1YTOA

Crystal structure of gly19 deletion mutant of human acidic fibroblast growth factor
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
139
structure length
139
Chain Sequence
b'HHHFNLPPGNYKKPKLLYCSNGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heparin-binding growth factor 1
publication title Conversion of type I 4:6 to 3:5 beta-turn types in human acidic fibroblast growth factor: Effects upon structure, stability, folding, and mitogenic function.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/growth factor
total genus 33
structure length 139
sequence length 139
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1ytoA00
1AVXB 2D24A 3H6SE 3FJHA 3RTJB 3S8KA 1FGAA 3POKA 2D43A 3AJ5A 1XYFA 2K8RA 4XKIA 1BFGA 2D1ZA 1EVTA 1S0DA 4KEIA 4USOA 3NJ5A 1W3GA 1TTUA 4KC3A 1FMMS 2AQZA 2E4MA 4XFTA 1ISVA 3Q7YA 2ZR1B 3O3QA 1DFQA 1AVWB 5GAQA 3C9ZA 3UD9A 3FJJA 1QQKA 1HKNA 4EB2B 1XG6A 3QR5A 4OWKA 1G82A 3ZC8A 3HSMA 3BB2A 1F31A 2BEAA 3FJCA 3AH4A 4X37A 2RQ9A 1VCLA 3N7LA 4CJMA 1IOBA 2MIBA 3A23A 1K5VA 2I1BA 4OEFA 1ISXA 4IY9A 2ZQNA 1CE7B 1I1BA 3AKFA 1AXMA 2Y9GA 1ISWA 3A07A 3JRRA 5DUYA 4I4RA 4P0LA 3BAVA 3RTIB 1IRPA 4PC4A 4A7YA 1G9BA 2NZ9A 3CU1B 2FDBM 4IZEA 3NBDA 2NM1A 1FV2A 3V0AB 3HOMA 4F83A 2ERMA 4J2SA 1RZOB 1SR4A 3R4UA 3ZXGA 4GOVA 3VUOA 2HWMA 5D61A 4JRAA 1YXWA 3FJIA 3F1RA 1R8NA 2P39A 1PZZA 4FVVA 5G00A 1PWAA 5D62A 5F8SA 4I1EA 3BRGC 2E4MC 3QYDA 2VU9A 4Z8SB 4KEJA 5BXSA 2KH2A 4A7KA 1FN0A 2DREA 1YBIA 3BA5A 4IHZA 4H9WA 3ILAA 3IM7A 1KNMA 1QXMA 3N7MA 1W3AA 3AZVA 3ZC9A 5FZYA 1MD6A 4EEEB 1QQLA 1TIEA 3P6IA 2HWAA 2YUGA 3AH1A 7I1BA 2D22A 4XFSA 4AN6A 1YYNA 3FJEA 1FWUA 4Q9PA 4KEKA 1BA7A 1DFCA 2HZ9A 2FO1A 3T8SA 1V6XA 3O49A 1G9DA 2NTDA 1ONKB 2FFVA 1DIWA 3PMEA 2F8XC 3O44A 1RMLA 1HWNB 1ABRB 2MLLB 3VT2A 3IIRA 1DQGA 3WINA 1V6VA 3PUBA 3CA3A 4R6UB 3FJAA 1RG8A 1PUMB 3O4AA 2XOAA 3N7KA 2M49A 5BP5A 4YOLA 4FGFA 4LO1A 5FZUA 1E0OA 4IONA 4D0TA 2VXTI 4I4OA 4I4UA 4GP3A 1JQZA 3EF2A 1IT0A 2GZBA 1DZDA 4QD2B 3WO3A 3UD8A 4GOYA 3CA0A 1CVSA 3I2XA 1Q03A 3AKIA 3R4SA 3JUTA 3IM5A 4IZXA 4QBCA 4ZGRB 2UUSA 1DZCA 3CA5A 1TWMA 1UPSA 3V0BB 1IRAX 3OJMA 3CA4A 4I37A 3SNVA 3ZX7A 3N0KA 3A21A 3AKHA 4ZBVB 4ZKTB 3E8LC 4A7ZA 4J23B 2DS0A 2Y9FA 3CA1A 3NBNA 3V0AA 3WMUA 1G9AA 4LO7C 2RSTA 3B9UA 4LO2A 1W3FA 4G9MA 4I4QA 3FJKA 1S0FA 3UDAA 1AVAC 1HWPB 2LIQA 1I1EA 1JT5A 4QC4A 2NYYA 1DQOA 3WINC 3FJBA 2J3PA 2X2SA 3F62B 2D44A 4JAWA 2P23A 3BA4A 2K43A 3OJ2A 5F8YA 4LO0A 4Z9WB 4P6AA 3O4BA 3WO2A 1TWEA 2QYIB 4OEEA 5BP5C 2BEBA 2VUAA 4LO1C 3OGFA 3WO4A 4GAIA 4EFRA 2ESUA 1A8DA 1AVUA 1N4KA 4Q91A 4L4IA 4JP0A 5D63A 1L2HA 3NBEA 3S8JA 3HALA 3BAUA 2NP0A 2GO2A 4USPA 1M16A 3BA7A 2F2FA 3RMYA 2X2TA 4G6MA 4J2KA 4L4HA 1XHBA 3IM6A 3MALA 1GGPB 1S0EA 1PUUB 1M2TB 1D0HA 4KBBA 3IAGC 1J0SA 2KLLA 1AFCA 2DRYA 3HBWA 4QKRA 4ZFYB 1EV2A 1HWMB 1II4A 2KI4A 1V6WA 3AKGA 2VXRA 3UJ4A 3BRDA 1Z2VA 3A22A 3MPPG 3FJ9A 2VLCA 4P0JA 1PC8B 5FZZA 4I4YA 4II0A 3H6RB 4JKQA 1SZ6B 2AXMA 2AAIB 4I8MA 3FJFA 1FMZA 1ITBA 1P63A 2QN4A 3O4DA 2ET2A 1IHKA 3CRHA 5BXPA 5BQUA 5DZUA 4TLPA 1EYLA 8I1BA 1R8OA 4LO0C 2R9KB 2BFHA 4HJJA 4OEGA 1BLDA 2Z48A 3VSZA 1SR4C 9ILBA 5EHAA 2NVHA 3VT0A 5HPZA 1BLAA 3BAHA 3FJDA 3OBRA 1T9FA 4HR6C 1ISZA 3D7WB 1BFBA 1JT7A 3FFZA 4Q9GA 3V0BA 2ZQOA 4OW4A 4OWLA 4DCKC 2HW9A 2F2FC 1Z4SA 2Q9XA 41BIA 3I29B 2D7RA 5F90A 3WA1A 1JLXA 4AN7B 1WBAA 2IWTB 2Z49A 4IQPA 4I4SA 5EG6C 1HIBA 1IJTA 5E24E 3LTQA 1WD4A 1NZKA 1G9CA 1WBCA 3OGGA 3Q7WA 1NUNA 4X3AA 4H04A 4X39A 1MC9A 2VSAA 3FJ8A 2AFGA 1AF9A 4D8HA 6I1BA 4DEPA 2K4AB 2KI6B 1BASA 4I6IA 1Z0HA 2D20A 1S0BA 3BRFA 5DVHA 4I4PA 4EFPA 3RSJA 3AH2A 5I1BA 4JKXB 2Q3NB 1S0GA 1XZZA 1FV3A 3AZWA 4G6JA 4ZFUB 4LO3A 5BQUC 4D0ZA 5B2HA 3P6JA 31BIA 4QD2C 1V6UA 5BOWA 2Y9XE 3CRGA 4I2SA 4JQ0A 3K1XA 3VWCA 5DSSB 1HWOB 5EC5A 4ISRA 1S0LA 3AJ6A 4IY8A 4OWJA 1RY7A 1DLLA 1FQ9A 21BIA 4QO3A 4OUJA 3RMXA 4I7IA 3UD7A 1BARA 1JLYA 4QKSA 4I1BA 3BAQA 3V79C 4I4VA 2D23A 4ZA3B 4G9NA 4ISQA 4EKXB 1TOOA 2Y9WC 2LIEA 3O4CA 1S0CA 2WRYA 4IYBA 3H6QA 4DENA 1TP0A 4WBCA 3H6RA 4GP0A 4QBVA 4QALA 3BADA 2WBCA 3TC2A 3P53A 3CA6A 4J2XA 3CQAA 4I96A 3HN1A 1JT3A 5JMCA 4I0YA 4XFUA 2FGFA 3VEQA 3VSFA 4EFQA 4HA2A 4ZFWB 1YF8B 1T4QA 1JT4A 2D7IA 3BX1C 1DJSB 3FGMA 3Q7XA 4ENDA 1YTOA 4LO8B 1Q1UA 3O4OA 2FFUA 3PG0A 4LO2C 3W9TA 1OQLB 2IHOA 3CAHA 4GAFA 2RG9B 1BFCA 5F8WA 4F34A 3I2AA 4LO3C 1IILA 3N7JA 3VT1A 3PHZA 5FNWA 1HCEA 3BAOA 4P0KA 3KMVA 4I3NA 3UJ0A 3OBTA 1ILR1 3CRIA 2DRZA 1FWVA 3FUQA 5BVPI 2KKIA 3ZXDA 3FUOA 3HMYA 1WD3A 3O5WB 3LLPA 3OJVA 1TFMB 1JTCA 1HCDA 5BXTA 2L5XA 3NBCA 2VSEA 5JLVA 4G1RA 4ZOTA 4J2YA 1ISYA 4I4XA 5FNXA 1EPWA 3BTAA 3BAGA 1JY0A 3WMVA 5BXRA 1K5UA 4ZLBB 1Q04A 4JPZA 4X38A 2MC2A 1BFFA 4LO7B
chains in the Genus database with same CATH superfamily
1AVXB 2D24A 3H6SE 3FJHA 3RTJB 3S8KA 1FGAA 3POKA 2D43A 3AJ5A 1XYFA 2K8RA 4XKIA 1BFGA 2D1ZA 1EVTA 1S0DA 4KEIA 4USOA 3NJ5A 1W3GA 1TTUA 4KC3A 1FMMS 2AQZA 2E4MA 4XFTA 1ISVA 3Q7YA 2ZR1B 3O3QA 1DFQA 1AVWB 5GAQA 3C9ZA 3UD9A 3FJJA 1QQKA 1HKNA 4EB2B 1XG6A 3QR5A 4OWKA 1G82A 3ZC8A 3HSMA 3BB2A 1F31A 2BEAA 3FJCA 3AH4A 4X37A 2RQ9A 1VCLA 3N7LA 4CJMA 1IOBA 2MIBA 3A23A 1K5VA 2I1BA 4OEFA 1ISXA 4IY9A 2ZQNA 1CE7B 1I1BA 3AKFA 1AXMA 2Y9GA 1ISWA 3A07A 3JRRA 5DUYA 4I4RA 4P0LA 3BAVA 3RTIB 1IRPA 4PC4A 4A7YA 1G9BA 2NZ9A 3CU1B 2FDBM 4IZEA 3NBDA 2NM1A 1FV2A 3V0AB 3HOMA 4UY4A 4F83A 2ERMA 4J2SA 1RZOB 1SR4A 3R4UA 3ZXGA 4GOVA 3VUOA 2HWMA 5D61A 4JRAA 1YXWA 3FJIA 3F1RA 1R8NA 2P39A 1PZZA 4FVVA 5G00A 1PWAA 5D62A 5F8SA 4I1EA 3BRGC 2E4MC 3QYDA 2VU9A 4Z8SB 4KEJA 5BXSA 2KH2A 4A7KA 1FN0A 2DREA 1YBIA 3BA5A 4IHZA 4H9WA 3ILAA 3IM7A 1KNMA 1QXMA 3N7MA 1W3AA 3AZVA 3ZC9A 5FZYA 1MD6A 4EEEB 1QQLA 1TIEA 3P6IA 2HWAA 2YUGA 3AH1A 7I1BA 2D22A 4XFSA 4AN6A 1YYNA 3FJEA 1FWUA 4Q9PA 4KEKA 1BA7A 1DFCA 2HZ9A 2FO1A 3T8SA 1V6XA 3O49A 1G9DA 2NTDA 1ONKB 2FFVA 1DIWA 3PMEA 2F8XC 3O44A 1RMLA 1HWNB 1ABRB 2MLLB 3VT2A 3IIRA 1DQGA 3WINA 1V6VA 3PUBA 3CA3A 4R6UB 3FJAA 1RG8A 1PUMB 3O4AA 2XOAA 3N7KA 2M49A 5BP5A 4YOLA 4FGFA 4LO1A 5FZUA 1E0OA 4IONA 4D0TA 2VXTI 4I4OA 4I4UA 4GP3A 1JQZA 3EF2A 1IT0A 2GZBA 1DZDA 4QD2B 3WO3A 3UD8A 4GOYA 3CA0A 1CVSA 3I2XA 1Q03A 3AKIA 3R4SA 3JUTA 3IM5A 4IZXA 4QBCA 4ZGRB 2UUSA 1DZCA 3CA5A 1TWMA 1UPSA 3V0BB 1IRAX 3OJMA 3CA4A 4I37A 3SNVA 3ZX7A 3N0KA 3A21A 3AKHA 4ZBVB 4ZKTB 3E8LC 4A7ZA 4J23B 2DS0A 2Y9FA 3CA1A 3NBNA 3V0AA 3WMUA 1G9AA 4LO7C 2RSTA 3B9UA 4LO2A 1W3FA 4G9MA 4I4QA 3FJKA 1S0FA 3UDAA 1AVAC 1HWPB 2LIQA 1I1EA 1JT5A 4QC4A 2NYYA 1DQOA 3WINC 3FJBA 2J3PA 2X2SA 3F62B 2D44A 4JAWA 2P23A 3BA4A 2K43A 3OJ2A 5F8YA 4LO0A 4Z9WB 4P6AA 3O4BA 3WO2A 1TWEA 2QYIB 4OEEA 5BP5C 2BEBA 2VUAA 4MZGB 4LO1C 3OGFA 3WO4A 4GAIA 4EFRA 2ESUA 1A8DA 1AVUA 1N4KA 4Q91A 4L4IA 4JP0A 5D63A 4H75A 1L2HA 3NBEA 3S8JA 3HALA 3BAUA 2NP0A 2GO2A 4USPA 1M16A 3BA7A 2F2FA 3RMYA 2X2TA 4G6MA 4J2KA 4L4HA 1XHBA 3IM6A 3MALA 1GGPB 1S0EA 1PUUB 1M2TB 1D0HA 4KBBA 3IAGC 1J0SA 2KLLA 1AFCA 2DRYA 3HBWA 4QKRA 4ZFYB 1EV2A 1HWMB 1II4A 2KI4A 1V6WA 3AKGA 2VXRA 3UJ4A 3BRDA 1Z2VA 3A22A 3MPPG 3FJ9A 2VLCA 4P0JA 1PC8B 5FZZA 4I4YA 4II0A 3H6RB 4JKQA 1SZ6B 2AXMA 2AAIB 4I8MA 3FJFA 1FMZA 1ITBA 1P63A 2QN4A 4MZHA 3O4DA 2ET2A 1IHKA 3CRHA 5BXPA 5BQUA 5DZUA 4TLPA 1EYLA 8I1BA 1R8OA 4LO0C 2R9KB 2BFHA 4HJJA 4OEGA 1BLDA 2Z48A 3VSZA 1SR4C 9ILBA 5EHAA 2NVHA 3VT0A 5HPZA 1BLAA 3BAHA 3FJDA 3OBRA 1T9FA 4HR6C 1ISZA 3D7WB 1BFBA 1JT7A 3FFZA 4Q9GA 3V0BA 2ZQOA 4OW4A 4OWLA 4DCKC 2HW9A 2F2FC 1Z4SA 2Q9XA 41BIA 3I29B 2D7RA 2NS2A 5F90A 3WA1A 1JLXA 4AN7B 1WBAA 2IWTB 2Z49A 4IQPA 4I4SA 5EG6C 1HIBA 1IJTA 5E24E 3LTQA 1WD4A 1NZKA 1G9CA 1WBCA 3OGGA 3Q7WA 1NUNA 4X3AA 4H04A 4X39A 1MC9A 2VSAA 3FJ8A 2AFGA 1AF9A 4D8HA 6I1BA 4DEPA 2K4AB 2KI6B 1BASA 4I6IA 1Z0HA 2D20A 1S0BA 3BRFA 5DVHA 4I4PA 4EFPA 3RSJA 3AH2A 5I1BA 4JKXB 2Q3NB 1S0GA 1XZZA 1FV3A 3AZWA 4G6JA 4ZFUB 4LO3A 5BQUC 4D0ZA 5B2HA 3P6JA 31BIA 4QD2C 1V6UA 5BOWA 2Y9XE 3CRGA 4I2SA 4JQ0A 3K1XA 3VWCA 5DSSB 1HWOB 5EC5A 4ISRA 1S0LA 3AJ6A 4IY8A 4OWJA 1RY7A 1DLLA 1FQ9A 21BIA 4QO3A 4OUJA 3RMXA 4I7IA 3UD7A 1BARA 1JLYA 4QKSA 4I1BA 3BAQA 3V79C 4I4VA 2D23A 4ZA3B 4G9NA 4ISQA 4EKXB 1TOOA 2Y9WC 2LIEA 3O4CA 1S0CA 2WRYA 4IYBA 3H6QA 4DENA 1TP0A 4WBCA 3H6RA 4GP0A 4QBVA 4QALA 3BADA 2WBCA 3TC2A 3P53A 3CA6A 4J2XA 3CQAA 4I96A 3HN1A 1JT3A 5JMCA 4I0YA 4XFUA 2FGFA 3VEQA 3VSFA 4EFQA 4HA2A 4ZFWB 1YF8B 1T4QA 1JT4A 2D7IA 3BX1C 1DJSB 3FGMA 3Q7XA 4ENDA 1YTOA 4LO8B 1Q1UA 3O4OA 2FFUA 3PG0A 4LO2C 3W9TA 1OQLB 2IHOA 3CAHA 4GAFA 2RG9B 1BFCA 5F8WA 4F34A 3I2AA 4LO3C 1IILA 3N7JA 3VT1A 3PHZA 5FNWA 1HCEA 3BAOA 4P0KA 3KMVA 4I3NA 3UJ0A 3OBTA 1ILR1 3CRIA 2DRZA 1FWVA 3FUQA 5BVPI 2KKIA 3ZXDA 3FUOA 3HMYA 1WD3A 3O5WB 3LLPA 3OJVA 1TFMB 1JTCA 1HCDA 5BXTA 2L5XA 3NBCA 2VSEA 5JLVA 4G1RA 4ZOTA 4J2YA 1ISYA 4I4XA 5FNXA 1EPWA 3BTAA 3BAGA 1JY0A 3WMVA 5BXRA 1K5UA 4ZLBB 1Q04A 4JPZA 4MZFB 4X38A 2MC2A 1BFFA 4LO7B
chains in the Genus database with same CATH topology
1AVXB 2D24A 3H6SE 3FJHA 3RTJB 3S8KA 1FGAA 3POKA 2D43A 3AJ5A 1XYFA 2K8RA 4XKIA 1BFGA 2D1ZA 1EVTA 1S0DA 4KEIA 4USOA 3NJ5A 1W3GA 1TTUA 4KC3A 1FMMS 2AQZA 2E4MA 4XFTA 1ISVA 3Q7YA 2ZR1B 3O3QA 1DFQA 1AVWB 5GAQA 3C9ZA 3UD9A 3FJJA 1QQKA 1HKNA 4EB2B 1XG6A 3QR5A 4OWKA 1G82A 3ZC8A 3HSMA 3BB2A 1F31A 2BEAA 3FJCA 3AH4A 4X37A 2RQ9A 1VCLA 3N7LA 4CJMA 1IOBA 2MIBA 3A23A 1K5VA 2I1BA 4OEFA 1ISXA 4IY9A 2ZQNA 1CE7B 1I1BA 3AKFA 1AXMA 2Y9GA 1ISWA 3A07A 3JRRA 5DUYA 4I4RA 4P0LA 3BAVA 3RTIB 1IRPA 4PC4A 4A7YA 1G9BA 2NZ9A 3CU1B 2FDBM 4IZEA 3NBDA 2NM1A 1FV2A 3V0AB 3HOMA 4UY4A 4F83A 2ERMA 4J2SA 1RZOB 1SR4A 3R4UA 3ZXGA 4GOVA 3VUOA 2HWMA 5D61A 4JRAA 1YXWA 3FJIA 3F1RA 1R8NA 2P39A 1PZZA 4FVVA 5G00A 1PWAA 5D62A 5F8SA 4I1EA 3BRGC 2E4MC 3QYDA 2VU9A 4Z8SB 4KEJA 5BXSA 2KH2A 4A7KA 1FN0A 2DREA 1YBIA 3BA5A 4IHZA 4H9WA 3ILAA 3IM7A 1KNMA 1QXMA 3N7MA 1W3AA 3AZVA 3ZC9A 5FZYA 1MD6A 4EEEB 1QQLA 1TIEA 3P6IA 2HWAA 2YUGA 3AH1A 7I1BA 2D22A 4XFSA 4AN6A 1YYNA 3FJEA 1FWUA 4Q9PA 4KEKA 1BA7A 1DFCA 2HZ9A 2FO1A 3T8SA 1V6XA 3O49A 1G9DA 2NTDA 1ONKB 2FFVA 1DIWA 3PMEA 2F8XC 3O44A 1RMLA 1HWNB 1ABRB 2MLLB 3VT2A 3IIRA 1DQGA 3WINA 1V6VA 3PUBA 3CA3A 4R6UB 3FJAA 1RG8A 1PUMB 3O4AA 2XOAA 3N7KA 2M49A 5BP5A 4YOLA 4FGFA 4LO1A 5FZUA 1E0OA 4IONA 4D0TA 2VXTI 4I4OA 4I4UA 4GP3A 1JQZA 3EF2A 1IT0A 2GZBA 1DZDA 4QD2B 3WO3A 3UD8A 4GOYA 3CA0A 1CVSA 3I2XA 1Q03A 3AKIA 3R4SA 3JUTA 3IM5A 4IZXA 4QBCA 4ZGRB 2UUSA 1DZCA 3CA5A 1TWMA 1UPSA 3V0BB 1IRAX 3OJMA 3CA4A 4I37A 3SNVA 3ZX7A 3N0KA 3A21A 3AKHA 4ZBVB 4ZKTB 3E8LC 4A7ZA 4J23B 2DS0A 2Y9FA 3CA1A 3NBNA 3V0AA 3WMUA 1G9AA 4LO7C 2RSTA 3B9UA 4LO2A 1W3FA 4G9MA 4I4QA 3FJKA 1S0FA 3UDAA 1AVAC 1HWPB 2LIQA 1I1EA 1JT5A 4QC4A 2NYYA 1DQOA 3WINC 3FJBA 2J3PA 2X2SA 3F62B 2D44A 4JAWA 2P23A 3BA4A 2K43A 3OJ2A 5F8YA 4LO0A 4Z9WB 4P6AA 3O4BA 3WO2A 1TWEA 2QYIB 4OEEA 5BP5C 2BEBA 2VUAA 4MZGB 4LO1C 3OGFA 3WO4A 4GAIA 4EFRA 2ESUA 1A8DA 1AVUA 1N4KA 4Q91A 4L4IA 4JP0A 5D63A 4H75A 1L2HA 3NBEA 3S8JA 3HALA 3BAUA 2NP0A 2GO2A 4USPA 1M16A 3BA7A 2F2FA 3RMYA 2X2TA 4G6MA 4J2KA 4L4HA 1XHBA 3IM6A 3MALA 1GGPB 1S0EA 1PUUB 1M2TB 1D0HA 4KBBA 3IAGC 1J0SA 2KLLA 1AFCA 2DRYA 3HBWA 4QKRA 4ZFYB 1EV2A 1HWMB 1II4A 2KI4A 1V6WA 3AKGA 2VXRA 3UJ4A 3BRDA 1Z2VA 3A22A 3MPPG 3FJ9A 2VLCA 4P0JA 1PC8B 5FZZA 4I4YA 4II0A 3H6RB 4JKQA 1SZ6B 2AXMA 2AAIB 4I8MA 3FJFA 1FMZA 1ITBA 1P63A 2QN4A 4MZHA 3O4DA 2ET2A 1IHKA 3CRHA 5BXPA 5BQUA 5DZUA 4TLPA 1EYLA 8I1BA 1R8OA 4LO0C 2R9KB 2BFHA 4HJJA 4OEGA 1BLDA 2Z48A 3VSZA 1SR4C 9ILBA 5EHAA 2NVHA 3VT0A 5HPZA 1BLAA 3BAHA 3FJDA 3OBRA 1T9FA 4HR6C 1ISZA 3D7WB 1BFBA 1JT7A 3FFZA 4Q9GA 3V0BA 2ZQOA 4OW4A 4OWLA 4DCKC 2HW9A 2F2FC 1Z4SA 2Q9XA 41BIA 3I29B 2D7RA 2NS2A 5F90A 3WA1A 1JLXA 4AN7B 1WBAA 2IWTB 2Z49A 4IQPA 4I4SA 5EG6C 1HIBA 1IJTA 5E24E 3LTQA 1WD4A 1NZKA 1G9CA 1WBCA 3OGGA 3Q7WA 1NUNA 4X3AA 4H04A 4X39A 1MC9A 2VSAA 3FJ8A 2AFGA 1AF9A 4D8HA 6I1BA 4DEPA 2K4AB 2KI6B 1BASA 4I6IA 1Z0HA 2D20A 1S0BA 3BRFA 5DVHA 4I4PA 4EFPA 3RSJA 3AH2A 5I1BA 4JKXB 2Q3NB 1S0GA 1XZZA 1FV3A 3AZWA 4G6JA 4ZFUB 4LO3A 5BQUC 4D0ZA 5B2HA 3P6JA 31BIA 4QD2C 1V6UA 5BOWA 2Y9XE 3CRGA 4I2SA 4JQ0A 3K1XA 3VWCA 5DSSB 1HWOB 5EC5A 4ISRA 1S0LA 3AJ6A 4IY8A 4OWJA 1RY7A 1DLLA 1FQ9A 21BIA 4QO3A 4OUJA 3RMXA 4I7IA 3UD7A 1BARA 1JLYA 4QKSA 4I1BA 3BAQA 3V79C 4I4VA 2D23A 4ZA3B 4G9NA 4ISQA 4EKXB 1TOOA 2Y9WC 2LIEA 3O4CA 1S0CA 2WRYA 4IYBA 3H6QA 4DENA 1TP0A 4WBCA 3H6RA 4GP0A 4QBVA 4QALA 3BADA 2WBCA 3TC2A 3P53A 3CA6A 4J2XA 3CQAA 4I96A 3HN1A 1JT3A 5JMCA 4I0YA 4XFUA 2FGFA 3VEQA 3VSFA 4EFQA 4HA2A 4ZFWB 1YF8B 1T4QA 1JT4A 2D7IA 3BX1C 1DJSB 3FGMA 3Q7XA 4ENDA 1YTOA 4LO8B 1Q1UA 3O4OA 2FFUA 3PG0A 4LO2C 3W9TA 1OQLB 2IHOA 3CAHA 4GAFA 2RG9B 1BFCA 5F8WA 4F34A 3I2AA 4LO3C 1IILA 3N7JA 3VT1A 3PHZA 5FNWA 1HCEA 3BAOA 4P0KA 3KMVA 4I3NA 3UJ0A 3OBTA 1ILR1 3CRIA 2DRZA 1FWVA 3FUQA 5BVPI 2KKIA 3ZXDA 3FUOA 3HMYA 1WD3A 3O5WB 3LLPA 3OJVA 1TFMB 1JTCA 1HCDA 5BXTA 2L5XA 3NBCA 2VSEA 5JLVA 4G1RA 4ZOTA 4J2YA 1ISYA 4I4XA 5FNXA 1EPWA 3BTAA 3BAGA 1JY0A 3WMVA 5BXRA 1K5UA 4ZLBB 1Q04A 4JPZA 4MZFB 4X38A 2MC2A 1BFFA 4LO7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AVX B;  2D24 A;  3H6S E;  3FJH A;  3RTJ B;  3S8K A;  1FGA A;  3POK A;  2D43 A;  3AJ5 A;  1XYF A;  2K8R A;  4XKI A;  1BFG A;  2D1Z A;  1EVT A;  1S0D A;  4KEI A;  4USO A;  3NJ5 A;  1W3G A;  1TTU A;  4KC3 A;  1FMM S;  2AQZ A;  2E4M A;  4XFT A;  1ISV A;  3Q7Y A;  2ZR1 B;  3O3Q A;  1DFQ A;  1AVW B;  5GAQ A;  3C9Z A;  3UD9 A;  3FJJ A;  1QQK A;  1HKN A;  4EB2 B;  1XG6 A;  3QR5 A;  4OWK A;  1G82 A;  3ZC8 A;  3HSM A;  3BB2 A;  1F31 A;  2BEA A;  3FJC A;  3AH4 A;  4X37 A;  2RQ9 A;  1VCL A;  3N7L A;  4CJM A;  1IOB A;  2MIB A;  3A23 A;  1K5V A;  2I1B A;  4OEF A;  1ISX A;  4IY9 A;  2ZQN A;  1CE7 B;  1I1B A;  3AKF A;  1AXM A;  2Y9G A;  1ISW A;  3A07 A;  3JRR A;  5DUY A;  4I4R A;  4P0L A;  3BAV A;  3RTI B;  1IRP A;  4PC4 A;  4A7Y A;  1G9B A;  2NZ9 A;  3CU1 B;  2FDB M;  4IZE A;  3NBD A;  2NM1 A;  1FV2 A;  3V0A B;  3HOM A;  4F83 A;  2ERM A;  4J2S A;  1RZO B;  1SR4 A;  3R4U A;  3ZXG A;  4GOV A;  3VUO A;  2HWM A;  5D61 A;  4JRA A;  1YXW A;  3FJI A;  3F1R A;  1R8N A;  2P39 A;  1PZZ A;  4FVV A;  5G00 A;  1PWA A;  5D62 A;  5F8S A;  4I1E A;  3BRG C;  2E4M C;  3QYD A;  2VU9 A;  4Z8S B;  4KEJ A;  5BXS A;  2KH2 A;  4A7K A;  1FN0 A;  2DRE A;  1YBI A;  3BA5 A;  4IHZ A;  4H9W A;  3ILA A;  3IM7 A;  1KNM A;  1QXM A;  3N7M A;  1W3A A;  3AZV A;  3ZC9 A;  5FZY A;  1MD6 A;  4EEE B;  1QQL A;  1TIE A;  3P6I A;  2HWA A;  2YUG A;  3AH1 A;  7I1B A;  2D22 A;  4XFS A;  4AN6 A;  1YYN A;  3FJE A;  1FWU A;  4Q9P A;  4KEK A;  1BA7 A;  1DFC A;  2HZ9 A;  2FO1 A;  3T8S A;  1V6X A;  3O49 A;  1G9D A;  2NTD A;  1ONK B;  2FFV A;  1DIW A;  3PME A;  2F8X C;  3O44 A;  1RML A;  1HWN B;  1ABR B;  2MLL B;  3VT2 A;  3IIR A;  1DQG A;  3WIN A;  1V6V A;  3PUB A;  3CA3 A;  4R6U B;  3FJA A;  1RG8 A;  1PUM B;  3O4A A;  2XOA A;  3N7K A;  2M49 A;  5BP5 A;  4YOL A;  4FGF A;  4LO1 A;  5FZU A;  1E0O A;  4ION A;  4D0T A;  2VXT I;  4I4O A;  4I4U A;  4GP3 A;  1JQZ A;  3EF2 A;  1IT0 A;  2GZB A;  1DZD A;  4QD2 B;  3WO3 A;  3UD8 A;  4GOY A;  3CA0 A;  1CVS A;  3I2X A;  1Q03 A;  3AKI A;  3R4S A;  3JUT A;  3IM5 A;  4IZX A;  4QBC A;  4ZGR B;  2UUS A;  1DZC A;  3CA5 A;  1TWM A;  1UPS A;  3V0B B;  1IRA X;  3OJM A;  3CA4 A;  4I37 A;  3SNV A;  3ZX7 A;  3N0K A;  3A21 A;  3AKH A;  4ZBV B;  4ZKT B;  3E8L C;  4A7Z A;  4J23 B;  2DS0 A;  2Y9F A;  3CA1 A;  3NBN A;  3V0A A;  3WMU A;  1G9A A;  4LO7 C;  2RST A;  3B9U A;  4LO2 A;  1W3F A;  4G9M A;  4I4Q A;  3FJK A;  1S0F A;  3UDA A;  1AVA C;  1HWP B;  2LIQ A;  1I1E A;  1JT5 A;  4QC4 A;  2NYY A;  1DQO A;  3WIN C;  3FJB A;  2J3P A;  2X2S A;  3F62 B;  2D44 A;  4JAW A;  2P23 A;  3BA4 A;  2K43 A;  3OJ2 A;  5F8Y A;  4LO0 A;  4Z9W B;  4P6A A;  3O4B A;  3WO2 A;  1TWE A;  2QYI B;  4OEE A;  5BP5 C;  2BEB A;  2VUA A;  4LO1 C;  3OGF A;  3WO4 A;  4GAI A;  4EFR A;  2ESU A;  1A8D A;  1AVU A;  1N4K A;  4Q91 A;  4L4I A;  4JP0 A;  5D63 A;  1L2H A;  3NBE A;  3S8J A;  3HAL A;  3BAU A;  2NP0 A;  2GO2 A;  4USP A;  1M16 A;  3BA7 A;  2F2F A;  3RMY A;  2X2T A;  4G6M A;  4J2K A;  4L4H A;  1XHB A;  3IM6 A;  3MAL A;  1GGP B;  1S0E A;  1PUU B;  1M2T B;  1D0H A;  4KBB A;  3IAG C;  1J0S A;  2KLL A;  1AFC A;  2DRY A;  3HBW A;  4QKR A;  4ZFY B;  1EV2 A;  1HWM B;  1II4 A;  2KI4 A;  1V6W A;  3AKG A;  2VXR A;  3UJ4 A;  3BRD A;  1Z2V A;  3A22 A;  3MPP G;  3FJ9 A;  2VLC A;  4P0J A;  1PC8 B;  5FZZ A;  4I4Y A;  4II0 A;  3H6R B;  4JKQ A;  1SZ6 B;  2AXM A;  2AAI B;  4I8M A;  3FJF A;  1FMZ A;  1ITB A;  1P63 A;  2QN4 A;  3O4D A;  2ET2 A;  1IHK A;  3CRH A;  5BXP A;  5BQU A;  5DZU A;  4TLP A;  1EYL A;  8I1B A;  1R8O A;  4LO0 C;  2R9K B;  2BFH A;  4HJJ A;  4OEG A;  1BLD A;  2Z48 A;  3VSZ A;  1SR4 C;  9ILB A;  5EHA A;  2NVH A;  3VT0 A;  5HPZ A;  1BLA A;  3BAH A;  3FJD A;  3OBR A;  1T9F A;  4HR6 C;  1ISZ A;  3D7W B;  1BFB A;  1JT7 A;  3FFZ A;  4Q9G A;  3V0B A;  2ZQO A;  4OW4 A;  4OWL A;  4DCK C;  2HW9 A;  2F2F C;  1Z4S A;  2Q9X A;  41BI A;  3I29 B;  2D7R A;  5F90 A;  3WA1 A;  1JLX A;  4AN7 B;  1WBA A;  2IWT B;  2Z49 A;  4IQP A;  4I4S A;  5EG6 C;  1HIB A;  1IJT A;  5E24 E;  3LTQ A;  1WD4 A;  1NZK A;  1G9C A;  1WBC A;  3OGG A;  3Q7W A;  1NUN A;  4X3A A;  4H04 A;  4X39 A;  1MC9 A;  2VSA A;  3FJ8 A;  2AFG A;  1AF9 A;  4D8H A;  6I1B A;  4DEP A;  2K4A B;  2KI6 B;  1BAS A;  4I6I A;  1Z0H A;  2D20 A;  1S0B A;  3BRF A;  5DVH A;  4I4P A;  4EFP A;  3RSJ A;  3AH2 A;  5I1B A;  4JKX B;  2Q3N B;  1S0G A;  1XZZ A;  1FV3 A;  3AZW A;  4G6J A;  4ZFU B;  4LO3 A;  5BQU C;  4D0Z A;  5B2H A;  3P6J A;  31BI A;  4QD2 C;  1V6U A;  5BOW A;  2Y9X E;  3CRG A;  4I2S A;  4JQ0 A;  3K1X A;  3VWC A;  5DSS B;  1HWO B;  5EC5 A;  4ISR A;  1S0L A;  3AJ6 A;  4IY8 A;  4OWJ A;  1RY7 A;  1DLL A;  1FQ9 A;  21BI A;  4QO3 A;  4OUJ A;  3RMX A;  4I7I A;  3UD7 A;  1BAR A;  1JLY A;  4QKS A;  4I1B A;  3BAQ A;  3V79 C;  4I4V A;  2D23 A;  4ZA3 B;  4G9N A;  4ISQ A;  4EKX B;  1TOO A;  2Y9W C;  2LIE A;  3O4C A;  1S0C A;  2WRY A;  4IYB A;  3H6Q A;  4DEN A;  1TP0 A;  4WBC A;  3H6R A;  4GP0 A;  4QBV A;  4QAL A;  3BAD A;  2WBC A;  3TC2 A;  3P53 A;  3CA6 A;  4J2X A;  3CQA A;  4I96 A;  3HN1 A;  1JT3 A;  5JMC A;  4I0Y A;  4XFU A;  2FGF A;  3VEQ A;  3VSF A;  4EFQ A;  4HA2 A;  4ZFW B;  1YF8 B;  1T4Q A;  1JT4 A;  2D7I A;  3BX1 C;  1DJS B;  3FGM A;  3Q7X A;  4END A;  1YTO A;  4LO8 B;  1Q1U A;  3O4O A;  2FFU A;  3PG0 A;  4LO2 C;  3W9T A;  1OQL B;  2IHO A;  3CAH A;  4GAF A;  2RG9 B;  1BFC A;  5F8W A;  4F34 A;  3I2A A;  4LO3 C;  1IIL A;  3N7J A;  3VT1 A;  3PHZ A;  5FNW A;  1HCE A;  3BAO A;  4P0K A;  3KMV A;  4I3N A;  3UJ0 A;  3OBT A;  1ILR 1;  3CRI A;  2DRZ A;  1FWV A;  3FUQ A;  5BVP I;  2KKI A;  3ZXD A;  3FUO A;  3HMY A;  1WD3 A;  3O5W B;  3LLP A;  3OJV A;  1TFM B;  1JTC A;  1HCD A;  5BXT A;  2L5X A;  3NBC A;  2VSE A;  5JLV A;  4G1R A;  4ZOT A;  4J2Y A;  1ISY A;  4I4X A;  5FNX A;  1EPW A;  3BTA A;  3BAG A;  1JY0 A;  3WMV A;  5BXR A;  1K5U A;  4ZLB B;  1Q04 A;  4JPZ A;  4X38 A;  2MC2 A;  1BFF A;  4LO7 B; 
#chains in the Genus database with same CATH topology
 1AVX B;  2D24 A;  3H6S E;  3FJH A;  3RTJ B;  3S8K A;  1FGA A;  3POK A;  2D43 A;  3AJ5 A;  1XYF A;  2K8R A;  4XKI A;  1BFG A;  2D1Z A;  1EVT A;  1S0D A;  4KEI A;  4USO A;  3NJ5 A;  1W3G A;  1TTU A;  4KC3 A;  1FMM S;  2AQZ A;  2E4M A;  4XFT A;  1ISV A;  3Q7Y A;  2ZR1 B;  3O3Q A;  1DFQ A;  1AVW B;  5GAQ A;  3C9Z A;  3UD9 A;  3FJJ A;  1QQK A;  1HKN A;  4EB2 B;  1XG6 A;  3QR5 A;  4OWK A;  1G82 A;  3ZC8 A;  3HSM A;  3BB2 A;  1F31 A;  2BEA A;  3FJC A;  3AH4 A;  4X37 A;  2RQ9 A;  1VCL A;  3N7L A;  4CJM A;  1IOB A;  2MIB A;  3A23 A;  1K5V A;  2I1B A;  4OEF A;  1ISX A;  4IY9 A;  2ZQN A;  1CE7 B;  1I1B A;  3AKF A;  1AXM A;  2Y9G A;  1ISW A;  3A07 A;  3JRR A;  5DUY A;  4I4R A;  4P0L A;  3BAV A;  3RTI B;  1IRP A;  4PC4 A;  4A7Y A;  1G9B A;  2NZ9 A;  3CU1 B;  2FDB M;  4IZE A;  3NBD A;  2NM1 A;  1FV2 A;  3V0A B;  3HOM A;  4UY4 A;  4F83 A;  2ERM A;  4J2S A;  1RZO B;  1SR4 A;  3R4U A;  3ZXG A;  4GOV A;  3VUO A;  2HWM A;  5D61 A;  4JRA A;  1YXW A;  3FJI A;  3F1R A;  1R8N A;  2P39 A;  1PZZ A;  4FVV A;  5G00 A;  1PWA A;  5D62 A;  5F8S A;  4I1E A;  3BRG C;  2E4M C;  3QYD A;  2VU9 A;  4Z8S B;  4KEJ A;  5BXS A;  2KH2 A;  4A7K A;  1FN0 A;  2DRE A;  1YBI A;  3BA5 A;  4IHZ A;  4H9W A;  3ILA A;  3IM7 A;  1KNM A;  1QXM A;  3N7M A;  1W3A A;  3AZV A;  3ZC9 A;  5FZY A;  1MD6 A;  4EEE B;  1QQL A;  1TIE A;  3P6I A;  2HWA A;  2YUG A;  3AH1 A;  7I1B A;  2D22 A;  4XFS A;  4AN6 A;  1YYN A;  3FJE A;  1FWU A;  4Q9P A;  4KEK A;  1BA7 A;  1DFC A;  2HZ9 A;  2FO1 A;  3T8S A;  1V6X A;  3O49 A;  1G9D A;  2NTD A;  1ONK B;  2FFV A;  1DIW A;  3PME A;  2F8X C;  3O44 A;  1RML A;  1HWN B;  1ABR B;  2MLL B;  3VT2 A;  3IIR A;  1DQG A;  3WIN A;  1V6V A;  3PUB A;  3CA3 A;  4R6U B;  3FJA A;  1RG8 A;  1PUM B;  3O4A A;  2XOA A;  3N7K A;  2M49 A;  5BP5 A;  4YOL A;  4FGF A;  4LO1 A;  5FZU A;  1E0O A;  4ION A;  4D0T A;  2VXT I;  4I4O A;  4I4U A;  4GP3 A;  1JQZ A;  3EF2 A;  1IT0 A;  2GZB A;  1DZD A;  4QD2 B;  3WO3 A;  3UD8 A;  4GOY A;  3CA0 A;  1CVS A;  3I2X A;  1Q03 A;  3AKI A;  3R4S A;  3JUT A;  3IM5 A;  4IZX A;  4QBC A;  4ZGR B;  2UUS A;  1DZC A;  3CA5 A;  1TWM A;  1UPS A;  3V0B B;  1IRA X;  3OJM A;  3CA4 A;  4I37 A;  3SNV A;  3ZX7 A;  3N0K A;  3A21 A;  3AKH A;  4ZBV B;  4ZKT B;  3E8L C;  4A7Z A;  4J23 B;  2DS0 A;  2Y9F A;  3CA1 A;  3NBN A;  3V0A A;  3WMU A;  1G9A A;  4LO7 C;  2RST A;  3B9U A;  4LO2 A;  1W3F A;  4G9M A;  4I4Q A;  3FJK A;  1S0F A;  3UDA A;  1AVA C;  1HWP B;  2LIQ A;  1I1E A;  1JT5 A;  4QC4 A;  2NYY A;  1DQO A;  3WIN C;  3FJB A;  2J3P A;  2X2S A;  3F62 B;  2D44 A;  4JAW A;  2P23 A;  3BA4 A;  2K43 A;  3OJ2 A;  5F8Y A;  4LO0 A;  4Z9W B;  4P6A A;  3O4B A;  3WO2 A;  1TWE A;  2QYI B;  4OEE A;  5BP5 C;  2BEB A;  2VUA A;  4MZG B;  4LO1 C;  3OGF A;  3WO4 A;  4GAI A;  4EFR A;  2ESU A;  1A8D A;  1AVU A;  1N4K A;  4Q91 A;  4L4I A;  4JP0 A;  5D63 A;  4H75 A;  1L2H A;  3NBE A;  3S8J A;  3HAL A;  3BAU A;  2NP0 A;  2GO2 A;  4USP A;  1M16 A;  3BA7 A;  2F2F A;  3RMY A;  2X2T A;  4G6M A;  4J2K A;  4L4H A;  1XHB A;  3IM6 A;  3MAL A;  1GGP B;  1S0E A;  1PUU B;  1M2T B;  1D0H A;  4KBB A;  3IAG C;  1J0S A;  2KLL A;  1AFC A;  2DRY A;  3HBW A;  4QKR A;  4ZFY B;  1EV2 A;  1HWM B;  1II4 A;  2KI4 A;  1V6W A;  3AKG A;  2VXR A;  3UJ4 A;  3BRD A;  1Z2V A;  3A22 A;  3MPP G;  3FJ9 A;  2VLC A;  4P0J A;  1PC8 B;  5FZZ A;  4I4Y A;  4II0 A;  3H6R B;  4JKQ A;  1SZ6 B;  2AXM A;  2AAI B;  4I8M A;  3FJF A;  1FMZ A;  1ITB A;  1P63 A;  2QN4 A;  4MZH A;  3O4D A;  2ET2 A;  1IHK A;  3CRH A;  5BXP A;  5BQU A;  5DZU A;  4TLP A;  1EYL A;  8I1B A;  1R8O A;  4LO0 C;  2R9K B;  2BFH A;  4HJJ A;  4OEG A;  1BLD A;  2Z48 A;  3VSZ A;  1SR4 C;  9ILB A;  5EHA A;  2NVH A;  3VT0 A;  5HPZ A;  1BLA A;  3BAH A;  3FJD A;  3OBR A;  1T9F A;  4HR6 C;  1ISZ A;  3D7W B;  1BFB A;  1JT7 A;  3FFZ A;  4Q9G A;  3V0B A;  2ZQO A;  4OW4 A;  4OWL A;  4DCK C;  2HW9 A;  2F2F C;  1Z4S A;  2Q9X A;  41BI A;  3I29 B;  2D7R A;  2NS2 A;  5F90 A;  3WA1 A;  1JLX A;  4AN7 B;  1WBA A;  2IWT B;  2Z49 A;  4IQP A;  4I4S A;  5EG6 C;  1HIB A;  1IJT A;  5E24 E;  3LTQ A;  1WD4 A;  1NZK A;  1G9C A;  1WBC A;  3OGG A;  3Q7W A;  1NUN A;  4X3A A;  4H04 A;  4X39 A;  1MC9 A;  2VSA A;  3FJ8 A;  2AFG A;  1AF9 A;  4D8H A;  6I1B A;  4DEP A;  2K4A B;  2KI6 B;  1BAS A;  4I6I A;  1Z0H A;  2D20 A;  1S0B A;  3BRF A;  5DVH A;  4I4P A;  4EFP A;  3RSJ A;  3AH2 A;  5I1B A;  4JKX B;  2Q3N B;  1S0G A;  1XZZ A;  1FV3 A;  3AZW A;  4G6J A;  4ZFU B;  4LO3 A;  5BQU C;  4D0Z A;  5B2H A;  3P6J A;  31BI A;  4QD2 C;  1V6U A;  5BOW A;  2Y9X E;  3CRG A;  4I2S A;  4JQ0 A;  3K1X A;  3VWC A;  5DSS B;  1HWO B;  5EC5 A;  4ISR A;  1S0L A;  3AJ6 A;  4IY8 A;  4OWJ A;  1RY7 A;  1DLL A;  1FQ9 A;  21BI A;  4QO3 A;  4OUJ A;  3RMX A;  4I7I A;  3UD7 A;  1BAR A;  1JLY A;  4QKS A;  4I1B A;  3BAQ A;  3V79 C;  4I4V A;  2D23 A;  4ZA3 B;  4G9N A;  4ISQ A;  4EKX B;  1TOO A;  2Y9W C;  2LIE A;  3O4C A;  1S0C A;  2WRY A;  4IYB A;  3H6Q A;  4DEN A;  1TP0 A;  4WBC A;  3H6R A;  4GP0 A;  4QBV A;  4QAL A;  3BAD A;  2WBC A;  3TC2 A;  3P53 A;  3CA6 A;  4J2X A;  3CQA A;  4I96 A;  3HN1 A;  1JT3 A;  5JMC A;  4I0Y A;  4XFU A;  2FGF A;  3VEQ A;  3VSF A;  4EFQ A;  4HA2 A;  4ZFW B;  1YF8 B;  1T4Q A;  1JT4 A;  2D7I A;  3BX1 C;  1DJS B;  3FGM A;  3Q7X A;  4END A;  1YTO A;  4LO8 B;  1Q1U A;  3O4O A;  2FFU A;  3PG0 A;  4LO2 C;  3W9T A;  1OQL B;  2IHO A;  3CAH A;  4GAF A;  2RG9 B;  1BFC A;  5F8W A;  4F34 A;  3I2A A;  4LO3 C;  1IIL A;  3N7J A;  3VT1 A;  3PHZ A;  5FNW A;  1HCE A;  3BAO A;  4P0K A;  3KMV A;  4I3N A;  3UJ0 A;  3OBT A;  1ILR 1;  3CRI A;  2DRZ A;  1FWV A;  3FUQ A;  5BVP I;  2KKI A;  3ZXD A;  3FUO A;  3HMY A;  1WD3 A;  3O5W B;  3LLP A;  3OJV A;  1TFM B;  1JTC A;  1HCD A;  5BXT A;  2L5X A;  3NBC A;  2VSE A;  5JLV A;  4G1R A;  4ZOT A;  4J2Y A;  1ISY A;  4I4X A;  5FNX A;  1EPW A;  3BTA A;  3BAG A;  1JY0 A;  3WMV A;  5BXR A;  1K5U A;  4ZLB B;  1Q04 A;  4JPZ A;  4MZF B;  4X38 A;  2MC2 A;  1BFF A;  4LO7 B; 
#chains in the Genus database with same CATH homology
 1AVX B;  2D24 A;  3H6S E;  3FJH A;  3RTJ B;  3S8K A;  1FGA A;  3POK A;  2D43 A;  3AJ5 A;  1XYF A;  2K8R A;  4XKI A;  1BFG A;  2D1Z A;  1EVT A;  1S0D A;  4KEI A;  4USO A;  3NJ5 A;  1W3G A;  1TTU A;  4KC3 A;  1FMM S;  2AQZ A;  2E4M A;  4XFT A;  1ISV A;  3Q7Y A;  2ZR1 B;  3O3Q A;  1DFQ A;  1AVW B;  5GAQ A;  3C9Z A;  3UD9 A;  3FJJ A;  1QQK A;  1HKN A;  4EB2 B;  1XG6 A;  3QR5 A;  4OWK A;  1G82 A;  3ZC8 A;  3HSM A;  3BB2 A;  1F31 A;  2BEA A;  3FJC A;  3AH4 A;  4X37 A;  2RQ9 A;  1VCL A;  3N7L A;  4CJM A;  1IOB A;  2MIB A;  3A23 A;  1K5V A;  2I1B A;  4OEF A;  1ISX A;  4IY9 A;  2ZQN A;  1CE7 B;  1I1B A;  3AKF A;  1AXM A;  2Y9G A;  1ISW A;  3A07 A;  3JRR A;  5DUY A;  4I4R A;  4P0L A;  3BAV A;  3RTI B;  1IRP A;  4PC4 A;  4A7Y A;  1G9B A;  2NZ9 A;  3CU1 B;  2FDB M;  4IZE A;  3NBD A;  2NM1 A;  1FV2 A;  3V0A B;  3HOM A;  4UY4 A;  4F83 A;  2ERM A;  4J2S A;  1RZO B;  1SR4 A;  3R4U A;  3ZXG A;  4GOV A;  3VUO A;  2HWM A;  5D61 A;  4JRA A;  1YXW A;  3FJI A;  3F1R A;  1R8N A;  2P39 A;  1PZZ A;  4FVV A;  5G00 A;  1PWA A;  5D62 A;  5F8S A;  4I1E A;  3BRG C;  2E4M C;  3QYD A;  2VU9 A;  4Z8S B;  4KEJ A;  5BXS A;  2KH2 A;  4A7K A;  1FN0 A;  2DRE A;  1YBI A;  3BA5 A;  4IHZ A;  4H9W A;  3ILA A;  3IM7 A;  1KNM A;  1QXM A;  3N7M A;  1W3A A;  3AZV A;  3ZC9 A;  5FZY A;  1MD6 A;  4EEE B;  1QQL A;  1TIE A;  3P6I A;  2HWA A;  2YUG A;  3AH1 A;  7I1B A;  2D22 A;  4XFS A;  4AN6 A;  1YYN A;  3FJE A;  1FWU A;  4Q9P A;  4KEK A;  1BA7 A;  1DFC A;  2HZ9 A;  2FO1 A;  3T8S A;  1V6X A;  3O49 A;  1G9D A;  2NTD A;  1ONK B;  2FFV A;  1DIW A;  3PME A;  2F8X C;  3O44 A;  1RML A;  1HWN B;  1ABR B;  2MLL B;  3VT2 A;  3IIR A;  1DQG A;  3WIN A;  1V6V A;  3PUB A;  3CA3 A;  4R6U B;  3FJA A;  1RG8 A;  1PUM B;  3O4A A;  2XOA A;  3N7K A;  2M49 A;  5BP5 A;  4YOL A;  4FGF A;  4LO1 A;  5FZU A;  1E0O A;  4ION A;  4D0T A;  2VXT I;  4I4O A;  4I4U A;  4GP3 A;  1JQZ A;  3EF2 A;  1IT0 A;  2GZB A;  1DZD A;  4QD2 B;  3WO3 A;  3UD8 A;  4GOY A;  3CA0 A;  1CVS A;  3I2X A;  1Q03 A;  3AKI A;  3R4S A;  3JUT A;  3IM5 A;  4IZX A;  4QBC A;  4ZGR B;  2UUS A;  1DZC A;  3CA5 A;  1TWM A;  1UPS A;  3V0B B;  1IRA X;  3OJM A;  3CA4 A;  4I37 A;  3SNV A;  3ZX7 A;  3N0K A;  3A21 A;  3AKH A;  4ZBV B;  4ZKT B;  3E8L C;  4A7Z A;  4J23 B;  2DS0 A;  2Y9F A;  3CA1 A;  3NBN A;  3V0A A;  3WMU A;  1G9A A;  4LO7 C;  2RST A;  3B9U A;  4LO2 A;  1W3F A;  4G9M A;  4I4Q A;  3FJK A;  1S0F A;  3UDA A;  1AVA C;  1HWP B;  2LIQ A;  1I1E A;  1JT5 A;  4QC4 A;  2NYY A;  1DQO A;  3WIN C;  3FJB A;  2J3P A;  2X2S A;  3F62 B;  2D44 A;  4JAW A;  2P23 A;  3BA4 A;  2K43 A;  3OJ2 A;  5F8Y A;  4LO0 A;  4Z9W B;  4P6A A;  3O4B A;  3WO2 A;  1TWE A;  2QYI B;  4OEE A;  5BP5 C;  2BEB A;  2VUA A;  4MZG B;  4LO1 C;  3OGF A;  3WO4 A;  4GAI A;  4EFR A;  2ESU A;  1A8D A;  1AVU A;  1N4K A;  4Q91 A;  4L4I A;  4JP0 A;  5D63 A;  4H75 A;  1L2H A;  3NBE A;  3S8J A;  3HAL A;  3BAU A;  2NP0 A;  2GO2 A;  4USP A;  1M16 A;  3BA7 A;  2F2F A;  3RMY A;  2X2T A;  4G6M A;  4J2K A;  4L4H A;  1XHB A;  3IM6 A;  3MAL A;  1GGP B;  1S0E A;  1PUU B;  1M2T B;  1D0H A;  4KBB A;  3IAG C;  1J0S A;  2KLL A;  1AFC A;  2DRY A;  3HBW A;  4QKR A;  4ZFY B;  1EV2 A;  1HWM B;  1II4 A;  2KI4 A;  1V6W A;  3AKG A;  2VXR A;  3UJ4 A;  3BRD A;  1Z2V A;  3A22 A;  3MPP G;  3FJ9 A;  2VLC A;  4P0J A;  1PC8 B;  5FZZ A;  4I4Y A;  4II0 A;  3H6R B;  4JKQ A;  1SZ6 B;  2AXM A;  2AAI B;  4I8M A;  3FJF A;  1FMZ A;  1ITB A;  1P63 A;  2QN4 A;  4MZH A;  3O4D A;  2ET2 A;  1IHK A;  3CRH A;  5BXP A;  5BQU A;  5DZU A;  4TLP A;  1EYL A;  8I1B A;  1R8O A;  4LO0 C;  2R9K B;  2BFH A;  4HJJ A;  4OEG A;  1BLD A;  2Z48 A;  3VSZ A;  1SR4 C;  9ILB A;  5EHA A;  2NVH A;  3VT0 A;  5HPZ A;  1BLA A;  3BAH A;  3FJD A;  3OBR A;  1T9F A;  4HR6 C;  1ISZ A;  3D7W B;  1BFB A;  1JT7 A;  3FFZ A;  4Q9G A;  3V0B A;  2ZQO A;  4OW4 A;  4OWL A;  4DCK C;  2HW9 A;  2F2F C;  1Z4S A;  2Q9X A;  41BI A;  3I29 B;  2D7R A;  2NS2 A;  5F90 A;  3WA1 A;  1JLX A;  4AN7 B;  1WBA A;  2IWT B;  2Z49 A;  4IQP A;  4I4S A;  5EG6 C;  1HIB A;  1IJT A;  5E24 E;  3LTQ A;  1WD4 A;  1NZK A;  1G9C A;  1WBC A;  3OGG A;  3Q7W A;  1NUN A;  4X3A A;  4H04 A;  4X39 A;  1MC9 A;  2VSA A;  3FJ8 A;  2AFG A;  1AF9 A;  4D8H A;  6I1B A;  4DEP A;  2K4A B;  2KI6 B;  1BAS A;  4I6I A;  1Z0H A;  2D20 A;  1S0B A;  3BRF A;  5DVH A;  4I4P A;  4EFP A;  3RSJ A;  3AH2 A;  5I1B A;  4JKX B;  2Q3N B;  1S0G A;  1XZZ A;  1FV3 A;  3AZW A;  4G6J A;  4ZFU B;  4LO3 A;  5BQU C;  4D0Z A;  5B2H A;  3P6J A;  31BI A;  4QD2 C;  1V6U A;  5BOW A;  2Y9X E;  3CRG A;  4I2S A;  4JQ0 A;  3K1X A;  3VWC A;  5DSS B;  1HWO B;  5EC5 A;  4ISR A;  1S0L A;  3AJ6 A;  4IY8 A;  4OWJ A;  1RY7 A;  1DLL A;  1FQ9 A;  21BI A;  4QO3 A;  4OUJ A;  3RMX A;  4I7I A;  3UD7 A;  1BAR A;  1JLY A;  4QKS A;  4I1B A;  3BAQ A;  3V79 C;  4I4V A;  2D23 A;  4ZA3 B;  4G9N A;  4ISQ A;  4EKX B;  1TOO A;  2Y9W C;  2LIE A;  3O4C A;  1S0C A;  2WRY A;  4IYB A;  3H6Q A;  4DEN A;  1TP0 A;  4WBC A;  3H6R A;  4GP0 A;  4QBV A;  4QAL A;  3BAD A;  2WBC A;  3TC2 A;  3P53 A;  3CA6 A;  4J2X A;  3CQA A;  4I96 A;  3HN1 A;  1JT3 A;  5JMC A;  4I0Y A;  4XFU A;  2FGF A;  3VEQ A;  3VSF A;  4EFQ A;  4HA2 A;  4ZFW B;  1YF8 B;  1T4Q A;  1JT4 A;  2D7I A;  3BX1 C;  1DJS B;  3FGM A;  3Q7X A;  4END A;  1YTO A;  4LO8 B;  1Q1U A;  3O4O A;  2FFU A;  3PG0 A;  4LO2 C;  3W9T A;  1OQL B;  2IHO A;  3CAH A;  4GAF A;  2RG9 B;  1BFC A;  5F8W A;  4F34 A;  3I2A A;  4LO3 C;  1IIL A;  3N7J A;  3VT1 A;  3PHZ A;  5FNW A;  1HCE A;  3BAO A;  4P0K A;  3KMV A;  4I3N A;  3UJ0 A;  3OBT A;  1ILR 1;  3CRI A;  2DRZ A;  1FWV A;  3FUQ A;  5BVP I;  2KKI A;  3ZXD A;  3FUO A;  3HMY A;  1WD3 A;  3O5W B;  3LLP A;  3OJV A;  1TFM B;  1JTC A;  1HCD A;  5BXT A;  2L5X A;  3NBC A;  2VSE A;  5JLV A;  4G1R A;  4ZOT A;  4J2Y A;  1ISY A;  4I4X A;  5FNX A;  1EPW A;  3BTA A;  3BAG A;  1JY0 A;  3WMV A;  5BXR A;  1K5U A;  4ZLB B;  1Q04 A;  4JPZ A;  4MZF B;  4X38 A;  2MC2 A;  1BFF A;  4LO7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...