ESIA 3VP3A 4D2OA 1BSGA 4FH4A 2OSUA 3MFDA 2HDRA 1RGZA 3HUMA 2ZQAA 3AGDA 5L2FA 4RYEA 3N8SA 1MXOA 3NI9A 1ES2A 3NDGA 1HD8A 3C7VA 4MEZA 4S2MA 5EPHA 3OPHA 4OOYA 3GTCA 3MXRA 2JBFA 2ZC7A 4KZ9A 3SH7A 5HL1A 1FSWA 1E3UD 4QB8A 4DE1A 1W8YA 3IF6C 4KZBA 4F94A 4WMCD 5HAIA 2J8YA 3OZHA 3UDIA 1LI0A 5JYOA 4MLLA 5F83A 4U3TA 3FWLA 5E2FA 2C6WB 4N1XA 3IQAA 1ALQA 4PM8A 4S2PA 1LLBA 1BUEA 1PWDA 4GB7A 4BJPA 4JBFA 1NYMA 3BFFA 1FR6A 4PPRA 5EVIA 1ZC2A 2HP9A 4U0XA 2A49A 2J9OA 4S2NA 5KZHA 4Y0TA 4DE3A 1GA9A 3MZEA 1PWGA 5CGSA 3VSKA 3NBLA 4WELA 5CEBA 1L2SA 3A3EA 3HVFA 3JYIA 5GLAA 1Y54A 5HAQA 5CHJA 1IELA 2Y2PA 2ZM2A 4UHUA 4OVDA 2Y2HA 5GL9A 3WS1A 4FH2A 3FZCA 1MWRA 1L0DA 3P98A 5DTSA 4WEJA 2UWXA 4E6XA 1HTZA 3N7WA 4ZTKA 3IT9A 3PAGA 3UE1A 4CJNA 1RGYA 3QHYA 4JPMA 1K56D 1YLZA 3Q82A 4HESA 4OPYA 3VP1A 4GZBA 4X6TA 2ZM8A 1NY0A 5I94A 2XD5A 3G2YA 4IBRA 4KZ6A 4HBTA 3VSLA 1KVMA 1TDLA 3TG9A 5IHVA 4R4SA 5FI2A 1AXBA 5A92A 3W8KA 2P9VA 3BYDA 3IHBA 1C3BA 2Y2KA 1KGGA 2Y2GA 4N9KA 4QY6A 1WYBA 1NXYA 5DTTA 4PM6A 4R4RA 3ZG9B 3Q07A 1U60A 2G2WA 1HVBA 3SS4A 1LI9A 5AQ7A 4LV2A 1YT4A 3A3DA 1GHIA 3NC8A 4GD6A 2IWBA 3S1YA 3UN7A 1K57C 4A5RA 2XF3A 3G34A 4UA7A 5EE8A 3UNWA 1IYPA 2DRWA 2HPBA 1K6RA 1K38A 1BTLA 3N4IA 1K55C 5J8XA 3FYZA 4IEDA 2EFXA 4BD0A 3WS5A 1YQSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WGW A;  4OPR A;  2ZQC A;  4EWF A;  4E3O A;  2R9W A;  4UAA A;  3G31 A;  3RJU A;  5CED A;  4HEF A;  1JWP A;  4LCM A;  2ZC6 B;  3UDF A;  4EV4 A;  4E3N A;  1NZO A;  2WGI A;  3A3I A;  2H5S A;  2C5W B;  4JXS A;  1XGJ A;  4BQM A;  1ERM A;  2Y55 A;  4BL2 A;  5HAP A;  2XDM A;  5FAT A;  2XR0 A;  1SHV A;  2OLU A;  5GHZ A;  3EQU A;  3PBS A;  3UPP A;  1XA7 A;  2Z2M B;  1M40 A;  4L0L A;  3HUN A;  5AQB A;  4RX2 A;  3WS0 A;  3SS3 A;  4OP5 A;  1IEM A;  4OPZ A;  5M18 A;  1ES5 A;  5TGF A;  1CEF A;  1XPB A;  4OLG A;  5DF9 A;  3PBO A;  1TEM A;  5A90 A;  3FKV A;  5FQM A;  1IKI A;  1CEG A;  1PWC A;  3O86 A;  5FAP A;  1FSY A;  4C75 A;  2Y2M A;  4PM7 A;  1MPL A;  3DTM A;  1BLH A;  1JWV A;  4DE0 A;  1YLP A;  5HAR A;  2WGV A;  1ZG6 A;  5CHM A;  4ZDX A;  3C4O A;  1GHM A;  1Q2Q A;  4S2J A;  4DF6 A;  3IF5 A;  2XK1 A;  4Y0U A;  3OC2 A;  3NY4 A;  4MBK A;  2ZQ7 A;  3HUO A;  5FQQ A;  3PTE A;  1E25 A;  4GNU A;  2ZLY A;  1K6S A;  1RCJ A;  4WEK A;  3ZHH A;  1ES4 A;  3ZG8 B;  1FR1 A;  3BFD A;  3G32 A;  2WKI A;  1MWT A;  3DW0 A;  2Y2O A;  2RL3 A;  4WYY A;  4ZJ3 A;  4UA6 A;  5TR7 A;  4B88 A;  3W4Q A;  4BD1 A;  5DF8 A;  4S2O A;  1ESU A;  4E3L A;  3OPP A;  3IXH A;  5EVI D;  2CC1 A;  4S2N C;  3PBT A;  2XFT A;  4YIN A;  1W8Q A;  3MBZ A;  1PZO A;  3RXX A;  1VM1 A;  3PAE A;  4R1G A;  3CMZ A;  5E2G A;  2WAF A;  2B5R A;  1W7F A;  4P87 A;  4WZ5 A;  1K25 A;  4BLM A;  3NCK A;  4E3K A;  1EI5 A;  2GDN A;  2XLN A;  2Y2Q A;  2ZD8 A;  4HBU A;  3BM6 A;  2WZX A;  3PBR A;  4LEN A;  4FD8 A;  4DDS A;  3IWQ A;  3VMA A;  1DJB A;  4FCF A;  1K4F A;  1BLC A;  4UA9 A;  5A91 A;  1XGI A;  2EX9 A;  3G4P A;  4LCL A;  3BFE A;  3HBR A;  3M6H A;  4OKP A;  2Z2L B;  2ZC3 B;  1KVL A;  4X53 A;  4IVK A;  4FSF A;  4ZAM A;  3WRT A;  2Q9N A;  1ZG4 A;  2WAE A;  2H0T A;  4O7D A;  2OLV A;  4N9L A;  4S2I A;  3UE3 A;  2EX2 A;  2WZZ A;  3GVB A;  4IVI A;  4KZA A;  1ES3 A;  1IYO A;  3CZD A;  1JVJ A;  5FI7 A;  3W4P A;  4B4Z A;  4OH0 A;  3VP2 A;  2ZC5 B;  1YLJ A;  3AGF A;  4U0T A;  4OP8 A;  3V5M A;  5F82 A;  2G2U A;  2WYX A;  3NIA A;  1TDG A;  3HLC A;  3OCN A;  5GHX A;  1YM1 A;  3ZNY A;  5FA7 A;  1IYS A;  3Q81 A;  2R9X A;  3UO9 A;  3NDE A;  1J9M A;  3P09 A;  2FFY A;  5EVL A;  2ZM0 A;  5FQJ A;  2WKH A;  1SCW A;  2Y2J A;  3WS2 A;  3QNB A;  4X69 A;  3RXW A;  5M19 A;  5G18 A;  4K91 A;  4NK3 A;  4DXB A;  2VGJ A;  2QPN A;  1LL9 A;  1S0W A;  2J7V A;  3IF6 B;  3GQZ A;  4P85 A;  1M6K A;  3UY6 A;  1CK3 A;  1GA0 A;  5FAO A;  3WRZ A;  3BLS A;  3LY3 A;  4OON A;  1PIO A;  1LL5 A;  2Y2L A;  3VFH A;  4H8R A;  3C4P A;  5FAS A;  4X55 A;  3SH8 A;  4QD4 A;  5EOE A;  2RCX A;  2WKE A;  5FI6 A;  4KZ8 A;  4KZ7 A;  4PM5 A;  1GCE A;  3AGE A;  3VOZ A;  5F1F A;  5CHU A;  1I5Q A;  1BLS A;  1LHY A;  1H8Z A;  2EXA A;  3M2J A;  4KQR A;  5GLB A;  3LEZ A;  2X01 A;  4RVA A;  3BEC A;  3S22 A;  5E2E A;  3IWI A;  1KDW A;  2V2F F;  4RA7 A;  3M6B A;  2JC7 A;  3OPL A;  4Y7P A;  1K54 C;  3N8L A;  2DCF A;  3GV9 A;  3FKW A;  1WE4 A;  4OOL A;  5FQK A;  1DJA A;  1NZU A;  4E6W A;  4JF4 A;  1FOF A;  4IBX A;  4JXG A;  3O87 A;  3UDX A;  3ZG0 A;  4DKI A;  4EUZ A;  4GOG A;  5GHY A;  4EQI A;  3Q7V B;  5AQ9 A;  4CPK A;  1FCO A;  4OQI A;  3E2K A;  4MNR A;  2J9P A;  1CI8 A;  1XP4 A;  1BLP A;  2HP5 A;  2ZQ9 A;  5BOH A;  3A3J A;  3MKE A;  1IYQ A;  4GD8 A;  3W4O A;  1KE4 A;  1SDE A;  5CEC A;  4S2K A;  3HL9 A;  1WYC A;  3OCL A;  2E8I A;  3V39 A;  3IH8 A;  1HZO A;  5DVA A;  1ONH A;  4ZBE A;  1ONG A;  4KZ4 A;  3OPR A;  3GRJ A;  4R3B A;  4R23 A;  1ERQ A;  3V3R A;  1K57 A;  3IH9 A;  1S6R A;  1OME A;  4EBL A;  2PU4 A;  2BLS A;  1JTD A;  2HDS A;  5HX9 A;  3BFC A;  4X68 A;  2QMI A;  3MZD A;  1YMS A;  4E3M A;  3HLG A;  2P74 A;  5M1A A;  3VP0 A;  4E3I A;  2Y4A A;  3VOY A;  2WK0 A;  4KG5 A;  3V50 A;  3ISG A;  4KQQ A;  5FQI A;  4WM9 A;  2H0Y A;  3A3F A;  5EEC A;  4K0X A;  1H5X A;  3HRE A;  5EVI C;  3BRM A;  5A93 A;  5HW3 A;  3PBN A;  3IWO A;  3ZGA B;  3IXD A;  2ZMA A;  1E4D A;  4S2L A;  1O07 A;  2BG1 A;  1N4O A;  1MWU A;  3SS5 A;  3ZFZ A;  5AQA A;  2XD1 A;  1YLT A;  4OPQ A;  3MXS A;  3Q7Z A;  2HDU A;  3BEB A;  1PZP A;  1G68 A;  4WBG A;  2EX8 A;  4LV0 A;  3C7U A;  5DF7 A;  1L0F A;  3G30 A;  2XH9 A;  5D3O A;  4B4X A;  2HDQ A;  1Q2P A;  2OV5 A;  2Q9M A;  4PMA A;  4DE2 A;  4LV3 A;  3CG5 A;  3E2L A;  3TOI A;  4C6Y A;  2WUQ A;  4NET A;  2JCH A;  1I2S A;  4QJG A;  3LO7 A;  2EXB A;  2EFU A;  1DY6 A;  3G2Z A;  5JYP A;  1XKZ A;  2ZQ8 A;  3N8R A;  1QMF A;  1DJC A;  2WAD A;  4GN2 A;  3HLE A;  4R0Q A;  1SKF A;  4LV1 A;  3V3S A;  3ZVT A;  3G35 A;  1G6A A;  3Q1F A;  2Y2I A;  3MKF A;  4K0W A;  2VGK A;  2DNS A;  3QNC A;  3S4X A;  2FFF B;  3ZCZ A;  3SH9 A;  4PM9 A;  1NYY A;  5F1G A;  1E3U A;  1O7E A;  2HP6 A;  3GMW A;  4QHC A;  4WMC A;  3UPO A;  3EQV A;  3HLD A;  3IF6 A;  4ID4 A;  3BLM A;  4GKU A;  5EVI B;  4EBN A;  1CI9 A;  2XFS A;  1FCN A;  3LY4 A;  4M3K A;  4P0M A;  3HLW A;  4KG2 A;  5GLD A;  4KG6 A;  5EUA A;  3PBQ A;  2A3U A;  5E43 A;  2XEP A;  1BZA A;  4XUZ A;  3GSG A;  5E2H A;  5FQ9 A;  1I2W A;  1MY8 A;  3O3V A;  4JXV A;  3IHA A;  5KMW A;  2ZQD A;  1XA1 A;  2IWD A;  4QU3 A;  4DXC A;  1H8Y A;  4RX3 A;  4OQ0 A;  1QME A;  4BEN A;  1N9B A;  1SDN A;  4C3Q A;  3N6I A;  1YLY A;  5CXW A;  1BT5 A;  4GDN A;  5EOO A;  3DWZ A;  4JF5 A;  3WS4 A;  2Y2N A;  1GHP A;  1IKG A;  1JTG A;  3UE0 A;  4WZ4 A;  1W79 A;  4DDY A;  3GR2 A;  3HLF A;  4MBH A;  1RP5 A;  1PI5 A;  3C5A A;  4JLF A;  1KE3 A;  2X71 A;  4JXW A;  5CRF A;  2XGN A;  4GDB A;  3HLB A;  2JE5 A;  2P9V B;  1K56 A;  1VQQ A;  3VP4 A;  4OQH A;  3VFF A;  4XUX A;  4Q8I A;  5FDH A;  1YLW A;  3Q7V A;  1L0G A;  3M2K A;  4JF6 A;  5CTN A;  1ERO A;  2I72 A;  1PYY A;  5DTK A;  4KQO A;  1FQG A;  4N92 A;  1KE0 A;  4QY5 A;  5HFO A;  5TFQ A;  2Y91 A;  2PU2 A;  3LCE A;  1PI4 A;  1MWS A;  3TSG A;  3ZG5 A;  4N1H A;  4YFM A;  4R3J A;  5FAQ A;  1KGE A;  5KSC A;  4X56 A;  2EX6 A;  3ZDJ A;  1W5D A;  4P6B A;  3MZF A;  4XXR A;  5U47 A;  1MKI A;  3D4F A;  3B3X A;  4MBF A;  4JKT A;  3IXB A;  5FSR A;  1KDS A;  4Z9Q A;  5CGX A;  1XXM A;  2X02 A;  2XQZ A;  4KZ5 A;  2WGW B;  3CJM A;  4KZ3 A;  1ZKJ A;  2V20 A;  1EWZ A;  3I7J A;  1NRF A;  3ZG7 B;  1TVF A;  1YMX A;  1Z6F A;  5KSH A;  5CTM A;  3FV7 A;  4OLD A;  3O88 A;  1PW1 A;  1PW8 A;  4WZ5 C;  2ZJ9 A;  3ITA A;  4KEN B;  4BL3 A;  1K55 A;  2QZ6 A;  2V1Z A;  4E3J A;  4ZJ1 A;  3SOI A;  5CGW A;  2H10 A;  1JWZ A;  3BFG A;  5GLC A;  4OQG A;  1L0E A;  4ZJ2 A;  1K54 A;  2IWC A;  3ITB A;  1K4E A;  1MBL A;  4EBP A;  5CER A;  2ZC4 B;  3UPN A;  3DWK A;  1FCM A;  2PBY A;  4OOM A;  4Y0O A;  1BUL A;  1KGF A;  3WWX A;  3ZVW A;  3ZNT A;  1NJ4 A;  3IXG A;  1XX2 A;  2Y59 A;  4DRT A;  1ESI A;  3VP3 A;  4D2O A;  1BSG A;  4FH4 A;  2OSU A;  3MFD A;  2HDR A;  1RGZ A;  3HUM A;  2ZQA A;  3AGD A;  5L2F A;  4RYE A;  3N8S A;  1MXO A;  3NI9 A;  1ES2 A;  3NDG A;  1HD8 A;  3C7V A;  4MEZ A;  4S2M A;  5EPH A;  3OPH A;  4OOY A;  3GTC A;  3MXR A;  2JBF A;  2ZC7 A;  4KZ9 A;  3SH7 A;  5HL1 A;  1FSW A;  1E3U D;  4QB8 A;  4DE1 A;  1W8Y A;  3IF6 C;  4KZB A;  4F94 A;  4WMC D;  5HAI A;  2J8Y A;  3OZH A;  3UDI A;  1LI0 A;  5JYO A;  4MLL A;  5F83 A;  4U3T A;  3FWL A;  5E2F A;  2C6W B;  4N1X A;  3IQA A;  1ALQ A;  4PM8 A;  4S2P A;  1LLB A;  1BUE A;  1PWD A;  4GB7 A;  4BJP A;  4JBF A;  1NYM A;  3BFF A;  1FR6 A;  4PPR A;  5EVI A;  1ZC2 A;  2HP9 A;  4U0X A;  2A49 A;  2J9O A;  4S2N A;  5KZH A;  4Y0T A;  4DE3 A;  1GA9 A;  3MZE A;  1PWG A;  5CGS A;  3VSK A;  3NBL A;  4WEL A;  5CEB A;  1L2S A;  3A3E A;  3HVF A;  3JYI A;  5GLA A;  1Y54 A;  5HAQ A;  5CHJ A;  1IEL A;  2Y2P A;  2ZM2 A;  4UHU A;  4OVD A;  2Y2H A;  5GL9 A;  3WS1 A;  4FH2 A;  3FZC A;  1MWR A;  1L0D A;  3P98 A;  5DTS A;  4WEJ A;  2UWX A;  4E6X A;  1HTZ A;  3N7W A;  4ZTK A;  3IT9 A;  3PAG A;  3UE1 A;  4CJN A;  1RGY A;  3QHY A;  4JPM A;  1K56 D;  1YLZ A;  3Q82 A;  4HES A;  4OPY A;  3VP1 A;  4GZB A;  4X6T A;  2ZM8 A;  1NY0 A;  5I94 A;  2XD5 A;  3G2Y A;  4IBR A;  4KZ6 A;  4HBT A;  3VSL A;  1KVM A;  1TDL A;  3TG9 A;  5IHV A;  4R4S A;  5FI2 A;  1AXB A;  5A92 A;  3W8K A;  2P9V A;  3BYD A;  3IHB A;  1C3B A;  2Y2K A;  1KGG A;  2Y2G A;  4N9K A;  4QY6 A;  1WYB A;  1NXY A;  5DTT A;  4PM6 A;  4R4R A;  3ZG9 B;  3Q07 A;  1U60 A;  2G2W A;  1HVB A;  3SS4 A;  1LI9 A;  5AQ7 A;  4LV2 A;  1YT4 A;  3A3D A;  1GHI A;  3NC8 A;  4GD6 A;  2IWB A;  3S1Y A;  3UN7 A;  1K57 C;  4A5R A;  2XF3 A;  3G34 A;  4UA7 A;  5EE8 A;  3UNW A;  1IYP A;  2DRW A;  2HPB A;  1K6R A;  1K38 A;  1BTL A;  3N4I A;  1K55 C;  5J8X A;  3FYZ A;  4IED A;  2EFX A;  4BD0 A;  3WS5 A;  1YQS A; 
#chains in the Genus database with same CATH topology
 4EWF A;  4ME4 A;  4UAA A;  4HEF A;  1JWP A;  2ZC6 B;  3UDF A;  3A3I A;  2H5S A;  4BL2 A;  4QWO A;  4H6J A;  5GHZ A;  3EQU A;  3HUN A;  4EU0 A;  3SS3 A;  2YKF A;  1CEF A;  5F69 A;  4OLG A;  3PBO A;  2BAS A;  1UWN X;  5FQM A;  1IKI A;  4I5S A;  2VGL M;  3LIA A;  1FSY A;  1OTE A;  4PM7 A;  1ZG6 A;  1OTB A;  5CHM A;  4ZDX A;  4S2J A;  3IF5 A;  1YSQ A;  2XK1 A;  3NY4 A;  2ZQ7 A;  3HUO A;  3ZG8 B;  3FPV A;  4BD1 A;  1H3Q A;  3UB8 A;  2L0W A;  3PBT A;  2VEA A;  4R3A A;  2WAF A;  4BLM A;  1K25 A;  2JKT I;  2Y2Q A;  2ZD8 A;  4LEN A;  3IWQ A;  3CLO A;  4UA9 A;  5EFW A;  4I39 A;  3BFE A;  2OAQ 1;  4OKP A;  2Z2L B;  2AVX A;  4IVK A;  1CF0 A;  4ZAM A;  1ZG4 A;  4HIA A;  2H0T A;  4O7D A;  4N9L A;  2WZZ A;  4O8G A;  1JVJ A;  1OJG A;  2ZBB A;  5DKK A;  3VP2 A;  5F82 A;  2G2U A;  2PRF A;  3NIA A;  1OTI A;  3ZNY A;  2PR5 A;  3Q81 A;  3UO9 A;  3P09 A;  1JNU A;  5EVL A;  5FQJ A;  2WKH A;  4NKP A;  5G18 A;  4K91 A;  2VGJ A;  2QPN A;  2J7V A;  2W3D A;  3IX3 A;  1CK3 A;  5FAO A;  4MN5 A;  3WRZ A;  3BLS A;  1LL5 A;  2Y2L A;  4PAU A;  3PR6 A;  3C4P A;  5FAS A;  1GCE A;  5CHU A;  5G4Y A;  1LT0 A;  4RVA A;  2P7J A;  2QJ5 A;  3IX8 A;  1T18 A;  4Y7P A;  3OPL A;  3MXQ A;  3FKW A;  1ZTU A;  3TJZ C;  4JF4 A;  2GX5 A;  3O87 A;  4DKI A;  2PBD P;  1XP4 A;  2HP5 A;  2ZQ9 A;  5BOH A;  3A3J A;  3MKE A;  2HZ5 A;  4S2K A;  1WYC A;  3IH8 A;  5DVA A;  5L10 A;  3SZT A;  3IH9 A;  4EBL A;  2PU4 A;  3BFC A;  1TS0 A;  1YMS A;  2Y79 A;  2P74 A;  2Y4A A;  5HL6 A;  1WA9 A;  4KQQ A;  2XSS A;  5EEC A;  3JPU A;  3HRE A;  3D72 A;  3ZGA B;  1O07 A;  1MWU A;  3ZFZ A;  5AQA A;  4UEY A;  2XD1 A;  1YLT A;  3MXS A;  4BWI A;  1PZP A;  2Z6C A;  5HD3 A;  5DF7 A;  3G30 A;  4EER A;  4B4X A;  4NG2 A;  4LV3 A;  3CG5 A;  2LB9 A;  2WUQ A;  5AVF A;  2OAP 1;  4NET A;  5DFX A;  2JCH A;  2VKS A;  2EXB A;  2EFU A;  1DY6 A;  3UB7 A;  1DJC A;  3MQQ A;  1SKF A;  2QKP A;  4R6L A;  2OOL A;  3ZVT A;  1G6A A;  2VLG A;  3Q1F A;  3B33 A;  4K0W A;  1OTD A;  3D3O A;  4NEE D;  5F1G A;  1E3U A;  3H7W B;  3JVV A;  3UPO A;  3L7H A;  4O01 A;  2W3H A;  4M3K A;  1FCN A;  3HLW A;  2KX6 A;  2MJ6 A;  2A3U A;  2PHY A;  2W3F A;  1H8Y A;  2W27 A;  1GSW A;  1SDN A;  5DKL A;  3DWZ A;  2ZL1 B;  3H9W A;  1CJF A;  1GHP A;  4P6Z M;  3EGX C;  4WZ4 A;  1W79 A;  3GR2 A;  4JGQ A;  4LRZ E;  4JXW A;  4GDB A;  3HLB A;  2JE5 A;  2P9V B;  1YLW A;  3BWL A;  1L0G A;  5DTK A;  1MKM A;  5HFO A;  2PU2 A;  3LCE A;  1LSX A;  1MWS A;  1T1A A;  5FAQ A;  4X56 A;  4P6B A;  3C2W A;  3D4F A;  3IXB A;  2JKR M;  4Z9Q A;  4R38 A;  3CJM A;  4HI4 A;  2ACG A;  3ZQ5 A;  1TVF A;  3FV7 A;  5DJU A;  3CIT A;  4WZ5 C;  2ZJ9 A;  4G3K A;  1K55 A;  5CGW A;  3QP4 A;  3BJN A;  4ZJ2 A;  2IWC A;  5C5K A;  1MBL A;  3DWK A;  4Y0O A;  1BUL A;  3WWX A;  3KSH A;  3ZNT A;  1NJ4 A;  4DRT A;  1BSG A;  4FH4 A;  2OSU A;  3MFD A;  2HDR A;  1RGZ A;  3HUM A;  3AGD A;  1P97 A;  3N8S A;  3NDG A;  3C7V A;  2J3W A;  3GTC A;  3MXR A;  4EES A;  3L9K A;  4YNR A;  1W8Y A;  3UDI A;  1LI0 A;  5JYO A;  5F5Y A;  3FWL A;  2C6W B;  3IQA A;  3H7W A;  1BUE A;  1S1Z A;  4PPR A;  4F3L B;  3BFF A;  5EM0 A;  1DP8 A;  4HP4 A;  2HP9 A;  2A49 A;  4KUO A;  3QP8 A;  5L07 A;  4S2N A;  3A0V A;  5K5B A;  1GA9 A;  3MZE A;  1PWG A;  2PD8 A;  3NBL A;  4EEP A;  5CEB A;  5HAQ A;  2A2L A;  3HVF A;  5GLA A;  1XJ6 A;  4EEU A;  4UHU A;  2Y2P A;  3WS1 A;  4WEJ A;  2G7U A;  3U4L P;  1ACF A;  3UE1 A;  1RGY A;  2VGL S;  3VP1 A;  4X6T A;  5CX7 A;  4IBR A;  1UWP X;  2P9V A;  1C3B A;  4N9K A;  4QY6 A;  2KOI A;  1D1J A;  1STZ A;  1NXY A;  4PM6 A;  2G2W A;  4NXF A;  1LI9 A;  5AQ7 A;  4LV2 A;  1HLU P;  3A3D A;  4GD6 A;  4DMZ A;  3E98 A;  1KOU A;  3UN7 A;  3QP5 A;  3G34 A;  1IYP A;  4MDZ A;  2ZOH A;  3T4J A;  5J8X A;  4IED A;  2EFX A;  4YWZ A;  3WS5 A;  4E6X A;  4E3O A;  3NOP C;  4GLQ A;  1NZO A;  2WGI A;  1FIL A;  1XGJ A;  1ERM A;  2Y55 A;  5FAT A;  2XR0 A;  3E4P A;  3UPP A;  2XRO A;  2Z2M B;  1M40 A;  4LPZ A;  4RX2 A;  4OP5 A;  1IEM A;  5F6A A;  1ES5 A;  1XPB A;  2FZ0 A;  3PXP A;  2Y2M A;  1MPL A;  1BLH A;  4HHD A;  5HAR A;  3C4O A;  1GHM A;  1Q2Q A;  4Y0U A;  1S4R A;  3OC2 A;  4MBK A;  5FQQ A;  1E25 A;  4WEK A;  1ES4 A;  4O0P A;  3DW0 A;  4ZJ3 A;  5TR7 A;  3W4Q A;  5EVI D;  1OT6 A;  1W8Q A;  3GDI A;  3MBZ A;  3RXX A;  4F3L A;  5E2G A;  5FDS A;  2B18 A;  1W7F A;  4WZ5 A;  4P87 A;  1T1B A;  2XLN A;  3IBJ A;  3T4L A;  4HBU A;  4F94 A;  1DJB A;  1K4F A;  1BLC A;  5A91 A;  2QWS A;  2PAV P;  1XGI A;  3G4P A;  3RH8 B;  4WN5 A;  3R4K A;  4FSF A;  4LGW A;  3T1S A;  1PRQ A;  2WAE A;  4S2I A;  3UE3 A;  2EA9 A;  1P9R A;  4IVI A;  3MQO A;  3CZD A;  5FI7 A;  4OH0 A;  3QP1 A;  2ZC5 B;  3AGF A;  2WKQ A;  3LIE A;  4FUW A;  1TDG A;  3IBR A;  5FA7 A;  3C30 A;  4HH2 A;  2W3G A;  2ZM0 A;  1SCW A;  3WS2 A;  5M19 A;  1PFL A;  1LL9 A;  1S0W A;  3T12 B;  3GQZ A;  3UY6 A;  4OON A;  1PIO A;  4H8R A;  5J4E A;  5EOE A;  4GCZ A;  2WKE A;  3AGE A;  1I5Q A;  1BLS A;  1LHY A;  3M2J A;  4IHQ A;  2PR6 A;  2X01 A;  1YAX A;  3BEC A;  3IWI A;  4IUH A;  1K54 C;  2XA7 M;  3HCY A;  3N8L A;  3GV9 A;  4D60 A;  1WE4 A;  3MSH A;  4ETX A;  4E6W A;  4IBX A;  1OPX A;  2V0W A;  4JXG A;  3K3C A;  3P7N A;  3UMD A;  4EQI A;  5AQ9 A;  5MC7 A;  4R70 A;  4CPK A;  1FCO A;  4X1L A;  5HWT A;  4CQH A;  3W4O A;  2XRN A;  4Z1W A;  1S4S A;  3OCL A;  3V39 A;  3KYE A;  2GZA A;  3LFV A;  3GRJ A;  4R23 A;  3V3R A;  3OLO A;  1NLZ A;  4HOI A;  5TBM B;  2HDS A;  2JKG A;  5L8M A;  3HLG A;  4E3I A;  3VOY A;  1G6O A;  2WK0 A;  4KG5 A;  4WLA A;  3ISG A;  5FQI A;  3A0R A;  3A3F A;  1H5X A;  5EVI C;  3BRM A;  5A93 A;  5HW3 A;  3PBN A;  5AVE A;  1E4D A;  2IA2 A;  3LUQ A;  2HDU A;  4PHT A;  2O99 A;  4WBG A;  5HD5 A;  1ZHH B;  4GJ4 A;  2BTF P;  4I38 A;  4P6Z S;  2XH9 A;  5D3O A;  3B47 A;  2HDQ A;  3OBF A;  4PMA A;  3NOT C;  3S7P A;  5FEG A;  5HDC A;  1VHM A;  2Z6D A;  1OTA A;  3T4O A;  2CMN A;  3VE4 A;  3V3S A;  2Y2I A;  3MKF A;  3LIC A;  3LI8 A;  4WF0 A;  1IOU A;  2FFF B;  3SH9 A;  1F98 A;  4RQ9 A;  3GMW A;  4XT2 B;  3EQV A;  4ID4 A;  2V9A A;  4NXB A;  5EVI B;  1CI9 A;  2XFS A;  1X0O A;  4P0M A;  5GLD A;  3KX0 X;  5E43 A;  1NRJ A;  5FQ9 A;  3NJA A;  4QU3 A;  4DXC A;  4BEN A;  1YLY A;  2P08 A;  1XJ2 A;  3CUE C;  2V1B A;  1IKG A;  2PD7 A;  1JTG A;  3UE0 A;  4QPR A;  1PI5 A;  4MCW A;  1KE3 A;  2X71 A;  5CRF A;  3SW1 A;  2XGN A;  5FEF A;  2QHK A;  1XJ4 A;  3KSI A;  5FDH A;  5HPF A;  4JF6 A;  3UE6 A;  2PT7 A;  1ERO A;  2I72 A;  1PYY A;  3VV4 A;  5HDD A;  1FQG A;  5TFQ A;  1PI4 A;  1W5D A;  1MKI A;  1XFN A;  5TBM A;  1KDS A;  2XQZ A;  4KZ5 A;  2WGW B;  4KZ3 A;  1ZKJ A;  3ZG7 B;  1MZU A;  5IU1 A;  4KEN B;  4BL3 A;  2V1Z A;  4E3J A;  4ZJ1 A;  3SOI A;  2H10 A;  1L0E A;  2I9V A;  1K54 A;  4L9G A;  2GNX A;  2HV1 A;  1K4E A;  4EBP A;  5CER A;  1N9N A;  2ZC4 B;  3ZVW A;  2W0N A;  1XX2 A;  2Y59 A;  2A24 B;  4LRX C;  1W63 M;  1GSV A;  2DMW A;  4RYE A;  1ES2 A;  4MEZ A;  3OPH A;  2B02 A;  4OOY A;  4DE1 A;  1H0M A;  3IF6 C;  2M1C A;  5HAI A;  1V9Y A;  2J8Y A;  2PDR A;  4MLL A;  5F83 A;  5E2F A;  3DAV A;  1PNE A;  1ALQ A;  4K08 A;  3HJI A;  4XT2 A;  1NYM A;  5EVI A;  3T1X A;  3CI6 A;  2J9O A;  5KZH A;  4DE3 A;  4NXG A;  2KDK A;  4PKY G;  3K2N A;  4EXO A;  1Y54 A;  2Y8H A;  4HJ4 A;  5GL9 A;  3FZC A;  4FOF A;  3P98 A;  1XFQ A;  3PAG A;  1G28 A;  4HNB A;  3G2Y A;  3OOV A;  4HBT A;  3LR4 A;  1KVM A;  1TDL A;  3TG9 A;  4R4S A;  5FI2 A;  3R7W B;  2VV8 A;  4R4R A;  4HH3 A;  3SS4 A;  1K57 C;  2XF3 A;  4B9O A;  2HPB A;  1K38 A;  3F1P B;  4L9F A;  2GJ3 A;  2V0U A;  2WGW A;  4OPR A;  3ZYT A;  1SZV A;  2VJW A;  2R9W A;  4WUJ A;  3G31 A;  3RJU A;  3MF0 A;  4EV4 A;  4E3N A;  4ETZ A;  2V8C A;  1SHV A;  2OLU A;  3CUE A;  1XA7 A;  4LFU A;  4OPZ A;  5M18 A;  1TEM A;  5A90 A;  2VZW A;  2VA0 A;  3FC7 A;  1T1C A;  2A24 A;  3EOI A;  4C75 A;  3DTM A;  1G5U A;  1JWV A;  3VOL A;  4DE0 A;  1ODV A;  4ZRR A;  4DF6 A;  4IUK A;  3PTE A;  4GNU A;  2ZLY A;  1K6S A;  5EVE A;  3ZHH A;  4M4X A;  1FR1 A;  3G32 A;  2WKI A;  3A0S A;  2Y2O A;  2RL3 A;  1T19 A;  4WYY A;  2H28 A;  1YKD A;  3CPT B;  2JKF A;  4S2O A;  1ESU A;  4EUV A;  3OPP A;  2CC1 A;  1YPR A;  2XFT A;  4YIN A;  5HWW A;  1VM1 A;  3PAE A;  3CMZ A;  2B5R A;  3NCK A;  4E3K A;  1EI5 A;  2GDN A;  2O9B A;  3BM6 A;  3PBR A;  2ZMF A;  5EV0 A;  3HBR A;  3M6H A;  2XA7 S;  1FIK A;  4X53 A;  4X1M A;  3LR0 A;  3MR0 A;  1P0Z A;  1IYO A;  3W4P A;  3T4S A;  1YLJ A;  1MC0 A;  3S7O A;  3VE3 A;  2W1R A;  3R7W A;  1S67 L;  4BBT A;  3OCN A;  1YM1 A;  1IYS A;  2R9X A;  2J3T C;  3NDE A;  2FFY A;  2Y2J A;  3QNB A;  4X69 A;  3E4O A;  3RXW A;  4NK3 A;  3F1O B;  1M6K A;  5DFY A;  1GA0 A;  1SKO B;  1EW0 A;  3LY3 A;  3VFH A;  3F1P A;  4QD4 A;  2O9A A;  3T4T A;  4KZ7 A;  2LB5 A;  3VOZ A;  2NUP C;  2JHE A;  4KQR A;  4X25 A;  5DJT A;  5TJJ A;  2ZOI A;  2HF6 A;  2JKT M;  2V2F F;  4RA7 A;  3M6B A;  2JC7 A;  2QJ7 A;  1DJA A;  1NZU A;  4G3V A;  1FOF A;  3NUL A;  4DN0 A;  1YSP A;  4GOG A;  5GHY A;  3E2K A;  4MNR A;  2K31 A;  4GD8 A;  1KE4 A;  5CEC A;  2E8I A;  4KQD A;  3NEC A;  1HZO A;  1ONH A;  4AFI A;  4KZ4 A;  5HPI A;  3OPR A;  4R3B A;  1N9L A;  1ERQ A;  1K57 A;  1OME A;  4GW9 A;  5HX9 A;  2QMI A;  3MZD A;  3CPT A;  4IJG A;  4E3M A;  3MS6 A;  5M1A A;  3U2A A;  4WM9 A;  1OJ5 A;  4LRY C;  3PYP A;  3IWO A;  5IS1 A;  4S2L A;  2BG1 A;  1N4O A;  2FH5 A;  4E04 A;  4EW7 A;  2W3E A;  3BEB A;  4FTX A;  1TF1 A;  3C7U A;  3MMH A;  1GSX A;  3T1Q B;  2L4R A;  2Q9M A;  4DE2 A;  1N9O A;  4C6Y A;  2D01 A;  1TS6 A;  1I2S A;  4QJG A;  3FG8 A;  5JYP A;  1XKZ A;  2WAD A;  4R0Q A;  4LV1 A;  3QP2 A;  3ZCZ A;  1NYY A;  1O7E A;  3BQA A;  1NLY A;  3HLD A;  3K3D A;  5HSQ A;  3F1O A;  4EBN A;  3LY4 A;  1SKO A;  4ARZ A;  3KSG A;  5F68 A;  2XEP A;  3CHW P;  1F5M A;  3GSG A;  1I2W A;  1MY8 A;  4JXV A;  5KMW A;  3IHA A;  3RFB A;  4RX3 A;  2INW A;  1QME A;  1IFQ A;  2WKP A;  3CWF A;  2D02 A;  4JF5 A;  4MBH A;  3C5A A;  4JLF A;  3DTK A;  1VQQ A;  3VP4 A;  3VFF A;  4NXE A;  4XUX A;  4Q8I A;  5CTN A;  1AWI A;  2PYP A;  4QY5 A;  1KE0 A;  3ICY A;  4HY8 A;  3ZG5 A;  4YFM A;  2PYR A;  3EGD C;  5KSC A;  2EX6 A;  3MZF A;  4MBF A;  4HQA A;  1XXM A;  2X02 A;  3TE8 A;  2V20 A;  1Z6F A;  5KSH A;  5CTM A;  3F1N B;  4OLD A;  1PW8 A;  2QZ6 A;  4Q0H A;  1TD5 A;  2M7U A;  1JWZ A;  3BFG A;  5GLC A;  4OQG A;  3E0Y A;  4UQI M;  1KGF A;  4Y13 A;  5AJG A;  1ESI A;  3JVU A;  2B95 A;  2ZQA A;  1MXO A;  3NI9 A;  1TS7 A;  4I3A A;  5EPH A;  2JBF A;  2ZC7 A;  4KZ9 A;  3SH7 A;  4QB8 A;  4JGP A;  2UV0 E;  4WMC D;  4KUK A;  4U3T A;  1Y4O A;  1DRM A;  1PWD A;  4JBF A;  4U0X A;  4GS9 B;  4Y0T A;  1TS8 A;  2W1T B;  5CGS A;  3VSK A;  4WEL A;  1L2S A;  4CLC E;  5CHJ A;  1IEL A;  3UB9 A;  2V8F A;  4OVD A;  4YOF A;  3LR3 A;  4FH2 A;  4WL9 A;  1L0D A;  2UWX A;  1HTZ A;  3N7W A;  4CJN A;  3IT9 A;  4JPM A;  1K56 D;  1YLZ A;  2VK3 A;  4CLC C;  2HJE A;  4OPY A;  3E4Q A;  4GZB A;  1NY0 A;  5I94 A;  2XD5 A;  3T4K A;  3VSL A;  5IHV A;  1AXB A;  3W8K A;  3BYD A;  3O5Y A;  2Y2K A;  2EWW A;  3ZG9 B;  3Q07 A;  1U60 A;  1HVB A;  4Y5F A;  5J3W A;  1GHI A;  2IWB A;  3S1Y A;  4GHI B;  4A5R A;  5EE8 A;  2DRW A;  3BY9 A;  1BTL A;  3N4I A;  1K55 C;  3FYZ A;  4BD0 A;  2ZQC A;  5CED A;  4LCM A;  3F1N A;  4DJ3 A;  4JXS A;  2C5W B;  5HAP A;  4BQM A;  1VEU B;  2XDM A;  2ZMV A;  3PBS A;  4L0L A;  5AQB A;  3WS0 A;  1F9I A;  5TGF A;  4CLC B;  3PHY A;  3KYQ A;  3EEA A;  5DF9 A;  3FKV A;  1V9Z A;  1CEG A;  1PWC A;  3O86 A;  5FAP A;  2OWH A;  2O0Y A;  2JN7 A;  3FPW A;  1YLP A;  3KYZ A;  2WGV A;  3S4X A;  5KIZ A;  1RCJ A;  3BFD A;  1MWT A;  4Y3I A;  2M7V A;  4UA6 A;  4B88 A;  5DF8 A;  4E3L A;  3IXH A;  2L1M A;  4MN7 A;  4S2N C;  3BQ8 A;  4PKY A;  1PZO A;  1OT9 A;  4R1G A;  4BBV A;  3UB5 P;  4GS9 A;  3G6O A;  1P9W A;  4DDS A;  2WZX A;  3MFX A;  4FD8 A;  3VMA A;  2W1T A;  4FCF A;  2O9C A;  2EX9 A;  4LCL A;  2E8J A;  2ZC3 B;  1KVL A;  3LI9 A;  4HJ6 A;  3WRT A;  3IX4 A;  2Q9N A;  4MMN A;  2OLV A;  2EX2 A;  3DTE A;  3GVB A;  4KZA A;  1ES3 A;  4B4Z A;  4U0T A;  4OP8 A;  3V5M A;  2WYX A;  2R78 A;  3HLC A;  3LEQ A;  5GHX A;  4I3I A;  3HJK A;  1J9M A;  3LIB A;  2J3T D;  3C8C A;  4DXB A;  3IF6 B;  5I5L A;  3P01 A;  4P85 A;  4GHI A;  3S7N A;  4X55 A;  3SH8 A;  2RCX A;  5FI6 A;  4KZ8 A;  4PM5 A;  5F1F A;  3DTI A;  2K7S A;  1H8Z A;  2EXA A;  5GLB A;  2WKR A;  3LR5 A;  3LEZ A;  4Y17 A;  3S22 A;  5E2E A;  1DP9 A;  1KDW A;  1VEU A;  3B42 A;  3EEH A;  2DCF A;  5A8B A;  4OOL A;  3DBA A;  4BMW A;  5FQK A;  4CLC A;  1UGU A;  4ESP A;  3UDX A;  3ZG0 A;  4EUZ A;  3Q7V B;  4OQI A;  2J9P A;  1CI8 A;  1BLP A;  2J80 A;  1IYQ A;  1SDE A;  1W63 Q;  5J7E A;  3HL9 A;  3MQ0 A;  2QYB A;  4ZBE A;  1ONG A;  1J3W A;  1S6R A;  2BLS A;  1JTD A;  4X68 A;  3T50 A;  3VP0 A;  2NUT C;  3V50 A;  3GEC A;  2H0Y A;  1VET B;  4K0X A;  3IXD A;  2ZMA A;  5L09 A;  3SS5 A;  4OPQ A;  1H8M A;  3Q7Z A;  1G68 A;  2EX8 A;  4LV0 A;  4MN6 A;  1L0F A;  3CAX A;  1Q2P A;  2OV5 A;  3E2L A;  3LO7 A;  1NWZ A;  3NHQ A;  3G2Z A;  4HP9 A;  2ZQ8 A;  5G4Z A;  3N8R A;  1QMF A;  4GN2 A;  4EET B;  3HLE A;  3QP6 A;  3G35 A;  3H82 B;  2VGK A;  2DNS A;  4DJ2 A;  3QNC A;  1L3L A;  4PM9 A;  4JGO A;  3T1R A;  3TRC A;  2HP6 A;  4QHC A;  4WMC A;  3IF6 A;  2V1A A;  3BLM A;  4GKU A;  4KG2 A;  4KG6 A;  5EUA A;  3PBQ A;  5HDS A;  1BZA A;  4XUZ A;  5E2H A;  5HWV A;  3O3V A;  4ARZ B;  2ZQD A;  1XA1 A;  2IWD A;  2ZL1 A;  4B93 A;  4OQ0 A;  4UQI S;  1N9B A;  4C3Q A;  3N6I A;  5CXW A;  1BT5 A;  4GDN A;  2VX8 A;  5EOO A;  3WS4 A;  2Y2N A;  1BYW A;  5LBR A;  4Q0J A;  4DDY A;  3HLF A;  4I3J A;  3RTY A;  1RP5 A;  1A0K A;  3NOU C;  3UME A;  1K56 A;  4OQH A;  3Q7V A;  3M2K A;  4KQO A;  4N92 A;  2Y91 A;  3TSG A;  4N1H A;  4R3J A;  1KGE A;  3C38 A;  3ZDJ A;  4XXR A;  3TW8 A;  5U47 A;  3B3X A;  1LL8 A;  4JKT A;  2OWJ A;  5FSR A;  3BW6 A;  5CGX A;  2HJ9 C;  3IS2 B;  3UB6 A;  1EWZ A;  3I7J A;  1D06 A;  1NRF A;  2K2N A;  1K0K A;  1YMX A;  3O88 A;  1PW1 A;  1VET A;  4G3W A;  3ITA A;  3ULF A;  4BBU A;  4H6J B;  1F2K A;  3LIF A;  3ITB A;  3UPN A;  1FCM A;  2PBY A;  4OOM A;  3IXG A;  3KSF A;  4II7 A;  3W2Z A;  4L9E A;  3VP3 A;  4D2O A;  3S7Q A;  5L2F A;  2VV7 A;  1HD8 A;  3V67 A;  4S2M A;  5IT5 A;  5HL1 A;  1FSW A;  1E3U D;  1DP6 A;  3H82 A;  4KZB A;  3T4Q A;  4Q0I A;  1Z09 A;  3OZH A;  3MJQ A;  1CQA A;  4N1X A;  4PM8 A;  4S2P A;  1S1Y A;  1LLB A;  5FL3 A;  1D7E A;  4GB7 A;  2KLI A;  2JKR I;  4BJP A;  1Y28 A;  1FR6 A;  5HZH A;  1ZC2 A;  2VV6 A;  4HJ3 A;  1XJ3 A;  3JYI A;  3A3E A;  2ZM2 A;  2Y2H A;  1MWR A;  5DTS A;  4ZTK A;  4Y15 A;  5EM1 A;  3KO6 A;  3QHY A;  4HES A;  2YKH A;  3Q82 A;  3LID A;  2ZM8 A;  4CLC D;  4KZ6 A;  4LLO B;  2Q0O A;  4JGR A;  4EQ1 A;  5A92 A;  3IHB A;  2Y2G A;  1KGG A;  2HGV A;  1WYB A;  2P04 A;  5DTT A;  3EWK A;  3BY8 A;  2EWV A;  1S66 L;  3LGO A;  3D9Y A;  1YT4 A;  4Y2F A;  3NC8 A;  4UA7 A;  3UNW A;  3LYX A;  1K6R A;  1LSV A;  1LSW A;  1VB6 A;  3TOI A;  3IS2 A;  1YQS A; 
#chains in the Genus database with same CATH homology
 2WGW A;  4OPR A;  2ZQC A;  4EWF A;  4E3O A;  2R9W A;  4UAA A;  3G31 A;  3RJU A;  5CED A;  4HEF A;  1JWP A;  4LCM A;  2ZC6 B;  3UDF A;  4EV4 A;  4E3N A;  1NZO A;  2WGI A;  3A3I A;  2H5S A;  2C5W B;  4JXS A;  1XGJ A;  4BQM A;  1ERM A;  2Y55 A;  4BL2 A;  5HAP A;  2XDM A;  5FAT A;  2XR0 A;  1SHV A;  2OLU A;  5GHZ A;  3EQU A;  3PBS A;  3UPP A;  1XA7 A;  2Z2M B;  1M40 A;  4L0L A;  3HUN A;  5AQB A;  4RX2 A;  3WS0 A;  3SS3 A;  4OP5 A;  1IEM A;  4OPZ A;  5M18 A;  1ES5 A;  5TGF A;  1CEF A;  1XPB A;  4OLG A;  5DF9 A;  3PBO A;  1TEM A;  5A90 A;  3FKV A;  5FQM A;  1IKI A;  1CEG A;  1PWC A;  3O86 A;  5FAP A;  1FSY A;  4C75 A;  2Y2M A;  4PM7 A;  1MPL A;  3DTM A;  1BLH A;  1JWV A;  4DE0 A;  1YLP A;  5HAR A;  2WGV A;  1ZG6 A;  5CHM A;  4ZDX A;  3C4O A;  1GHM A;  1Q2Q A;  4S2J A;  4DF6 A;  3IF5 A;  2XK1 A;  4Y0U A;  3OC2 A;  3NY4 A;  4MBK A;  2ZQ7 A;  3HUO A;  5FQQ A;  3PTE A;  1E25 A;  4GNU A;  2ZLY A;  1K6S A;  1RCJ A;  4WEK A;  3ZHH A;  1ES4 A;  3ZG8 B;  1FR1 A;  3BFD A;  3G32 A;  2WKI A;  1MWT A;  3DW0 A;  2Y2O A;  2RL3 A;  4WYY A;  4ZJ3 A;  4UA6 A;  5TR7 A;  4B88 A;  3W4Q A;  4BD1 A;  5DF8 A;  4S2O A;  1ESU A;  4E3L A;  3OPP A;  3IXH A;  5EVI D;  2CC1 A;  4S2N C;  3PBT A;  2XFT A;  4YIN A;  1W8Q A;  3MBZ A;  1PZO A;  3RXX A;  1VM1 A;  3PAE A;  4R1G A;  3CMZ A;  5E2G A;  2WAF A;  2B5R A;  1W7F A;  4P87 A;  4WZ5 A;  1K25 A;  4BLM A;  3NCK A;  4E3K A;  1EI5 A;  2GDN A;  2XLN A;  2Y2Q A;  2ZD8 A;  4HBU A;  3BM6 A;  2WZX A;  3PBR A;  4LEN A;  4FD8 A;  4DDS A;  3IWQ A;  3VMA A;  1DJB A;  4FCF A;  1K4F A;  1BLC A;  4UA9 A;  5A91 A;  1XGI A;  2EX9 A;  3G4P A;  4LCL A;  3BFE A;  3HBR A;  3M6H A;  4OKP A;  2Z2L B;  2ZC3 B;  1KVL A;  4X53 A;  4IVK A;  4FSF A;  4ZAM A;  3WRT A;  2Q9N A;  1ZG4 A;  2WAE A;  2H0T A;  4O7D A;  2OLV A;  4N9L A;  4S2I A;  3UE3 A;  2EX2 A;  2WZZ A;  3GVB A;  4IVI A;  4KZA A;  1ES3 A;  1IYO A;  3CZD A;  1JVJ A;  5FI7 A;  3W4P A;  4B4Z A;  4OH0 A;  3VP2 A;  2ZC5 B;  1YLJ A;  3AGF A;  4U0T A;  4OP8 A;  3V5M A;  5F82 A;  2G2U A;  2WYX A;  3NIA A;  1TDG A;  3HLC A;  3OCN A;  5GHX A;  1YM1 A;  3ZNY A;  5FA7 A;  1IYS A;  3Q81 A;  2R9X A;  3UO9 A;  3NDE A;  1J9M A;  3P09 A;  2FFY A;  5EVL A;  2ZM0 A;  5FQJ A;  2WKH A;  1SCW A;  2Y2J A;  3WS2 A;  3QNB A;  4X69 A;  3RXW A;  5M19 A;  5G18 A;  4K91 A;  4NK3 A;  4DXB A;  2VGJ A;  2QPN A;  1LL9 A;  1S0W A;  2J7V A;  3IF6 B;  3GQZ A;  4P85 A;  1M6K A;  3UY6 A;  1CK3 A;  1GA0 A;  5FAO A;  3WRZ A;  3BLS A;  3LY3 A;  4OON A;  1PIO A;  1LL5 A;  2Y2L A;  3VFH A;  4H8R A;  3C4P A;  5FAS A;  4X55 A;  3SH8 A;  4QD4 A;  5EOE A;  2RCX A;  2WKE A;  5FI6 A;  4KZ8 A;  4KZ7 A;  4PM5 A;  1GCE A;  3AGE A;  3VOZ A;  5F1F A;  5CHU A;  1I5Q A;  1BLS A;  1LHY A;  1H8Z A;  2EXA A;  3M2J A;  4KQR A;  5GLB A;  3LEZ A;  2X01 A;  4RVA A;  3BEC A;  3S22 A;  5E2E A;  3IWI A;  1KDW A;  2V2F F;  4RA7 A;  3M6B A;  2JC7 A;  3OPL A;  4Y7P A;  1K54 C;  3N8L A;  2DCF A;  3GV9 A;  3FKW A;  1WE4 A;  4OOL A;  5FQK A;  1DJA A;  1NZU A;  4E6W A;  4JF4 A;  1FOF A;  4IBX A;  4JXG A;  3O87 A;  3UDX A;  3ZG0 A;  4DKI A;  4EUZ A;  4GOG A;  5GHY A;  4EQI A;  3Q7V B;  5AQ9 A;  4CPK A;  1FCO A;  4OQI A;  3E2K A;  4MNR A;  2J9P A;  1CI8 A;  1XP4 A;  1BLP A;  2HP5 A;  2ZQ9 A;  5BOH A;  3A3J A;  3MKE A;  1IYQ A;  4GD8 A;  3W4O A;  1KE4 A;  1SDE A;  5CEC A;  4S2K A;  3HL9 A;  1WYC A;  3OCL A;  2E8I A;  3V39 A;  3IH8 A;  1HZO A;  5DVA A;  1ONH A;  4ZBE A;  1ONG A;  4KZ4 A;  3OPR A;  3GRJ A;  4R3B A;  4R23 A;  1ERQ A;  3V3R A;  1K57 A;  3IH9 A;  1S6R A;  1OME A;  4EBL A;  2PU4 A;  2BLS A;  1JTD A;  2HDS A;  5HX9 A;  3BFC A;  4X68 A;  2QMI A;  3MZD A;  1YMS A;  4E3M A;  3HLG A;  2P74 A;  5M1A A;  3VP0 A;  4E3I A;  2Y4A A;  3VOY A;  2WK0 A;  4KG5 A;  3V50 A;  3ISG A;  4KQQ A;  5FQI A;  4WM9 A;  2H0Y A;  3A3F A;  5EEC A;  4K0X A;  1H5X A;  3HRE A;  5EVI C;  3BRM A;  5A93 A;  5HW3 A;  3PBN A;  3IWO A;  3ZGA B;  3IXD A;  2ZMA A;  1E4D A;  4S2L A;  1O07 A;  2BG1 A;  1N4O A;  1MWU A;  3SS5 A;  3ZFZ A;  5AQA A;  2XD1 A;  1YLT A;  4OPQ A;  3MXS A;  3Q7Z A;  2HDU A;  3BEB A;  1PZP A;  1G68 A;  4WBG A;  2EX8 A;  4LV0 A;  3C7U A;  5DF7 A;  1L0F A;  3G30 A;  2XH9 A;  5D3O A;  4B4X A;  2HDQ A;  1Q2P A;  2OV5 A;  2Q9M A;  4PMA A;  4DE2 A;  4LV3 A;  3CG5 A;  3E2L A;  3TOI A;  4C6Y A;  2WUQ A;  4NET A;  2JCH A;  1I2S A;  4QJG A;  3LO7 A;  2EXB A;  2EFU A;  1DY6 A;  3G2Z A;  5JYP A;  1XKZ A;  2ZQ8 A;  3N8R A;  1QMF A;  1DJC A;  2WAD A;  4GN2 A;  3HLE A;  4R0Q A;  1SKF A;  4LV1 A;  3V3S A;  3ZVT A;  3G35 A;  1G6A A;  3Q1F A;  2Y2I A;  3MKF A;  4K0W A;  2VGK A;  2DNS A;  3QNC A;  3S4X A;  2FFF B;  3ZCZ A;  3SH9 A;  4PM9 A;  1NYY A;  5F1G A;  1E3U A;  1O7E A;  2HP6 A;  3GMW A;  4QHC A;  4WMC A;  3UPO A;  3EQV A;  3HLD A;  3IF6 A;  4ID4 A;  3BLM A;  4GKU A;  5EVI B;  4EBN A;  1CI9 A;  2XFS A;  1FCN A;  3LY4 A;  4M3K A;  4P0M A;  3HLW A;  4KG2 A;  5GLD A;  4KG6 A;  5EUA A;  3PBQ A;  2A3U A;  5E43 A;  2XEP A;  1BZA A;  4XUZ A;  3GSG A;  5E2H A;  5FQ9 A;  1I2W A;  1MY8 A;  3O3V A;  4JXV A;  3IHA A;  5KMW A;  2ZQD A;  1XA1 A;  2IWD A;  4QU3 A;  4DXC A;  1H8Y A;  4RX3 A;  4OQ0 A;  1QME A;  4BEN A;  1N9B A;  1SDN A;  4C3Q A;  3N6I A;  1YLY A;  5CXW A;  1BT5 A;  4GDN A;  5EOO A;  3DWZ A;  4JF5 A;  3WS4 A;  2Y2N A;  1GHP A;  1IKG A;  1JTG A;  3UE0 A;  4WZ4 A;  1W79 A;  4DDY A;  3GR2 A;  3HLF A;  4MBH A;  1RP5 A;  1PI5 A;  3C5A A;  4JLF A;  1KE3 A;  2X71 A;  4JXW A;  5CRF A;  2XGN A;  4GDB A;  3HLB A;  2JE5 A;  2P9V B;  1K56 A;  1VQQ A;  3VP4 A;  4OQH A;  3VFF A;  4XUX A;  4Q8I A;  5FDH A;  1YLW A;  3Q7V A;  1L0G A;  3M2K A;  4JF6 A;  5CTN A;  1ERO A;  2I72 A;  1PYY A;  5DTK A;  4KQO A;  1FQG A;  4N92 A;  1KE0 A;  4QY5 A;  5HFO A;  5TFQ A;  2Y91 A;  2PU2 A;  3LCE A;  1PI4 A;  1MWS A;  3TSG A;  3ZG5 A;  4N1H A;  4YFM A;  4R3J A;  5FAQ A;  1KGE A;  5KSC A;  4X56 A;  2EX6 A;  3ZDJ A;  1W5D A;  4P6B A;  3MZF A;  4XXR A;  5U47 A;  1MKI A;  3D4F A;  3B3X A;  4MBF A;  4JKT A;  3IXB A;  5FSR A;  1KDS A;  4Z9Q A;  5CGX A;  1XXM A;  2X02 A;  2XQZ A;  4KZ5 A;  2WGW B;  3CJM A;  4KZ3 A;  1ZKJ A;  2V20 A;  1EWZ A;  3I7J A;  1NRF A;  3ZG7 B;  1TVF A;  1YMX A;  1Z6F A;  5KSH A;  5CTM A;  3FV7 A;  4OLD A;  3O88 A;  1PW1 A;  1PW8 A;  4WZ5 C;  2ZJ9 A;  3ITA A;  4KEN B;  4BL3 A;  1K55 A;  2QZ6 A;  2V1Z A;  4E3J A;  4ZJ1 A;  3SOI A;  5CGW A;  2H10 A;  1JWZ A;  3BFG A;  5GLC A;  4OQG A;  1L0E A;  4ZJ2 A;  1K54 A;  2IWC A;  3ITB A;  1K4E A;  1MBL A;  4EBP A;  5CER A;  2ZC4 B;  3UPN A;  3DWK A;  1FCM A;  2PBY A;  4OOM A;  4Y0O A;  1BUL A;  1KGF A;  3WWX A;  3ZVW A;  3ZNT A;  1NJ4 A;  3IXG A;  1XX2 A;  2Y59 A;  4DRT A;  1ESI A;  3VP3 A;  4D2O A;  1BSG A;  4FH4 A;  2OSU A;  3MFD A;  2HDR A;  1RGZ A;  3HUM A;  2ZQA A;  3AGD A;  5L2F A;  4RYE A;  3N8S A;  1MXO A;  3NI9 A;  1ES2 A;  3NDG A;  1HD8 A;  3C7V A;  4MEZ A;  4S2M A;  5EPH A;  3OPH A;  4OOY A;  3GTC A;  3MXR A;  2JBF A;  2ZC7 A;  4KZ9 A;  3SH7 A;  5HL1 A;  1FSW A;  1E3U D;  4QB8 A;  4DE1 A;  1W8Y A;  3IF6 C;  4KZB A;  4F94 A;  4WMC D;  5HAI A;  2J8Y A;  3OZH A;  3UDI A;  1LI0 A;  5JYO A;  4MLL A;  5F83 A;  4U3T A;  3FWL A;  5E2F A;  2C6W B;  4N1X A;  3IQA A;  1ALQ A;  4PM8 A;  4S2P A;  1LLB A;  1BUE A;  1PWD A;  4GB7 A;  4BJP A;  4JBF A;  1NYM A;  3BFF A;  1FR6 A;  4PPR A;  5EVI A;  1ZC2 A;  2HP9 A;  4U0X A;  2A49 A;  2J9O A;  4S2N A;  5KZH A;  4Y0T A;  4DE3 A;  1GA9 A;  3MZE A;  1PWG A;  5CGS A;  3VSK A;  3NBL A;  4WEL A;  5CEB A;  1L2S A;  3A3E A;  3HVF A;  3JYI A;  5GLA A;  1Y54 A;  5HAQ A;  5CHJ A;  1IEL A;  2Y2P A;  2ZM2 A;  4UHU A;  4OVD A;  2Y2H A;  5GL9 A;  3WS1 A;  4FH2 A;  3FZC A;  1MWR A;  1L0D A;  3P98 A;  5DTS A;  4WEJ A;  2UWX A;  4E6X A;  1HTZ A;  3N7W A;  4ZTK A;  3IT9 A;  3PAG A;  3UE1 A;  4CJN A;  1RGY A;  3QHY A;  4JPM A;  1K56 D;  1YLZ A;  3Q82 A;  4HES A;  4OPY A;  3VP1 A;  4GZB A;  4X6T A;  2ZM8 A;  1NY0 A;  5I94 A;  2XD5 A;  3G2Y A;  4IBR A;  4KZ6 A;  4HBT A;  3VSL A;  1KVM A;  1TDL A;  3TG9 A;  5IHV A;  4R4S A;  5FI2 A;  1AXB A;  5A92 A;  3W8K A;  2P9V A;  3BYD A;  3IHB A;  1C3B A;  2Y2K A;  1KGG A;  2Y2G A;  4N9K A;  4QY6 A;  1WYB A;  1NXY A;  5DTT A;  4PM6 A;  4R4R A;  3ZG9 B;  3Q07 A;  1U60 A;  2G2W A;  1HVB A;  3SS4 A;  1LI9 A;  5AQ7 A;  4LV2 A;  1YT4 A;  3A3D A;  1GHI A;  3NC8 A;  4GD6 A;  2IWB A;  3S1Y A;  3UN7 A;  1K57 C;  4A5R A;  2XF3 A;  3G34 A;  4UA7 A;  5EE8 A;  3UNW A;  1IYP A;  2DRW A;  2HPB A;  1K6R A;  1K38 A;  1BTL A;  3N4I A;  1K55 C;  5J8X A;  3FYZ A;  4IED A;  2EFX A;  4BD0 A;  3WS5 A;  1YQS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...