1YTFB

Yeast tfiia/tbp/dna complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
46
structure length
46
Chain Sequence
SNAEASRVYEIIVESVVNEVREDFENAGIDEQTLQDLKNIWQKKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a yeast TFIIA/TBP/DNA complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*TP*GP*TP*AP*TP*GP*TP*AP*TP*AP*TP*AP*AP*AP*AP*C)-3
total genus 18
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 1996-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.100 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1ytfB00
3W7XA 3E35A 3W7SA 3W7WA 3W7UA 3BY6A 5GW7A 3W7TA 3D3IA 1NH2B 1RM1C 1NVPB 2HR3A 3IC7A 2WAMA 4HAMA 1S3JA 1YTFB 2P90A 5CA3A
chains in the Genus database with same CATH superfamily
3ETGA 3K08A 4UVCA 4I55B 2EIMC 4PDLA 1N32B 2HHHB 1QBZA 2YIBA 3IC9A 4NYKA 1P49A 1L0NH 4FMTA 1GRJA 1Q43A 2Q73A 3U11A 1XL6A 2Q68A 1THZA 2IH3C 2DYSB 3K58A 4LF9O 5CB4A 3SPGA 4DV3B 3BAAA 2P6JA 4B7KA 5B1NA 4H44B 4R50A 4PDMA 3ABKB 4HBNA 1URFA 3JASB 4DV5O 2ZM6O 2ZXWB 4BIUA 2UUAB 1BGYH 1WA8B 1N8RW 1XNQO 2WSSG 3BPZA 1NTMH 1PPJH 1IZ3A 3E8GA 3SJAC 4ZIBA 5E1AC 4KXRA 3OGCC 5EYPA 1BS3A 1FXVA 3VQXA 4CH3A 4OGQB 3LSSA 3SJQC 3CCJV 3ETDA 4JI6B 4B3SO 1NBMG 1VF7A 4DR2O 2AZ2A 2P22C 2E5LB 1PP9H 3ASOB 3JAKB 2YXLA 3DC5A 4FK5C 1VARA 2GHYA 3UO3A 3X2QC 5KMGB 2PI5A 1P7GA 2W6IG 3AG1B 2AHZA 1WB7A 3VQVA 1EN4A 3RVYA 3TK1A 2ITCC 2PGGA 1SESA 1IDSA 2ODMA 5KAIZ 4TV8B 1YJWV 1XUQA 4FLXA 2LO1A 2EJRA 2PTMA 1OV9A 5CA1B 1NJIW 2HHHO 3JD2A 2QA4V 4B3RO 4LF4O 1WA8A 3SYAA 5J9PC 5IYCO 3P30A 4MTOA 4LH7A 1BMFG 3ABTA 2ADQB 4UV9A 3IC7A 1Q6IA 2DQ3A 1M1KW 4XDLA 3RYHB 4JI0B 4X8AA 1MA1A 4DR3O 5IJ9B 1F4MA 5IYZB 1S77D 4J7KA 1BSMA 1VF6C 4O4HA 3ZHSA 1DGSA 1HNXB 5LP6B 3KG2A 1OCZC 2BSKB 3MAQA 3HKEA 1QHTA 4RUEA 2ZM6B 1TUBB 1PNLA 4WFEA 4DK1A 2Y0PA 3SYCA 5JJNB 5KA6A 2BOCC 2VWKA 1M9NA 2X6BA 5H6QA 3K06A 2EILB 1IX9A 1DLBA 5IWAB 2E5LO 3P32A 1JPXA 3OUFA 4ZOLA 5ITZB 1WP8A 4DR3B 4U7NA 2UU9B 5BXZA 2VWJA 2CGOA 4K0KB 1NI8A 3A8TA 4IIJB 1RPRA 2WA4A 4J11A 5JQGA 2GV9A 1AJQA 5LMNB 3ZBHA 1K9MW 1FJGB 2UUBO 1WPXA 4DR1B 1WAZA 4J41A 3FYIB 4X62B 1AROP 2E3CA 4JYAB 2CGNA 2G38A 1SETA 1TVKB 3VBBA 1VQPV 3IAYA 1K7DA 1L1FA 4WBNB 5K1XA 2DQ0A 1SQVH 4XDKA 3MHHC 2OIEA 2F43G 4DR7B 4MVZA 3D8CA 1ZX3A 3SYPA 5C93A 4MW3A 3LDEA 5LA6A 2F23A 4GKJB 1AR5A 3CXCU 3J7AU 1KD1W 4LC1A 1H2KA 1V9PA 5L3FA 4JI7O 2W0XA 4J9YB 4JI3O 2ILMA 2Y4UA 3CSXA 1GN4A 4JAUA 2D3OW 4CH5A 1M56C 1BHAA 1AVMA 1WP7A 1YCIA 4N23A 4X65B 4I4TB 2EZPA 3CXHF 5L3CA 3SPCA 4K0KO 1GKFA 3A0RA 4CS4A 4LNUA 3M99B 3HKCB 1GAXA 4TV9B 4MTFA 3JASA 1F51A 3T1YO 1IBKO 2WAMA 1OCOC 3B77A 4GX2A 4PA6A 4FM2A 2DW4A 1XREA 4GX0A 4O4JA 4Q6GA 3JD0A 1PKXA 1F7YA 1H8EG 2EINB 1Y4MA 3RYCB 1Q3EA 1K33A 5LMUB 4B3TO 4DO2A 3FAVA 5KHJA 3AG7A 1QCEA 2UUBB 1GMGA 4JZ2A 5LP6C 2BTOA 3C90A 4AQYB 2YS8A 3SDLA 2VS0A 4XBFA 1MG1A 3UT5A 5KUMA 2Y4TA 3ZMUA 1XI1A 2HVKC 4B3SB 1YDXA 2QM7A 3WG7B 1RSOB 1MABG 2PI4A 4BIZA 3FB5C 2OTJV 2E76B 1I5YA 3ICXA 4X88A 2L35A 2R9AA 4DXWA 2YXHA 3FKSG 5EZYA 3QTCA 1WNSA 4LWSA 5C8YB 1Y76A 1EZJA 3JD1A 4TUYA 1CPYA 1I94O 2VRZA 4LF6O 4ZBMA 4QPKA 4DV0B 1EN6A 2L6LA 5FL7G 1AP5A 4NB5A 3CCRV 4EB6B 3TJTA 1NTKH 1G6UA 3T2MA 4WF9V 2F66C 5FLXN 3CCMV 2H3OA 3E2EA 3D3IA 4KHPO 2YIBD 4I50B 2VQEB 1E1RG 2ZD9A 4P9OA 3RYCA 4IL6Z 1EFRG 4NXNO 3KKYA 4P9PA 4DV1B 3R66A 1VQ5V 4U3JB 3RYIA 3TXQA 5J2TB 2Q6AA 3JAKA 4FLVA 1I94B 2P4KA 5KLVH 2JGDA 1YXBA 1DTOA 3H1LH 3ABMB 1WB8A 1OJHA 3CYOA 5LGTA 1YITV 5LHIA 3CC7V 4I0XA 1KBHA 1NVPB 1M93A 3D36A 3SJCC 3GB7C 2EJ7A 3ZN0A 2B5UA 4Z2WA 1VQ7V 2UXCO 2QTSA 3OTOO 2QWPB 4BAYA 3CEIA 5D5PA 4JI2O 2FL4A 4DV1O 2CH7B 3W7SA 1TVKA 2IJIA 2AXTZ 1YJNV 1FXHA 2UXXA 3ZHVA 5L3DA 1G4YB 1M57B 4NTWA 3HPLC 4QJFB 2HJFC 1E1QG 3CPWU 2ADPA 1PM9A 3SR2C 5LHHA 1SKVA 2IU3A 1FXKC 1BZKA 1VQLV 1N36B 2M6YA 4H33A 2PUSA 4LCUC 5JQGB 3CRQA 3JSNA 1BT8A 5LP6A 5IY5B 1H8HG 4BWAA 4LF7B 3CJHA 1R3JC 3E8HA 4WFHA 1WN7A 4B08A 3G80A 5EBMC 1GK9A 3JAMN 1WPBA 4JF3A 4MSWC 2IBZH 2JGDB 4X20A 3R65A 2QKAA 5J2TA 2VQFO 1K5SA 1S3JA 4I50A 2PYLA 1GN6A 1OCZB 4JI1O 5B1OA 4O2BA 1XQ8A 1JFFB 4JI7B 5CMUA 1K97A 4CC5A 5LYJB 4NR1A 4JI3B 4MVRA 4IIJA 5JVDB 4PA3A 3OTOB 1NT2B 1R3IC 3CMAV 1UFIA 4HYOA 4I0XB 1Y67A 2Z3YA 2EIJB 1FD9A 3CCUV 3RBZA 3N2GB 2QWRB 2W0FC 5KMGA 4JI5B 1EN5A 3AK2A 1K3EA 3NR7A 3L74H 3AK1A 5JCOA 2JS3A 4DR7O 3W7XA 5B1BC 4WFBV 4JI1B 3OR6C 3HB3B 2ATKC 2DYSC 5CN0A 1V54B 2YI9A 3HKDA 5EIBD 2Q0OC 1W59A 4DV6O 1CEZA 1H2GA 4X1IA 2Q67A 3ZHUA 3BABA 3UT5B 3P3PA 3SYOA 3L9DA 1W2BU 1F4NA 4MT8A 1J5EO 2QGNA 2CTPA 4YHHB 4IT5A 1B3QA 2NN4A 2LGWA 4HAMA 1Q7YW 2F1MA 2UXDO 2OWOA 2B1GA 5FPRA 3CJHB 5AG2A 2JJ1G 1K4DC 3K59A 4LFCO 2QKCA 2H8PC 3BEHA 2ZDIC 2KSDA 4UCTA 4JI8O 4ZKIA 5BR8B 1S76D 2UXBO 3HKEB 3E8FA 3QF7A 1QU7A 4BW5A 1AI5A 3JALA 4AQYO 1HNZB 4ZHQB 4O4HB 2IW5A 4YJ2B 4LFBB 3JSLA 4YJ3A 3K03A 4ABMA 4MVSA 1HWYA 2X0LA 4DR4B 4RWUA 1JX9A 1K92A 3SJBC 5C8YA 1V55C 1YJ9V 2VQFB 4TUYB 3LDDA 2KB1A 3OMAB 3F7VC 1N33O 1GH6A 5B3SC 4LF9B 5EZYB 4NXMB 4O4JB 4FLTA 3EHBB 2WLIB 4J9ZB 4PA9A 5BR8O 3GVMA 1SA0B 3JAWB 2V7QG 3HKDB 4EFBA 1AI7A 4RO2A 1YTFB 2QE7G 1J95A 4NKGB 2BTQB 5LGUA 3CD6V 3ZX6A 2UXDB 2ZE7A 4F6EA 4J7JA 2OIGA 1W0JG 2YSUB 1Z2GA 3OFNG 3JATA 3E35A 5CA0B 1UJWB 2OCCC 1IBLO 1N33B 1FYJA 2WLHA 3H9VA 1KP3A 1ROPA 2XUMA 2HVJC 3SPJA 3ZEDA 2GSMB 1L8DA 3APQA 4O4IB 2UXCB 3IGAC 2YUAA 1XNRO 1SRYA 4FZ1A 5GONA 3LSQA 5LOVA 1SQXH 1ORQC 4FFBB 1SA0A 1TGOA 2Y69C 4YHHO 3ETEA 4DR2B 3JAWA 4IYIA 4B3RB 3D36C 2ZE8A 4DR4O 2CDYA 2OCHA 2YDEA 1XHZA 3ZRSA 2DN9A 1COWG 4P30A 3B09A 5CA0A 1O9GA 1GM7A 4JZGA 1MNGA 4J10A 2XASA 1X4TA 4I5SA 5A2QN 1XMQB 4IHJA 4C7UA 1S5LZ 4LFAO 5F2VO 5LA6B 2XHBA 1I5XA 2GUZB 4I7ZB 3CCSV 1IBLB 4QPJA 3UO2A 4GX1A 3S3XA 1XBLA 4WFFA 4YIPA 5BMVA 1GTOA 1BQ0A 4D6TH 5FNVB 5IYZA 3JARA 2Q4PA 2ZE5A 5HFMA 2W6JG 4MVOA 4B3MB 1PL4A 3RFRA 3QG5A 4MVQA 5H2FZ 3RN4A 1G1XB 2R72A 3UM7A 1NR7A 4I4TA 4R8CA 4Q20A 5GONB 4FFKA 4IYHA 5KA5A 1EZVH 2BE3A 3AG1C 4O2AA 1UPGA 2N05A 1Q90D 2LP7A 3UKMA 4J80A 5LMNO 2BOBC 2JDIG 4UCUA 3G71V 4PA4A 2E75B 2GDSA 3T1HB 5EC2C 4YIOA 2DYRB 5IDJA 3W7TA 3EFFK 3J81N 3DGEA 3N2GA 4X62O 4LR3A 1Y74A 2WLMA 4PV1B 1NH2D 5L3BA 2HP8A 4UB6Z 1OCCC 1KKDA 4MVUA 4CZZA 1N0NA 2GTAA 1N32O 1TUEB 3T4DA 2X7RB 4WBNA 5TISZ 4D7TA 4EB6A 3RT3C 1IXMA 1AR4A 4F4LA 1I7FA 4GX5A 4FLWA 1IXBA 3J80N 3H01A 3ZMVA 1HNZO 2NR5A 1ZTEA 2ZDIA 3JCUZ 1VIBA 3QVNA 1XMQO 2XT9A 4RQEA 3QO8A 2R9RB 3ZHTA 2PYJA 1I08A 4DV6B 2WPDG 5CBHA 4YJ2A 3G6EV 1KYOF 5DEDA 1O9HA 3ETQA 1ZWIC 4J42A 4JTCB 3CWBH 5JJEB 2F95B 4FIPC 2UUAO 2YEVA 4PJ0Z 2Y69B 1CXZB 2UUCO 4X64B 4QE9A 3THOA 2HLDG 4OX9O 4KUMA 2A0LA 4JYYA 2EIKB 3H1IH 1QQCA 3UCSC 1X59A 3ZHRA 2V4DA 1FXKA 4K35A 4DV4O 4YJ3B 2ZNIA 1ZL8B 2HJDA 4KP4A 4WFGA 5EYPB 5LMUO 1KQSU 1OCRC 3LNNA 4YY3B 1HNXO 3K5OA 2Q7GA 1JFFA 4CH4A 2P7TC 1RM1B 1US6A 2Q9LA 4X64O 3N27A 2Q69A 1MOFA 2K1EA 2EILC 3AG3B 3SGIA 4F6RB 5KX5A 4L87A 3ML0A 2CH7A 2QM8A 1IBMB 1N36O 4E2LA 2BCCH 5JH7B 4DUZB 3EXAA 1NH2B 1A32A 4DRXA 1LUWA 2JS5A 1VQ9V 2PF4E 4FVMA 3ZMTA 4XDJA 2UXNA 3APOA 5L3EA 1QR9A 2IJJA 4X1IB 4WCEV 3OMNB 5KHHA 1R6KA 3AG4B 4TSFG 4ZI7A 5JCOC 2WLJA 1V55B 1S72V 4B3TB 1FJGO 1JJOA 3DC6A 1HNWO 1IBMO 4AI8A 5CB4B 4U3JA 3RYIB 1Y76B 2YI8A 2MK3A 1OZ0A 3IFXA 2XTAA 3CCEV 1R3KC 4FLUA 4DV0O 3ZMSA 2P5OA 3CCVV 4ICGA 1KECA 2EZOA 1Y66A 4HNAB 2QWNB 2ZR3A 3BVOA 2P4VA 2Y0IA 4UB8Z 2ZE6A 4I55A 3CC2V 3B2EE 5IJ9A 4W4KA 3DXRB 1AB3A 4JGSA 3CB2A 4NXNB 1B04A 5DECA 4UCVA 2QWOB 2LW1A 1JMKC 1VP7A 5KX5B 1S5JA 3CE2A 1VQMV 3NXSA 3OMIB 2B1IA 4ZHQA 2OYQA 4LNUB 1WJZA 2ZIMA 4L8JA 2V1DA 4UV8A 4PI2A 4DV5B 2O57A 3WFVA 4DK0A 3MDSA 1QLEB 1XNQB 3ZIAG 2N04A 4CH6A 4PA7A 2OT5A 4UCSA 1S0VA 1OCOB 4QIWF 5LGNA 4JI8B 4TOIA 2X6CA 4WFAV 1AI6A 4Z1VA 3D3QA 3CCLV 2EINC 4JYAO 2LFSA 4X66B 4GKKB 5KUKA 1Z5VA 4RAIA 3OT7A 5HFLA 3LDCA 1AJPA 1SQGA 3ASNB 5BY1A 4JPRA 4EEQA 2BTQA 1G8MA 2E74B 1K73W 2FB5A 1GM9A 3HKCA 2DE0X 3KZIZ 3N2KA 2LW7A 4J7ZA 1XDCA 3L73H 1SQPH 2AZ0A 3OGIB 1AR1B 5LHGA 1HNWB 3GWKC 3E8BA 3K57A 3B4SA 3LSUA 1BHBA 5JWPA 4K3AA 3BHPA 3OTFA 4X1YB 4W4LA 1SS3A 3EVKA 2F4VB 5BZBA 5IWAO 1ZSPA 4TWKA 1NVPD 2XAFA 3RWRD 2XAQA 4QGPA 2R70A 3ZMZA 4DUYB 2RDCA 5IJ0A 4LF8B 4BW9A 4FFBA 2RN9A 2JIZG 3ZCCA 3E86A 5LOVB 4G2KA 2WA3A 5IYDO 1KU9A 1FS0G 3G67A 2FKXA 4QNHB 4UCOA 1RFYA 1D5AA 2Q7EA 4PDRA 4DR1O 5EBLC 2XAHA 1YVWA 1ENVA 5FNVA 3E22B 3MD0A 4GUNA 5IY5C 1YF2A 4OPHA 2ZXWC 3WU2Z 2ITDC 1PD3A 1QVGU 2ZQMA 2QKSA 2LGQA 1RSOA 3G4SV 4DR5O 4DR6O 4JI4O 3H1KH 1QLNA 3AG2C 2GUZA 1D5NA 2LFRA 1DK1A 3JALB 3N2KB 1R6NA 4IGGA 2QEXV 1M90W 5H6RA 3BA9A 4IHJB 5KHIA 4FLZA 2ZKOA 1M5IA 3U10A 4FLYA 5IJ0B 1U96A 1T5EA 5ITZA 4DV4B 3OEHG 4LFBO 1NKDA 4NVPA 3JARB 4JYCA 4X1YA 2A79B 3JYCA 1HR0O 1FKAO 1TAEA 1ZUQA 4KFMA 1ZLZA 4D7SA 4AHCA 3FB8C 1PV0A 5B1BB 5LXTB 4FZ0A 1B6QA 4DV3O 3BCCH 4B3MO 1AJNA 1SZXA 3K9AA 2M7WA 1MZEA 1N0JA 3CRCA 1FAFA 1JA8A 4NTYA 3ABLC 1V54C 4F6RA 4LBEC 2IU0A 4MTGA 2PZSA 2OTLV 4UCRA 2RNBA 4UUJC 3DXRA 4PI0A 1Q5OA 1FFTB 3F5WC 3FX7A 1FPOA 1LR1A 4UVAA 3RYFB 4PD4F 3O9OA 4DR5B 4DR6B 4JI4B 1LUVA 4DV7O 2IJKA 4JASA 2EIJC 2LQTA 2N74A 1AILA 1GN3A 4AILC 5DM6V 2FYUH 1GN2A 3BRCA 4NTXA 4FJCC 2CK3G 5GTIZ 3K3WA 4E4EA 5EIBC 4I9QA 5A9GA 3L75H 4BIOA 4X65O 3K5MA 2HR3A 4OPAA 3CCQV 1K8AW 4X1KB 3Q4HA 4EKWA 3T4ZA 3VQYA 3OM3B 4OX9B 3ABUA 3GWOA 1M56B 4O4LB 2C2AA 3ZS8C 3DTUB 4JAVA 1JJ2U 4UXNA 1L0LH 4R7CA 3BY6A 4DV7B 1IBKB 1Q8IA 1IURA 5B1AB 1N34B 4UFZA 3RGBA 2ZCEA 1HW7A 4B7EA 1BCCH 2AHYA 2D2CB 1JQ0A 4H13B 1FXKB 2QTOA 2Q5ZA 2WWWA 1YEWA 2DMXA 4X89A 1KC8W 2FMLA 3WB2A 1XOUA 2KG7A 3ZJZA 3STLC 4I9WA 1SF9A 3ZHQA 1R3LC 4DYLA 1W0KG 3H1JH 2CE4A 3TXSA 2RMKB 1DF4A 2IH1C 3SPHA 2ARHA 2BSKA 3QO5A 1P7BA 2NNUA 3E89A 2Q7HA 4PHZA 4X1KA 3I56V 1M4UA 1NTZH 1AP6A 4GKKO 2JEXA 3OR7C 3K79A 1BL8A 2UU9O 5E79Z 2JEUA 1XMOO 2LJ2A 4DW0A 5KHKA 1WLEA 2JRIA 3ZRWB 2CTRA 3E83A 3T1HO 4PELA 1H38A 4JI6O 3CMEV 3K5NA 1JR9A 2JGUA 3A0HZ 1QR8A 4HNAA 5CA3A 5J2UA 1QLEC 1XEQA 5LL6Y 2A06H 2UXBB 4CC6A 2XAGA 5IT9N 1NQTA 1DF5A 4LF7O 1U97A 3Q4HB 3K04A 1VEWA 1JOYA 4DV2O 1N34O 2ZNJA 4TQFA 5L3GA 3LUTB 2ETNA 1MMMA 2IM9A 2JVDA 3ABLB 1P84F 4OXSA 3OUSA 5CBGA 2QJ1A 3T1YB 2FTKA 3JCZA 1S5HC 3OE7G 1SERA 2EIMB 2Q8VA 3P3NA 4TV8A 1YHQV 1NS1A 2CUGA 1K5QA 1K34A 5IE9A 2KG7B 2WLIA 1YIJV 3QO7A 1YTFD 1Q6UA 3JD3A 1EBOA 4H0LB 1VQ8V 3ZRWA 3KCYA 1LNQA 1SQFA 2WLLA 2HKOA 4GT1A 1VQOV 1RP3B 3AK3A 4PDVA 5GW7A 4TV9A 2YEVB 1NZ6A 2YC0A 1HR0B 5EK0A 5CA1A 1H2LA 2ZIOA 3F7YC 5B3SB 4GZRB 1I0HA 5JJJB 3RYFA 1OHHG 3IJ4A 1Q86W 5LXTA 1SZTA 2ZT9B 2GBOA 4GCZA 5GTHZ 3FD9A 3C3TA 4QE7A 5B5EZ 3FAVB 4LF6B 5H5NA 4MW8A 1R1BA 2DWEC 1FFXB 1ZL8A 1BE3H 1KKCA 3FFQA 2A3QA 4JV5O 1VQ6V 4LH6A 3ASOC 5FPOA 3SYQA 1MZFA 1MSWD 4FPPA 4RUFA 1VF6A 3SPIA 1N4CA 2P06A 2WLKA 4EFEA 5BMVB 4UVBA 1XILA 2NLJC 1JVMA 3A2FA 3A0BZ 4X66O 2Z5UA 1IVSA 3WG7C 1KMIZ 3VOUA 4FM0A 1VQNV 2EX3A 1P4RA 4LFCB 3L72H 1KUQA 3C3SA 4A5UB 2ZINA 4JV5B 3LNMB 2HG5C 3U0ZA 1XHXA 3B40A 4ASUG 1GM8A 1E79G 3ZRVA 1EM1A 2QM4A 4R6ZA 3E22A 2RQ6A 4ZI7B 2QR4A 1OCCB 3G6BA 2DJVA 4O2AB 3L71H 1Q82W 5KAFZ 1YI2V 3CRRA 2OCCB 4LFAB 4P2ZA 3HKBB 4N21A 3K5LA 1H2SB 2DOSA 2EULA 4HZ3A 4LF5O 4NXMO 1VMGA 4G28B 5KHGA 2DWDC 5IYBO 3OEEG 3WB1A 4DRXB 4CS2A 4U7OA 1B06A 2Y48A 3K0GA 2XNDG 2HEPA 2RJZA 3F5TA 3ABMC 3AG3C 4YXWG 4K8XA 1JCHA 3PN1A 5EC1C 1KP2A 1RM1C 4DW1A 3OAAG 1F23A 3JD4A 3OD4A 1TA8A 2HFEC 2AW9A 2YIAA 1AI4A 4O4LA 3TGUH 3CC4V 5J2UB 2CAZC 2F93B 2EBOA 2P67A 4JI2B 2Q0AA 1YSCA 1Y74B 2AGAA 2XAJA 2XOKG 4TQDA 4ZOLB 2JJ2G 1RPOA 1Z5WA 1MSDA 1H2NA 1KB9F 2QWQB 2YXYA 1NU1H 3I5DA 3RW0A 2QDOA 3JATB 1M57C 3TCUA 3WB0A 3ABKC 3CX5F 3K9SA 1H2MA 5D5QA 3I55V 3AG4C 3HKBA 2MW2B 1OCRB 4MTXA 1R6TA 4X9QA 5B1AC 4JAAA 3PJSK 2A9HA 4KL1A 5LYJA 4JI0O 3CRMA 3W7UA 3B8NA 4LF5B 1ZAUA 3BA8A 1D2DA 3MHSC 4O2BB 1VQ4V 2R9IA 2RCVA 4O4IA 3W7WA 2ZR2A 4FM1A 1XMOB 5LBQA 4GYCB 3HR0A 4Z1MG 5EBWC 3RYHA 4MS2A 4X20B 3X2QB 4JYBA 1PNKA 2JK5C 3UQ8A 1XNRB 2IJHA 2CTQA 1K4CC 2VQEO 1NR1A 4YY3O 4DUZO 2YIDA 1HP8A 1TUBA 2Z0AA 4K8ZA 3RVZA 2P90A 3O65A 3ZN1A 2A7WA 2K9PA 1HDJA 3DSQA 4LF8O 4DV2B 5JVDA 4CBCA 2DYRC 3QNEA 4H37A 4JTDB 4JI5O 3L70H 1R73A 3AEIA 2UUCB 2WLNA 4BR6A 4LWSB 1PNMA 5H9CA 4GKJO 5DN6G 2QSAA 2F4VO 1Y6XA 2GTSA 2CTWA 3VQWA 2WLLB 2YICA 4U3FH 1Q6HA 2KKWA 3ZRXA 1YZBA 1QVFU 1VQKV 4KHPB 3FB6C 2KQXA 4JTAB 2EIKC 1SC5B 1XL4A 3TETA 1BQZA 3H1HH 3FYEB 1VF5B 3CRAA 2B9ZA 1SQQH 3AG2B 2PY5A 3FB7C 1J5EB 3OW2U 3M7MX 4CS3A 5B66Z 4DUYO 5K1PA 4MVMA 4G27B 3CHXA 3CP1A 4LP8A 2X6AA 3STZC 3S3WA 2H94A 3K0DA 1PL0A 1GO3F 4LF4B 5JH7A 3CS5A 3ASNC 3BFRA 3M8AA 4RQFA 1SQBH 1QNMA 4TT3G 1FFXA 3B8MA 4GLXA 3T1CA 3KCXA 1Q81W 1CP9A 5CBFA
chains in the Genus database with same CATH topology
3ETGA 3ZJZA 3STLC 4I9WA 5L3DA 1G4YB 1M57B 3K08A 3HPLC 4QJFB 2HJFC 1R3LC 4UVCA 2EIMC 1W0KG 4KP4A 1E1QG 4PDLA 4WFGA 3CPWU 1QBZA 5LHHA 1KQSU 1DF4A 1OCRC 2IU3A 1FXKC 2IH1C 4FMTA 3SPHA 1VQLV 4H33A 3QO5A 1P7BA 4LCUC 2NNUA 3E89A 1XL6A 5IY5B 1H8HG 2Q68A 1THZA 2P7TC 1RM1B 3I56V 2IH3C 2Q69A 2DYSB 1MOFA 1R3JC 2K1EA 2EILC 2JEXA 3AG3B 3E8HA 3OR7C 4WFHA 3SPGA 5EBMC 1GK9A 3K79A 1BL8A 3ML0A 4L87A 4JF3A 4MSWC 2P6JA 5B1NA 2QM8A 4R50A 2JEUA 3R65A 4PDMA 4E2LA 1WLEA 1NH2B 3ZRWB 1K5SA 3E83A 1S3JA 4PELA 1H38A 1VQ9V 3ABKB 1OCZB 3CMEV 2ZXWB 4BIUA 5B1OA 3ZMTA 4XDJA 1QR8A 2UXNA 5CA3A 1N8RW 2WSSG 1QLEC 5CMUA 5L3EA 1K97A 3E8GA 1QR9A 2IJJA 4WCEV 3OMNB 5E1AC 4MVRA 4PA3A 1R3IC 3OGCC 3CMAV 1R6KA 3AG4B 4TSFG 2XAGA 1FXVA 1NQTA 2WLJA 1DF5A 1V55B 4HYOA 1S72V 3LSSA 3SJQC 3CCJV 3ETDA 2Z3YA 2EIJB 1NBMG 3CCUV 3K04A 3RBZA 1JOYA 3ASOB 2W0FC 5L3GA 4FK5C 2GHYA 3LUTB 1K3EA 3ABLB 3X2QC 2MK3A 2PI5A 1OZ0A 3IFXA 3W7XA 2W6IG 4OXSA 3CCEV 3AG1B 3OUSA 2AHZA 5B1BC 5CBGA 1R3KC 4WFBV 3RVYA 3TK1A 3ZMSA 3CCVV 3OR6C 2ITCC 2FTKA 3JCZA 3HB3B 1SESA 2ATKC 2DYSC 5CN0A 1KECA 2EZOA 1V54B 1Y66A 1S5HC 3OE7G 2ZR3A 1SERA 1YJWV 2EIMB 1YHQV 1CEZA 1H2GA 2EJRA 2Q67A 3CC2V 1NJIW 3JD2A 3SYOA 1K5QA 2QA4V 1K34A 1W2BU 3SYAA 5J9PC 2WLIA 5IYCO 1F4NA 3P30A 4MTOA 4MT8A 1YIJV 3QO7A 1YTFD 4JGSA 3JD3A 1EBOA 1BMFG 1VQ8V 3ABTA 4UV9A 3ZRWA 3IC7A 4HAMA 1Q7YW 2B1GA 2DQ3A 1LNQA 1M1KW 4XDLA 2WLLA 2HKOA 4GT1A 2JJ1G 4X8AA 1VQOV 1K4DC 2H8PC 4PDVA 3BEHA 2ZDIC 5GW7A 2YEVB 1F4MA 1S77D 1VQMV 4ZKIA 3NXSA 1S76D 3OMIB 2B1IA 5EK0A 3E8FA 3F7YC 5B3SB 3KG2A 1OCZC 2V1DA 4BW5A 1AI5A 4UV8A 1OHHG 1Q86W 3WFVA 4RUEA 1QLEB 1SZTA 2IW5A 1PNLA 4GCZA 3ZIAG 4WFEA 3K03A 4PA7A 4MVSA 1HWYA 2OT5A 4QE7A 1S0VA 1OCOB 4QIWF 2X0LA 3SYCA 5KA6A 5LGNA 4MW8A 2DWEC 2BOCC 1JX9A 2X6CA 4WFAV 1AI6A 1K92A 1M9NA 3CCLV 2X6BA 1V55C 5H6QA 3K06A 1YJ9V 2EINC 2EILB 3LDDA 1DLBA 2KB1A 3OMAB 2LFSA 3F7VC 1VQ6V 3ASOC 5B3SC 3SYQA 3P32A 1JPXA 3OUFA 5KUKA 1MSWD 4FPPA 4RAIA 5HFLA 3EHBB 4U7NA 4RUFA 3LDCA 2WLIB 4J9ZB 3SPIA 1AJPA 4PA9A 2WLKA 3ASNB 1RPRA 4JPRA 4UVBA 1G8MA 1K73W 2V7QG 1GM9A 2NLJC 1JVMA 1AJQA 1AI7A 4RO2A 1YTFB 2QE7G 1J95A 2Z5UA 1K9MW 3WG7C 5LGUA 1AR1B 5LHGA 3CD6V 3VOUA 1VQNV 3E8BA 1WPXA 1P4RA 1W0JG 2YSUB 1BHBA 3OFNG 3FYIB 3E35A 1UJWB 2OCCC 1AROP 5BZBA 1SETA 3LNMB 2HG5C 3VBBA 1VQPV 4TWKA 4ASUG 1GM8A 1E79G 3ZRVA 1K7DA 2WLHA 1NVPD 1KP3A 1ROPA 2XAFA 2HVJC 2XAQA 1L1FA 3SPJA 4R6ZA 3ZMZA 2GSMB 2DQ0A 1OCCB 3IGAC 4XDKA 3MHHC 1Q82W 1SRYA 2F43G 2JIZG 4MVZA 3E86A 3LSQA 3ZCCA 1YI2V 3SYPA 5C93A 4G2KA 5IYDO 4MW3A 3LDEA 1ORQC 2OCCB 1FS0G 4P2ZA 4QNHB 4N21A 2Y69C 3CXCU 3ETEA 4PDRA 1KD1W 5EBLC 4LC1A 4HZ3A 4G28B 2XAHA 2DWDC 5IYBO 1ENVA 3OEEG 5L3FA 4U7OA 3MD0A 5IY5C 2Y48A 3K0GA 2ZXWC 4J9YB 2ITDC 1PD3A 2XNDG 3ZRSA 1COWG 1QVGU 4P30A 2ZQMA 2QKSA 3ABMC 3AG3C 4JAUA 1GM7A 4YXWG 2D3OW 1JCHA 1M56C 2XASA 5EC1C 1BHAA 4I5SA 1KP2A 3G4SV 1RM1C 4N23A 1QLNA 3AG2C 3OAAG 2LFRA 2EZPA 5L3CA 1F23A 3JD4A 3SPCA 2HFEC 1R6NA 2QEXV 1M90W 5H6RA 1GKFA 1AI4A 1I5XA 3A0RA 3M99B 3CC4V 3CCSV 2EBOA 2P67A 1YSCA 4QPJA 4MTFA 1F51A 4GX1A 4WFFA 2XAJA 2WAMA 2XOKG 1GTOA 1OCOC 3B77A 4GX2A 4PA6A 2DW4A 3OEHG 4GX0A 3JD0A 1NKDA 1PKXA 2JJ2G 1RPOA 1H8EG 2EINB 3RW0A 5HFMA 1Y4MA 1M57C 4JYCA 2W6JG 3TCUA 4MVOA 3ABKC 1K33A 3I55V 3AG4C 4DO2A 4MVQA 2A79B 1QCEA 3JYCA 3UM7A 1OCRB 4MTXA 1NR7A 1GMGA 5B1AC 4R8CA 4KFMA 3PJSK 4Q20A 2A9HA 3FB8C 3W7UA 5KA5A 3AG1C 5B1BB 3B8NA 4XBFA 1MG1A 5KUMA 3MHSC 1B6QA 1VQ4V 2LP7A 2R9IA 3UKMA 3ZMUA 1AJNA 2HVKC 2QM7A 3WG7B 3W7WA 1MABG 2BOBC 2ZR2A 3K9AA 2JDIG 4BIZA 2PI4A 3FB5C 2M7WA 2OTJV 3G71V 1I5YA 5LBQA 4PA4A 4X88A 4DXWA 4Z1MG 5EC2C 5EBWC 3FKSG 2DYRB 4MS2A 3ABLC 3X2QB 1V54C 5IDJA 3EFFK 4JYBA 3W7TA 3DGEA 1PNKA 4LBEC 2IU0A 1EZJA 2JK5C 3JD1A 4MTGA 1CPYA 2IJHA 2OTLV 1K4CC 4UUJC 4ZBMA 4QPKA 1FFTB 1NR1A 2WLMA 3F5WC 1NH2D 5L3BA 5FL7G 1OCCC 1KKDA 3RVZA 2P90A 4MVUA 3CCRV 3ZN1A 4UVAA 4CZZA 3T2MA 4WF9V 3CCMV 1TUEB 4CBCA 2IJKA 2DYRC 3QNEA 4H37A 3D3IA 2EIJC 4JASA 2X7RB 3T4DA 3E2EA 4JTDB 5DM6V 1E1RG 1R73A 1IXMA 3AEIA 4F4LA 2WLNA 2ZD9A 4GX5A 1PNMA 4P9OA 5H9CA 1EFRG 4FJCC 2CK3G 3K3WA 3H01A 3ZMVA 5DN6G 4P9PA 1VQ5V 2WLLB 2ZDIA 2Q6AA 3ZRXA 2HR3A 1QVFU 3CCQV 4RQEA 1VQKV 3QO8A 1K8AW 2R9RB 1DTOA 3FB6C 4EKWA 3T4ZA 3ABMB 2WPDG 3OM3B 2EIKC 4JTAB 3CYOA 5CBHA 3ABUA 5LGTA 3GWOA 1M56B 1XL4A 1YITV 3TETA 5LHIA 2C2AA 3G6EV 3CC7V 3DTUB 4JAVA 1JJ2U 3FYEB 4UXNA 4R7CA 1NVPB 1ZWIC 3AG2B 4JTCB 3FB7C 3BY6A 3D36A 3OW2U 3GB7C 5B1AB 4FIPC 3ZN0A 2YEVA 2B5UA 2Y69B 4MVMA 1VQ7V 4QE9A 2AHYA 4G27B 2HLDG 1JQ0A 2X6AA 3CP1A 4LP8A 4KUMA 2H94A 3STZC 3K0DA 1PL0A 1FXKB 1GO3F 2A0LA 2QTOA 3ASNC 2EIKB 4BAYA 4RQFA 2WWWA 4X89A 4TT3G 1KC8W 3W7SA 2IJIA 3B8MA 1YJNV 1FXKA 3T1CA 1Q81W 1FXHA 1CP9A 5CBFA 2UXXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W7X A;  3E35 A;  3W7S A;  3W7W A;  3W7U A;  3BY6 A;  5GW7 A;  3W7T A;  3D3I A;  1NH2 B;  1RM1 C;  1NVP B;  2HR3 A;  3IC7 A;  2WAM A;  4HAM A;  1S3J A;  1YTF B;  2P90 A;  5CA3 A; 
#chains in the Genus database with same CATH topology
 3ETG A;  3K08 A;  4UVC A;  4I55 B;  2EIM C;  4PDL A;  1N32 B;  2HHH B;  1QBZ A;  2YIB A;  3IC9 A;  4NYK A;  1P49 A;  1L0N H;  4FMT A;  1GRJ A;  1Q43 A;  2Q73 A;  3U11 A;  1XL6 A;  2Q68 A;  1THZ A;  2IH3 C;  2DYS B;  3K58 A;  4LF9 O;  5CB4 A;  3SPG A;  4DV3 B;  3BAA A;  2P6J A;  4B7K A;  5B1N A;  4H44 B;  4R50 A;  4PDM A;  3ABK B;  4HBN A;  1URF A;  3JAS B;  4DV5 O;  2ZM6 O;  2ZXW B;  4BIU A;  2UUA B;  1BGY H;  1WA8 B;  1N8R W;  1XNQ O;  2WSS G;  3BPZ A;  1NTM H;  1PPJ H;  1IZ3 A;  3E8G A;  3SJA C;  4ZIB A;  5E1A C;  4KXR A;  3OGC C;  5EYP A;  1BS3 A;  1FXV A;  3VQX A;  4CH3 A;  4OGQ B;  3LSS A;  3SJQ C;  3CCJ V;  3ETD A;  4JI6 B;  4B3S O;  1NBM G;  1VF7 A;  4DR2 O;  2AZ2 A;  2P22 C;  2E5L B;  1PP9 H;  3ASO B;  3JAK B;  2YXL A;  3DC5 A;  4FK5 C;  1VAR A;  2GHY A;  3UO3 A;  3X2Q C;  5KMG B;  2PI5 A;  1P7G A;  2W6I G;  3AG1 B;  2AHZ A;  1WB7 A;  3VQV A;  1EN4 A;  3RVY A;  3TK1 A;  2ITC C;  2PGG A;  1SES A;  1IDS A;  2ODM A;  5KAI Z;  4TV8 B;  1YJW V;  1XUQ A;  4FLX A;  2LO1 A;  2EJR A;  2PTM A;  1OV9 A;  5CA1 B;  1NJI W;  2HHH O;  3JD2 A;  2QA4 V;  4B3R O;  4LF4 O;  1WA8 A;  3SYA A;  5J9P C;  5IYC O;  3P30 A;  4MTO A;  4LH7 A;  1BMF G;  3ABT A;  2ADQ B;  4UV9 A;  3IC7 A;  1Q6I A;  2DQ3 A;  1M1K W;  4XDL A;  3RYH B;  4JI0 B;  4X8A A;  1MA1 A;  4DR3 O;  5IJ9 B;  1F4M A;  5IYZ B;  1S77 D;  4J7K A;  1BSM A;  1VF6 C;  4O4H A;  3ZHS A;  1DGS A;  1HNX B;  5LP6 B;  3KG2 A;  1OCZ C;  2BSK B;  3MAQ A;  3HKE A;  1QHT A;  4RUE A;  2ZM6 B;  1TUB B;  1PNL A;  4WFE A;  4DK1 A;  2Y0P A;  3SYC A;  5JJN B;  5KA6 A;  2BOC C;  2VWK A;  1M9N A;  2X6B A;  5H6Q A;  3K06 A;  2EIL B;  1IX9 A;  1DLB A;  5IWA B;  2E5L O;  3P32 A;  1JPX A;  3OUF A;  4ZOL A;  5ITZ B;  1WP8 A;  4DR3 B;  4U7N A;  2UU9 B;  5BXZ A;  2VWJ A;  2CGO A;  4K0K B;  1NI8 A;  3A8T A;  4IIJ B;  1RPR A;  2WA4 A;  4J11 A;  5JQG A;  2GV9 A;  1AJQ A;  5LMN B;  3ZBH A;  1K9M W;  1FJG B;  2UUB O;  1WPX A;  4DR1 B;  1WAZ A;  4J41 A;  3FYI B;  4X62 B;  1ARO P;  2E3C A;  4JYA B;  2CGN A;  2G38 A;  1SET A;  1TVK B;  3VBB A;  1VQP V;  3IAY A;  1K7D A;  1L1F A;  4WBN B;  5K1X A;  2DQ0 A;  1SQV H;  4XDK A;  3MHH C;  2OIE A;  2F43 G;  4DR7 B;  4MVZ A;  3D8C A;  1ZX3 A;  3SYP A;  5C93 A;  4MW3 A;  3LDE A;  5LA6 A;  2F23 A;  4GKJ B;  1AR5 A;  3CXC U;  3J7A U;  1KD1 W;  4LC1 A;  1H2K A;  1V9P A;  5L3F A;  4JI7 O;  2W0X A;  4J9Y B;  4JI3 O;  2ILM A;  2Y4U A;  3CSX A;  1GN4 A;  4JAU A;  2D3O W;  4CH5 A;  1M56 C;  1BHA A;  1AVM A;  1WP7 A;  1YCI A;  4N23 A;  4X65 B;  4I4T B;  2EZP A;  3CXH F;  5L3C A;  3SPC A;  4K0K O;  1GKF A;  3A0R A;  4CS4 A;  4LNU A;  3M99 B;  3HKC B;  1GAX A;  4TV9 B;  4MTF A;  3JAS A;  1F51 A;  3T1Y O;  1IBK O;  2WAM A;  1OCO C;  3B77 A;  4GX2 A;  4PA6 A;  4FM2 A;  2DW4 A;  1XRE A;  4GX0 A;  4O4J A;  4Q6G A;  3JD0 A;  1PKX A;  1F7Y A;  1H8E G;  2EIN B;  1Y4M A;  3RYC B;  1Q3E A;  1K33 A;  5LMU B;  4B3T O;  4DO2 A;  3FAV A;  5KHJ A;  3AG7 A;  1QCE A;  2UUB B;  1GMG A;  4JZ2 A;  5LP6 C;  2BTO A;  3C90 A;  4AQY B;  2YS8 A;  3SDL A;  2VS0 A;  4XBF A;  1MG1 A;  3UT5 A;  5KUM A;  2Y4T A;  3ZMU A;  1XI1 A;  2HVK C;  4B3S B;  1YDX A;  2QM7 A;  3WG7 B;  1RSO B;  1MAB G;  2PI4 A;  4BIZ A;  3FB5 C;  2OTJ V;  2E76 B;  1I5Y A;  3ICX A;  4X88 A;  2L35 A;  2R9A A;  4DXW A;  2YXH A;  3FKS G;  5EZY A;  3QTC A;  1WNS A;  4LWS A;  5C8Y B;  1Y76 A;  1EZJ A;  3JD1 A;  4TUY A;  1CPY A;  1I94 O;  2VRZ A;  4LF6 O;  4ZBM A;  4QPK A;  4DV0 B;  1EN6 A;  2L6L A;  5FL7 G;  1AP5 A;  4NB5 A;  3CCR V;  4EB6 B;  3TJT A;  1NTK H;  1G6U A;  3T2M A;  4WF9 V;  2F66 C;  5FLX N;  3CCM V;  2H3O A;  3E2E A;  3D3I A;  4KHP O;  2YIB D;  4I50 B;  2VQE B;  1E1R G;  2ZD9 A;  4P9O A;  3RYC A;  4IL6 Z;  1EFR G;  4NXN O;  3KKY A;  4P9P A;  4DV1 B;  3R66 A;  1VQ5 V;  4U3J B;  3RYI A;  3TXQ A;  5J2T B;  2Q6A A;  3JAK A;  4FLV A;  1I94 B;  2P4K A;  5KLV H;  2JGD A;  1YXB A;  1DTO A;  3H1L H;  3ABM B;  1WB8 A;  1OJH A;  3CYO A;  5LGT A;  1YIT V;  5LHI A;  3CC7 V;  4I0X A;  1KBH A;  1NVP B;  1M93 A;  3D36 A;  3SJC C;  3GB7 C;  2EJ7 A;  3ZN0 A;  2B5U A;  4Z2W A;  1VQ7 V;  2UXC O;  2QTS A;  3OTO O;  2QWP B;  4BAY A;  3CEI A;  5D5P A;  4JI2 O;  2FL4 A;  4DV1 O;  2CH7 B;  3W7S A;  1TVK A;  2IJI A;  2AXT Z;  1YJN V;  1FXH A;  2UXX A;  3ZHV A;  5L3D A;  1G4Y B;  1M57 B;  4NTW A;  3HPL C;  4QJF B;  2HJF C;  1E1Q G;  3CPW U;  2ADP A;  1PM9 A;  3SR2 C;  5LHH A;  1SKV A;  2IU3 A;  1FXK C;  1BZK A;  1VQL V;  1N36 B;  2M6Y A;  4H33 A;  2PUS A;  4LCU C;  5JQG B;  3CRQ A;  3JSN A;  1BT8 A;  5LP6 A;  5IY5 B;  1H8H G;  4BWA A;  4LF7 B;  3CJH A;  1R3J C;  3E8H A;  4WFH A;  1WN7 A;  4B08 A;  3G80 A;  5EBM C;  1GK9 A;  3JAM N;  1WPB A;  4JF3 A;  4MSW C;  2IBZ H;  2JGD B;  4X20 A;  3R65 A;  2QKA A;  5J2T A;  2VQF O;  1K5S A;  1S3J A;  4I50 A;  2PYL A;  1GN6 A;  1OCZ B;  4JI1 O;  5B1O A;  4O2B A;  1XQ8 A;  1JFF B;  4JI7 B;  5CMU A;  1K97 A;  4CC5 A;  5LYJ B;  4NR1 A;  4JI3 B;  4MVR A;  4IIJ A;  5JVD B;  4PA3 A;  3OTO B;  1NT2 B;  1R3I C;  3CMA V;  1UFI A;  4HYO A;  4I0X B;  1Y67 A;  2Z3Y A;  2EIJ B;  1FD9 A;  3CCU V;  3RBZ A;  3N2G B;  2QWR B;  2W0F C;  5KMG A;  4JI5 B;  1EN5 A;  3AK2 A;  1K3E A;  3NR7 A;  3L74 H;  3AK1 A;  5JCO A;  2JS3 A;  4DR7 O;  3W7X A;  5B1B C;  4WFB V;  4JI1 B;  3OR6 C;  3HB3 B;  2ATK C;  2DYS C;  5CN0 A;  1V54 B;  2YI9 A;  3HKD A;  5EIB D;  2Q0O C;  1W59 A;  4DV6 O;  1CEZ A;  1H2G A;  4X1I A;  2Q67 A;  3ZHU A;  3BAB A;  3UT5 B;  3P3P A;  3SYO A;  3L9D A;  1W2B U;  1F4N A;  4MT8 A;  1J5E O;  2QGN A;  2CTP A;  4YHH B;  4IT5 A;  1B3Q A;  2NN4 A;  2LGW A;  4HAM A;  1Q7Y W;  2F1M A;  2UXD O;  2OWO A;  2B1G A;  5FPR A;  3CJH B;  5AG2 A;  2JJ1 G;  1K4D C;  3K59 A;  4LFC O;  2QKC A;  2H8P C;  3BEH A;  2ZDI C;  2KSD A;  4UCT A;  4JI8 O;  4ZKI A;  5BR8 B;  1S76 D;  2UXB O;  3HKE B;  3E8F A;  3QF7 A;  1QU7 A;  4BW5 A;  1AI5 A;  3JAL A;  4AQY O;  1HNZ B;  4ZHQ B;  4O4H B;  2IW5 A;  4YJ2 B;  4LFB B;  3JSL A;  4YJ3 A;  3K03 A;  4ABM A;  4MVS A;  1HWY A;  2X0L A;  4DR4 B;  4RWU A;  1JX9 A;  1K92 A;  3SJB C;  5C8Y A;  1V55 C;  1YJ9 V;  2VQF B;  4TUY B;  3LDD A;  2KB1 A;  3OMA B;  3F7V C;  1N33 O;  1GH6 A;  5B3S C;  4LF9 B;  5EZY B;  4NXM B;  4O4J B;  4FLT A;  3EHB B;  2WLI B;  4J9Z B;  4PA9 A;  5BR8 O;  3GVM A;  1SA0 B;  3JAW B;  2V7Q G;  3HKD B;  4EFB A;  1AI7 A;  4RO2 A;  1YTF B;  2QE7 G;  1J95 A;  4NKG B;  2BTQ B;  5LGU A;  3CD6 V;  3ZX6 A;  2UXD B;  2ZE7 A;  4F6E A;  4J7J A;  2OIG A;  1W0J G;  2YSU B;  1Z2G A;  3OFN G;  3JAT A;  3E35 A;  5CA0 B;  1UJW B;  2OCC C;  1IBL O;  1N33 B;  1FYJ A;  2WLH A;  3H9V A;  1KP3 A;  1ROP A;  2XUM A;  2HVJ C;  3SPJ A;  3ZED A;  2GSM B;  1L8D A;  3APQ A;  4O4I B;  2UXC B;  3IGA C;  2YUA A;  1XNR O;  1SRY A;  4FZ1 A;  5GON A;  3LSQ A;  5LOV A;  1SQX H;  1ORQ C;  4FFB B;  1SA0 A;  1TGO A;  2Y69 C;  4YHH O;  3ETE A;  4DR2 B;  3JAW A;  4IYI A;  4B3R B;  3D36 C;  2ZE8 A;  4DR4 O;  2CDY A;  2OCH A;  2YDE A;  1XHZ A;  3ZRS A;  2DN9 A;  1COW G;  4P30 A;  3B09 A;  5CA0 A;  1O9G A;  1GM7 A;  4JZG A;  1MNG A;  4J10 A;  2XAS A;  1X4T A;  4I5S A;  5A2Q N;  1XMQ B;  4IHJ A;  4C7U A;  1S5L Z;  4LFA O;  5F2V O;  5LA6 B;  2XHB A;  1I5X A;  2GUZ B;  4I7Z B;  3CCS V;  1IBL B;  4QPJ A;  3UO2 A;  4GX1 A;  3S3X A;  1XBL A;  4WFF A;  4YIP A;  5BMV A;  1GTO A;  1BQ0 A;  4D6T H;  5FNV B;  5IYZ A;  3JAR A;  2Q4P A;  2ZE5 A;  5HFM A;  2W6J G;  4MVO A;  4B3M B;  1PL4 A;  3RFR A;  3QG5 A;  4MVQ A;  5H2F Z;  3RN4 A;  1G1X B;  2R72 A;  3UM7 A;  1NR7 A;  4I4T A;  4R8C A;  4Q20 A;  5GON B;  4FFK A;  4IYH A;  5KA5 A;  1EZV H;  2BE3 A;  3AG1 C;  4O2A A;  1UPG A;  2N05 A;  1Q90 D;  2LP7 A;  3UKM A;  4J80 A;  5LMN O;  2BOB C;  2JDI G;  4UCU A;  3G71 V;  4PA4 A;  2E75 B;  2GDS A;  3T1H B;  5EC2 C;  4YIO A;  2DYR B;  5IDJ A;  3W7T A;  3EFF K;  3J81 N;  3DGE A;  3N2G A;  4X62 O;  4LR3 A;  1Y74 A;  2WLM A;  4PV1 B;  1NH2 D;  5L3B A;  2HP8 A;  4UB6 Z;  1OCC C;  1KKD A;  4MVU A;  4CZZ A;  1N0N A;  2GTA A;  1N32 O;  1TUE B;  3T4D A;  2X7R B;  4WBN A;  5TIS Z;  4D7T A;  4EB6 A;  3RT3 C;  1IXM A;  1AR4 A;  4F4L A;  1I7F A;  4GX5 A;  4FLW A;  1IXB A;  3J80 N;  3H01 A;  3ZMV A;  1HNZ O;  2NR5 A;  1ZTE A;  2ZDI A;  3JCU Z;  1VIB A;  3QVN A;  1XMQ O;  2XT9 A;  4RQE A;  3QO8 A;  2R9R B;  3ZHT A;  2PYJ A;  1I08 A;  4DV6 B;  2WPD G;  5CBH A;  4YJ2 A;  3G6E V;  1KYO F;  5DED A;  1O9H A;  3ETQ A;  1ZWI C;  4J42 A;  4JTC B;  3CWB H;  5JJE B;  2F95 B;  4FIP C;  2UUA O;  2YEV A;  4PJ0 Z;  2Y69 B;  1CXZ B;  2UUC O;  4X64 B;  4QE9 A;  3THO A;  2HLD G;  4OX9 O;  4KUM A;  2A0L A;  4JYY A;  2EIK B;  3H1I H;  1QQC A;  3UCS C;  1X59 A;  3ZHR A;  2V4D A;  1FXK A;  4K35 A;  4DV4 O;  4YJ3 B;  2ZNI A;  1ZL8 B;  2HJD A;  4KP4 A;  4WFG A;  5EYP B;  5LMU O;  1KQS U;  1OCR C;  3LNN A;  4YY3 B;  1HNX O;  3K5O A;  2Q7G A;  1JFF A;  4CH4 A;  2P7T C;  1RM1 B;  1US6 A;  2Q9L A;  4X64 O;  3N27 A;  2Q69 A;  1MOF A;  2K1E A;  2EIL C;  3AG3 B;  3SGI A;  4F6R B;  5KX5 A;  4L87 A;  3ML0 A;  2CH7 A;  2QM8 A;  1IBM B;  1N36 O;  4E2L A;  2BCC H;  5JH7 B;  4DUZ B;  3EXA A;  1NH2 B;  1A32 A;  4DRX A;  1LUW A;  2JS5 A;  1VQ9 V;  2PF4 E;  4FVM A;  3ZMT A;  4XDJ A;  2UXN A;  3APO A;  5L3E A;  1QR9 A;  2IJJ A;  4X1I B;  4WCE V;  3OMN B;  5KHH A;  1R6K A;  3AG4 B;  4TSF G;  4ZI7 A;  5JCO C;  2WLJ A;  1V55 B;  1S72 V;  4B3T B;  1FJG O;  1JJO A;  3DC6 A;  1HNW O;  1IBM O;  4AI8 A;  5CB4 B;  4U3J A;  3RYI B;  1Y76 B;  2YI8 A;  2MK3 A;  1OZ0 A;  3IFX A;  2XTA A;  3CCE V;  1R3K C;  4FLU A;  4DV0 O;  3ZMS A;  2P5O A;  3CCV V;  4ICG A;  1KEC A;  2EZO A;  1Y66 A;  4HNA B;  2QWN B;  2ZR3 A;  3BVO A;  2P4V A;  2Y0I A;  4UB8 Z;  2ZE6 A;  4I55 A;  3CC2 V;  3B2E E;  5IJ9 A;  4W4K A;  3DXR B;  1AB3 A;  4JGS A;  3CB2 A;  4NXN B;  1B04 A;  5DEC A;  4UCV A;  2QWO B;  2LW1 A;  1JMK C;  1VP7 A;  5KX5 B;  1S5J A;  3CE2 A;  1VQM V;  3NXS A;  3OMI B;  2B1I A;  4ZHQ A;  2OYQ A;  4LNU B;  1WJZ A;  2ZIM A;  4L8J A;  2V1D A;  4UV8 A;  4PI2 A;  4DV5 B;  2O57 A;  3WFV A;  4DK0 A;  3MDS A;  1QLE B;  1XNQ B;  3ZIA G;  2N04 A;  4CH6 A;  4PA7 A;  2OT5 A;  4UCS A;  1S0V A;  1OCO B;  4QIW F;  5LGN A;  4JI8 B;  4TOI A;  2X6C A;  4WFA V;  1AI6 A;  4Z1V A;  3D3Q A;  3CCL V;  2EIN C;  4JYA O;  2LFS A;  4X66 B;  4GKK B;  5KUK A;  1Z5V A;  4RAI A;  3OT7 A;  5HFL A;  3LDC A;  1AJP A;  1SQG A;  3ASN B;  5BY1 A;  4JPR A;  4EEQ A;  2BTQ A;  1G8M A;  2E74 B;  1K73 W;  2FB5 A;  1GM9 A;  3HKC A;  2DE0 X;  3KZI Z;  3N2K A;  2LW7 A;  4J7Z A;  1XDC A;  3L73 H;  1SQP H;  2AZ0 A;  3OGI B;  1AR1 B;  5LHG A;  1HNW B;  3GWK C;  3E8B A;  3K57 A;  3B4S A;  3LSU A;  1BHB A;  5JWP A;  4K3A A;  3BHP A;  3OTF A;  4X1Y B;  4W4L A;  1SS3 A;  3EVK A;  2F4V B;  5BZB A;  5IWA O;  1ZSP A;  4TWK A;  1NVP D;  2XAF A;  3RWR D;  2XAQ A;  4QGP A;  2R70 A;  3ZMZ A;  4DUY B;  2RDC A;  5IJ0 A;  4LF8 B;  4BW9 A;  4FFB A;  2RN9 A;  2JIZ G;  3ZCC A;  3E86 A;  5LOV B;  4G2K A;  2WA3 A;  5IYD O;  1KU9 A;  1FS0 G;  3G67 A;  2FKX A;  4QNH B;  4UCO A;  1RFY A;  1D5A A;  2Q7E A;  4PDR A;  4DR1 O;  5EBL C;  2XAH A;  1YVW A;  1ENV A;  5FNV A;  3E22 B;  3MD0 A;  4GUN A;  5IY5 C;  1YF2 A;  4OPH A;  2ZXW C;  3WU2 Z;  2ITD C;  1PD3 A;  1QVG U;  2ZQM A;  2QKS A;  2LGQ A;  1RSO A;  3G4S V;  4DR5 O;  4DR6 O;  4JI4 O;  3H1K H;  1QLN A;  3AG2 C;  2GUZ A;  1D5N A;  2LFR A;  1DK1 A;  3JAL B;  3N2K B;  1R6N A;  4IGG A;  2QEX V;  1M90 W;  5H6R A;  3BA9 A;  4IHJ B;  5KHI A;  4FLZ A;  2ZKO A;  1M5I A;  3U10 A;  4FLY A;  5IJ0 B;  1U96 A;  1T5E A;  5ITZ A;  4DV4 B;  3OEH G;  4LFB O;  1NKD A;  4NVP A;  3JAR B;  4JYC A;  4X1Y A;  2A79 B;  3JYC A;  1HR0 O;  1FKA O;  1TAE A;  1ZUQ A;  4KFM A;  1ZLZ A;  4D7S A;  4AHC A;  3FB8 C;  1PV0 A;  5B1B B;  5LXT B;  4FZ0 A;  1B6Q A;  4DV3 O;  3BCC H;  4B3M O;  1AJN A;  1SZX A;  3K9A A;  2M7W A;  1MZE A;  1N0J A;  3CRC A;  1FAF A;  1JA8 A;  4NTY A;  3ABL C;  1V54 C;  4F6R A;  4LBE C;  2IU0 A;  4MTG A;  2PZS A;  2OTL V;  4UCR A;  2RNB A;  4UUJ C;  3DXR A;  4PI0 A;  1Q5O A;  1FFT B;  3F5W C;  3FX7 A;  1FPO A;  1LR1 A;  4UVA A;  3RYF B;  4PD4 F;  3O9O A;  4DR5 B;  4DR6 B;  4JI4 B;  1LUV A;  4DV7 O;  2IJK A;  4JAS A;  2EIJ C;  2LQT A;  2N74 A;  1AIL A;  1GN3 A;  4AIL C;  5DM6 V;  2FYU H;  1GN2 A;  3BRC A;  4NTX A;  4FJC C;  2CK3 G;  5GTI Z;  3K3W A;  4E4E A;  5EIB C;  4I9Q A;  5A9G A;  3L75 H;  4BIO A;  4X65 O;  3K5M A;  2HR3 A;  4OPA A;  3CCQ V;  1K8A W;  4X1K B;  3Q4H A;  4EKW A;  3T4Z A;  3VQY A;  3OM3 B;  4OX9 B;  3ABU A;  3GWO A;  1M56 B;  4O4L B;  2C2A A;  3ZS8 C;  3DTU B;  4JAV A;  1JJ2 U;  4UXN A;  1L0L H;  4R7C A;  3BY6 A;  4DV7 B;  1IBK B;  1Q8I A;  1IUR A;  5B1A B;  1N34 B;  4UFZ A;  3RGB A;  2ZCE A;  1HW7 A;  4B7E A;  1BCC H;  2AHY A;  2D2C B;  1JQ0 A;  4H13 B;  1FXK B;  2QTO A;  2Q5Z A;  2WWW A;  1YEW A;  2DMX A;  4X89 A;  1KC8 W;  2FML A;  3WB2 A;  1XOU A;  2KG7 A;  3ZJZ A;  3STL C;  4I9W A;  1SF9 A;  3ZHQ A;  1R3L C;  4DYL A;  1W0K G;  3H1J H;  2CE4 A;  3TXS A;  2RMK B;  1DF4 A;  2IH1 C;  3SPH A;  2ARH A;  2BSK A;  3QO5 A;  1P7B A;  2NNU A;  3E89 A;  2Q7H A;  4PHZ A;  4X1K A;  3I56 V;  1M4U A;  1NTZ H;  1AP6 A;  4GKK O;  2JEX A;  3OR7 C;  3K79 A;  1BL8 A;  2UU9 O;  5E79 Z;  2JEU A;  1XMO O;  2LJ2 A;  4DW0 A;  5KHK A;  1WLE A;  2JRI A;  3ZRW B;  2CTR A;  3E83 A;  3T1H O;  4PEL A;  1H38 A;  4JI6 O;  3CME V;  3K5N A;  1JR9 A;  2JGU A;  3A0H Z;  1QR8 A;  4HNA A;  5CA3 A;  5J2U A;  1QLE C;  1XEQ A;  5LL6 Y;  2A06 H;  2UXB B;  4CC6 A;  2XAG A;  5IT9 N;  1NQT A;  1DF5 A;  4LF7 O;  1U97 A;  3Q4H B;  3K04 A;  1VEW A;  1JOY A;  4DV2 O;  1N34 O;  2ZNJ A;  4TQF A;  5L3G A;  3LUT B;  2ETN A;  1MMM A;  2IM9 A;  2JVD A;  3ABL B;  1P84 F;  4OXS A;  3OUS A;  5CBG A;  2QJ1 A;  3T1Y B;  2FTK A;  3JCZ A;  1S5H C;  3OE7 G;  1SER A;  2EIM B;  2Q8V A;  3P3N A;  4TV8 A;  1YHQ V;  1NS1 A;  2CUG A;  1K5Q A;  1K34 A;  5IE9 A;  2KG7 B;  2WLI A;  1YIJ V;  3QO7 A;  1YTF D;  1Q6U A;  3JD3 A;  1EBO A;  4H0L B;  1VQ8 V;  3ZRW A;  3KCY A;  1LNQ A;  1SQF A;  2WLL A;  2HKO A;  4GT1 A;  1VQO V;  1RP3 B;  3AK3 A;  4PDV A;  5GW7 A;  4TV9 A;  2YEV B;  1NZ6 A;  2YC0 A;  1HR0 B;  5EK0 A;  5CA1 A;  1H2L A;  2ZIO A;  3F7Y C;  5B3S B;  4GZR B;  1I0H A;  5JJJ B;  3RYF A;  1OHH G;  3IJ4 A;  1Q86 W;  5LXT A;  1SZT A;  2ZT9 B;  2GBO A;  4GCZ A;  5GTH Z;  3FD9 A;  3C3T A;  4QE7 A;  5B5E Z;  3FAV B;  4LF6 B;  5H5N A;  4MW8 A;  1R1B A;  2DWE C;  1FFX B;  1ZL8 A;  1BE3 H;  1KKC A;  3FFQ A;  2A3Q A;  4JV5 O;  1VQ6 V;  4LH6 A;  3ASO C;  5FPO A;  3SYQ A;  1MZF A;  1MSW D;  4FPP A;  4RUF A;  1VF6 A;  3SPI A;  1N4C A;  2P06 A;  2WLK A;  4EFE A;  5BMV B;  4UVB A;  1XIL A;  2NLJ C;  1JVM A;  3A2F A;  3A0B Z;  4X66 O;  2Z5U A;  1IVS A;  3WG7 C;  1KMI Z;  3VOU A;  4FM0 A;  1VQN V;  2EX3 A;  1P4R A;  4LFC B;  3L72 H;  1KUQ A;  3C3S A;  4A5U B;  2ZIN A;  4JV5 B;  3LNM B;  2HG5 C;  3U0Z A;  1XHX A;  3B40 A;  4ASU G;  1GM8 A;  1E79 G;  3ZRV A;  1EM1 A;  2QM4 A;  4R6Z A;  3E22 A;  2RQ6 A;  4ZI7 B;  2QR4 A;  1OCC B;  3G6B A;  2DJV A;  4O2A B;  3L71 H;  1Q82 W;  5KAF Z;  1YI2 V;  3CRR A;  2OCC B;  4LFA B;  4P2Z A;  3HKB B;  4N21 A;  3K5L A;  1H2S B;  2DOS A;  2EUL A;  4HZ3 A;  4LF5 O;  4NXM O;  1VMG A;  4G28 B;  5KHG A;  2DWD C;  5IYB O;  3OEE G;  3WB1 A;  4DRX B;  4CS2 A;  4U7O A;  1B06 A;  2Y48 A;  3K0G A;  2XND G;  2HEP A;  2RJZ A;  3F5T A;  3ABM C;  3AG3 C;  4YXW G;  4K8X A;  1JCH A;  3PN1 A;  5EC1 C;  1KP2 A;  1RM1 C;  4DW1 A;  3OAA G;  1F23 A;  3JD4 A;  3OD4 A;  1TA8 A;  2HFE C;  2AW9 A;  2YIA A;  1AI4 A;  4O4L A;  3TGU H;  3CC4 V;  5J2U B;  2CAZ C;  2F93 B;  2EBO A;  2P67 A;  4JI2 B;  2Q0A A;  1YSC A;  1Y74 B;  2AGA A;  2XAJ A;  2XOK G;  4TQD A;  4ZOL B;  2JJ2 G;  1RPO A;  1Z5W A;  1MSD A;  1H2N A;  1KB9 F;  2QWQ B;  2YXY A;  1NU1 H;  3I5D A;  3RW0 A;  2QDO A;  3JAT B;  1M57 C;  3TCU A;  3WB0 A;  3ABK C;  3CX5 F;  3K9S A;  1H2M A;  5D5Q A;  3I55 V;  3AG4 C;  3HKB A;  2MW2 B;  1OCR B;  4MTX A;  1R6T A;  4X9Q A;  5B1A C;  4JAA A;  3PJS K;  2A9H A;  4KL1 A;  5LYJ A;  4JI0 O;  3CRM A;  3W7U A;  3B8N A;  4LF5 B;  1ZAU A;  3BA8 A;  1D2D A;  3MHS C;  4O2B B;  1VQ4 V;  2R9I A;  2RCV A;  4O4I A;  3W7W A;  2ZR2 A;  4FM1 A;  1XMO B;  5LBQ A;  4GYC B;  3HR0 A;  4Z1M G;  5EBW C;  3RYH A;  4MS2 A;  4X20 B;  3X2Q B;  4JYB A;  1PNK A;  2JK5 C;  3UQ8 A;  1XNR B;  2IJH A;  2CTQ A;  1K4C C;  2VQE O;  1NR1 A;  4YY3 O;  4DUZ O;  2YID A;  1HP8 A;  1TUB A;  2Z0A A;  4K8Z A;  3RVZ A;  2P90 A;  3O65 A;  3ZN1 A;  2A7W A;  2K9P A;  1HDJ A;  3DSQ A;  4LF8 O;  4DV2 B;  5JVD A;  4CBC A;  2DYR C;  3QNE A;  4H37 A;  4JTD B;  4JI5 O;  3L70 H;  1R73 A;  3AEI A;  2UUC B;  2WLN A;  4BR6 A;  4LWS B;  1PNM A;  5H9C A;  4GKJ O;  5DN6 G;  2QSA A;  2F4V O;  1Y6X A;  2GTS A;  2CTW A;  3VQW A;  2WLL B;  2YIC A;  4U3F H;  1Q6H A;  2KKW A;  3ZRX A;  1YZB A;  1QVF U;  1VQK V;  4KHP B;  3FB6 C;  2KQX A;  4JTA B;  2EIK C;  1SC5 B;  1XL4 A;  3TET A;  1BQZ A;  3H1H H;  3FYE B;  1VF5 B;  3CRA A;  2B9Z A;  1SQQ H;  3AG2 B;  2PY5 A;  3FB7 C;  1J5E B;  3OW2 U;  3M7M X;  4CS3 A;  5B66 Z;  4DUY O;  5K1P A;  4MVM A;  4G27 B;  3CHX A;  3CP1 A;  4LP8 A;  2X6A A;  3STZ C;  3S3W A;  2H94 A;  3K0D A;  1PL0 A;  1GO3 F;  4LF4 B;  5JH7 A;  3CS5 A;  3ASN C;  3BFR A;  3M8A A;  4RQF A;  1SQB H;  1QNM A;  4TT3 G;  1FFX A;  3B8M A;  4GLX A;  3T1C A;  3KCX A;  1Q81 W;  1CP9 A;  5CBF A; 
#chains in the Genus database with same CATH homology
 3ETG A;  3ZJZ A;  3STL C;  4I9W A;  5L3D A;  1G4Y B;  1M57 B;  3K08 A;  3HPL C;  4QJF B;  2HJF C;  1R3L C;  4UVC A;  2EIM C;  1W0K G;  4KP4 A;  1E1Q G;  4PDL A;  4WFG A;  3CPW U;  1QBZ A;  5LHH A;  1KQS U;  1DF4 A;  1OCR C;  2IU3 A;  1FXK C;  2IH1 C;  4FMT A;  3SPH A;  1VQL V;  4H33 A;  3QO5 A;  1P7B A;  4LCU C;  2NNU A;  3E89 A;  1XL6 A;  5IY5 B;  1H8H G;  2Q68 A;  1THZ A;  2P7T C;  1RM1 B;  3I56 V;  2IH3 C;  2Q69 A;  2DYS B;  1MOF A;  1R3J C;  2K1E A;  2EIL C;  2JEX A;  3AG3 B;  3E8H A;  3OR7 C;  4WFH A;  3SPG A;  5EBM C;  1GK9 A;  3K79 A;  1BL8 A;  3ML0 A;  4L87 A;  4JF3 A;  4MSW C;  2P6J A;  5B1N A;  2QM8 A;  4R50 A;  2JEU A;  3R65 A;  4PDM A;  4E2L A;  1WLE A;  1NH2 B;  3ZRW B;  1K5S A;  3E83 A;  1S3J A;  4PEL A;  1H38 A;  1VQ9 V;  3ABK B;  1OCZ B;  3CME V;  2ZXW B;  4BIU A;  5B1O A;  3ZMT A;  4XDJ A;  1QR8 A;  2UXN A;  5CA3 A;  1N8R W;  2WSS G;  1QLE C;  5CMU A;  5L3E A;  1K97 A;  3E8G A;  1QR9 A;  2IJJ A;  4WCE V;  3OMN B;  5E1A C;  4MVR A;  4PA3 A;  1R3I C;  3OGC C;  3CMA V;  1R6K A;  3AG4 B;  4TSF G;  2XAG A;  1FXV A;  1NQT A;  2WLJ A;  1DF5 A;  1V55 B;  4HYO A;  1S72 V;  3LSS A;  3SJQ C;  3CCJ V;  3ETD A;  2Z3Y A;  2EIJ B;  1NBM G;  3CCU V;  3K04 A;  3RBZ A;  1JOY A;  3ASO B;  2W0F C;  5L3G A;  4FK5 C;  2GHY A;  3LUT B;  1K3E A;  3ABL B;  3X2Q C;  2MK3 A;  2PI5 A;  1OZ0 A;  3IFX A;  3W7X A;  2W6I G;  4OXS A;  3CCE V;  3AG1 B;  3OUS A;  2AHZ A;  5B1B C;  5CBG A;  1R3K C;  4WFB V;  3RVY A;  3TK1 A;  3ZMS A;  3CCV V;  3OR6 C;  2ITC C;  2FTK A;  3JCZ A;  3HB3 B;  1SES A;  2ATK C;  2DYS C;  5CN0 A;  1KEC A;  2EZO A;  1V54 B;  1Y66 A;  1S5H C;  3OE7 G;  2ZR3 A;  1SER A;  1YJW V;  2EIM B;  1YHQ V;  1CEZ A;  1H2G A;  2EJR A;  2Q67 A;  3CC2 V;  1NJI W;  3JD2 A;  3SYO A;  1K5Q A;  2QA4 V;  1K34 A;  1W2B U;  3SYA A;  5J9P C;  2WLI A;  5IYC O;  1F4N A;  3P30 A;  4MTO A;  4MT8 A;  1YIJ V;  3QO7 A;  1YTF D;  4JGS A;  3JD3 A;  1EBO A;  1BMF G;  1VQ8 V;  3ABT A;  4UV9 A;  3ZRW A;  3IC7 A;  4HAM A;  1Q7Y W;  2B1G A;  2DQ3 A;  1LNQ A;  1M1K W;  4XDL A;  2WLL A;  2HKO A;  4GT1 A;  2JJ1 G;  4X8A A;  1VQO V;  1K4D C;  2H8P C;  4PDV A;  3BEH A;  2ZDI C;  5GW7 A;  2YEV B;  1F4M A;  1S77 D;  1VQM V;  4ZKI A;  3NXS A;  1S76 D;  3OMI B;  2B1I A;  5EK0 A;  3E8F A;  3F7Y C;  5B3S B;  3KG2 A;  1OCZ C;  2V1D A;  4BW5 A;  1AI5 A;  4UV8 A;  1OHH G;  1Q86 W;  3WFV A;  4RUE A;  1QLE B;  1SZT A;  2IW5 A;  1PNL A;  4GCZ A;  3ZIA G;  4WFE A;  3K03 A;  4PA7 A;  4MVS A;  1HWY A;  2OT5 A;  4QE7 A;  1S0V A;  1OCO B;  4QIW F;  2X0L A;  3SYC A;  5KA6 A;  5LGN A;  4MW8 A;  2DWE C;  2BOC C;  1JX9 A;  2X6C A;  4WFA V;  1AI6 A;  1K92 A;  1M9N A;  3CCL V;  2X6B A;  1V55 C;  5H6Q A;  3K06 A;  1YJ9 V;  2EIN C;  2EIL B;  3LDD A;  1DLB A;  2KB1 A;  3OMA B;  2LFS A;  3F7V C;  1VQ6 V;  3ASO C;  5B3S C;  3SYQ A;  3P32 A;  1JPX A;  3OUF A;  5KUK A;  1MSW D;  4FPP A;  4RAI A;  5HFL A;  3EHB B;  4U7N A;  4RUF A;  3LDC A;  2WLI B;  4J9Z B;  3SPI A;  1AJP A;  4PA9 A;  2WLK A;  3ASN B;  1RPR A;  4JPR A;  4UVB A;  1G8M A;  1K73 W;  2V7Q G;  1GM9 A;  2NLJ C;  1JVM A;  1AJQ A;  1AI7 A;  4RO2 A;  1YTF B;  2QE7 G;  1J95 A;  2Z5U A;  1K9M W;  3WG7 C;  5LGU A;  1AR1 B;  5LHG A;  3CD6 V;  3VOU A;  1VQN V;  3E8B A;  1WPX A;  1P4R A;  1W0J G;  2YSU B;  1BHB A;  3OFN G;  3FYI B;  3E35 A;  1UJW B;  2OCC C;  1ARO P;  5BZB A;  1SET A;  3LNM B;  2HG5 C;  3VBB A;  1VQP V;  4TWK A;  4ASU G;  1GM8 A;  1E79 G;  3ZRV A;  1K7D A;  2WLH A;  1NVP D;  1KP3 A;  1ROP A;  2XAF A;  2HVJ C;  2XAQ A;  1L1F A;  3SPJ A;  4R6Z A;  3ZMZ A;  2GSM B;  2DQ0 A;  1OCC B;  3IGA C;  4XDK A;  3MHH C;  1Q82 W;  1SRY A;  2F43 G;  2JIZ G;  4MVZ A;  3E86 A;  3LSQ A;  3ZCC A;  1YI2 V;  3SYP A;  5C93 A;  4G2K A;  5IYD O;  4MW3 A;  3LDE A;  1ORQ C;  2OCC B;  1FS0 G;  4P2Z A;  4QNH B;  4N21 A;  2Y69 C;  3CXC U;  3ETE A;  4PDR A;  1KD1 W;  5EBL C;  4LC1 A;  4HZ3 A;  4G28 B;  2XAH A;  2DWD C;  5IYB O;  1ENV A;  3OEE G;  5L3F A;  4U7O A;  3MD0 A;  5IY5 C;  2Y48 A;  3K0G A;  2ZXW C;  4J9Y B;  2ITD C;  1PD3 A;  2XND G;  3ZRS A;  1COW G;  1QVG U;  4P30 A;  2ZQM A;  2QKS A;  3ABM C;  3AG3 C;  4JAU A;  1GM7 A;  4YXW G;  2D3O W;  1JCH A;  1M56 C;  2XAS A;  5EC1 C;  1BHA A;  4I5S A;  1KP2 A;  3G4S V;  1RM1 C;  4N23 A;  1QLN A;  3AG2 C;  3OAA G;  2LFR A;  2EZP A;  5L3C A;  1F23 A;  3JD4 A;  3SPC A;  2HFE C;  1R6N A;  2QEX V;  1M90 W;  5H6R A;  1GKF A;  1AI4 A;  1I5X A;  3A0R A;  3M99 B;  3CC4 V;  3CCS V;  2EBO A;  2P67 A;  1YSC A;  4QPJ A;  4MTF A;  1F51 A;  4GX1 A;  4WFF A;  2XAJ A;  2WAM A;  2XOK G;  1GTO A;  1OCO C;  3B77 A;  4GX2 A;  4PA6 A;  2DW4 A;  3OEH G;  4GX0 A;  3JD0 A;  1NKD A;  1PKX A;  2JJ2 G;  1RPO A;  1H8E G;  2EIN B;  3RW0 A;  5HFM A;  1Y4M A;  1M57 C;  4JYC A;  2W6J G;  3TCU A;  4MVO A;  3ABK C;  1K33 A;  3I55 V;  3AG4 C;  4DO2 A;  4MVQ A;  2A79 B;  1QCE A;  3JYC A;  3UM7 A;  1OCR B;  4MTX A;  1NR7 A;  1GMG A;  5B1A C;  4R8C A;  4KFM A;  3PJS K;  4Q20 A;  2A9H A;  3FB8 C;  3W7U A;  5KA5 A;  3AG1 C;  5B1B B;  3B8N A;  4XBF A;  1MG1 A;  5KUM A;  3MHS C;  1B6Q A;  1VQ4 V;  2LP7 A;  2R9I A;  3UKM A;  3ZMU A;  1AJN A;  2HVK C;  2QM7 A;  3WG7 B;  3W7W A;  1MAB G;  2BOB C;  2ZR2 A;  3K9A A;  2JDI G;  4BIZ A;  2PI4 A;  3FB5 C;  2M7W A;  2OTJ V;  3G71 V;  1I5Y A;  5LBQ A;  4PA4 A;  4X88 A;  4DXW A;  4Z1M G;  5EC2 C;  5EBW C;  3FKS G;  2DYR B;  4MS2 A;  3ABL C;  3X2Q B;  1V54 C;  5IDJ A;  3EFF K;  4JYB A;  3W7T A;  3DGE A;  1PNK A;  4LBE C;  2IU0 A;  1EZJ A;  2JK5 C;  3JD1 A;  4MTG A;  1CPY A;  2IJH A;  2OTL V;  1K4C C;  4UUJ C;  4ZBM A;  4QPK A;  1FFT B;  1NR1 A;  2WLM A;  3F5W C;  1NH2 D;  5L3B A;  5FL7 G;  1OCC C;  1KKD A;  3RVZ A;  2P90 A;  4MVU A;  3CCR V;  3ZN1 A;  4UVA A;  4CZZ A;  3T2M A;  4WF9 V;  3CCM V;  1TUE B;  4CBC A;  2IJK A;  2DYR C;  3QNE A;  4H37 A;  3D3I A;  2EIJ C;  4JAS A;  2X7R B;  3T4D A;  3E2E A;  4JTD B;  5DM6 V;  1E1R G;  1R73 A;  1IXM A;  3AEI A;  4F4L A;  2WLN A;  2ZD9 A;  4GX5 A;  1PNM A;  4P9O A;  5H9C A;  1EFR G;  4FJC C;  2CK3 G;  3K3W A;  3H01 A;  3ZMV A;  5DN6 G;  4P9P A;  1VQ5 V;  2WLL B;  2ZDI A;  2Q6A A;  3ZRX A;  2HR3 A;  1QVF U;  3CCQ V;  4RQE A;  1VQK V;  3QO8 A;  1K8A W;  2R9R B;  1DTO A;  3FB6 C;  4EKW A;  3T4Z A;  3ABM B;  2WPD G;  3OM3 B;  2EIK C;  4JTA B;  3CYO A;  5CBH A;  3ABU A;  5LGT A;  3GWO A;  1M56 B;  1XL4 A;  1YIT V;  3TET A;  5LHI A;  2C2A A;  3G6E V;  3CC7 V;  3DTU B;  4JAV A;  1JJ2 U;  3FYE B;  4UXN A;  4R7C A;  1NVP B;  1ZWI C;  3AG2 B;  4JTC B;  3FB7 C;  3BY6 A;  3D36 A;  3OW2 U;  3GB7 C;  5B1A B;  4FIP C;  3ZN0 A;  2YEV A;  2B5U A;  2Y69 B;  4MVM A;  1VQ7 V;  4QE9 A;  2AHY A;  4G27 B;  2HLD G;  1JQ0 A;  2X6A A;  3CP1 A;  4LP8 A;  4KUM A;  2H94 A;  3STZ C;  3K0D A;  1PL0 A;  1FXK B;  1GO3 F;  2A0L A;  2QTO A;  3ASN C;  2EIK B;  4BAY A;  4RQF A;  2WWW A;  4X89 A;  4TT3 G;  1KC8 W;  3W7S A;  2IJI A;  3B8M A;  1YJN V;  1FXK A;  3T1C A;  1Q81 W;  1FXH A;  1CP9 A;  5CBF A;  2UXX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...