1YTUA

Structural basis for 5'-end-specific recognition of the guide rna strand by the a. fulgidus piwi protein
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
426
structure length
410
Chain Sequence
MEYKIVENGLTYRIGNGASVPISNTGELIKGLRNYGPYEVPSLKYNQIALIHNNQFSSLINQLKSQISSKIDEVWHIHNINISEFIYDSPHFDSIKSQVDNAIDTGVDGIMLVLPEYNTPLYYKLKSYLINSIPSQFMRYDILSNRNLTFYVDNLLVQFVSKLGGKPWILNVDPEKGSDIIIGTGATRIDNVNLFCFAMVFKKDGTMLWNEISPIVTSSEYLTYLKSTIKKVVYGFKKSNPDWDVEKLTLHVSGKRPKMKDGETKILKETVEELKKQEMVSRDVKYAILHLNETHPFWVMGDPYEGTKVKLSSKRYLLTLLQPYPIKPLSVEIVSDNWTSEEYYHNVHEILDEIYYLSKMNWRGFRSRNLPVTVNYPKLVAGIIANVNRYGGYPINPEGNRSLQTNPWFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for 5'-end-specific recognition of guide RNA by the A. fulgidus Piwi protein.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Rna binding protein/rna
molecule keywords 5'-R(P*AP*GP*AP*CP*AP*G)-3'
total genus 125
structure length 410
sequence length 426
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02171 Piwi Piwi domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1ytuA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ytuA02
3VQ6A 2N9UA 4EYKA 3QERA 4QYMA 1U45A 3OQOA 3RQIA 3V9WA 2IPAB 3UK0A 3CFYA 1JX6A 3OYGA 5KQLA 3L3VA 1YTUA 4CBVA 4KMRA 1WSFA 1B9DA 2PY5A 3VQ9A 5FBKA 1UOCA 3SNNA 1Q9XA 3SG0A 4DU1A 3V1RA 3OY9A 1JHZA 4KI4A 3ZCMA 3WNFA 4FLZA 4FJIA 1U49A 2JVKA 3RH0A 2A9RA 1RXEA 3NHGA 4MQEA 1S9GA 3H1GA 2G8IA 4N47A 2RJNA 2YNGA 4JA2A 4KHYA 3SUQA 4MS4B 3MEEA 4RV5A 4M3RA 2WY2D 1SUQA 2MYNA 3TR8A 3N53A 3TD9A 3HT3A 3AO3A 4NQRA 1AB6A 3KD1E 3GBVA 2I5JA 2YNHA 1ZBLA 4C8KA 3JSMA 5HP1A 4ZHRA 2X78A 4DU4A 4RW4A 3PV8A 5FDLA 1NXVA 4WUTA 3O75A 3OLXA 1EETA 4LX8A 4CJLA 2F8TA 3AA5X 1MIHA 1ZN2A 4OATA 3TAFA 5TPZD 5TE9A 4JP1A 5TQ0B 2HSGA 3D8UA 5EWJA 4I7FA 4IMJB 2AYZA 4OKJA 3NBMA 3QINA 5TPWA 2E4UA 1BGXT 3HEBA 5KRSA 4GVMA 3PO4A 3ZSYA 4M41A 3EY1A 4IDKA 1YTAA 1QPZA 2O4GA 3M9WA 1NTRA 3VNAA 3URMA 1F4VA 3GRCA 1EWKA 4KFCA 1C4WA 5EWMB 4CF1A 4E3SA 3KTOA 4L4UA 3GBPA 4FB4A 5IULC 1IKYA 1JFSA 3NHMA 3KYJB 3FGZA 3KD5E 2QU7A 1ISRA 5E3JA 2FBXA 4FZYA 4M88A 1Z17A 4H60A 4RXMA 1WSEA 2KZZA 2PMCA 4E89A 4LH5A 5TPZA 1H9CA 3P83D 3ZT2A 3OYAA 1HNVA 2XY8A 4LD0A 4DFKA 3T38A 4GW6A 4W5NA 5TQ2A 4M3UA 1L5UA 2JK1A 3HM9A 2XY7A 1LK0A 2DY4A 4ZTFA 1Z2DA 4DTUA 1B92A 1JLBA 2HQRA 3DRPA 1WSIA 3JPWA 5CNJA 3ALYA 3P5JA 1RNHA 1BL3A 4Q6BA 4RKRA 2G8VA 3LUGA 1NXWA 1KMIY 4QPJC 1BI4A 5EU7A 2PL9A 4ELVA 1R8JA 4CGJA 4CJEA 3QEIA 1ZYQA 3TABA 3HK2A 4RK5A 2LBPA 5CYQA 3ZSRA 2FVYA 1QP4A 1AB5A 1QSYA 4HNQA 4RZSA 4O44A 3L3UA 1X9WA 1RTIA 2P9HA 2O20A 3SQNA 1KFDA 3NF6A 2Q3SA 4RW9A 3C3KA 3KLHA 2PKXA 3CNBA 4DSJA 1DJMA 5HRPA 4AHUA 4O55A 4FZZA 4QYWA 4O0JA 1JL3A 4ZMSA 4DMNA 1NK9A 2HB5A 2IPNA 2KFZA 1QE1A 2FQWA 3K2PA 3TWHA 5KGXA 3LWLA 2ATQA 3MA0A 1RCHA 4J2AA 4JASB 1NXOA 2R48A 4S05A 3MF4A 1TLFA 3LUCA 4M3XA 2KZMA 1Z13A 3AVKA 3E61A 3JY6A 3IP5A 2Q5CA 4RY8A 3IPAA 4CK3A 3G85A 3L49A 2FBYA 4DSFA 3AVIA 1NK7A 4DSKA 3IP9A 3NH0A 3GYBA 5HSGA 3HPOA 1L5YA 4F2RA 2Y1JA 2WRZA 3CG7A 1URPA 3QLTA 5C42A 4CEDA 3V9UA 3VA3A 3KG2A 1JL1A 3CG4A 1ZGZA 2J48A 5JNTA 1KGSA 5HBMA 4ELTA 1CYEA 2PYLA 2LPMA 6CHYA 1VRTA 3EULA 3CFOA 4I2PA 2OQRA 3RMBA 4ZMRA 4MRMA 4BWMA 3K5NA 4OTZA 1HNIA 4IKFA 2HHUA 1BDHA 4FYDA 2GI4A 1LW2A 1XWWA 2VWJA 2VYCA 1D1QA 3DLEA 3IP7A 3QLVC 1S5JA 2A9OA 2NUBA 1A04A 2E4WA 4RXUA 1ITGA 1DTTA 2IOCA 4Z9AA 2PUGA 3ZSOA 1VSIA 1VRUA 3RRGA 1TAQA 3QNOA 3OYFA 1TAUA 4RW7A 7ABPA 1RT6A 3V1QA 4IMIB 2H3HA 1LAWA 3N0XA 2A1RA 4Y1CA 4KQCA 1M2EA 5DTEA 3EJWA 1TVRA 4RW6A 1S1VA 1KTQA 1W0HA 2PJUA 1PEAA 3AO1A 5JNRA 1QNLA 4K8XA 1TM2A 2RPIA 5EWLB 1JLQA 4PUOA 4BE1A 4WE1A 3DLRA 4FJJA 2WOMA 3LUFA 5IUNC 1RTJA 3ASMA 3KJVA 4FLVA 4DQQA 4LDZA 2KFNA 4MS3B 4P1ZA 2QVGA 1NK8A 1QQAA 2Z1JA 1SL0A 1NOYA 2TMYA 1MU2A 4Z4HA 2IPLA 1SL2A 2JVIA 1M5TA 3RMDA 2X6NA 4O1IA 3O3GA 1RPJA 3HVTA 3OO0A 4K8ZA 2JBAB 3T19A 4EYGA 1BCMA 2A9PA 1J54A 3CTPA 4ID1A 2NZVG 3HDVA 4LZLA 2VG5A 5J1EA 1ZBUA 1BDJA 1GCAA 2YHBA 4E7PA 5JNUA 1W9HA 2B5JA 4CEQA 1XC9A 1D9DA 2GX6A 4KK4A 4E1MA 2G8UA 3NFAA 2FEKA 4CJTA 5FWYB 1NK0A 1CXUA 3AVNA 3FFTA 3BRSA 1J9AA 5HM6A 1GOCA 2EHGA 3PO5A 3I09A 3QK7A 4D74A 3TX6A 2E4XA 2X74A 2RN2A 3OM1A 2IOYA 4OPJA 5D2CA 1VSFA 4JRPA 4G0PA 1IIBA 4MYRA 3ROTA 1QP0A 4BACA 4CECA 4YNQA 1USIA 3QLUA 3THVA 4EYQA 4IBNA 1HMVA 3IDOA 1NJWA 3RVLA 1RDAA 4AHTA 4G86A 5F64A 1D4ZA 4BDZA 4KTZA 4LRQA 5DGCA 1HYZA 1GUDA 3NGYA 5GOTA 4CERA 1DCFA 4OGCA 4JB0A 4ID5A 1U0SY 1DG9A 3EDCA 2HHVA 2R47A 4DF4A 4EP4A 1RXIA 2ZQBA 2Z1HA 3ZT3A 3MECA 1HEYA 1JLAA 4DFMA 1YK0A 1JDPA 5K14A 2WJWA 3KS9A 3LAKA 4FJHA 2D0AA 4IGAA 1JL2A 5IUKC 4F12A 4B8AB 5BQ3A 1P6UA 2H0AA 2GV9A 3CFPA 2PUBA 4OVLA 1UDRA 1NATA 4DTMA 1ZESA 4KHNA 4PY5A 4S04A 2RKIA 2YV0X 2OPPA 2ZAYA 3H75A 4G97A 3LDSA 1LBHA 1USGA 2B4AA 4FJXA 3PX6A 4G0QA 2DFFA 3ILYA 2MYPA 4OKEA 3MM4A 3MIZA 5CNIA 3H5TA 2G8HA 3C94A 4RW8A 4F8RA 2D5RA 4CF2A 4KHSA 2QXYA 3K9CA 4HNSA 1QMPA 3IAYA 4FZXC 3OQNA 4MR7B 4RG8A 1RDDA 2FC0A 1WSJA 4FXDA 4OLAA 3VQDA 4DS5A 1QQCA 3V1OA 1VSKA 1RBVA 3H1EA 4JS4A 4IF4A 1LBIA 3O2QB 4HUGA 4FLXA 1NOZA 3DBIA 2KYRA 1HRHA 3Q41A 2OZMA 3DLBA 3QX9A 3KLEA 1NY5A 3A3KA 3JS5A 3CM5A 1NJYA 2GKGA 3HSTB 2CHFA 3LFTA 1GOAA 5FBHA 4NCAA 1MB0A 3OYBA 4N0PA 2WONA 4LE0A 1FFWA 3SY8A 1DCKA 4G0YA 3DI6A 2P51A 3I0SA 1A2OA 3HXMA 2HNYA 1ZH2A 1WETA 1DZ3A 3A0RB 3ITHA 3OYNA 4Y1DA 4XLTA 5TQ2B 2YKMA 1PNTA 1Q9YA 5DKFA 1VK0A 2IAJA 1DBPA 4GNRA 4CFDA 5DCLA 1TL1A 5IUJC 3DOKA 1KRWA 3D0PA 4B9TA 1BQMA 3AO2A 3MXIA 1YMVA 3DM2A 5KRTA 4H4MA 4F06A 3QLHA 3RMCA 4MR9B 1APBA 1U8TA 2PL1A 1Z15A 3O74A 1BISA 3TARA 4LH4A 1YK1A 3C6QA 1RNLA 3HYFA 1T05A 3AA4A 2WMYA 4CJSA 3N0WA 3LALA 5T3YA 4MQFA 4RK7A 1FK9A 1BIUA 1OXBB 1I39A 4E0DA 4KQ9A 3BRQA 5C5EA 1VSLA 5JS1A 4MR7A 4FLUA 3AVLA 4AHCA 1VKRA 1VLZA 2QZJA 1HQUA 1I3CA 3QEMB 1C1CA 2F96A 3ROFA 2M1ZA 5PNTA 3EGCA 5SWMA 1QP7A 4FLWA 1HYVA 4CHNA 4AHVA 3T8YA 2KQ2A 3UUGA 1TJYA 3T95A 4OG2A 2OPSA 3CU5A 1YMUA 2OYQA 1K68A 4FJ9A 4DTNA 4LY7A 1Z25A 1G15A 1GLGA 1QO0A 5CY4A 3TI0A 3SUNA 1PHRA 3K5LA 4W5OA 3CYMA 1S8NA 3LPTA 4RKQA 4FJGA 3VQBA 3PX0A 4KAZA 3KKEA 4BE0A 2FMFA 1ZGGA 3SZ2A 5C24A 3OYCA 4OBBA 2RDMA 4HTUA 3C6TA 1RBUA 5JS2A 1VSEA 4F4KA 3JYTA 4D6YA 1JXBA 1NJXA 5CHYA 4TMYA 3V81A 3VQ8A 2JVJA 4E19A 3M8PA 2FEWB 4Z0NA 9ABPA 2HMIA 4DQDA 4FJ8A 1L3VA 3A0UA 1TV6A 3AVHA 5FRMA 3KTQA 4ML3A 4MQFB 4B08A 1W25A 4DTOA 1HQEA 1NKBA 2FW0A 4E7LA 3OYJA 4PEVA 3H08A 4B3OA 3DRSA 2IYNA 3T6KA 5HLFA 4RY9A 1Y1LA 4BDPA 4PE5B 4DTXA 3V6DA 2FBVA 3LZJA 4YLEA 3LP0A 1N6QA 1DCMA 3Q7RA 2IS3A 4KRFA 3HUTA 4Z4GA 4UHKA 4KTWA 4JRQA 4N56A 1KVBA 3BILA 4ETIA 1YS6A 1RT3A 1Z2EA 4HUFA 2QKBA 1TKXA 1C6VA 1BI4B 3HJFA 4MQEB 4KI6A 1X1PA 3AA2A 4LE2A 3K58A 3MEDA 4HNRA 1ZBHA 1U04A 4O0IA 4O5AA 4DQRA 3SV3A 3NCIA 3CFRA 5IBQA 3MYYA 2PUFA 4DWIA 3A2FA 1KVCA 1ZDMA 3SQ2A 3RVOA 1EAYA 3H1FA 4CFAA 2GWRA 3DMJA 4DTJA 1U2QA 3OS2A 4OGEA 3K5OA 3EODA 2IKSA 1KRXA 4Q0BA 4QICA 2ETJA 5DLEA 3RVPA 3NBPA 3I5AA 3JPYA 3ZSXA 5KWSA 1UA0A 4Z99A 4EUKA 1D9FA 4FW2A 3H5IA 3KLNA 1RBRA 3L2RA 3F9KA 3RVJA 4EVRA 3NGZA 1LWFA 2G8FA 4N41A 3M8SA 2P5GA 3W9SA 3LP1A 3RVRA 4PQUA 3RVSA 3VQPA 1B00A 4P98A 3KKRA 4L85A 4BE2A 4DADA 3LP2A 4YV7A 4DF8A 3ZSQA 3E3MA 4PYRA 1JF8A 2ID7A 3DOLA 3OS0A 3OLVA 1NK6A 3NF8A 4KV7A 1JBEA 2HVIA 1IKVA 4BWJA 3KK1A 1RDCA 3LAMA 3EYZA 3LP3A 1NXPA 3E01A 3LUAA 1RTDA 4JOQA 2VK2A 4FK0A 3QESA 3CLKA 3HSYA 1JKHA 3FDFA 2MSWA 2JGUA 4MPTA 1MB3A 3CZCA 3KSMA 4EZ6A 3LUKA 2JCGA 4DTPA 2RJOA 4MRMB 3OMXA 4CJ5A 4KTQA 4W5QA 4FLYA 2KW4A 3T1AA 4EVSA 2VUIB 4KREA 3M8QA 4C8LA 1UAXA 1ZY2A 2GBPA 4WT7A 3O2SB 3RTVA 3NNSA 1BAPA 1Y97A 2FMHA 4KNYA 1CZBA 4E7HA 1BDIA 4F3TA 1PEYA 4IFYA 1SXGA 3KLGA 8ABPA 4RSMA 4FM0A 4B9SA 3TO5A 1RZRD 3AA3A 3BBLA 1KLNA 3M6MD 2VUHB 2GBZA 2L17A 1L5ZA 4F3OA 1C1AA 3AVCA 3U6FA 4L8RB 4M3YA 5ABPA 3UIQA 1KCFA 1RBSA 3AV9A 1KFSA 3M9XA 4D6XA 3ILHA 1KLMA 4NYFA 4RK4A 4FCYA 4CIGA 3FFWA 3BDPA 3CG0A 4G0XA 4EGSA 3VQ5A 1TL3A 3VQCA 2QXFA 3LZIA 4MS1A 2LSNA 4HHTA 2FLWA 5IEJA 1IKXA 1GUBA 3C3WA 4CEEA 4CHOA 2R25B 1UWBA 4G0MA 4FVMA 1VSDA 4CCHA 3HCWA 1DRJA 4F8JA 4J2DA 1O1WA 2HHSA 3FFIA 2HJ9A 4MS4A 4MS3A 3I8DA 1TK5A 2ZD1A 2HQOA 4LDAA 1E6KA 4RY0A 4M3TA 5BR1A 1M5UA 4ZJPA 1TKTA 5GQSA 3QO9A 4MS1B 4KZKA 3OLYA 1YS7A 2FN8A 2BGGA 3LPUA 3AVJA 3OM0A 2M98A 1YVUA 1RT1A 1CXQA 4G0ZA 4G0OA 1RT4A 2HNDA 4OLBA 1BVHA 3L2QA 4DN6A 1JH9A 1JYFA 5CNMA 2HW3A 1LW0A 3LANA 1TGOA 4LE1A 2D0BA 1HYSA 4AH9A 3SCXA 4JLHA 1RZRA 5C25A 2YKNA 3ISNC 3P9YA 3KYIB 1FKPA 1BIZA 4CIEA 4JAVC 4DSLA 4M3WA 2FXIA 1EX4A 2HHXA 4BDYA 2OA8A 3R0JA 4CF0A 3C6UA 4RK1A 2XDYA 2E4VA 3I42A 1B9FA 4G1QA 3GL9A 3SYZA 3OYDA 2HHQA 1ASUA 1DP4A 2E6MA 4JB2A 3O21A 2KTQA 4EVQA 3Q7TA 2JRLA 2PUCA 2GUIA 3C3MA 1TK8A 1IO2A 4KB0A 1J5OA 1X9MA 5C5CA 1QSLA 5TQJA 3IS9A 1S1TA 3S3NA 2IC3A 3AO5A 5FRNA 4FJLA 3Q9SA 3RR7A 1NXSA 1U2PA 4UQGA 1FQWA 4HVJA 2FQYA 5CZ2A 4MLCA 2FSPA 2FEPA 1Z26A 4CHQA 1EFAA 5HKOA 3JVIA 4LSLA 3CHYA 1C1BA 2D0CA 3QETA 3KHTA 3O4NA 1JFTA 4XARA 3K57A 2B4JA 3O1IC 3KIOA 1Z18A 3EAFA 4DFJA 3JVDA 2PLNA 2X7XA 3P1GA 1EWTA 3RVMA 4ZTJA 4TN5A 3O3FA 4WZZA 1TMYA 2AJQA 4H3KB 3CRNA 2VG7A 4CEFA 3CZ5A 2XY6A 4CGFA 3LUHA 4JS5A 3QIOA 5DK5A 3QLVA 1WSGA 1E6LA 1P6QA 2XY5A 1IH7A 3B6OA 4KB1A 2FN9A 4CHZA 3B2NA 1KSPA 1YIOA 4QOZB 4CGDA 3TANA 1S6PA 2FKAA 2X6SA 4ELUA 3AVMA 3D02A 1KRPA 3CQ8A 1DBQA 4Z0UA 4CEZA 4CGGA 4MR8B 1EXQA 5KTQA 2ID9A 3HP6A 4KPYA 3PUFA 3WNEA 2FMIA 2OENG 2RGYA 1QS4A 3IRXA 4CHYA 4WXMA 4I9LA 2P5OA 1E6MA 5KC8A 5HRRA 4RXTA 4CJRA 1D2AA 4FM2A 4J2BA 2QR3A 4DTRA 1PNRA 3SQ0A 4XFKA 4E7OA 4M42A 1LWCA 1JXEA 4I9QA 1MVOA 1C0MA 1TKDA 3QELB 3KLIA 5FROA 1XHZA 1N5YA 2ZWMA 3LTEA 1RT2A 5HQJA 3C97A 4ZPJA 4Y9TA 1DC7A 1SKRA 3S3MA 5KC9A 2E4LA 4YGXB 4CJPA 3M8RA 1T8EA 4KK3A 4XIUA 4E7IA 4Q5VA 2AYXA 4B9VA 1T34A 3CS3A 3HVRA 5TQ0A 2JBAA 2LIVA 3TB6A 4B8CA 3SPZA 2QKKA 1EWVA 3B6PA 1NKEA 4DQIA 3MQ4A 2QK9A 3DRRA 2MSLA 4FE4A 4W5RA 3TAQA 2PZSA 4GMJB 1VSMA 4HUEA 3H5LA 5J2PA 4ETMA 1REVA 3F6CA 4CEBA 4XAQA 2FMKA 1A0OA 3OYMA 2E6LA 2YNIA 3SV4A 4AHRA 4M3ZA 3L2WA 3VQAA 3EQ2A 3OQMA 1JYEA 3QEVA 3L2UA 3TMYA 1XHFA 4PA1A 4Q6WA 2FQXA 1GCGA 3GWGA 4CEOA 3F7NA 4N5SA 1WN7A 2WB4A 5IC5A 3DZDA 4DG1A 1LV5A 3N6VA 1OXKB 1GOBA 1JDNA 1SXHA 5J2MA 4N03A 2RF2A 4RK6A 3A10A 2F8SA 2XRIA 4QCLA 4HYEA 2PE5A 4WWHA 2PAFA 1L3SA 4FJNA 4Q7EA 1T03A 3ZT1A 1U47A 3HZHA 3MAQA 3SPYA 1U48A 4GPAA 4AHSA 1BHLA 2V0NA 3KCNA 3TAEA 2QW1A 2B6AA 4EZ9A 3S99A 5TPWB 2FTKE 1K6YA 3O3HA 3NH1A 5JNSA 3LMKA 1QHTA 4IFVA 4I2QA 3OYLA 5FWXB 1C0EA 3N0RA 1ASVA 4KFBA 3OLZA 2QSJA 1QQBA 2MSKA 5D3GA 3L2VA 2HPHA 4CGHA 3HPHA 3OLWA 1YT3A 1CZ9A 4RU1A 3NF9A 4UHJA 4CIFA 1S6QA 1NXTA 3OJUA 4KVFA 4DFPA 1RT7A 3F6PA 4O1HA 3ULDA 1XI1A 1FFSA 3MXJA 4FM1A 4R5PA 3HP9A 4KV8A 1JLEA 1JLCA 4FJ5A 1QSSA 1S1UA 5KQMA 3V4IA 3SAJA 2Z1IA 2LUOA 3OVNA 1K66A 1EP4A 2FBTA 2PUAA 2E4YA 2MYTA 5HRNA 3QNNA 1R0AA 4DSIA 1RILA 3G10A 1IKWA 4IILA 3H5OA 4B9UA 4MR9A 5IX8A 5E41A 1WAFA 4ICLA 1KVAA 4CHPA 3L8BA 2O4IA 3DGEC 3QEMA 2EX3A 3LUDA 2P4UA 3OYKA 3TAPA 4AILC 4FK2A 1VSHA 1M2FA 4YO7A 3BREA 1DLOA 3VA0A 1MAVA 1L3UA 4NYNA 3SI6A 2IGIA 4H3HB 1WNSA 4PICA 1S1WA 3G1WA 4WXEA 1EKEA 1DBWA 1DRKA 4IRXA 4CJ3A 3HS3A 2L18A 2FLKA 4Z4IA 3PX4A 1JLKA 2OPQA 3I45A 3O2JA 5B3JA 3KK2A 3MXMA 5FWYA 1XHEA 1D5WA 3U3YA 1JWLA 4CFCA 3EQZA 1NK4A 3HO1A 3QELA 4NCGA 4ZYLA 4XXHA 3MEGA 4DU3A 2QV0A 4YCSA 4MLDA 2OZSA 4NICA 1HJRA 3H6GA 4NCBA 1SKSA 1RDBA 3SQ4A 4C8MA 1ABFA 4CJUA 1RBTA 3NH2A 1LAVA 2DTUA 3GA5A 1ZBIA 3RVQA 1USKA 2L2QA 3RRHA 5I3UA 3KLOA 4PWDA 2W42A 3FMVA 3VQ4A 1ZITA 4CF9A 3SNKA 1QTMA 4EYOA 5KI6A 1P2FA 3Q7SA 3OS1A 4MFBA 1SKWA 3IG1A 4YRZA 4CJ4A 1CLQA 1JLGA 3SUPA 3KKSA 3RMAA 2YNFA 3BGRA 4M45A 4C8NA 5I42A 2WJAA 1Z12A 5BRJA 4CJFA 3H5WA 4CJWA 1Q8IA 1U4BA 2HVHA 4FW1A 1JFVA 3AVBA 1C0UA 4ETNA 4LSNA 2PUDA 2E4ZA 2PUEA 1RT5A 4MR8A 2HHWA 2XO7A 1WAJA 3T3FA 3ZT0A 3QEKA 2NZUG 1VPWA 1VRVA 1CHNA 1T7PA 4F2SA 3LUJA 1I3AA 3AVAA 3LOPA 1J56A 3ZSWA 3VQ7A 4Z9BA 4TSXA 5T7BA 4EY3A 2CHEA 1TK0A 5CZ1A 3VQQA 2HHTA 1XHXA 3IPCA 2BANA 4DLEA 1A5XA 1Z16A 1NKCA 3HDGA 5IEBA 4YR7A 1A5WA 3K5MA 3MMNA 4FK4A 4Z4EA 4CGIA 4CEAA 2PYJA 1WLJA 4QAGA 2DFHA 4FLTA 1LJUA 2NT4A 3N75A 3NF7A 1A5VA 4CK2A 1ABEA 3O4QA 3SM9A 2JLEA 1ZH4A 3LKVA 1NXXA 2BDPA 2HNZA 5ED4A 3DLGA 5FWXA 4MQ3A 5J2NA 3KK3A 3NHZA 2I6FA 3FFXA 3OYIA 4KKOA 2HQBA 4DS4A 4FJMA 3QLUC 1UA1A 4YP9A 4KHQA 3ZSZA 4B09A 4F11A 3ZT4A 2LP4Y 4RK0A 2IDMA 3DLHA 3OYEA 1IG9A 4OJRA 2YHAA 2Z1GA 3CM6A 1F21A 4OPKA 3N8IA 3HL8A 4O4GA 3OMWA 4DTSA 3CKMA 3VQEA 4IG3A 5EWLA 5CYMA 3S9HA 2JB9A 3VNBA 3QEPA 1D8YA 4H8KA 4N0QA 3QEXA 3SQ1A 4DSEA 2WWVD 2B1JA 3RR8A 4MAAA 1J53A 1BA2A 1LJLA 2IDOA 3NNNA 3O1HB 3L6UA 3UKJA 5KGWA 1TKZA 5HROA 3RVKA 1FXXA 1PUXA 1HPZA 4DLGA 4OKKA 1FFGA 4CFBA 3DGFC 1ASWA 3NNDA 1ZHHA 2DFEA 3NDKA 4KHUA 3TAGA 1EHCA 2A1SA 2ITGA 2R4QA 4CE9A 4B9MA 3D45A 5KQGA 3QEWA 4YWHA 1ISSA 2G8KA 3O1JC 2DRIA 3K4HA 3HPGA 1D1PA 4PZ0A 3TAMA 1ZVVA 4H4OA 1E2BA 1ZBFA 1XWLA 2IPMA 3AO4A 3KJXA 1QKKA 4CJKA 1BQNA 1SV5A 2CWDA 3K59A 3AVGA 3OYHA 1NJZA 2OPRA 1VSJA 2CD7A 4CF8A 5KQPA 4FJKA 3U3GA 5J2QA 3HUUA 1L3TA 5JNVA 3V9ZA 3C95A 2G8WA 2NT3A 3Q15C 4TLLB 4FE7A 1X9SA 4CJVA 3KLFA 3H6HA 3WNGA 3LWMA 3DYAA 3NGIA 5CNKA 3PY8A 3WNHA 1SL1A 4B9NA 5BRAA 4W5TA 3S3OA 5EWJB 5I4CA 3SUOA 3NAEA 1QO0D 1SXIA 3DLKA 5HRSA 1CEYA 4CK1A 2VG6A 2Y1IA 2BE2A 1DC8A 5SZTA 6ABPA 4KO0A 4E1NA 3RWUA 2QVCA 1F51E 3JTEA 1SD5A 5JNWA 1DTQA 3EZ5A 1ZAYA 4CESA 3I0RA 3ZSVA 4EP5A 4XASA 3V9XA 4MGEA 3QX8A 2MYUA 1JLFA 4N76A 4HCBA 3G0ZA 3QIPA 1BCOA 1FKOA 1S9EA 3OJSA 1SRRA 2XHBA 1TVMA 4CJQA 4HCCA 3GT7A 1FSPA 3NE6A 1NK5A 2L19A 1WSHA 4TLMB 2A9QA 2ZE2A 1P8AA 3V9SA 4C8OA 5B3JC 1LWEA 4YFUA 3HV2A 5DMRA 3SJJA 1RTHA 4NV3A 1D5AA 3IP6A 3GV0A 3H5VA 2R7YA 4RS3A 2VWKA 4E7KA 3OO1A 4IG0A 4E7JA 1C0TA 4RWEA 5EWMA 3F73A 4J2EA 4FJ7A 3RVNA 4RDCA 3LKBA 4Z4FA 4YS6A 4KHWA 2P1JA 4O5BA 4DQSA 4Z4CA 3VN5A 1S1XA 3AVFA 4B9LA 4DQPA
chains in the Genus database with same CATH superfamily
2J7PD 3AUKA 4ZOLB 1LDMA 5DV9A 1IEXA 2FOIA 1UBMS 2ZJ7A 2E2QA 3RJZA 4IL5A 4F7WA 3RTGA 5I6DA 2HBJA 1ACMA 1RYYA 4KLCA 2A1IA 4GDFA 3GFVA 2VDWA 4AJ1A 5FPYA 5CXQA 4BU1A 4UDOA 4RTOA 3NHFA 4JA0A 1PKXA 1Z37A 5D3QA 2NVUA 1S6YA 4P3YA 3N8DA 3S5UA 2WWGA 3TTXA 1V8BA 2RKOA 3UJNA 3TLAA 4ABYA 4CT5A 1EIWA 5DYWA 4HWRA 4CZFA 3OZ7A 3MINA 1EJBA 3JQAB 4M9XA 5GPBA 2P6MA 1MV5A 2AMJA 4F3CA 1K27A 4FQ7A 4KMRA 2W41A 1GU0A 3GPIA 3PCXA 5AKKA 2P6RA 2QI2A 4QEDA 4WJKB 4QFCA 2WYUA 2A0YA 4BR2A 4DU1A 3JWEA 4ILEA 4MH0R 3OY9A 5I3CA 1JHZA 1MTOA 3F2KA 2HTFA 3H8SA 2FUEA 1KJWA 3DEFA 3T4PA 3WNFA 3E66A 4FLZA 1CQJB 2XE4A 4ZVUA 3ZE7A 5FDFA 2VQFK 2H9AA 4R4JA 4BB5A 4I36A 3S8YA 2X15A 5JMOA 3NHGA 3C6BA 4IDGA 4EQZA 4MQEA 1G2IA 1RADA 2OAEA 3I8SA 2XQJA 3TIIA 4FILA 5LNK1 2AP1A 3A06A 1FE8A 2YNGA 4X1YB 1TVKA 4JA2A 1KQPA 2DGDA 3FYCA 3O8OB 3B20A 4C14A 4YRKA 2ZZNA 5A3QA 2Q49A 3F6EX 4WDQA 1WZCA 2AIRA 4H5TA 2BR5A 3QFPA 1KIFA 3SUQA 1LH0A 1ZUNB 2WA2A 4L8LA 4XWTA 2P3SA 2ALJA 1XEXA 2QE7D 2XUFA 4M76B 4MS4B 3VO2A 4YYEA 3UFXB 1ESEA 3LWZA 1XEFA 1DOAA 3FKSA 5DZSA 1WD5A 2D4WA 3D9QX 5FPQA 3UW1A 4R1QA 1K98A 1UPAA 3ICWA 5ALZA 5CLJA 2V96A 2AZDA 2BUCA 2JLRA 3UMFA 4DLVA 1ZIOA 4Y0WA 1K8XB 3BUSA 4E07A 4M1KA 1FFCA 5CVDA 4H08A 1Y8QB 3B6JA 2HI0A 3LK7A 1OGYA 1AB6A 1A9YA 1U0EA 3PT5A 4NBWA 3GBVA 2IX9A 2YNHA 2VHQA 3HKCB 1PTKA 1M6EX 2NVOA 3QVGB 4RY2A 2P6PA 3ZY5A 2VPYA 2X0RA 3CO5A 4UU7A 4A2WA 3WA7A 1NI4A 3CX4A 3GJ7A 2IZ0A 4YMGA 2ZAOA 5FDLA 3SAHA 2G5CA 1NXVA 4M1EA 3C7KA 1JALA 3K09A 4PPYA 4TSFD 1DZIA 2EYUA 1C2TA 5EGNA 1OWPA 2FEMA 1E1RD 3HP4A 3AA5X 1IBSA 1MIHA 1REQB 1TVEA 2B83A 2M6RA 2SHKA 4EHAA 5TE9A 2CT8A 1W36C 1E2GA 2XQIA 4FSHA 1SOMA 3HG7A 3NHWA 3NS7A 4V39A 3RNOA 2AYZA 2HBZA 3LZDA 3WS7A 3NBMA 3ZDQA 4U8GA 1M6HA 2IU0A 2E4UA 1BGXT 1DB3A 1T5HX 2A92A 2FSVA 3BBPA 4DIDA 1JG3A 3EBPA 4QNRA 3C8ZA 5BUSA 5C9ZA 3M83A 4QD3A 5KRSA 1NKVA 2GA9A 3GNSA 4H7JA 1PJRA 2BRUC 1VLMA 1IOZA 3F6SA 4IS3A 2AEJA 1K3TA 3ZX0A 2HUNA 2O0HA 2JIOA 2IA5A 2XB8A 1X1SA 2Y1WA 3EWSA 2HT1A 4K9RA 3HL4A 2XUDA 3QPDA 5FBWB 3EIEA 4M41A 4TVBA 2PQ0A 1A8IA 2F9TA 2OC9A 2Z58A 4IDOA 2NQ8A 1W5BA 1YL5A 3LFHA 4Z0PA 4C7XA 1TK2A 1V8DA 1W4AA 3BFKA 3DC7A 4JJ8A 4F72A 3HN6A 1AXGA 3I64A 1UAAA 1OFTA 4XB6B 1YTAA 5CR4A 3W8FA 3W1EA 1F2TB 3ZXIA 3IVRA 3JX9A 1RQGA 3I6QA 1E4GT 3VPSA 2DTEA 2PT7A 4F93B 4YJDA 1D6SA 1Z7BA 2V7ZA 4FPAA 1NZJA 1PK7A 2P9BA 4L95C 4B8ZA 4D42A 1NL3A 3HB1A 1DADA 2G40A 3ICOA 4TTQA 4PR3A 2B4RO 3B8AX 1O9BA 1T5SA 2IE0A 2PA0A 1HQKA 3QXHA 4LC0A 1H5UA 1XXHE 3STTA 1ISHA 1Q6YA 1GGHA 2RBGA 2YYYA 1U9IA 4CF1A 4E3SA 4PC3A 3FOEC 3K1AA 5KYUA 3T7IA 3GBPA 3T7SA 1VMIA 1GQ2A 1X7XB 1IKYA 1S7CA 4L5BA 4M22A 4HDSA 2UXCB 3I61A 5GTDA 2DKFA 4KITB 4IJKA 1YVRA 2GVNA 1BTOA 1M0TA 3FGZA 4PR0A 1MHPA 2A9JA 3H3OB 3WYNA 7MHTA 1AQ6A 2XXAA 2N1MA 4FZYA 4MWTA 1U5BA 3TQHA 3AJRA 1NBOA 2WTAA 1OX5A 2B5OA 4RXMA 1DFGA 3OJLA 4GZ6A 1H23A 1CQPA 1MNAA 1OKKA 2XCIA 3EEYA 1TU4A 3AVQA 2P2YA 4LH5A 1QVFM 2VF2A 4ZIRB 4GRDA 3ZT2A 3VR2D 4UQPA 2XY8A 5HQ3B 3OPVA 4CBWA 5JLFA 4DJ5X 3P96A 4GW6A 1NGIA 4A61A 5TQ2A 5JSYA 4ANFA 4CI0B 4FPBA 3WEEA 1OIVA 2QY6A 3HHEA 4OBXA 3RU9A 3A8TA 3TMKA 4WINA 1FU8A 3KWJA 1Y1TA 3BUZB 1EVIA 4CWAA 5KNBD 4WK0B 3HCPA 1T44A 3HACA 4DTUA 2WDPA 1EMDA 2IV2X 3EARA 2QUBA 3DL4A 4NBNA 1SBQA 3A9CA 3KEGA 4CVNE 4MV7A 5IAGA 4B4OA 4YRGA 3K70B 2AJLI 1FDUA 5AI8A 4M1QA 3TKYA 1EP3B 3VVMA 1ZQ9A 3K0SA 1NVBA 2VRBA 3JPWA 2BMAA 4CLHA 4G0VA 2CFRA 5NULA 4UUOA 4LDPA 5AVWA 2NO5A 2GKOA 3E2PA 1AK2A 1KP9A 2JJ2D 1YE3A 2NU9A 4Q6BA 2F3UA 2IF0A 3GARA 4Q1CA 4XWYA 3VDNB 3P39A 1KMIY 1PV4A 1EVQA 2R60A 5BVHA 2P6NA 3C85A 3Q7PA 4EDHA 5C37A 2FXUA 1U1DA 4PG5A 1YF3A 4BAZA 1EXMA 3NDJA 5JC1A 1CUVA 1W4LA 5LVAA 4P0QB 1I4EB 2LBPA 3FETA 3FNFA 1WEHA 4TRRA 4B5KA 1KRHA 1KQOA 1V1RB 3ZSRA 3GAMA 4R1MA 1GPMA 5K8LA 1QP4A 2JLXA 5I7FA 4II2A 3HGTA 2NZJA 2PZJA 3I1YA 1Q44A 1QSYA 5BPNA 3LY5A 5H68A 3W2IA 9LDBA 5JFGA 2Y1XA 5BN8A 4KXFB 4P92A 3UAYA 1J90A 4YRFA 3NHAA 4RZSA 2VOEA 1L7VC 4EMUA 3L3UA 2OB2A 3WMGA 2PVCA 4DWJA 3ABZA 2B21A 1IOLA 1I80A 3U3DA 1D2CA 5AOVA 2EC5A 4BLRA 5KMGB 4O4HF 4G84A 4MWSA 3KQKA 1ZNXA 4YGYA 5FBVB 1VIYA 2Q0SA 2CNBA 3KLHA 4OGWA 4DSJA 4JI2K 3EIHA 2ZSAA 1SKUA 3F90A 4IJAA 3KVYA 5AW4A 1QBKC 4CLDA 4JXKA 4C7OB 5HRPA 3SF0A 1MGOA 4G0NA 2H4JA 2WMDA 4U0JA 2IS1A 1A82A 1BWQA 4O55A 4OQMA 1FLDA 4C0LA 1E3MA 2TMKA 4ZT4A 2W6OA 4QYWA 2ZIEA 4NLCA 3L02A 4O0JA 2XRYA 3FHTA 2XTZA 4XLZA 4DMNA 1F48A 2ZTHA 5T4BA 4EB0A 5C12A 3ETJA 1PR1A 4OQDA 4OREX 1XMOB 1RJDA 1WJGA 2DQSA 3LP8A 3P8ZA 2ZJYA 4NPCA 5BVGB 4KSYA 4TXLA 1CP2A 1EM8B 1K5DA 3D7MA 1GCIA 3P0JA 4EJ0A 4NBUA 2GXQA 3TWHA 1E59A 4X20A 3X1ZA 4F1KA 3AR9A 2O3TA 4MNTA 4UASA 2VDWB 3KB6A 4W1PA 3N2YA 1RCHA 4FWOA 4BLWA 1QTNA 4GKJB 1DIAA 2C88A 3H18A 1II8A 4U1RA 3UC5A 2A0KA 3GJYA 4GOOD 3VTAA 4DMLA 1DO8A 1L4EA 1TLFA 3ZVRA 5F2RA 4URVR 3NH9A 2BE7A 3LUCA 4I4IA 4AF7A 3MX2A 1XZPA 3FZLA 1YI1A 3AVKA 1WNTA 3AJDA 3DHEA 3ESCA 1FRFS 4IR7A 1L7RA 4CT4B 3AOEA 1TQ6A 4X8LA 5LQAA 4KBOA 3IPAA 3HFSA 1RJEA 3C6KA 4EFHA 3G85A 4FC7A 1JNYA 2P6OA 2PXHA 3L49A 1XC3A 4DSFA 1NK7A 3M7IA 5ISMA 3K0KA 1E0KA 3DMRA 1FP2A 1DIBA 2EFJA 1CS4C 4ISCA 1XKLA 1OC4A 1T5LA 4H7PA 4UBNA 5DXAA 1UM9B 2Y1JA 1KC3A 2WRZA 4NU5A 3TG8A 3CG7A 1XRNA 3HNOA 2A88A 2MINA 3P32A 5ELLA 4C76A 4N0EA 2E5WA 4YR9A 1P31A 3E3NA 1ZIXA 4CEDA 2FW7A 1JR3D 3RT1A 3WKAA 3WLQA 3AFHA 4Q9DA 1K97A 2O9JA 1ZGZA 1IDOA 1CSEE 1P7PA 1IOVA 2X7JA 3CG4A 1B0PA 1UFQA 4RKYA 5HFNA 4ZOQI 1LB1B 4BNDB 4F6LA 1WEKA 1EX6A 1YGPA 4EA7A 2YHSA 3UHPA 4YHHK 2LPMA 3ZWQA 1CYEA 3BKWA 2JFWA 2HHLA 1IJKA 5DM2A 4MDFA 2Z09A 1LSOA 4JVNA 4RZHA 4GKVA 1VRTA 1M1YE 5CLGA 3L6CA 1I5RA 3W5IA 4LRSB 4JLVA 1CVIA 1ZQ1A 2A0WA 4MRMA 1YUWA 4BWMA 2H8GA 1QHHA 3DKVA 3NVKI 5EVCA 2FRVA 5BSRA 1PT5A 5T3UA 4ZK6A 5CVTA 1L9XA 4IHAA 4WX2B 1LW2A 1NC3A 2E6KA 3TTSA 5JVGL 1QWOA 2DYKA 1D1QA 4IIJF 3AKZA 1O6FA 1R9JA 2GKSA 3CLRD 3QLVC 2QENA 4ND3A 1S5JA 5YASA 2AF3C 1A04A 3PI7A 1V4SA 3BJEA 2ZPUA 3I3OA 4G09A 1WCWA 3FCUB 4MB0A 4UTPA 4RTMA 2E4WA 3JQDA 3MCAA 4QLOA 1ITGA 3KR9A 4BRPA 3E84A 1OZFA 4Z9AA 3ZHUA 1HFKA 1YB7A 2H06A 2JGRA 1RWOA 3IJEB 2BJWA 3HR7A 3PIRA 1CRZA 4GLJA 1NW3A 3EXHB 1FUEA 1ZLXA 4DSZA 3S81A 3REGA 3UUEA 3D2LA 4WNAA 2IYEA 3FZQA 3G7NA 4NCNA 5TGZA 1E98A 4EA6A 2WF7A 4EG4A 3GGCA 1PFWA 2N46A 3G13A 2MT9A 3HABA 4MTCA 3SS9X 3TI9A 1I24A 4G26A 4DUGA 1N0VC 3C6XA 3GNQA 4JLMA 3SQDA 3WLMA 2RBEA 1LAWA 2YIMA 3N0XA 1DKGD 1WUTA 1M2EA 2GCIA 4KQCA 5DTEA 1TVRA 1NE2A 1RWNA 3L7LA 4XRGA 4GWKA 4GV9A 4RW6A 3F98A 3SC2A 4M1WA 1S1VA 1UR5A 1IZ7A 4D4GA 2NU7A 2JAHA 3U7HB 1KTQA 2NUPA 3BICA 1W0HA 1IM5A 4RF5A 2I71A 5AQQA 3NIFB 1XEXB 3WMFA 4BRZA 1PFGA 1L8QA 2P75A 5ECGC 1G18A 4M55A 1QNLA 2Z8YA 2OHFA 1LVHA 2HEIA 1JSXA 1LS1A 2V6MA 1GRRA 3D7SA 4N3CA 3UXMA 3W5SA 5EWLB 4C4SA 4PUOA 2K6GA 4BE1A 4NB4A 2PPLA 2W2TA 1IC6A 4M38A 4DLWA 4B79A 4QVIA 1RI1A 1XCPA 3U9TA 1FP4B 3GJSA 3M2PA 2W2XA 2H08A 5CDHA 5A9RA 5I5EA 5IJ0A 2REBA 3PA8A 3V2UA 3IILA 2Q6OA 1CEEA 5IDXA 4B1ZA 2IZ6A 2KFNA 3KKOA 1HLDA 3VDQA 5JQGB 3LFUA 1ONOA 3BY5A 2W6NA 4PNZA 5COBA 3QPBA 2QX9A 2GZ1A 3R3JA 2V6JA 1AV6A 2QVGA 3FSRA 1KGDA 2VHEA 4FMDF 1YRYE 5CK5A 4LYYA 1J8QA 4HDSB 5LBUA 2P65A 2Q6IA 2DF8A 1NUAA 3FLEA 3DYIA 2CLFB 3GOHA 1MQSA 1QRAA 2AWNA 3OFKA 1AA6A 4C2UA 3LP5A 1W4ZA 2PT9A 1FVHA 3HFJA 3Q3IA 1JLHA 5B3AA 3W6ZA 2QQ5A 4UCFA 4A3SA 1V9LA 3CZ9A 1KH3A 4PBRA 5EXPA 4RJLA 1FTGA 4MOWA 2RH8A 1HNXB 1E0AA 1UQTA 4F2HA 3AOGA 4O1IA 5CDGA 4CKCB 4BC2A 3JYHA 4WERA 4CM1A 2XRFA 4PZAA 4QARA 2E37A 4TMKA 5FF9A 1W36D 1CY0A 1O9GA 1RPJA 2PRYA 1YZLA 4K8ZA 3T19A 3G9TA 2QJFA 2Q8NA 3B5EA 4LBVA 4F5DA 2P27A 2PMWB 1CE8A 3K9FC 1BHJA 1GNRA 3K0AB 4ID1A 1ZHFA 3AUYA 5IANA 3O9VA 3V8PA 1UODA 2D2XA 4RPJA 3HDVA 2WJGA 4U6NA 1VI5A 1E1RA 5IH7A 3T1YB 3AVOA 3K5HA 1ZBUA 1U5CA 1MKYA 2C4UA 2J7PA 2OHIA 4HRYA 2NZ8A 2X5NA 3SNHA 3GLGB 5K6AC 1G42A 4K6KA 4R2XA 4WVLA 3PX7A 1FOEB 5PGMA 1W9HA 5HKBA 2ZBPA 1BOTO 3GGSA 3FZMA 5FOVA 3NJRA 2P2SA 2X0EA 3B85A 3FF1A 2Q5EA 2YVKA 4IGFA 4I6JA 4FWTA 3CCSN 5CUQA 1NPTO 3FJOA 2GX6A 4HNVA 1RT9A 1DGKN 3OIUA 4XUGB 4A62A 1U2DC 4ARZA 1DEAA 1I14A 1OY1A 5ALQA 2YYSA 4BMCA 2PH1A 1M1YB 2Q4DA 4Q21A 2PSSA 4QRHA 4OI0A 2ZUBA 4TXNA 16PKA 1BU5A 2PV0A 1LX6A 1VC2A 2VRCA 4FLMA 1JHVA 1RWQA 4JHLA 4Q01A 1E3QA 4PM4A 2CL6X 2J9ZB 4XJTA 4BB9A 1G2OA 1E7QA 3CLTC 2XAUA 2Z2IA 1Y0BA 1UKCA 2ZG6A 1E32A 4TWIA 3HVHA 2XUGA 3BRWD 4HWPA 4H77A 3H2YA 2FPKA 4KIWA 3BRSA 2W6LA 3VDRA 1W96A 3A1UA 4I08A 3DBLB 1T8WA 4E2WA 2A6PA 1ZSVA 5KQDA 4LOLA 5A4KA 2ZRMA 2Z5VA 1N2GA 3B6EA 4WE3A 4INOA 3F5DA 1QQOA 1ESCA 3WWOA 5B5SA 3BMCA 1EJ2A 2WFMA 3BGSA 3BWEA 1O95C 2IOYA 4I0WB 4H6VA 1CZLA 3TEMA 4I8DA 4ARBA 1M8KA 1WOYA 4P31A 4OGFA 2A5XA 1TZJA 3HU2A 4I4TA 721PA 1QQ7A 1DKPA 2PX8A 2DLCX 3OUTA 1IJFA 2JGEA 3GCDA 5IVKA 2FG7C 2R2GA 2QX8A 2QLJA 1U2EA 3E9RA 1NGBA 3CMMA 3H3NO 2K4MA 2QEXN 3IULA 1WZNA 1QP0A 4BACA 1RMYA 3LVRE 5BN4A 3F5SA 3LIIA 1C7RA 4M0LA 3KEOA 2EDCA 1K3UB 3IESA 3MW8A 4I4TF 4RZIA 1R0KA 3MERA 4DTCA 1C7FA 1HMVA 1H1VA 2Q9BA 3LDAA 2DFTA 3IDOA 4PHCA 5LL6P 3RVLA 3VR6A 3ROEA 2XNDD 4QU9A 4YJ2F 5CX1B 4G86A 2HSTA 3LX6A 5LP6A 2FPOA 3PIDA 4LRQA 4CNQA 1U5BB 4Q00A 1G20B 1E7SA 5GOTA 2VTBB 4KFRA 3KSZO 1DCFA 1SQ5A 5JBIA 4JB0A 5EJIA 4L6AA 4B0PA 1NLVA 4M8NE 1U0SY 2BBWA 3FZNA 4KKXB 4GBJA 3SXUA 4DDUA 4EG0A 1W87A 2QKYA 4DF4A 4BV8A 4LF5K 4JK9A 1N1EA 4K9NA 1PT7A 1PL6A 2LTAA 5HMMA 3QHPA 4OHFA 3ZHOA 1Q19A 2AI1A 3AVVA 1OWMA 2J3LA 1OH8A 2ZS7A 4KR0A 4DA0A 1KS2A 4LXGA 3TRHA 1I4LD 1JDPA 5K14A 3F2VA 1XTRA 1R6BX 4DNQA 4FJHA 1K0UA 2FEXA 3PFWO 3H42B 2ZI5A 3GEDA 5JRDS 1P2DA 3BIXA 1P7WA 2GYVA 5IUKC 4B8AB 3GMDA 1U6JA 3CJ7A 4HZUB 4F12A 1YZKA 3D7KA 3L4SO 1ECBA 2Z4RA 3RSCA 4LOJA 1JHOA 2GXSA 4LOIA 4BNXA 4BX0A 4RTNA 2CV1A 4FD2A 5LXTF 3CF6R 4NKRA 1R27A 2Q2RA 4XH9B 3RTAA 4PY5A 1G38A 2RKIA 2YV0X 2OPPA 4TXHA 2HZBA 3H75A 4MDBA 1KKUA 4NONA 1DC6A 1MX5A 1RGIA 3TR0A 4ECEA 5F9FA 3AL2A 1USGA 4HXGA 1WY5A 5EE3A 4DNXA 1L7DA 1A5BB 2IU3A 2ZWVA 3PX6A 4MGZR 4MIEA 4OKEA 3DPIA 5JWRA 3MM4A 3KKQA 4QJBA 4CLRA 1O0CA 4ER7A 5AJZA 1DPGA 5AFUA 3LF2A 1R4AA 3A6EA 3DHYA 3C94A 4Q37A 4HS4A 5EMMA 1P18A 3ZTYA 4KQXA 1RJWA 3RRZA 3TPFA 3VNVA 3TVYA 2CZGA 3FTQA 3LT1A 3MFQA 4LGYA 3BE6A 1YB5A 3OQNA 1N2CE 4K40A 2IYUA 3GY0A 3TE7A 3GRVA 2Q41A 1U7TA 3BQMB 4MI3A 4A92A 5KOIA 3TBFA 4NU0A 1T9ZA 4OLAA 2ZAIA 5LWHA 4F4CA 1YQ9A 3VYVA 3OE1A 3CSUA 4QBIA 1B7GO 1UP7A 4H59A 5TVGA 1OUMA 1PUJA 1QQCA 2OZLA 1JIIA 1OB2A 3DWIA 4NDNE 3JQ9A 5ECYA 3HUFA 1VL2A 2WF9A 5HL7L 4Q39A 3ULKA 5F2OA 1LBIA 1ZWKA 1KL7A 2JA2A 3NG1A 2P9GA 1KFCB 1IXSB 4L8YA 4ESOA 1AHIA 1B74A 4PYNA 3DM9B 2CFSA 4BRDA 3JXEA 5DBIA 4BRFA 3Q41A 4TTPA 2Y9PB 2OZMA 3DLBA 1HKBA 1OF1A 2BKXA 3KLEA 3HVJA 1KI6A 3JS5A 1B6TA 2XWPA 4TMZA 1YIJN 1W73A 3OHMA 3DAWA 2G0NA 3VSAA 2Q5QA 1JLRA 5BMVA 5IFLA 2NYUA 4ZYZA 2O8FB 2C58A 4ZVTA 3QLJA 1MB0A 3E81A 4EY6A 1SA0B 4NX2A 5B4TA 2WONA 1RJFA 2OECA 2RAVA 4GS5A 3P4YA 5IKEA 3NJ8A 4QRDA 3R5HA 4GI7A 9ABPA 3ZDDA 4I5GA 3PE3A 4HAIA 2OUIA 4UPDA 3DEJA 3ST7A 1E2KA 1FFWA 1A3CA 4HH1A 1AS3A 4UHDA 5AQMA 2GB4A 2GHTA 2OM2A 4Y6RA 1XMXA 3BE8A 4DV2B 4RVSA 4G0YA 2P51A 4LBZA 5JLAA 5T4HA 3F1LA 2ZJAA 3GAFA 3UB4A 1H85A 4EELA 1YZQA 2DY1A 2VP4A 2FEAA 2ABWA 1ZH2A 2Q2VA 5DNYB 3QEAZ 2OKCA 2OXCA 4GQIA 4BEJA 5EFOA 1FX0B 4NV0A 1A9TA 2HMTA 1NF3A 2WJPA 1O96A 4KP7A 4TYMA 4XDZA 4DEXA 2X2FA 3OYNA 1I32A 5A5FA 3KNZA 2QN9A 4KGXA 3P7MA 1DKLA 3RJTA 4BNJA 4GI5A 2AOTB 2HV8A 2RGBA 4XLTA 4IJQA 5TQ2B 2YKMA 4CZLA 2PS3A 3C3DA 3GIWA 3NGLA 2HHHK 3CLRC 5HCNA 4PQYA 1TM1E 3DE5X 2CYBA 1GY8A 4HLNA 1BEUB 3GDFA 4Y67A 5H8WA 3Q0IA 3PICA 2NAFA 4YONB 2WFZA 5DGXA 5EEGA 4LF4K 5HILA 3D2FB 4FOTA 4MWCA 1OHHD 2BMVA 3RFUA 1J8FA 3JCZA 3FVWA 3V1MA 1FPQA 3V7YA 5EZYF 4BKPA 1JAYA 3DSRA 2FNAA 3L5OA 3RS9A 5EGSA 1NBMA 4FS3A 5DHUA 5DCLA 3THYA 4CMGA 1J00A 3A4TA 1XZFA 5EP4A 4JP3A 2ASOA 3SR4A 4Z7NB 1ISFA 5JYBA 4ZI7B 3L46A 4B9TA 1R66A 1W85B 3IKJA 3AO2A 4N5IX 3M2TA 1XN4A 4UHEA 3O95A 3ZUPA 4DNPA 3O93A 2D5BA 3ECCA 3HMQA 4JMPA 3PRHA 5KRTA 2QWNA 4KYVA 4WBNA 2YV5A 1P9NA 4C1NA 3I76A 1Y98A 4LYAA 2I3AA 1BQ3A 1SU4A 3CGWA 3G9XA 4N54A 3VKFA 3MGKA 3RMCA 4AJ4A 1APBA 3F1KA 3CERA 1GSHA 3UV6A 1K9MO 1RI3A 4FLEA 4OHKA 3ZGLA 1G5PA 1C7ZA 4NXNK 1E62A 1Z15A 1BISA 2FCRA 5K4AA 4V0OA 1WR8A 1E2NA 5ECDA 4LH4A 3STXA 2P30A 3D3EA 4WOKA 4O33A 4BC4A 1OBVA 4MDYA 3DCJA 1UT8A 1YKGA 3PB3A 3A4IA 2IV7A 4DOMA 3HYFA 3CN9A 3K2IA 1P9LA 3AA4A 2F48A 2VWGA 4WRRA 4UM9B 1T9CA 2QEQA 4YMIA 3KWLA 2XA9A 3LALA 2XMZA 4IIVA 1T9BA 4AJHA 2NP6A 1J2RA 4PSCA 1EB8A 1H6DA 4YT8A 4JKIA 5AVKA 1OXBB 3LF1A 1RWPA 3PRKE 2GF9A 5IJ9A 2V8BA 3W8EA 1TTTA 5A9TA 2PV7A 4HQFA 1S8AA 4UAUA 1GTMA 1II0A 1VSLA 4H03B 1AHHA 1MOZA 3A26A 4H0CA 1KH2A 3VSBA 3RNLA 2XH8A 2IBSA 1QHSA 1JR3A 4BRLA 1FSSA 1QH8B 3K6RA 4MR7A 1EYZA 2ZOSA 2QMZA 4MA5A 5IJWA 4BFSA 1ZKDA 1YBMA 1XL0A 4BVKA 1G20E 4NXNB 3CR7A 1QK4A 3QX7A 3TKAA 2I78A 4DMMA 4QGAA 4YAGA 1I3CA 2FQQA 1N8SA 1L5KA 3EKSA 4RSRA 3CJ1A 1C1CA 2LWIA 2Y0EA 3D6MA 5IYZA 2IYQA 4FYPA 1G60A 1O7JA 1D4XA 1LDYA 4J75A 4MK4A 4BEVA 5B7PA 4WACA 2D8MA 5KPTA 5NLLA 5JMWA 1ZGJA 5SWMA 5FPPA 2HBQA 4BQOA 3UPDA 5BWNA 5F3DA 1CJBA 3H99A 5SICE 2BF4A 3LL3A 1YJ5A 1JHMA 5AICA 4LZJA 1DIHA 4Q4HA 4NNPA 2JEZA 1BD4A 2WFLB 3T95A 2CK3A 1JWBB 3TBKA 2OPSA 2ZXFA 3DXYA 3BGWA 1U1EA 2PBRA 2VDLB 4HMPA 4ARZB 1K68A 3M4JA 4IUCS 5DDIP 2AC7A 2I2XB 3SIRA 1U7ZA 4QTZA 4RZXA 4RPHA 4B3FX 4LY7A 4UHFA 2O54A 2H18A 4LVNA 3QUQA 1RKVA 5KNCH 1RLIA 4AL4A 1QO0A 1T13A 1ZCBA 1UJ6A 2CBXA 3KKMA 2ZPAA 4FONA 1QIHA 3IT3A 1GD1O 6PFKA 2JK0A 4RORA 3PC4A 4I1RA 3UBTA 1FMTA 5EXDA 2QTBA 1S8NA 4RKQA 5CFOA 5EUCA 1CK4A 4OSEA 3MN5A 3TL6A 4PTLA 1TQ2A 3CKLA 4PLFA 1PW7A 3RBZA 3ZX2A 4KAZA 1CUEA 2GN4A 3GVHA 3KT6A 4G4SP 3TCXB 3UANA 2QWOA 1Q0PA 4J2HA 1CR2A 3F3YA 5FJIA 1XN1A 3TGWA 4KLRA 4IDBA 2IGBA 2VH1A 3SZ2A 1EVKA 2WAAA 3EXHC 5DP2A 1Y42X 3FWPA 1HOXA 5MN6A 4JD2B 4PNPA 2A1UB 121PA 1WU8A 2RDMA 3TXYA 4K9SA 4NAUA 1X42A 3QU2A 4Q9KA 3NV7A 4ZGBA 5IPFA 3QMLA 3GLSA 3R09A 5JS2A 2NXWA 2QXTA 4HWOA 3LDNA 1LBTA 2BEUB 2R87A 4D6YA 2DUUA 3UAWA 4BRCA 3Q6NA 5CHYA 4LEIA 4TMYA 4MCIA 1R88A 4RMGA 2BVNA 3NHKA 2BM9A 5AKEA 4PVDA 3DOUA 1ILEA 1BC5A 3AY3A 1Q15A 4EOGA 4RHXA 1LY1A 4K9OA 4BNTA 3W3ZB 3WWYA 4P3OA 4V0RA 1QHGA 2Q62A 4DDWA 2PGIA 5D5HA 4E2ZA 4B3GA 1AZWA 1XPUA 3ESAA 1K7EB 1U8XX 1ZOOA 6REQB 1NF8A 3IOMA 1VDMA 4IKEA 4KWTA 3IPRA 2WHPA 4FJ8A 5A71A 1ODTC 4KAAA 1NN0A 2EL7A 3AVHA 1VQPN 2FN3A 4PTZA 3VERA 1OLUA 4IHQA 4BEWA 4YN3A 3G1UA 3OIFA 1A9PA 3CCJN 1YUBA 3HI6A 5K51A 3O4WA 3OYJA 4AKTA 4AS3A 3NALA 4YUXA 2J09A 3U7IA 3H08A 1RYEA 2IJGX 1Q0UA 2CUKA 4RIIA 1CCWA 1OA1A 3UMBA 5IDQA 1BQ4A 1I6MA 5CMLA 4M8KA 3UJ8A 4CZHA 1ODFA 2TSYB 1LKZA 1E2UA 2O2HA 5IAKA 1O54A 3FZFA 4B3OA 1C3VA 2IYOA 3EXIA 4DCOA 4EHLA 5ALIA 1HE4A 3I58A 3MRXA 4MKHA 3OOSA 4RHCA 2RCYA 1T5DX 4DV1K 1P45A 4PE5B 5JLHA 3IA7A 3TCKA 1RXYA 3G5LA 1PJ3A 1QIMA 2FBVA 2OHVA 3ICCA 4HAUA 1H42A 1JFFB 3WYBA 1IJBA 4YLEA 3Q4GA 3Q7RA 4BGAA 5I9SA 3T3PB 5BUQA 2O4UX 2XGSA 4KRFA 2EBWA 3HUTA 3OHPA 4FOOA 4G8CA 4YFYA 5TARA 4HK4A 3WGHA 3T4UA 4KTWA 2AK2A 3RFVA 1AX9A 2RGRA 3CF4G 4LGVA 4WY8A 4B3MK 1RT3A 1ZGCA 1UXGA 5U4XA 2WB2A 1TKXA 2IYAA 1BI4B 3D4IA 3LLSA 1J1IA 4DSNA 4NXMB 3S2SA 4DZZA 1Z6ZA 4MQEB 1HDOA 1FIUA 1KBOA 1X1PA 3PE6A 1ZIDA 3WTBA 4LE2A 1S8OA 3K58A 1SC4A 2BFCB 1XEWX 4O0IA 2MR6A 2QSUA 2W37A 4HNRA 4O5AA 3IB3A 3OPQA 1G59A 1IXYA 1Z6RA 3VDMA 1IY2A 1HDIA 3GDWA 3OPXA 4LI0A 2ZUWA 4U9HS 4Z0TA 3GJRA 5IBQA 2R0QC 1GXSB 5WRFA 3R8FA 2PUFA 3BQNB 3A2FA 3DXKA 1KVCA 2FDRA 1ZDMA 3VKUA 2JH8A 2B9EA 3BSYA 3VA7A 2PMKA 2A5JA 2DFDA 2IZ1A 3D3JA 4XPIB 3PGJA 3PFBA 1X1QA 4G5OA 2XCTB 3IHTA 1Z4NA 2D4AA 1R8XA 2E55A 2ON6A 2Y1GA 3A1SA 5DBGA 2H85A 3FKJA 4B2PA 1EG2A 5A9SA 5CG1A 3IMEA 2UYHA 2FSIA 3EISA 3EODA 1EJ0A 1XPJA 3PRYA 4ZI5A 3WZLA 4R8RA 4CCWA 1QQ6A 3TEFA 4GV6A 1M66A 2ACVA 3AY7A 3I1IA 4GMKA 4WK4B 1Z34A 3K0AA 3NVKA 4XH4A 5E2AA 3UATA 2J5XA 3HTVA 3H5NA 1JCEA 2OGWA 3T7AA 4IO8A 1M2GA 2R6JA 3QOYA 3DCIA 5IKMA 3D0RA 1RBRA 3LBIA 3F9KA 3QFSA 3JQCA 5G1NA 1YS1X 3RVJA 1E9DA 4J90A 1RQRA 3P4XA 8MHTA 4TM7A 2ASMA 1CZNA 1P7ZA 4JNKA 3LNCA 4QUGA 4DLYA 2GD2A 1VMDA 5F7JA 1DQYA 4N41A 1BGWA 1TEXA 1VGQA 5BR8B 3TZQA 5TEWA 3SZLA 3W9SA 2EWMA 1U8FO 2DWQA 4MGKR 4QEZA 1IB0A 2B20A 2R5FA 2B69A 2RKWA 4J0QA 4PG4A 3RVSA 3UQZA 4BO0A 4C30A 1C1HA 1CUCA 1HSZA 2R2AA 3VYUB 4JUFA 1NF2A 1XQYA 3V97A 4L85A 4I1YA 1SUBA 3WGZA 3LS2A 2ZBQA 1JJ2M 3MILA 4RIGA 2QG4A 2QRJA 4CR7A 4YRMA 3GZJA 3KV1A 3O4JA 1VHXA 1W6UA 2ID7A 1QRDA 3GRZA 2Q31A 1W0KA 2R6R1 3PUYA 5TSDA 3OS0A 3W5BA 2OFWA 4IEEA 4HJXA 4YMUA 2GPYA 3H11A 2YMLA 1PI3A 2W0SA 2J6IA 3I9V1 1AQYA 1NM1A 1NMQA 2PXCA 3NBXX 3PX2A 3QBVA 2RHGB 3EZWA 4BWJA 2Z56A 1J1ZA 3LAMA 1YRLA 1R7RA 1A7UA 1YJBA 1LD3A 3ZWDA 4ZVNA 4R6WA 4L5IA 1A9OA 4G24A 4R7TA 3IURA 1YO6A 5J5VA 3D3KA 1Z39A 4H6XA 2P9PB 2REOA 4KN8A 4LYDA 1QHNA 2VK2A 4O2LA 2QA4N 5SY6A 2BEWB 5EKXA 4L3OA 4ZOBA 3HSYA 1QCDA 3FDFA 3U4GA 4EPWA 1US8B 3QKSB 2WJYA 5DHPA 2DPHA 4GUAA 1XLTC 2GPTA 1S3XA 4WFQA 1L5OA 3C7NA 1Z6YA 3W5VA 3G0GA 4HBZA 4I50A 3QA9A 4OJMX 5KSWB 5KYXA 3GA0A 1MOQA 1NJ5A 5KNDD 2HXSA 3QVSA 4ZU6X 3T7TA 4BKRA 3RC8A 1Z4KA 1B41A 4C22A 1W46A 4LXXA 4ZAFA 5CXSA 5B57C 3OM9A 4EKEA 3O7MA 3LIPA 3MNFA 3N8GA 3SI7A 3MN9A 5F77A 4MRMB 4KR2A 3S2EA 3VH2A 1Z5UA 3L93A 4KTQA 1LSUA 4YMVA 1ULUA 2ZI3A 4GM0A 1VAZA 3TOZA 2CY0A 5AQKA 2JGKA 4UNSA 4RTRA 3GEBA 4CCYB 4AJIA 2NUAA 4HOYA 4R84A 4DCTA 3T1AA 3PYXA 2ECFA 2OCBA 2XR1A 4U7DA 4GIBA 3WXBA 4TUYF 5JCPA 3M8QA 4GLLA 4BU0A 2F2TA 2C96A 1O87A 1Q7EA 1KI2A 4EJSB 1M0EA 1XQ9A 4X20B 3NUQA 2Q8QA 1TUGA 2FMHA 2PEZA 4TS1A 1P19A 3V8RA 4B6EA 4KNYA 1BDIA 4OB7A 4F3TA 2KJQA 4ZCIA 4BZXA 4BMVA 3UBMA 3OIWA 4XCXA 1RIIA 2B8NA 2PX2A 3PEFA 4ARSA 5EJ5A 2ZTLA 2KLAA 2ES4A 4XUEA 3ZY4A 1CT9A 5F35A 3P9SA 4YLGA 2DFPA 2IY9A 3KVNA 1YD7A 3EEIA 2VRNA 4RA6A 3S27A 2IEAA 3TO5A 3M6MD 2AVDA 4QATA 2VUHB 1U7XA 1QR2A 2QRMA 3N2ZB 3P9KA 1G20A 2WYIA 5FUYA 4IO1A 4WN3A 3T1NA 2FW8A 3WKDA 2AN5A 4NQZA 5CIYA 2JJYA 5ADUS 2AFIE 2CE2X 3E9PA 4FOPA 1Y4AE 3SD7A 2ZYTX 3AVCA 4DV5K 1E3SA 4X6YA 2V8OA 5ABPA 2X9GA 1X8KA 2PGAA 1QGED 3QNMA 4YP5A 5F4BA 3UGJA 3ZETB 1O5IA 2QZPA 3F49S 3I6ZA 5E6RB 5KYKA 2PX0A 2WSSA 3M1AA 4N7MA 4PRLA 4B8WA 4I3FA 5A0FA 4IDAA 2G1KA 4X45A 1QTQA 5SY4A 5AVSA 4GGMX 2CL7X 2QPTA 4OQEA 3O92A 3MQFA 2LNDA 4B6FA 4XQGA 1X9JA 4EECA 4LNUA 4LXHA 4MX8A 1Z0IA 4YAJA 1Z88A 4HTFA 4KXYA 3RRNA 2QS9A 2XGGA 3OIYA 2WLSA 3A14A 1MRSA 3EVTA 4OHMA 1J2YA 2UZ4A 1OTXA 4NSNA 4UC0A 3ME5A 3Q10A 2FI1A 2VT6A 3ETLA 1KFBB 3PEVA 3NFYA 1ZM7A 3JQQA 2QXFA 5DX1A 5FV4A 1U1GA 5TEVA 4L5CA 2IBTA 5LR6A 4NZOA 3K0HA 3EN9A 3IUNA 4FWMA 4H5WA 2Y4NA 4U3JB 5JC8A 2R6CA 2AGVA 2NTYC 3GGJA 2VF8A 4MRRA 1ML3A 2VT2A 3HM8A 4LVOA 2IQIA 3R4CA 2FCAA 3C3WA 2C5LA 3DOOA 5IKXA 2OOSA 3OCYA 1I4DD 1IMJA 3FPHA 2EG5A 3WBFA 2L0XA 5KDDA 1SAZA 1GUYA 4FVMA 4B3JA 5LP6B 1KETA 4FZ3A 3QI2A 4LJ5A 4DRZA 3H16A 5EHZA 5KOHB 2FZCA 4AJ2A 3CPJB 3Q3HA 5TVKA 2Q6KA 4YJFA 1D0IA 4F8JA 3KETA 4WJLA 3RANA 5A02A 2HHSA 2DWUA 4DWVA 3ZOKA 5G02A 3OCXA 1R64A 3PENA 1M5RA 2GNAA 3EGDA 1IUPA 3IMGA 3IUPA 5J47A 3VR5A 4D9NA 1N8KA 4QWMA 1P0FA 4CMIA 2HQOA 4X65K 3EFBA 4ZHSA 5T57A 4LDAA 1NOIA 4HEQA 4S1TA 5EJ6A 5B7GA 5BR1A 1GJRA 5LQMA 4TKZA 1FYXA 2Y77A 3CURA 1XVAA 4JBHA 1SD2A 3TQIA 5DOZA 1UBKS 5GQSA 4M36A 4IFEA 3QMVA 3SFTA 1ZINA 3KQLA 4IRXA 4KZKA 1W4BA 3WKEA 3ONEA 3KQSA 2BGGA 1G3MA 1DRWA 3AVJA 2BUAA 2P2ZA 1SHJA 2YH2A 3W04A 2QBYA 4S1PA 1Z56C 2WKWA 4LTDA 5DNCA 3V4RA 1KR5A 3C4JA 4X90A 1BZYA 3B51X 3L07A 5LA6B 1N4AA 3ZLUA 2HNDA 2DJIA 4RVCA 1UH5A 1EK0A 2H51A 2ISCA 1E61A 4GEGA 4R2HA 1JPVA 2YHYA 3HZOA 5DFAA 4GR5A 2AN3A 1E9SA 1BVHA 3DUFA 4DB3A 1J06A 1RQ2A 3QHQA 1GVHA 3ET4A 5JDCC 1C1YA 2ZYHA 5A05A 5JEDA 4RFSB 5EJEA 1VBMA 1UPFA 2XCUA 1C30B 3G1TA 3D0OA 3G8CA 2C82A 5AK6A 1AY0A 3K0FB 2ZQZA 4TTVA 3RAGA 3TZHA 1TGOA 1A9SA 2AI3A 2CKMA 4LE1A 5FPSA 1A7AA 3EZXA 2G1PA 1Y9JA 4JBXA 4KGVA 2I9KA 1RZRA 4V2IA 3V8QA 5F7XA 1I13A 5JY6A 5KVVA 2H4ZA 4C6TA 4CZIA 1UPCA 2VT3A 2BL4A 2VQDA 4L7QA 4YCAA 2D1KA 4UTVA 2IS4A 1N2BA 2EWVA 4WCFA 3KAQA 4CIEA 4ENWA 4CEIA 3A2MA 2H52A 4MUIA 1V96A 1HT1E 4GX2A 4LFCK 1K8KB 1ESDA 3WI7A 4DV4B 1U02A 4RK1A 4NFHA 5JD4A 2XDYA 4E03A 2HU5A 2IW1A 4HWIA 1B9FA 1B8UA 3RSHA 4YRBA 1ECJA 4A16A 3K9QO 5D5PA 3GF4A 2UVPA 3LPDA 3QZUA 5DTMA 1I33A 4UU0A 1L5NA 1P2SA 1ILWA 3O4IA 5DHTA 4IXTA 4DR6K 2O3QA 4RHEA 4YRRA 3O21A 5ETJA 3ZGNA 4WKPA 4LI3X 4P86A 3RYCB 2WSSD 3P0EA 4ZVSA 2DBRA 3D1LA 2A7XA 3HGMA 3EQ7A 3PTLA 1DX4A 4PX2A 2ORYA 4FHGA 4X64B 4B74A 3KT3A 3Q7TA 1TU3A 3ND9A 4H35A 1MAWA 2GUIA 1X80A 1S3FA 3OSZA 5J2UB 1KU0A 1JH8A 1MBZA 1SY7A 2B3DA 3R20A 1TK8A 4JP8A 3VR4D 1XZIA 5I7EA 4KB0A 1J5OA 1HURA 1MH1A 4DCPA 5C5CA 3QBEA 2ACKA 3AF4A 3NDBB 1EESA 4EATA 5TQJA 2OG2A 3GGDA 4BVLA 5JMVA 1C1XA 2B94A 4NG5A 2AEFA 3R76A 3MB5A 1ZOPA 4PS1A 3H5AA 5JVDB 2OUKA 3MT9A 4I50F 3RR7A 2PU5A 4JOSA 3SFVA 2PKRA 3PPXA 4RLFA 4G56A 4BLSA 4Y1RA 4J2TA 1ADBA 3QWIA 4C05A 8GPBA 5KCZA 2V55B 4KXWA 3Q0TA 1QMGA 3BCRA 4EZIA 4GOKA 4JLBA 2JHAA 3T0FA 1N3IA 4EY5A 1MJ5A 4JC0A 3E7DA 1I01A 4E21A 1DQRA 2Q4EA 2Q9UA 2XF2A 3I6YA 5B1HA 3TPZA 5CLFA 4GLOA 2CJPA 2AJ8A 3JVIA 3UMRA 1L6IA 5C1PA 4LSLA 3CHYA 4ARUA 4EB6A 3MMZA 5I7UA 2G9UA 1C1BA 3NOXA 3QETA 3DZHA 3O4NA 1W0CA 1EM6A 3F46A 1WZEA 3QUCA 3TTYA 1S2OA 3O9ZA 2I7NA 1JYSA 3COSA 2HK8A 3O1IC 3WY9A 4H7HA 3A6ZA 4FHEA 4K9DA 4TV8A 1Z18A 3LUPA 3WE7A 1PJLA 4EHJA 2PJRA 3N7UA 3CSDA 2ZJ5A 2VP5A 3EAFA 5C10A 3JVDA 2PLNA 4JU9A 4KDFA 4QXPA 1EWTA 3RK1A 4F85A 2YXPX 3BWYA 5GJWC 2P4QA 3WLTA 4BNDA 4NCKA 4AMVA 5BPLA 3BS4A 3UKOA 1PDOA 3DONA 3FM9A 3HLYA 2GK6A 4MW2A 4WZZA 1T2VA 2NACA 4JKEA 4OHOA 4H3KB 3CRNA 3LBNA 2CD9A 2VG7A 1JDZA 4Q47A 5EQFA 1MX3A 5A3VA 1GPBA 2CJFA 2ZR9A 4JS5A 1L5MA 4N7JA 5HF5A 2FVXA 2RHOA 2HXYA 4PG8A 2QVBA 1K5HA 2VP3A 3TM5A 3G2NA 3O8CA 1A97A 3QIOA 2QSYA 2H16A 3Q3CA 1KAEA 2NU8B 1H05A 1E6LA 1XSEA 2B4QA 3WIDA 1JZTA 3ZBTA 1T2AA 4H0TB 4P0PB 1OIXA 4KB1A 2ZAMA 4L28A 4MVCA 5P8WA 4OFWA 1QZ5A 4K41A 3UWMA 3U0BA 4TLBA 5EQTA 4D5EA 1CQJA 1U5AA 4LOHA 3B2NA 2Z3VA 1B93A 1AXRA 1BDBA 1TJ4A 1JBQA 1U0TA 2G1AA 1QH0A 4BUCA 3O9TA 2VAMA 3MK6A 3TANA 1S6PA 2AHOA 5FHRA 3BHMA 3GPCA 4DB4A 3P27A 5HTOA 3AINA 4MJXA 3WLAA 1W2HA 2DHCA 1IAVA 4QXMA 5JPDA 1VP3A 4BO9A 2I1WA 1GGJA 2ZRHA 4D3SA 5CW1A 2XUQA 1THTA 4TVSA 5BR7A 1N36B 3RTEA 3ILSA 3ICVA 4W6QA 3A36A 4KTVE 2OL4A 4PZZA 1QOQB 3R3XA 1N8TA 2YZMA 4H0VB 4WFBL 2HLHA 2K7ZA 1EXQA 4MR8B 1NNEA 2CUNA 3KYCA 3OTOB 4REQA 3I1FA 1M2NA 4PHTX 1MENA 1SVWA 2RMKA 1GZ6A 1WDLA 2XDWA 5B2ZA 2ZIVB 3H9UA 3JYNA 4HQRA 1AK9A 4O4JF 4X1IA 1EVYA 3C8MA 1DJQA 2BGKA 2DQYA 2HU2A 3MZ0A 5KYVA 5T6BA 4JCOA 1BXRA 3K2EA 4HDOB 1M3SA 1KHTA 3IRXA 3DMTA 4G07A 4QVKA 1HY3A 1BE8A 4UXHA 2DQZA 1KEZA 2I2BA 4OV6B 4PV7A 5LKRA 3KIPA 5E8RA 4Z94A 1K7YA 4BX3A 3WICA 4CJRA 3KPUA 1C29B 2NNWB 3UJPA 3ZC3A 2PMEA 1G8KA 1XD2B 2I0FA 4FS8A 3FF4A 4C7MA 4DXDA 1JEJA 5G41A 1QPGA 5DU2A 5K4HA 1Z3IX 3ELUA 3ZJVA 1LOTB 2P0EA 3AY9A 2JBWA 2MTBA 3IVXA 3MWYW 3V34A 5LZ4A 1KEEA 3PYMA 4XFKA 1PNRA 2Q97A 1AKQA 4ZO4A 4JLNA 4E7OA 1B73A 1UWVA 3QBXA 1TTQB 2FPWA 1C7JA 2R6GA 4MVXA 1MDFA 4M42A 1PVVA 3KVOA 3VGJA 4I9QA 3IBGA 1C0MA 1TKDA 3LM9A 2EATA 3BEOA 3GR6A 2CGEA 1MX9A 1JT2A 5F78A 5FROA 4UDYX 2IHKA 2AFIA 2BFOA 4WKNA 5ED0A 4X6UA 1CU1A 4OI1A 1ZNQO 3VHXA 5KYYB 5ESDA 4FI3F 4FK8A 3PE4A 2EZ4A 4G23A 4QL3A 5TJ9A 3JAMA 2BYTA 2W2KA 3S3MA 1T8SA 5BP7A 1VL6A 4IFTA 2A33A 1TYBE 1QHIA 2XZTA 1XGKA 5AKXA 3ROGA 3M8RA 1EDDA 4P4UA 1T8EA 1D1SA 2ODQA 2ZE8A 4IIEA 1HRDA 1VLLA 3EG9B 4IEIA 3LQ4A 3UG7A 4DSUA 3R9WA 2VI5A 3VUEA 3GJZA 2VKTA 2X42A 3WKCA 2AG6A 2CUTA 5LOVA 3S2IA 3DLAA 3VQTA 3ZKWB 2GEFA 5MHTA 3OWXA 4O8UA 2YMQA 1Z4OA 2VHYA 1HFJA 3CS3A 3CF4A 3GLIB 2CZQA 2D0IA 4YNBA 1KQ3A 2LIVA 3PXDA 4UDNA 1G21A 3TTDA 2V9PA 4UOZA 1Z82A 1DT9A 5DO9A 1EO1A 3AI1A 1G5HA 2FWAA 1Z6QA 2QKKA 1RFGE 2P9UB 2ZRKA 2FOXA 3HY4A 3OSUA 4EEKA 2VN8A 2ZITA 4R9RA 1NKEA 5A7FA 4DTIA 2RGWA 2EW8A 4Q3LA 2ZUUA 3I9LA 4IVPA 3BORA 1P0MA 1MQAA 4GW3A 1XXHB 2IYYA 3IQXA 4UAJA 1FDSA 3VR1A 5ALTA 5JYCA 5LZ2A 4NK4A 4JZKA 2OVFA 1KYIA 3RRMA 3A6HA 2OYCA 1OREA 2H7CA 1VSMA 3QX3A 4OI4A 4U2KA 5E7QA 4PO1A 1XCJA 1GITA 4C6HA 1EKXA 3VV2A 1D8TA 1D9ZA 1I3LA 2JCXA 3C41J 2WM8A 4CG1A 5J1SB 3AL0C 4MA4A 2DG2A 5SZHB 5L3RA 4W9NC 3OYMA 4PWYA 1Y6QA 3EEFA 4DM3A 4DZTA 3CLUD 3A6LA 3L2WA 3KPVA 3RODA 4RJTA 4HAVA 4ZYTA 3WIOA 3CVVA 2X77A 4TLAA 2QRVA 1JYEA 3QEVA 3TMYA 5BN5B 1KYYA 4X3PA 2I6UA 2QV7A 3DKRA 1WDMA 4FTWA 2HF7A 1NJ8A 3DVSX 4IO0A 4ZQEA 1JQLB 3GWGA 4CEOA 1QCCA 2AHRA 3M6GA 3CMAN 3UIEA 2V58A 2WM2A 3BXEA 3IIKA 3RHTA 2XQVA 3RC2A 1WZIA 3ZHSA 1LV5A 1JDNA 2VHWA 1JXMA 5E6RA 2ST1A 4RK6A 1JHDA 4BRQA 3AFGA 4UD2A 1QBGA 4PGMA 2Z2KA 2XRIA 3KX2A 2FPPB 1ZR4A 4R0MA 3F3SA 4HYEA 3E8SA 3BK2A 4WWHA 5IARA 3F0TA 2PAFA 4EY4A 2YKGA 4ZAZA 3H4VA 3ZU2A 4E3WA 2ANBA 3DB2A 2X3FA 4Q3CA 1T36B 3UEOA 5K0ZA 4F2DA 5KWJA 3M6UA 4IM7A 1U47A 4ITRC 4L0DA 2WAYA 5HIAA 1YRAA 2AT1A 3V1TC 2Q1UA 1UEXC 5DOVA 4QDKA 4JVOA 4EFNA 5KOJB 1U48A 2NRTA 1UJMA 3FPSA 4B4VA 4W5JA 2E82A 4ZVRA 1N7JA 2EKBA 2I4TA 2VJPA 3U4QA 3KCNA 1QRUA 1AJEA 1L9KA 3HYLA 4G81A 4MGYR 4DLAA 5IYZF 1M8JA 2GDJA 5CM2Z 1V3UA 4EZ9A 3G0DA 3BM5A 1A96A 5HGJA 1C30A 3ZN2A 4BVJA 2IC5A 3C1AA 1JLLA 1GADO 1GTJ1 2W6PA 3DZ8A 3O3NB 3O3HA 4YQYA 4F9FA 1N5RA 3KSUA 4UZFA 3NH1A 4AZTA 3F3MA 2YV2A 3FSEA 3EOAI 5JNSA 4KR7A 1QHTA 5K6AA 3E9EA 5C8ZA 3OYLA 5FWXB 2N47A 4CT0A 1CR4A 2VOJA 2DBZA 3AERA 5JWHA 3SYLA 3QKSA 4RM2A 1F6DA 2FPUA 1PJSA 2Q45A 3MOIA 4M53A 3OLZA 5F23A 1ODKA 1W75A 4QYTA 4IKOA 3PGLA 4R98A 2N3ZA 2BI4A 3BGDA 1O5TA 2CN1A 2QZ9A 3EK2A 1YAJA 2R7AA 3I12A 5A1JA 3LLMA 5L51A 2EP7A 4RV9A 3UWSA 3ZI7A 1FJHA 4PKIA 4XYMA 3NF9A 1GL7A 1SULA 4N82A 3CLVA 4GC9A 4ALNA 4BCCA 2YY6A 3CPWM 1JSCA 2XWJI 1R0CA 1X1BA 2P9FA 4QQKA 4JKFA 4CIFA 4JFRA 1S6QA 3P9QA 4R1UA 5AQOA 5FI3A 2VJCA 3OJUA 3IBCA 2JCBA 4EUSA 4N8EA 3W9UA 2Q4BA 4KMMA 4RZ3A 5ALMA 3PCRB 4FYXA 1R0XA 3WYEA 4PYOA 2PS9A 3OT1A 1WQ3A 4OIFA 4B3RB 2FFRA 2JHCA 4LF9B 2OZPA 4FM1A 1N75A 1RTKA 3A2NA 1EE9A 1SG0A 1ZVKA 3OJWA 4LHVA 2EJUA 3FRJA 3STYA 1PL7A 2X0JA 3HP9A 1HTBA 2W00A 1VJ5A 2W2MA 1WW2A 1S3GA 2GYYA 1FBTA 4L5JA 2IHVA 4S1WA 1IYZA 2GWJA 3LSTA 4LTMA 3T3NA 1UKAA 4M7OA 3V8VA 3QUTA 3I0NA 1QSSA 1G4HA 1M74A 1TO2E 4I81A 4INZA 5E0OA 2JHGA 3A1WA 5THXA 2JLBA 4OQQA 4CM9A 5ERXA 1W59A 3AT1A 3HLTA 4G1MB 5KVQA 3SICE 3Q8LA 3GLIE 1HE5A 3PKIA 1N7IA 4H1WA 1W0JA 3KCQA 1LDEA 4OBEA 2PSHA 4AQYK 5AQUA 3SR0A 3UYLA 4IZ9A 2FBTA 2PH5A 2MU1A 3N0TA 4YRTA 3KO8A 3ECAA 4JH0A 2W71A 4CCYA 3UWDA 3RT7A 4DSIA 2I65A 1RILA 3E5RA 3AIIA 2DLNA 3G10A 3VMFB 4IDEA 4MW9A 2C7QA 1PQYA 2Y66A 1IB6A 1JG1A 2GZAA 3A1EA 3HU5A 3PHLA 3QYAA 5E41A 1WAFA 1WKCA 5HPYB 1JAHA 1E4VA 3EE8A 2ZGYA 1U3CA 1Z8NA 2RGNA 2WUVA 1C3LA 1ESVA 3B38A 3I8XA 1U1IA 3HBJA 3LH5A 3M6WA 3N87A 4CQMA 1HC7A 5KJFA 2B2CA 1V8FA 1IHYA 3QEMA 1NGGA 5LY3A 2JAUA 1UBUS 1J0BA 5GZ1A 2ZK7A 3D1JA 3H45C 1VQ7N 2I4MA 4KPEC 1EUQA 4LUCA 3OE7D 5EN4A 4FGUA 3BMNA 3HRGA 3KE8A 4YBZA 1T8TA 3ONDA 1UJ2A 4QUIA 4RCYA 3AUSA 2D0PB 4CKBB 2XNKA 4YO7A 5F1PA 2E1PA 1Z0SA 1Y34E 4ESVA 4G1UC 4KRXA 2WOJA 4YFVA 3OTHA 3PJDA 2BFCA 1HLUA 3P0IA 4EAHD 3LDOA 3SI6A 3GUUA 3P97A 3VR6H 1WNSA 3MUFA 1PSZA 3ENVA 4YMWA 1VG1A 5HMLA 4PICA 4PSKA 3HVUA 4FEAA 5IT4A 4ZQCB 5FLKA 2BFWA 1VE1A 3NHYA 5EIWA 3G1WA 5AM0A 3SX4A 5JZVA 3N5KA 4GXNA 4Y2XA 3VKGA 1XKTA 1A5AB 1NJ1A 4ND8B 4S0ZA 4GM1A 4XE5A 3TH5A 1EKEA 5HZHA 4RX1A 3W8RA 3HS3A 2UU9B 1FFYA 5JFTA 2BH1A 5CX4A 4UEOA 2PRKA 1K4KA 4YQZA 5BMVF 1FDIA 1PDWA 1N33K 1VJ0A 1HE8B 3PX4A 1D2GA 2R68A 1A76A 1F12A 3B53X 4I1IA 2DR3A 4PLZA 4X94A 3O2JA 3RVDA 3ZIAD 5BR4A 1U7HA 5FWYA 1D5WA 4J0GA 2NU6B 3BN3A 1DQNA 1YQEA 2C4TA 2IY7A 4JEIA 1E8DA 1DRVA 2COKA 2FSHA 4RH0A 2G88A 4HUQA 2XVXA 4Y0VA 3EQZA 5DGDA 3WV4A 3HO1A 3FX2A 4LZAA 4BGBA 4JI0K 1KY4A 4GR9A 3VR5H 5K3OA 4RL6A 4F0JA 3KXLA 1DQSA 5T67A 4C6RA 1VQ4N 1W5FA 2OWEA 3U9LA 2EF1A 2OKGA 4HJRA 3BHJA 1Z68A 821PA 3UXEA 1BWFO 3OECA 4PXAA 3TM4A 1UXKA 1AH2A 2C1XA 4NENA 3NPAA 1Q7YO 1RRFA 1J39A 4WQ4A 4X62K 3RYIB 4C8MA 1J21A 221PA 2WG0A 5FTKA 2I6XA 4CJUA 1Z74A 4YOXA 1NDUA 5DNWA 2EKQA 3TUIC 5EY4A 3WIVA 1YFLA 2XT6A