1YTUA

Structural basis for 5'-end-specific recognition of the guide rna strand by the a. fulgidus piwi protein
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
426
structure length
410
Chain Sequence
MEYKIVENGLTYRIGNGASVPISNTGELIKGLRNYGPYEVPSLKYNQIALIHNNQFSSLINQLKSQISSKIDEVWHIHNINISEFIYDSPHFDSIKSQVDNAIDTGVDGIMLVLPEYNTPLYYKLKSYLINSIPSQFMRYDILSNRNLTFYVDNLLVQFVSKLGGKPWILNVDPEKGSDIIIGTGATRIDNVNLFCFAMVFKKDGTMLWNEISPIVTSSEYLTYLKSTIKKVVYGFKKSNPDWDVEKLTLHVSGKRPKMKDGETKILKETVEELKKQEMVSRDVKYAILHLNETHPFWVMGDPYEGTKVKLSSKRYLLTLLQPYPIKPLSVEIVSDNWTSEEYYHNVHEILDEIYYLSKMNWRGFRSRNLPVTVNYPKLVAGIIANVNRYGGYPINPEGNRSLQTNPWFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for 5'-end-specific recognition of guide RNA by the A. fulgidus Piwi protein.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Rna binding protein/rna
molecule keywords 5'-R(P*AP*GP*AP*CP*AP*G)-3'
total genus 125
structure length 410
sequence length 426
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02171 Piwi Piwi domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1ytuA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ytuA02
4YS6A 4CJ5A 1WAFA 1S1UA 4XIUA 1U49A 4DSKA 3OMWA 3BILA 4FK4A 2X7XA 4DU4A 1EXQA 5B3JC 3C3WA 3DOKA 3HSTB 1NXPA 4DS5A 1M5UA 2RJNA 2RF2A 1IKVA 1TVMA 2ZAYA 3CLKA 1RXIA 4KVFA 3KTOA 2XY6A 2VG6A 1ZDMA 2L17A 1QP0A 3OLZA 4KB1A 1C4WA 5IUJC 2FBVA 4KHSA 4WT7A 3AO3A 1TL1A 2PMCA 5JNWA 4DTMA 1CZBA 2YNHA 4ZYLA 1JFSA 2H3HA 1OXKB 5DTEA 1ZHHA 5E3JA 3OJUA 5TQ2A 3TAEA 2CHEA 1HJRA 4TMYA 4L8RB 2KFZA 1KGSA 4B9TA 3QNOA 1TV6A 3I0SA 1LAVA 3C6QA 3AVCA 4KTZA 3V1RA 2F8SA 2HHQA 4CHYA 4MFBA 1SL2A 4OBBA 1BCOA 4CFAA 8ABPA 1XWLA 5J2MA 5IULC 5SWMA 2QXYA 3K59A 3NGYA 1UDRA 3KCNA 4HTUA 3H1FA 1VSHA 1WN7A 3OJSA 2LUOA 1PNRA 3Q7TA 4MRMA 3SJJA 1HQUA 1IKWA 2ZQBA 4BE2A 4RK4A 4FK0A 3VA3A 1NXOA 5EWJB 1L5ZA 5PNTA 4DU1A 3L3VA 4CEDA 3KLGA 4N41A 5KQLA 4J2AA 2XY8A 2KTQA 4KHYA 4YCSA 4KPYA 2IC3A 2PL1A 3VNAA 1MIHA 4DLGA 2R47A 4CIGA 4E7IA 1J9AA 4RS3A 1XC9A 5IEJA 4MQEB 3GYBA 3K5NA 1AB5A 4ETIA 2G8WA 1Y97A 5IUKC 1QQBA 2GV9A 2WMYA 3MYYA 1Y1LA 4MS1A 2BDPA 2PZSA 1QS4A 1SKWA 1SKRA 2FSPA 1RZRA 4FXDA 3IG1A 4FJKA 1O1WA 4UHKA 3SUOA 3VA0A 1VSIA 1JWLA 4PWDA 4IFVA 1ZBLA 5JNSA 1DTQA 3O21A 3EODA 5DLEA 3LMKA 2RGYA 2E6LA 4ELVA 3N8IA 1GUDA 1DCKA 5JNRA 3VQ9A 4E7LA 4QOZB 1BGXT 4RXUA 2WB4A 3KTQA 3AVKA 3TAPA 3LKBA 4C8MA 1X9MA 4ID5A 1RT6A 3ILHA 4OATA 3V1OA 1VPWA 4AHSA 3ZCMA 1YTUA 3SUQA 5HLFA 4CBVA 3OLXA 1D1QA 2QZJA 2LSNA 3O4NA 4CK1A 4ZTFA 5D3GA 3QO9A 3CZ5A 3KKSA 1DG9A 2IS3A 5KI6A 1KRPA 3K5OA 3S3OA 4HVJA 2R7YA 5KRSA 1D4ZA 1QSSA 5I42A 4FK2A 5HM6A 3T38A 4ETMA 4OLAA 4QYMA 3NFAA 3OYDA 2PUEA 4AHVA 1APBA 1DJMA 4B8CA 3KLOA 4FZYA 1IKXA 4QPJC 1GOAA 5ABPA 3OO0A 3ZT4A 4H4OA 1JBEA 4Z4CA 1EWKA 4KK3A 3UKJA 4DF8A 4CJQA 4IKFA 4Z9BA 1PEYA 3V9XA 3WNEA 3LWLA 4M3WA 1DP4A 3LAMA 4GPAA 1U04A 3CYMA 1HQEA 3LUKA 5J2PA 4DTXA 3PX0A 3FFWA 4DG1A 1B9FA 1PHRA 4YRZA 3AVBA 4ZHRA 1M2EA 5CHYA 3AVMA 4IILA 3TAGA 4NV3A 1Q9XA 1J53A 1YVUA 3I42A 1GOCA 5BQ3A 3CS3A 3L49A 2Y1IA 1HYZA 1SV5A 5KGXA 2A9PA 1UWBA 3HJFA 2FQWA 5I4CA 4LSNA 2ZE2A 1NJZA 3DBIA 1YK0A 4CEQA 2FLWA 2WJAA 4AHCA 3TANA 3P83D 4FJ8A 4E7HA 3NHGA 4B9LA 3HP6A 1KVBA 6CHYA 4F8RA 3QEWA 1LV5A 4E7OA 3WNGA 2L19A 3O1HB 4CHOA 2YKNA 1ZGZA 2V0NA 3DLEA 3DM2A 4E7PA 3B6PA 3LUGA 2YHBA 1RDCA 4OGEA 1S1TA 3HT3A 1WSGA 4G1QA 1YS7A 1UAXA 3CTPA 4QAGA 1N5YA 3KD1E 1TMYA 5GOTA 1S6PA 1JL3A 4L85A 2HPHA 4C8NA 3PO4A 4KMRA 4HCCA 3OLYA 4OLBA 1QE1A 4CJ4A 2X6NA 4DTNA 2AJQA 5CZ1A 4IDKA 3MEGA 3QESA 3GA5A 1USIA 1F51E 4H3KB 3IDOA 3RVPA 4LY7A 4EYKA 2FN9A 1F4VA 3ULDA 3QELA 3KLEA 3DGEC 3AVFA 1VSJA 1W0HA 3M8QA 4C8KA 4E0DA 4FZXC 3OLVA 1J54A 1YT3A 2EX3A 4DSEA 1NXSA 4XLTA 2ITGA 4F8JA 3IP6A 4LH4A 3DLBA 4F12A 4DTRA 4FJLA 3LALA 4KNYA 1LW0A 4CJUA 4L4UA 2NZUG 2Z1GA 4FJ5A 3NBPA 1VK0A 1RTDA 3C3KA 1C0UA 1IKYA 4CERA 4CF1A 3CG0A 4G0PA 3NH2A 4O5AA 4MS3B 1BDIA 4IRXA 3OVNA 2IPMA 3IRXA 1EP4A 1I39A 3H08A 4AHRA 1NOYA 4Z0UA 3DZDA 5BRAA 4OKKA 5IBQA 4OGCA 4FJ7A 3EJWA 1VSEA 1JXEA 5CNKA 4KTQA 4NCGA 4LH5A 4FJNA 1ZBHA 3K2PA 4Z0NA 1LWEA 4CGGA 4UQGA 4DTPA 2E4LA 2FXIA 4PUOA 2QSJA 3T95A 4NYNA 5KWSA 1RBTA 1FK9A 4CEOA 3CFPA 3L2QA 4RY8A 1MAVA 3KG2A 3M8SA 1RTJA 1YK1A 4DQSA 4KFCA 3TX6A 7ABPA 4EYOA 4RU1A 4CGIA 4XAQA 1RDBA 1KFSA 3B2NA 4RY9A 3RVRA 1DZ3A 2JVJA 2L2QA 3I0RA 2ID7A 3ZT2A 1X9SA 3CKMA 1QMPA 1YMVA 1BI4B 3M6MD 5EWMA 3IP7A 4M88A 4N56A 4FM0A 4CF0A 2HHXA 4P1ZA 4OVLA 1H9CA 2YNGA 4JP1A 1ISSA 4XASA 1NK4A 4S04A 4CJEA 4CESA 3S3MA 1JYFA 2HSGA 3O3FA 4YR7A 3HEBA 1W9HA 4CHNA 1RBRA 5KTQA 1CXQA 1C1AA 4O1IA 4FCYA 4KTWA 1NK9A 4CJPA 4RKQA 1CHNA 4BDPA 3NE6A 1TGOA 4E7JA 5HQJA 5CNMA 4AHUA 2RKIA 1D8YA 1T34A 2FMIA 3IS9A 2IDOA 1L3VA 4DQIA 3JY6A 4EGSA 3NGZA 3QETA 2NT3A 3H5IA 1T05A 3FFTA 4W5OA 4Q0BA 4NCBA 3N0XA 4W5NA 1N6QA 3TR8A 1K66A 2M98A 3CRNA 2LP4Y 1JKHA 3OQNA 1WLJA 3SUNA 4WXMA 2TMYA 1EX4A 3E01A 4I2PA 4DQQA 1U47A 3CHYA 5ED4A 1YS6A 1R8JA 2Q3SA 3OYHA 1DBPA 4FE7A 4DFJA 3GWGA 3CG4A 4DMNA 4PY5A 3EAFA 2PUAA 2DFFA 3JTEA 4DN6A 3AA3A 2A9OA 3NF6A 4YWHA 1TLFA 4ZTJA 1IIBA 4TLMB 3QNNA 5HRPA 5D2CA 2QVCA 4RZSA 5J2NA 4G0YA 4RWEA 2HNDA 4FJHA 4NQRA 4MS4A 3VQEA 2XO7A 3OYNA 3SQ2A 2FQYA 4MS3A 2QV0A 1A5WA 3TAMA 1XHEA 1ZVVA 5EWLB 3IAYA 3V4IA 3HPHA 3I09A 3V9SA 4AILC 2B4JA 1JLEA 1Z18A 4N47A 4M41A 1XHFA 3NNNA 1HPZA 1I3AA 5HROA 3MQ4A 5EWMB 1RCHA 1ISRA 1Z17A 3NF8A 4H3HB 5TQJA 4O0JA 1SXGA 2HHSA 3C3MA 1DCMA 3D8UA 4HUFA 2PUFA 2KZMA 1BISA 1GLGA 3KLHA 3KJVA 1QKKA 1JFVA 1RT2A 1S1VA 3HVRA 2VUHB 1U2PA 3AO4A 3HVTA 2WONA 3LTEA 3N75A 2FQXA 3Q9SA 1BI4A 3URMA 3KK2A 4Y1CA 1VRUA 3C97A 4MR7A 4RXTA 1NKEA 1KTQA 4CHPA 5FRNA 2J48A 3FDFA 4DQDA 3EQZA 3DRSA 3O1IC 4W5TA 1KMIY 1TKXA 3U6FA 1ZGGA 3QIOA 3D0PA 4I9LA 4ZMRA 3H75A 3RVLA 4CJLA 1HEYA 4CIEA 1NXXA 2QVGA 1VSMA 1TM2A 2GX6A 2PAFA 2VYCA 2X74A 1JX6A 1URPA 1JF8A 3G1WA 4KB0A 3SV3A 4G0OA 1RBVA 2HB5A 3AVGA 4LE2A 1RTIA 3TD9A 2NUBA 1QPZA 4EYGA 1VRVA 3T3FA 1XI1A 3MAQA 4CJWA 4F3TA 1WSJA 2G8KA 2OZSA 3I45A 4E7KA 4CGDA 1ZESA 3RMDA 1U2QA 4TN5A 4O0IA 4KZKA 4J2EA 3K57A 1K68A 1WNSA 1EWTA 4CFCA 4EUKA 1TKZA 4FM1A 1SXHA 3ZSXA 3PO5A 4IGAA 3GRCA 2F96A 4RSMA 2P5OA 3LUDA 2FN8A 4DFPA 2AYXA 3RR7A 3OQMA 3IPCA 1EKEA 5TPWB 2FC0A 4J2BA 3QINA 1HYVA 3TI0A 5CZ2A 4YV7A 4N0PA 1ITGA 3ZSRA 3UK0A 4D6XA 4JS4A 3F73A 3HPGA 4IG0A 4N76A 2E4VA 4K8XA 1SD5A 4CF2A 3U3YA 2CHFA 2IOYA 3SY8A 2FBTA 4MPTA 3H6GA 3ZT0A 1T7PA 4B8AB 2O4GA 3JPYA 3V9WA 5FWXA 2RN2A 5JNUA 4XXHA 1DC8A 4MQFA 4ZMSA 2PYLA 3ILYA 1LJLA 4KO0A 1KLMA 3OYLA 1JLGA 3TAQA 2G8VA 1KRWA 3OY9A 1RBSA 1VSLA 3RVSA 2B1JA 3T8YA 2HNZA 3AVLA 3KK1A 3EZ5A 1NY5A 5DCLA 3ASMA 4FW2A 1RT7A 4KFBA 4B9SA 1ABEA 2OPSA 1NOZA 3EGCA 4F2RA 4KHNA 4FM2A 3H5TA 4DS4A 3M9WA 4QCLA 5CYQA 3LWMA 2FEPA 3TMYA 1JLFA 2BE2A 3QEKA 1X9WA 4CJTA 4E1NA 2FBXA 1U48A 3H5LA 1FFGA 3CM5A 1D1PA 3DGFC 1NTRA 5TQ0B 3RMCA 1EFAA 4M42A 1ZITA 3MA0A 5BRJA 4RG8A 3RVNA 4TSXA 1NKCA 3KD5E 3HPOA 4EYQA 2X6SA 4LSLA 1D9DA 5KQPA 3SCXA 1USGA 4WZZA 2WJWA 4CHZA 1NK8A 1FSPA 4PA1A 5KC9A 1L5UA 1JDPA 3IP9A 4FJMA 2R48A 3BBLA 3AV9A 5DMRA 2FVYA 3KYJB 4YGXB 4EZ6A 3QLHA 4RK1A 4YO7A 3VQ4A 1U8TA 4CJ3A 5T7BA 1L3SA 3K5LA 1LWCA 1SUQA 3F9KA 4WE1A 4RW7A 2IDMA 2FMHA 3QLTA 4W5RA 1BIUA 2OPPA 3LUFA 1Z16A 5FDLA 3NGIA 2D5RA 2JGUA 4JRPA 1U45A 4FW1A 4FB4A 4I2QA 3HV2A 1PNTA 1RPJA 5HP1A 1IH7A 1RBUA 1HYSA 4JB0A 5KRTA 2JVKA 4F11A 3T19A 3U3GA 1JHZA 2MSKA 4MR8B 2PUCA 2EHGA 4G97A 3HK2A 1BAPA 4KK4A 2XRIA 2WOMA 5C5EA 4DSFA 4FJIA 3NBMA 1ZAYA 3Q7SA 2HVIA 1KLNA 5CY4A 3H1GA 1REVA 4CGJA 3I8DA 3MXIA 4MLDA 1IO2A 3N53A 2KFNA 2GBZA 4KREA 4WXEA 4CK3A 3LPUA 4B3OA 3OYKA 3NAEA 1M5TA 2MYNA 3OYAA 2LPMA 4MR9A 3RWUA 5FRMA 3F6CA 5EU7A 3O3HA 3E61A 3ITHA 4RW8A 3HO1A 1ZH4A 2XY7A 1TAQA 4FJJA 5FBKA 1NJXA 1FKOA 1QQCA 1BHLA 3DRRA 4JB2A 4HNRA 3DI6A 4EVQA 5KC8A 2XY5A 1KCFA 3VQPA 4DQPA 5FWYA 3KLNA 1BDHA 1S5JA 4FLUA 3OO1A 4B08A 4PE5B 1J56A 3H5VA 3MM4A 4H4MA 3Q7RA 1YTAA 3KHTA 2OA8A 1MB0A 3QEMA 1DRJA 3A10A 1S1WA 2E6MA 3C94A 3HUTA 2VWJA 1RT3A 2GI4A 4O1HA 2PKXA 3T6KA 5B3JA 2L18A 3OYMA 4N5SA 2PLNA 3CG7A 1WAJA 3DLRA 3L3UA 3RMAA 4N0QA 2LBPA 4Q6WA 2E4WA 2FW0A 4MAAA 1USKA 2MYTA 3OYIA 3LUJA 2YNIA 3C95A 5TQ2B 2OZMA 1BCMA 1BQNA 2IYNA 5EWJA 1VSKA 3QEXA 4M45A 2LIVA 5JNVA 2PY5A 3VQAA 4OJRA 3MXJA 1A0OA 3K9CA 4D74A 2GKGA 1S8NA 4MLCA 5HRRA 4YNQA 4LZLA 4Z9AA 1RNLA 3V1QA 2JBAB 3OLWA 1Q8IA 2G8IA 4RK6A 2VG7A 3QX8A 2WRZA 2OQRA 3GT7A 5JNTA 1TL3A 4I7FA 1DC7A 4KKOA 3QEMB 5K14A 5KGWA 2NT4A 2HMIA 4EP5A 4OPKA 1QP7A 1ASUA 2M1ZA 3O75A 3RVMA 4XFKA 3VQ8A 1C0TA 1X1PA 3KJXA 4FLXA 4RW4A 3DLKA 4DF4A 3RMBA 2VWKA 2G8UA 1L3TA 4MR8A 2DFEA 1TKDA 3OYJA 3NCIA 1MU2A 3ISNC 2JRLA 5CNJA 2PL9A 4MS4B 4DLEA 5KQMA 2IPNA 3ROFA 3K5MA 1QSYA 4BWJA 1BDJA 3OM0A 3EQ2A 2ATQA 3O2QB 4FLYA 3RRHA 3VQ7A 4PZ0A 2W42A 2A1RA 3LUHA 3PUFA 1ZN2A 1A5XA 1ASVA 3BRQA 4HHTA 3BRSA 3OS2A 3M8PA 4NICA 4YP9A 2YKMA 2PE5A 3P1GA 2A9RA 2OYQA 3BREA 1CZ9A 2D0AA 3VQBA 1MB3A 2E4UA 1VLZA 3L8BA 4EZ9A 3RH0A 4MS1B 3C6TA 2X78A 3PV8A 2E4YA 1BQMA 1VSDA 4ML3A 2ID9A 1Z2EA 1JLAA 4QICA 1QO0A 1E2BA 5TPWA 4Q5VA 3L2WA 1I3CA 4DSJA 4EP4A 3LFTA 1Z15A 2XHBA 4G0MA 3JYTA 4CK2A 3HS3A 3TABA 1NATA 3LP0A 4AH9A 2ETJA 1QNLA 4PYRA 2HNYA 4DTSA 2H0AA 1D5WA 4CECA 1ZH2A 1U0SY 4JASB 4DWIA 4BDYA 4LRQA 4KHUA 2FLKA 1P2FA 3C6UA 2HQBA 1BL3A 2OENG 1JXBA 4Y1DA 4R5PA 3HL8A 3A3KA 3OM1A 4JS5A 3NH0A 3JSMA 1XHZA 1W25A 4FJXA 3QLUC 2FMKA 2F8TA 3VNBA 3QERA 4DSIA 4M3XA 4KAZA 2G8FA 2RJOA 2JBAA 1L3UA 1DTTA 3F6PA 3NF7A 3CQ8A 1R0AA 4JAVC 4KI6A 1DLOA 3PY8A 4ICLA 4Y9TA 3EULA 4LDZA 1TK8A 1RT5A 1EHCA 3OS1A 1SL1A 3RR8A 2XDYA 4KV7A 1A04A 5HSGA 2CWDA 3FMVA 2FEWB 1Z12A 3KLFA 1OXBB 1VKRA 5FBHA 4DTUA 1RDDA 3ZSWA 4DTJA 1P6UA 3JPWA 2HQRA 1WSIA 4EVRA 2YNFA 3QEIA 4E89A 5FWXB 1CLQA 4HNQA 3M8RA 3LANA 2FTKE 2P4UA 1S9EA 1F21A 4WUTA 4OTZA 5T3YA 3RQIA 4ETNA 4MQ3A 1Q9YA 3QX9A 3VN5A 3KKEA 4M3UA 3SM9A 3OYCA 2FKAA 4OG2A 4DTOA 3SG0A 3SQNA 3UIQA 4J2DA 1GUBA 1PUXA 2PUBA 1ABFA 2HHUA 4DADA 3HM9A 3AVNA 2QXFA 5HRNA 2IAJA 3A0RB 1GCGA 4QYWA 4GMJB 3ZSVA 3TAFA 3MF4A 1M2FA 5TE9A 4BWMA 4JA2A 5KQGA 1TAUA 3AO5A 4W5QA 2B5JA 1TK0A 1T8EA 4PEVA 3EY1A 4M3TA 3N6VA 3QK7A 2Z1HA 1JLKA 3H1EA 5F64A 1HNVA 5FROA 4K8ZA 1BA2A 3VQ6A 3MXMA 1JL2A 4CIFA 4M3RA 4M3ZA 1D9FA 3LZJA 1TJYA 2IOCA 2HHTA 3AO2A 3ZSYA 5DKFA 3MEEA 3V6DA 3Q41A 1Z13A 4CE9A 1QP4A 1KRXA 1Z2DA 4CEBA 3ZT1A 3SUPA 2HHVA 4CHQA 3RRGA 4Z4GA 3RVJA 3F7NA 1CXUA 1LK0A 2VK2A 5IX8A 3ZSZA 2B4AA 1BVHA 3SPYA 1EAYA 2JVIA 3IPAA 3UUGA 3NHZA 1RTHA 3A2FA 2OPQA 1P8AA 5C24A 3CFYA 3JVDA 3HYFA 3SNKA 1WSFA 4CEEA 2DFHA 3LAKA 5E41A 1NK0A 4DFMA 1FFSA 1TKTA 2ZWMA 4MQEA 2HJ9A 1K6YA 1RDAA 5HRSA 4HUEA 1KSPA 3AO1A 3OMXA 1HNIA 2VUIB 2QU7A 3QLVC 3SQ4A 4E1MA 2YV0X 3H5WA 4ZPJA 4FE4A 4O44A 3KLIA 3RVQA 1S6QA 1JFTA 5HBMA 3SPZA 3TWHA 3DLGA 4B9VA 2I6FA 4LDAA 5BR1A 1WSHA 5I3UA 4FLVA 2DTUA 3BDPA 4CEZA 3LP2A 4NCAA 3AA5X 4WWHA 1JH9A 5IC5A 4GNRA 3LUCA 4Z4EA 4CGFA 4KRFA 1P6QA 5J1EA 2P9HA 1JYEA 2QW1A 2KZZA 3BGRA 4N03A 4DQRA 2PJUA 9ABPA 1QSLA 1QTMA 4ELTA 3NHMA 2GBPA 3A0UA 2D0BA 4O4GA 1NXTA 4G0QA 1S1XA 4HUGA 4PICA 3G10A 3P5JA 3RVOA 4I9QA 4UHJA 3FFIA 4LE1A 3SAJA 2ZD1A 2DY4A 1UA1A 3ZSOA 3I5AA 3NNDA 5DK5A 3QELB 3LUAA 1ZBIA 3OYEA 2N9UA 3SQ1A 3S99A 1FFWA 3O4QA 3OS0A 4Z99A 3LP3A 1SXIA 3JVIA 3O2SB 1RT1A 1ZBUA 1NJYA 4CJFA 1EETA 4FJGA 4MYRA 4ID1A 3M9XA 1QO0D 4NYFA 1DRKA 4E3SA 1DBQA 3KYIB 4DSLA 3SNNA 1LAWA 4FVMA 1RILA 4IF4A 4IMIB 2AYZA 4MQFB 5CNIA 1SRRA 1DBWA 2GWRA 2HW3A 5JS1A 3OYFA 4GW6A 4CCHA 3L2RA 4C8LA 1KVCA 3OYGA 1JL1A 3EDCA 3WNHA 1NXWA 1ZBFA 3ALYA 3B6OA 1C0MA 3H5OA 3RTVA 4FLWA 3LDSA 1AB6A 1ASWA 2R4QA 3WNFA 3PX4A 1YIOA 3Q15C 1HMVA 4O5BA 4H8KA 4Q6BA 3W9SA 1C1CA 3T1AA 4B09A 3LZIA 3MECA 4CJKA 1WSEA 2JCGA 1HRHA 3LP1A 3P9YA 4YFUA 4Z4HA 1GCAA 3HCWA 4DFKA 4KHWA 1A2OA 3DMJA 3R0JA 4RW6A 2QR3A 3MIZA 2QK9A 1QQAA 1J5OA 1C1BA 2PUDA 4G0XA 1VSFA 4LD0A 3THVA 3O1JC 4G0ZA 3AA2A 4E19A 3GV0A 3NDKA 3QEVA 1NK6A 4IG3A 2KYRA 3OYBA 3QEPA 4JRQA 2P1JA 3AVIA 1ZY2A 3VQCA 3KIOA 3CFOA 4EY3A 3AA4A 3FGZA 1RXEA 4LX8A 4F4KA 3CM6A 3NH1A 4B9MA 2OPRA 3LPTA 3N0RA 2G8HA 5IUNC 2IKSA 5SZTA 5TPZD 1GOBA 3FFXA 2RPIA 3DRPA 4B9UA 2A9QA 4RKRA 1Z26A 1JLCA 3GBPA 1S9GA 2RDMA 6ABPA 3VQ5A 1VRTA 3RVKA 3EYZA 2CD7A 3O3GA 2B6AA 3CFRA 1E6LA 4RV5A 4YLEA 4MGEA 3KS9A 3L6UA 1LWFA 2IPAB 5DGCA 4LE0A 4B9NA 1U4BA 3AVJA 4D6YA 5C25A 3QIPA 3ROTA 3D45A 2YHAA 3HXMA 3SQ0A 3SI6A 4FZZA 3KKRA 3CU5A 2MSWA 5C5CA 3O2JA 1KVAA 1JLQA 2Z1IA 4FJ9A 3NNSA 3TARA 1A5VA 2I5JA 4F06A 4FLZA 1NK5A 4OKJA 2E4ZA 2HQOA 2JK1A 2Q5CA 1TK5A 3TB6A 4CF9A 4MR9B 3QLUA 5GQSA 4FLTA 1JLBA 3TO5A 4FYDA 1L5YA 2R25B 2O4IA 1KFDA 2A1SA 1NXVA 3E3MA 1C0EA 4KHQA 4IBNA 3L2UA 4C8OA 2O20A 5TPZA 3MEDA 4Q7EA 4EVSA 4S05A 1CYEA 2IGIA 3H6HA 1B00A 3AVAA 3LOPA 2MYPA 3HZHA 4BE1A 2Y1JA 1UA0A 3KSMA 3HSYA 4CFDA 1D2AA 3ZT3A 1ZYQA 3QLVA 5IEBA 3V9ZA 3S9HA 4RK0A 5CYMA 2D0CA 4BDZA 1JDNA 3DOLA 1LJUA 2FEKA 1FXXA 1YMUA 1B92A 2KW4A 1E6MA 3L2VA 4IFYA 3CZCA 1QHTA 4MR7B 4M3YA 3ZSQA 1FQWA 2JB9A 3SYZA 4CJVA 4ELUA 1MVOA 1NJWA 3V81A 4JOQA 2NZVG 1T03A 4KQ9A 3O74A 3HDGA 4GVMA 4RW9A 2DRIA 3GBVA 2QKBA 3V9UA 2P51A 1DCFA 3KK3A 3S3NA 3AVHA 4RK5A 2IPLA 4KQCA 2KQ2A 2Z1JA 3K58A 1Z25A 4BE0A 4XARA 4CJRA 1NK7A 2PUGA 3GL9A 4RY0A 3D02A 3N0WA 2QKKA 3K4HA 4DU3A 5J2QA 3HUUA 1C6VA 4RK7A 3SZ2A 4MRMB 2JLEA 2WWVD 3SV4A 3JS5A 2HVHA 5EWLA 2VG5A 2HHWA 4CGHA 4KV8A 5FWYB 4TLLB 5HKOA 4OKEA 4OPJA 2E4XA 1E6KA 4ZJPA 1RNHA 4O55A 4HCBA 2P5GA 1TVRA 4JLHA 4F2SA 4HYEA 3G85A 5TQ0A 3OQOA 4PQUA 1G15A 1RT4A 1LBIA 4G86A 1LW2A 4Z4FA 5JS2A 1XWWA 3MMNA 4CFBA 4Z4IA 3IP5A 2GUIA 3VQQA 1D5AA 4RDCA 1EWVA 4H60A 1CEYA 1SKSA 2MSLA 2PYJA 1FKPA 4CF8A 1LBHA 2BANA 4CJSA 3CNBA 1XHXA 1RZRD 1WETA 1IG9A 5C42A 4BACA 2MYUA 1B9DA 4AHTA 4RXMA 4F3OA 3DLHA 1PEAA 4IMJB 2BGGA 4P98A 1BIZA 3HP9A 1SL0A 4HNSA 4CEFA 3G0ZA 4KI4A 2FBYA 1NKBA 3DYAA 3NF9A 3VQDA 4CEAA 3LKVA 2FMFA 3HDVA 1UOCA 3PX6A 2WY2D
chains in the Genus database with same CATH superfamily
2IHZA 1M6EX 2V5AA 4EL5A 3D3WB 5ALLA 4DSKA 3MMPA 2PG3A 3OMWA 4Q1CA 4J4TA 3BILA 2X7XA 4HDKA 621PA 3EMBA 4EOGA 3X1MA 1Z0IA 3C3WA 3Q6NA 3DOKA 3QM1A 4ND4A 5A1JA 5B3JC 1QRSA 3K9QO 4MPRA 3RYFA 2JGDB 4EAQA 3RODA 4KBFA 2VCEA 4A1OA 1NXPA 5F51A 2JANA 1LXCA 1Z34A 2PA0A 3KWLA 3EC7A 4QVGA 1D2CA 3KE8A 1IKVA 1TYCA 3EQ9A 4KVZA 4MOWA 3VI4B 1DKRA 4YB8A 3U4QA 4BNDA 2V7UA 4UHHA 3QA3E 3KX2A 1EK2A 1EXDA 3HGQA 2XY6A 3NT5A 1XXLA 2VG6A 3BF8A 2G88A 2PZMA 1FDWA 5GAHP 2ZB3A 5K8CA 5KOYA 4AKHA 1XMJA 4Z9YA 2G77B 3E1YA 4M9QA 3GCXA 3IKVA 5J5VA 3I58A 1RYDA 2OFWA 4A2AA 1C4WA 4B3MK 1M34E 3M1LA 3O7WA 2QT9A 5J4LA 4WNAA 5IUJC 2B9EA 1NW9B 2C7QA 3E48A 2NV2B 3MDQA 1K75A 4R2IA 1ORRA 1VC2A 5A4AA 1MXFA 2GCOA 1OOEA 3I9MA 4HH3C 4UD6A 5I9IA 5KO2A 1SCIA 1W94A 1TL1A 1Y9ZA 2XJ9A 3NGXA 1EGQA 4K1LA 1HDRA 2DY0A 3LJKA 3IQXA 1NYQA 2H52A 3HPRA 3K0CC 2RB5A 4Q4HA 4QVKA 1FLVA 1ONPA 2NP7A 4CMJA 1LI7A 1QX4A 3M6VA 3OPYI 5H70A 1LKZA 1TB4A 1CZBA 2PO5A 1L4FA 1RRVA 1XCBA 1O6FA 2QL9A 3GJ0A 3NG1A 3Q0EA 4L51A 4ZYLA 1JFSA 4PN7A 1J23A 4PQRA 2H4YA 5KSWB 1VXRA 1P2GA 2Q2QA 3V42A 1C9NA 3R1XA 1ZHHA 2NSLA 2X14A 5KYXB 3NEAA 1EQ2A 3PGA1 5FBRB 3ZIAD 4HWTA 4Q7JB 1FFYA 1RC8A 1UFOA 3DR5A 3M6WA 5EJ6A 1DC3A 1HJRA 2EZ8A 4N12A 2KFZA 4B4WA 3M8KA 2DZDA 3LP5A 3V2GA 4BMCA 5GIOA 1J8YF 1GPYA 2QGFA 1NR5A 5KYWA 3D2AA 4WE3A 5FWDA 4D99A 1N7GA 3U9DA 4LXHA 5LQMA 2IXEA 3C6QA 1F2TB 4Q3KA 4WVFA 4IDHA 2DFKB 1QR2A 3VZBA 4YLYA 1WXIA 2WD9A 4E3ZA 4KTZA 5JXWA 3V1RA 4M37A 5AKXA 2F8SA 3I4LA 4YHHK 4YAWA 5BPMA 2P5YA 1F2DA 2QS9A 3K0CA 2UXDB 3FE2A 4I3GA 4N5LA 3UBMA 5LA6F 4ZIRB 5JVGL 3AO0B 2QPTA 2YNMA 3OIVA 3JWPA 4ZMBA 4QFMA 1OC4A 2AG1A 4C4RA 1BCOA 2E21A 3NH6A 4PLFA 4TUYA 1FTSA 4ZJPA 5A4IS 2J45A 2PUJA 1UBMS 4YROA 4UCWA 1B6SA 3VAAA 2IYXA 2QXYA 3ANMA 3PEEA 3JD0A 4YCAA 4DHEA 1E69A 4H7DA 1F1BA 2G28A 2WM9B 4OLFA 3HFSA 2IU6A 3FCSB 3HJTA 2UXBK 1KH1A 1ZBDA 2B2XA 4XRRA 3Q7TA 4TYNA 2ZUCA 1PNRA 1Z7BA 1HQUA 4TWAA 5I7WA 2ZQBA 4BE2A 2AUNA 3DTYA 4WIAA 3TN7A 1F8YA 1X8LA 3KZOA 1H4VB 3Q3CA 3WLLA 1Q0SA 4J29A 1EFLA 4DMLA 4ESHA 4RK4A 1RJWA 2HMVA 2QVLA 2VJAA 3MWEB 3OZSA 5JMPA 2X8AA 4DC9A 5AW6A 5JJ5A 4DG5A 4H0FA 2WJZB 3NRBA 3P0RA 2F9TA 2EW2A 2YJGA 4EFMA 3I5XA 2CV0A 3G89A 4C6RA 2AMVA 3INNA 1NP3A 3CH6A 1RABA 2ERCA 2IYFA 1M3SA 2H1RA 2NQ2C 2Q27A 3NW9A 4LZOA 3OPYA 1BJKA 4BR0A 1MX3A 4J2AA 2YY6A 3H1QA 5A2QA 2XY8A 1DTWA 3DO8A 1R4NB 1CETA 3KELA 4MV9A 3DAOA 3P2JA 4ENSA 5C8ZA 5DYYA 4CKEA 1Z0SA 1KQGA 2PL1A 1UT6A 4G24A 5CX4A 2P9YA 3CINA 3TX2A 1U6ZA 4P8RA 4DLGA 1E60A 3AFIA 3ULEB 4W5JA 3IUPA 1Q77A 5B53A 1U4NA 1GZ7A 2R8BA 2ZRNA 1F6BA 3LQRA 4IAOA 4GDMA 4J90A 1BD3A 1H05A 4WKPA 1UJCA 2AR0A 3TLAA 3VAYA 4EUNA 1XC9A 2QENA 2XRYA 5JFOA 5H8WA 1E7QA 2ZRLA 4A5SA 4E46A 4K6GA 5K09A 3FR0A 1NJIO 1OGIA 1N3YA 3E1KA 3GRRA 5IPFA 2QXUA 3P32A 3K5NA 2C84A 3G7NA 3M3DA 4LPKA 4E1BA 4ETIA 1Y97A 2WYIA 5IUKC 2W7TA 2RGEA 1GILA 2GV9A 1NI3A 2WMYA 1EM8A 3LYLA 4P3XA 5CM9C 4ZCLA 1AKQA 4ZU1X 3RK0A 2ZI5A 4A23A 2BDPA 2PZSA 3ITNA 3JZFA 3R3VA 3H19A 4TXNA 4EFLA 1SKRA 1ZK4A 2FSPA 3LQFA 4DIEA 5AQRA 4BRHA 1U8YA 2I71A 4RPJA 1LPSA 3TINA 5L3SB 3FM9A 3QLEA 4ZDIA 4J3NA 3U56A 2CH5A 5ETJA 4LGVA 1YR3A 2MCFA 2QN8A 4PONA 2ADOA 1O1WA 2FX2A 2R5WA 2XUKA 3D8NA 3I05A 2ZB2A 4IUDS 2XRMA 4H0OA 1HKHA 2DKFA 4Q7LA 3BMXA 1C0PA 2IHJA 4WACA 3UMRA 4XOIA 1LQTA 3MJSA 3MQFA 4PWDA 1NMEA 2O1EA 3LQYA 3PYLA 1YQUA 4UAVA 3ZVKA 4GKKK 1EHIA 1EVYA 5DLEA 3IEMA 3W0LB 3BEDA 4CZJA 3PWTA 3UW1A 4J1QA 2ZB4A 4NAUA 1GUDA 1DCKA 1O4VA 3PQ2A 4N65A 3VQ9A 2ZTUA 1WZUA 4QOZB 2GQ0A 1BGXT 2XAUA 3CW9A 1FJXA 1H8ED 1EJ6A 5AXAA 1CKEA 4F8EA 2VPZA 1PT5A 2C8KA 3ZWBA 1D03A 2BY4A 4RPIA 4DCJA 3AVKA 1ZAKA 3L6RA 3LKBA 4C8MA 1GRCA 1IB6A 3M1AA 5SZIA 4D41A 1A5BB 1UMDA 2NZXA 4UD2A 4YRSA 1LDGA 2WF6A 1U3GA 3KWJA 4I50F 3X3HA 3D5EA 3V1OA 2CJXA 5F1PA 1KE1A 4AHSA 1PFKA 4C01A 4EB8A 1VPWA 1V8FA 2B1GA 3N0TA 4IJMA 2HT6A 5TVKA 3L7AA 4KR0A 1YS1X 1W2BM 2JHAA 5HLFA 4C04A 2JGNA 4CU2A 3GUHA 2ZUBA 3OESA 1J5PA 4O4JF 4QC2A 4GM1A 4BLSA 4CK1A 4GKBA 1FQJA 3VKWA 2HRZA 3D3QA 1L2TA 3PXCX 4TTAA 1NL3A 4L8GA 3M1YA 2I1VB 3QKUA 4Z8YA 3KKSA 1Y9DA 2OD2A 4ZPXA 5KI6A 1J70A 3K5OA 3PXDA 3LL3A 4HVJA 3FYUC 2R7YA 5KRSA 1IBMK 1D4ZA 4RORA 3CRMA 5I42A 3F2KA 4FK2A 3AF2A 3AESA 3OIWA 4NH0A 3UUWA 5C53B 1QVVA 4KXUA 2GGSA 4OLAA 2C2BA 5I7UA 2P9IA 2GERA 3ZBQA 4Z3KA 1CP2A 1Y1RA 4OGLA 5CDFA 4C0QC 4E09A 3UMJA 3PLAE 2V8OA 5KNDD 4N5IX 2V54A 2FZEA 1PFQA 1MW9X 3PQ6A 1DJMA 2OLEA 3FOBA 2QRVA 4O2AB 4RSGA 1V16A 1Z6GA 2KLHA 2G70A 4JS0A 2VJMA 3VSDA 2BUAA 1IN8A 1R27A 1WEHA 2G9ZA 2KWIA 2X9VA 3KLOA 4L7QA 4DBLE 5HVNA 1GOAA 1AF7A 1M54A 2E89A 3FBGA 3OO0A 3KQWA 1S0UA 1KQSM 4PHTX 3HFJA 4H4OA 1JBEA 4LFCK 4GKVA 3T7EA 1W35A 2GZAA 5CEJA 3UKJA 2XUFA 3DPUA 3KQTA 4PYKA 1OH6A 4LI0A 2PMKA 3QNUA 4L2IA 4CETA 4CQMD 1LPBB 4KMOA 3WNEA 1WPQA 2C5BA 1JALA 4UZFA 1X80A 2YZMA 4WQ5A 3LF1A 2RE2A 4FKZA 3P0HA 1XKQA 3COZA 3MN1A 4M3WA 4ER6A 2QTVB 3BHNA 4HH1A 2PIAA 1WPRA 1ZSVA 2W00A 4ZVRA 2OBBA 2FXVA 5EKXA 1U04A 3A9CA 4QWWA 4O4LF 4L0QA 4YYZA 1TW3A 3MNFA 3LUKA 4MITA 5J2PA 4UQOA 3SYTA 2AFRA 3V2HA 3G23A 1YMQA 1Z39A 5F73A 4OIFA 2WYWA 4ZJZA 4RD4A 1DJLA 1KAEA 2DKNA 3YASA 4DCCA 3M9LA 4HJRA 4OB8A 4OK3A 4TMFA 5BQXA 3G0IA 3TZBA 2BJVA 3F6EX 5TRTA 4L9RA 1DAOA 1PHRA 1M2EA 4ZHRA 2D0DA 3PJGA 3WK7A 4LSMA 3I62A 1B1CA 2OORA 1L5KA 1NBWA 2W58A 2MSCB 4J4BA 3T06B 3EC1A 3BORA 2WD7A 3PD0A 1L5HA 4E22A 1Q9XA 4Y7DA 2VAXA 5EMKA 1NQ5A 1QH0A 1JAXA 2WA1A 3MYRA 2ZIXB 1TNDA 3L49A 4EKDA 1SHKA 4FN5A 1IXZA 1N3IA 2F2TA 2ZGZA 2WHXA 4PSKA 4PZEA 3ROKA 5EP4A 2CK3D 3CETA 3G9ZA 4F6LA 3T5AA 1UWBA 5CEFA 4QRIA 3G9QA 3UPTA 1ZCZA 4DBVO 1PQYA 4UQLA 1E98A 4BQRA 1E4EA 3R9IA 4RE5A 2X8JA 2ONYA 1EGMB 1ZL2A 3JR3A 3S2UA 4G8JA 5LQCA 3OPQA 3AGKA 4D3ZA 1TQDA 2Q2OA 1D4XA 2OO7A 3QFTA 4MWGA 2BM9A 2ZJ4A 1V7CA 1Y3BE 3FN4A 2QUKA 3O91A 5GVRA 2H2WA 4BVHA 3KQUA 4B9LA 2C9BA 1KZHA 3VC7A 4CIYA 3HP6A 4PGMA 4ALMA 4IXCA 2ZQYA 1U7WA 1EP9A 3OICA 2OV2A 2D3WA 1RMTA 2WWGA 3EQ6A 6CHYA 4F8RA 1P0IA 2GCIA 2OHJA 3QEWA 4PCAA 5BN3A 1RZUA 2Z1DA 3DPIA 2ZSKA 4E7OA 5KNBD 4D25A 3SI7A 1AZLA 1OH7A 5D8DA 2FWPA 4P32A 1D4OA 1GT91 1Z4IA 1EIWA 4DQ0A 1KERA 3LQ1A 3DOIA 1N77A 3C5CA 1H2AS 1NURA 4BV9A 1C14A 3ELDA 4OBXA 3DLEA 1YQDA 4GVLA 2BR5A 4AZ3B 1P81A 1K3TA 1V4BA 2IF0A 1M2VA 3H8VA 2YHBA 2AG5A 1LPMA 1S1TA 3CCRN 3PP8A 3ZXUB 2QW9A 4CMGA 4LCBA 5K0NA 1UAXA 5HUJA 3KWIA 4QL3A 1Z36A 1ZUIA 2OMEA 3LM8A 3N74A 5JY6A 2P6RA 1JL3A 1G4HA 1G5QA 1KMHB 1LWNA 1PJZA 1T26A 2AFIA 2HPHA 1DIRA 3GD7A 5HFJA 1IN1A 3N7UA 3PO4A 3OQIB 2DAPA 3KPVA 3TJZA 5LBUA 3PITA 4IXDA 1T1IA 3L05A 1X8JA 3EISA 2R00C 4FGWA 4A2QA 2I8LA 2X6NA 3K4QA 3C0BA 1U7XA 3NGLA 4JKIA 2AJQA 2MHCA 4FUTA 4DCGA 5T3YA 4KFTA 1PL8A 3MEGA 2BR3A 4JGIA 1IN5A 4KWEA 4HQNA 4MW0A 1BG6A 4U7DA 3DONA 1CNEA 4JVLA 5JQGA 1MG5A 2UUAB 2A1UA 4WXPA 1RIFA 4CCYA 3P9NA 1JEJA 3K5WA 2OECA 1CULC 3SYMA 3OQPA 1PX2A 1LI5A 3W34A 2PV7A 4BMZA 3GNTA 2ZYAA 3L7YA 4URYR 1JHOA 2XVXA 4LVOA 5DMHA 1UKEA 4DQVA 1I7QB 4O4HA 3KXPA 4LUCA 3SEFA 3UUFA 3WWEA 4D0RA 2R00A 3TBHA 2BE7A 4ZRNA 3ULDA 3MLAA 3X0DA 5JXGA 5LLTA 1L5WA 3WK4A 1UPXA 3DGEC 3Q6MA 2O06A 3AVFA 5E1OA 4GVPA 1GDDA 1II9A 1E2NA 2IBMA 3I9FA 1CR6A 3KVVA 1VSJA 2AL7A 5TDHA 1L3CA 3GT3A 1PYGA 2HADA 3BSFA 2R62A 3GJ5A 2P69A 2W83A 4FWBA 3DCYA 4KO4S 4MZXA 4W9NC 3WWDA 1E79A 3BEXA 3R24A 3LXMA 4IHQA 1T8SA 1W19A 3SIPA 4D4IA 3KJQA 3A9RA 1DWOA 2DQ4A 3KTAB 2XUIA 2UV8A 3A9SA 2EX3A 2XLBA 4GXNA 2BBSA 4JVOA 4WFKA 5FFMA 5K8UA 2IYEA 3HYNA 3JWIA 3L43A 2GEMA 2PQ0A 4M54A 3CCCA 5DTJA 4AQDA 4OYRA 3ON5A 3NDRA 5CH3A 1SHZA 3NAQA 4PLTA 3EAQA 1TM4E 1Z73A 4GMXA 1G5FA 3UY4A 5CFOA 2A1UB 3IP6A 5ALUA 4LH4A 1YZHA 5LZ7A 3TZKA 1JMVA 3DHEA 2B25A 4GMFA 3AG6A 2EKLA 3ETCA 1RSZA 3K9JA 4FJLA 1UDWA 2P65A 4URFA 3B1YA 5FORA 3LALA 1PTKA 3S3TA 5HZKA 4CJUA 1YR6A 3TUIC 2RHGB 2GAIA 3W6NA 3GRAA 1AKMA 4U5QA 1NUHA 1Q0RA 3OP4A 3D7SA 3SZLA 3REQB 4CF1A 2ZDQA 1V3VA 2A86A 2AXQA 4UBLA 1L5OA 3BGWA 4CCSA 4Q7KA 3EXHA 4DF3A 4X84A 3V7NA 1XZFA 1GGNA 2OC9A 1QF6A 3ZKAA 3OVNA 1Z3CA 3RKSA 5HMLA 3CN9A 4YHHB 2EXXA 3SGLA 5GIPE 3FHOA 3IRXA 1EP4A 1WDMA 1O87A 1I39A 3LX8A 4JYZA 3U7QA 1B43A 1YFZA 2WTAA 2AC4A 2GA9A 3MHTA 1NOYA 2IUSA 3UG6A 4Z0UA 5ESWA 3V80A 5CCEA 3HM2A 5I6DA 4RMIA 5BRAA 3VZDA 2I3BA 3EY9A 3OECA 4IIEA 4ZAZA 2I9KA 1RGIA 5D1HA 4O2RA 5FTKA 4D8VA 3LPCA 4ESVA 2QJOA 3EJWA 1TO1E 5CNKA 4RVHA 4H1TA 2C5GA 5A71A 2IU0A 2P9TA 4JUBA 4FJNA 4EF5A 1QC5B 1ES9A 5EIBC 5COBA 1ZBHA 3K2PA 1MPXA 1WS6A 4G56A 4Q1DA 4XSVA 3Q12A 4OO3A 4DT1B 4JI7K 4ZC1A 3HJAA 5D85A 4R7GA 1J21A 3VR1A 3N39C 2OXIA 2PVPA 4ZVLA 4DYHA 1SCDA 4MYHA 2WT8A 3IAUA 2P9SA 4P35A 2QE6A 5KWSA 1SCKA 1DEJA 4FFOA 3PR2B 1RBTA 1MEJA 1P9LA 1VPEA 2ID8A 3CFPA 3EEFA 4YCNA 1TZCA 4AMUA 1OZ0A 4GXTA 5BPLA 1RTJA 1HYGA 1G6HA 3IERA 4G3XA 4YC7A 3IE2A 2JI8A 3IJPA 1I10A 1F60A 2ZWPA 3KPYA 4LVUA 3WK5A 4CM7A 1LF5A 4RULA 1NNUA 4MWCA 1B0AA 4WLEA 3AETB 4RU1A 3IUNA 1IUOA 4XAQA 4PV7A 3WYBA 3B2NA 1VRWA 1Z62A 2O7SA 3OUZA 3V1NA 3HH8A 3NHJA 2DFPA 4PRLA 3RAGA 3HJGA 3N86A 2G0NA 1Z05A 4NMWA 3GP3A 3C8HA 4O4LA 4Q93A 4B9AA 5BQPA 1X7WA 2ID7A 3CW2A 1QU2A 2LTAA 2ZTSA 1ETUA 4BO3A 4NBUA 1U0RA 1YGPA 3HU2A 2EBHX 4EPWA 5CYOA 1K4MA 1PJRA 2B4RO 4X00A 1PFGA 2OC4A 3IP7A 4FM0A 2BRUC 4YEDA 2KB0A 4CF0A 1GGVA 2WWFA 2HHXA 2YX6A 2C1EA 2ZSJA 3RV4A 4QLBA 1H9CA 4R69A 4R98A 2BOVA 3QVJA 3JYQA 3SK0A 4ZEMA 2C98A 3M49A 3TOSA 5SYMA 2PLRA 4L72A 2LCIA 2BFCB 3RAPR 3PQCA 3EARA 4JI8K 1JNYA 3F4BA 4XUGB 4AM8A 5JRDS 5EJ7A 4C87A 4PHHA 2SKEA 5DTQA 4DRZA 3D0OA 2ZSUA 1G3UA 4YFVA 1IIRA 3ADDA 2DVMA 4JI0B 5HRAA 3OIFA 5DM1A 2WYVA 1W9HA 1FA9A 2AB0A 2D7CA 2PGNA 4DLLA 1KFEB 5LR6A 3GEMA 5GZ3A 4YDUC 2Q8NA 4Q4JB 4BMVA 4CN8A 2PTHA 1S8OA 1Y8AA 1C1AA 2B5WA 2VHVA 1TKRA 5DJ5A 4GFDA 4N7JA 4OQXA 1OI2A 4JYAB 4CJPA 2DY1A 2AQ8A 4Y2XA 1CHNA 3GLIB 2BSQA 1UBGA 1CYDA 1X1EA 5DXAA 3HG7A 4NBVA 4NXNB 1S2MA 4ZAWA 2CXHA 5AI8A 3TSYA 5KSYA 4I19A 2HA7A 5CNMA 3J80O 4AHUA 5LDGA 2VJLA 2EVWX 3F3MA 1ZFNA 4EATA 4A0SA 1D8YA 3FYHA 2FMIA 2ZG6A 1TUYA 4C3ZA 5G4KA 2HR1A 2OV4A 2FDRA 2XCLA 4YQYA 3VTKA 1NSYA 2GTDA 1QZ3A 2EV9A 2IIBA 4DQIA 5EHNA 3SC6A 1CD5A 1M7BA 1N2EA 2D1SA 1TQHA 4DOMA 1N36K 4EGSA 4HG2A 1M2GA 3NGZA 3HNOA 2NT3A 3BB1A 1PBNA 2OCLA 4ESEA 3GLRA 3FF1A 1T05A 3C4VA 1XD8A 3EXHB 2YH2A 4NCBA 1AS0A 3N0XA 5EJMA 4I46A 3SIRA 3BF3A 4W5NA 3I6YA 2B7CA 2R2AA 4Q1VA 3ROZA 3SX4A 3O7MA 2A1IA 2ZYTX 1YJWN 3OU7A 3F2VA 4JSTA 3EO3A 3CRNA 4BP1A 1V35A 5P8WA 4LXUA 4IZOA 1JKHA 1RYHA 4G8CA 2VZLA 4ZN6A 3NKFA 1UJNA 5CXXA 3OQNA 3SUNA 2GZRA 3CLTD 4NJMB 1H93A 1CUDA 2TMYA 2E2NA 3PUWA 4QUEA 3E01A 2BGWA 1QHEA 3LQQA 2QWPA 3L6QA 1GUZA 3I33A 1BCRB 1CJVC 1SPBS 2XMRA 3IUQA 3QI2A 1U47A 4WXHA 4XIGS 4DLVA 4EEXA 3CJ1A 1EDZA 1IOVA 1KH3A 1R8JA 2Q3SA 3OCXA 4XJTA 3OYHA 1XQ6A 2GJSA 3BXGA 2PZJA 3FJOA 3HR8A 2IU4A 3OCCA 4DFJA 4PY2A 1IYZA 1ST2A 3EVCA 3NHRA 1PJQA 1VA4A 4P93A 1UEIA 3HZZA 3HKCA 3JTEA 5ALGA 3WNQA 1YF3A 1OYYA 2ZJ2A 4PXYA 4RIIA 3FI9A 3K5IA 2HRBA 4PGAA 4WHMA 1WXGA 1HY3A 2Q1TA 3W4KA 3U6BA 4TLMB 1JN0A 1C9DB 3ZTYA 3TUZC 4E33A 3QYPA 5IWCA 5HRPA 4CKWA 1AF4A 4ZQBA 1R0RE 4OQNA 3FCOA 2DFLA 1KDZA 2JFNA 3V6MA 1C7EA 4M1MA 3SHQA 3MCUA 5J2NA 1IEVA 1QLHA 4G0YA 3RT9A 2V52B 4I8DA 2ASVA 1XCPA 5AKIA 1E7SA 3WGOA 4B2IA 3QUSA 1U2TA 1X7DA 3ECCA 4Z94A 1RXUA 2QV0A 3F6SA 4QU5A 3VR4A 4EJ6A 3EVBA 1A5WA 2V7XA 3LLCA 3PRJA 3JW8A 4A2CA 1Y98A 1YDHA 3WGJA 3HJNA 3ADOA 3M33A 4MW5A 3X1JA 3PCTA 3FWYA 3R5JA 4WQMA 3DL4A 3RYHA 5K05A 5KJFA 1NVTA 3DYVA 1BG3A 1NJ8A 1LSUA 4P7KA 1DKOA 5KNCA 1E3EA 4M9SA 4QPPA 4YPFA 2I80A 3KU4A 5CHIA 1JLEA 1MH1A 5KCZA 1E8MA 1RKUA 3LY5A 5IDYA 4N47A 2OLKA 4R3UC 1HPZA 4RFSA 4UNRA 5HROA 1UCFA 2ACVA 5EWMB 2JHFA 5KOJA 3GR6A 5LQKA 3ZE0B 1XG5A 2ZGVA 1ISRA 1Z17A 5FPQA 2AI1A 1DO0A 1I0LA 2H3EA 4NZNA 1R9JA 5E4JA 1BKDR 1M8JA 4NIMA 5LB2A 1RI4A 1KYQA 4RWZA 4MDEA 3WTBA 1WMSA 1LPNA 1PFVA 3SEZA 3DXMB 1NGFA 5FWNA 5K0ZA 3WLQA 2QM7A 2Y68A 3IDQA 1SULA 2R79A 4YJ2B 3UH1A 3V32A 4BJ1A 3CF4A 1Z33A 1TJNA 1DCMA 2BGMA 2JEZA 2A4MA 1AQUA 3D8UA 3LW8A 4MQUA 3B1FA 5E8JA 4HUQB 1OWPA 1RLTA 2QUHA 2PFSA 4LRUA 4XCXA 3SR3A 3NXKA 1KJ8A 2PUFA 2KZMA 1KY3A 1OROA 3CUYA 1BISA 3EXIB 3HJCA 4BNTA 4LYAA 1VFNA 1YOVB 3KLHA 4E12A 5DE3A 4O2LA 3OTHA 3GG4A 3MAAC 5AW9A 5KZMB 1RT2A 1S1VA 3HVRA 1M75A 1NNSA 2ZFUA 1CUEA 2XTJA 1XNQK 3L5KA 4WH0A 3T1TA 4I1IA 1VSUA 1ISPA 5C3UA 2ZDHA 3HVTA 2WONA 1EDEA 4L5CA 2ZREA 3R7FA 3W8DA 1SA0B 4TXMA 4R9VA 1KDRA 4BRUA 3N75A 3V33A 2FQXA 3Q9SA 5ISMA 2IQ5A 5C8VA 3TBFA 1EP2B 4IOKA 1MD9A 1JGTA 4BLOA 5DHSA 1CNFA 1ODSA 1RKBA 3URMA 5IS2A 1T5SA 3WSVA 2WJGA 1UBKS 3C97A 1XX6A 3EWIA 4MR7A 5EJEA 4J75A 1JHDA 1NKEA 3DHVA 3E5RA 1PCXA 1W93A 2BFDA 3BMQA 1CR1A 1KQ3A 4CHPA 3HLKA 4K2AA 4Y2HA 4DQDA 5AXDA 1ZJ5A 3DRSA 1L6RA 1VYVA 2VK8A 4S0XA 2DULA 1TKXA 3U6FA 3MBIA 1CQJB 3BZCA 1L7QA 1MU0A 4HTAA 3QIOA 3D0PA 2XQVA 3PT5A 2QPAA 3IX7A 3FTQA 3D4NA 2C03A 1TU4A 4ZOAA 1NU0A 5B7NA 4I9LA 4H15A 4OJKA 5IAEA 4KWIA 4ZMRA 3AEXA 7YASA 3I2YX 1M2HA 4CJLA 1IBKK 3GRPA 4RVGA 2ZTVA 3G7UA 3DA8A 2ZWIA 2QVGA 3GN1A 4M2LA 4D2IA 5LMCA 1VE5A 4NMXB 1N75A 4ZXFA 1Z5WA 1UEXC 4PG5A 4LZAA 5LQSA 5LU9A 2QBYB 2X74A 2W11A 3UOWA 4B6JA 5EJ4A 1JX6A 1URPA 2BF4A 3QVVA 3PD7A 1JF8A 1L3IA 3PNBA 5HBRA 1DBVO 3G1WA 4LF6B 4M63C 4DV7K 4LY9A 1DTSA 1ZOOA 2R97A 3U3JA 1GZVA 2IXBA 2EU8A 2IV2X 1P19A 2XB9A 1OI7A 1T9GR 3Q8KA 2LDBA 4GY2B 4I36A 4Y9DA 1NW5A 3OIDA 2P3OA 1PQPA 2DSNA 1AUQA 1Q11A 3I2KA 4UCQA 4D8XA 3EZGA 4KIFA 4JAXA 1YJBA 4LE2A 4H0PA 2OM6A 5ED0A 5EUQB 1LK7A 4DTIA 2VZ0A 1G1AA 4FFBA 3AZPA 1NWKA 1H3EA 1S22A 3O9SA 2UZ1A 1KVRA 2VYFA 2GHRA 4Q19A 4YT2A 4E13A 1QG0A 1XQ9A 2HZBA 1JKMA 4KQ6A 1YB4A 2O8DA 2HPAA 3D0KA 1RBQA 2RJ3A 1JVSA 2IYWA 5H9VA 3MAQA 4AC9A 3ZHQA 4DA8A 5IARA 5JMOA 4F3TA 2X2PA 1WSJA 2G8KA 1D0IA 2FFAA 4GHWA 3TTTA 1E6EA 1DIHA 5EVZA 4DR4K 1HFJA 2MJLA 1YAHA 4WGFA 4ZKDA 3JD1A 3W6ZA 5L40A 2DH6A 2PA3A 2XWQA 1XMVA 1Y1SA 1E2LA 4TN5A 5F1YA 4O0IA 4G1MB 2IXDA 5EIBD 3ZDFA 5C81A 1TTPB 3IILA 3WYFA 3EFBA 3BJEA 3UK6A 3K57A 1QBGA 4EYSA 3HKDA 1WXHA 4G26A 1MT3A 1NR1A 4F3KA 2UYCA 1CS0A 2HSEA 4R1NA 5HX7A 4N40A 3TH5A 4FM1A 2C31A 4WESA 1YVNA 1Y5RA 4J3JA 4PR3A 4ZVKA 3SOPA 3V1LA 3SVTA 4BRMA 3R9XA 1H1TA 1C3JA 4RTRA 2BVNA 1S2GA 2QX7A 1RQPA 3TIGA 1YUBA 2E8AA 2ZBPA 3P7MA 4KIUA 1TLTA 3SMSA 1ATIA 2DTDA 4J76A 3GRFA 5D00A 1ZD5A 3DXMA 4MCHA 3K1AA 1FMTA 1NRIA 9LDBA 3V1MA 3RF7A 3U49A 3RR7A 4HS4A 4DMKA 3KTAA 5LU8A 2IY7A 4X7BA 1I7DA 1HJOA 1G8GA 1LTKA 1R8SA 2CLHB 2G1JA 1MQ8B 5H81A 1EKEA 1JHRA 2X0NA 3VPSA 3ZHSA 3I1IA 1QOQB 3SHTA 2QY9A 2WUFA 4OI1A 4R16A 4OYHA 4YMIA 5AW5A 1IUNA 3RABA 3TI0A 3IA7A 2RG1A 1KBOA 2R68A 1POXA 5LM3A 1NLUA 4JLDA 4JS4A 2L42A 3F73A 3K92A 5ALRA 5CB4A 4IG0A 4R6XA 4HDRB 3BVPA 2W93A 1SEVA 2OBNA 3U7IA 3HCDA 4GWLA 1E2KA 5ELLA 3V2UA 2F3TA 2I4RA 4C4AA 3KJEA 5CBPA 2ZM6K 2IOYA 4DCOA 1UT8A 1V41E 2EG5A 3H1BA 1PYOA 1RP7A 4WKCA 3QWIA 4JI6B 3S29A 1X8XA 4B8AB 3ILSA 3FZQA 3KOWA 4NL4H 3VBEA 3ZXYA 4B7CA 3V9WA 1GUAA 2ODQA 4CKBA 3LPAA 1QDUA 1CK4A 1DC8A 4XXHA 1OAAA 3ZEAA 4MQFA 3ZV5A 2YJFA 1QNFA 4M53A 1RYFA 1A2BA 2QP3A 1NF2A 1KHTA 3E1SA 3PUKA 1R4AA 4MEJA 3ZR4B 3S1LA 3I2FA 1SK8A 4U2DA 4Q15A 3TAQA 5A7GA 4BJHB 1VE1A 4JK7A 1WHSB 4UTXA 4BNIA 5IHXA 1MV5A 3EMVA 3GVHA 1JIKA 3WWOA 5CURA 1VQ9N 2ZRCA 2IEBA 3C2QA 3RVSA 4N6OA 2J7PD 2B1JA 4ZJUA 3AEKB 1L8AA 5KC9A 3R3XA 2X2EA 1G8HA 2X86A 4Z1MA 4YMSA 1GQQA 2FP4A 2QRPA 3K2EA 3L6DA 4R83A 4B9SA 4KL8S 4OI4A 3F8WA 1DBSA 3V4LA 2JH3A 5KTNA 2FPXA 2DUUA 2VHCA 4J49A 4JQOA 5IJAA 5EINA 2VWGA 4DG8A 1OVGA 2VHZA 3A6PC 4DS4A 1JKFA 2ZIXA 1RM0A 1P3JA 2H4JA 3RS4A 3QKSA 4ZTUB 4JL8A 1N3LA 1JIIA 2G5PA 1YBFA 3M5DA 4KFSA 2P2LA 1U9IC 4E1NA 2R8OA 3TVYA 1UMKA 4FNGA 4AMZA 5JDCC 1PZHA 2JCYA 4A27A 2VHJA 4YRLA 4P4SB 1TIBA 3VR5H 3CM5A 4L3QA 1R0LA 4CW7B 4KGVA 4DJTA 2QZSA 3GLHB 4B47A 5DNDA 1BGWA 1D1PA 5IJZA 1R4NA 1GPAA 1WCXA 3D4IA 1EDOA 3DGFC 3ZCTA 3FLBA 4XGQA 1GTJ1 1R88A 4LWPA 4M1OA 4HT3B 5YASA 3CVYA 1HMPA 1JSCA 5ES4B 2I2FA 1M6VA 2QR5A 3E2IA 4M42A 2BFFA 4F56A 4RLFA 4TRRA 4MJXA 4ZZ0A 1ZITA 1DRVA 3MA0A 4B44A 1W1UA 4DJEC 4RG8A 4B1YB 3I9KA 4TV9F 1VDMA 1ODKA 4N3GA 3RVNA 1ZPDA 1OSNA 3TRJA 1KI1A 1NDQA 3E9LA 1ESNA 3CZRA 3OZAA 4IUBS 4JNKA 4WASA 4BVGA 1X7WB 2X4DA 2WR8A 1SOVA 3AR4A 1P77A 3ID6C 1PWHA 2ISQA 2FEAA 4CT4B 2EKPA 3U40A 3FIUA 5ITSA 1AIPA 2J07A 3FZLA 5GINA 2CYBA 5DSTA 2ZSAA 4AZ0B 1L1QA 2XECA 4CMEC 5AQQA 3HY6A 3R0IA 4HEHA 3LL4A 5EIEA 3OF3A 4QLOA 3SCXA 1SEPA 3SCZA 5KOHB 3MRTA 2RMKA 1Y9EA 3LWNA 3Q85A 2H2DA 1WF6A 1O1YA 1MC1A 3J8AA 1P39A 3D2CA 4EKNB 1VJDA 4NAVA 5DIFA 5KU1A 5SY4A 4MVCA 1H8HD 4KQMA 5CFZA 4JHLA 5E9WA 1OV6A 2FJPA 4FHCA 4RKEA 4CV0A 4TYYA 2R48A 3BBLA 3AV9A 5DMRA 1XZEA 2FVYA 2QTDA 2NO1A 3OJEA 4AY2A 3R40A 3GL1A 5CU7A 3M81A 3ZZ1A 5DHQA 2J0EA 4BB6A 2C5HA 1FP2A 3D3EA 1YZYA 1OX6A 3JQ8A 3T3NA 2FWJA 2COEA 1E5TA 1SUWA 2C5LA 3JASB 4H4DA 4YGYA 3RK4A 3WLIA 4BCBA 4LDPA 3K5LA 1F0YA 1SUQA 1DBIA 2B4KA 3DOFA 2Q5LA 1UZLA 2P1DA 4LXGA 4ZVOA 5B1YA 4P7BA 1FDIA 4RMHA 3FZMA 2AOTB 1V1MA 1JYSA 3QLTA 3U4LA 4W5RA 3A1WA 2ST1A 3IRUA 2E1ZA 2I7VA 2R1TA 2HU2A 2YV4A 3M6XA 5B30A 5EAIA 4H31A 3L0QA 5DPMA 4Q9KA 4OFZA 3NGIA 1ESMA 2O1SA 3SU8A 2D5RA 1U1EA 4LZPA 3VSCA 4NBTA 2OTCA 3VU9B 1U45A 3O2NA 3GN2A 3L41A 3IULA 4UNSA 1PNTA 1CPYA 5HP1A 2HM7A 1IH7A 1PLJA 2QPLA 4NFYA 2BZGA 4YMLA 1RBUA 2WTMA 2KBFA 1Z6QA 4JB0A 4LQ4A 1ISIA 5KBYA 5JARA 5KRTA 3GGCA 4ASUA 2OBXA 1QQOA 2JA1A 3J81O 2XGSA 4F11A 4ZGBA 1C9YA 2ZT5A 5KAPA 4I5DA 5LL6P 2GFHA 2J6IA 1E1YA 3SS9X 2DMRA 2VYQA 1UWKA 2OFOA 2V9ZA 3LDFA 1DNPA 3Q1LA 1Z2AA 4RTPA 4OHRA 1JA9A 4MR8B 3KVRA 3IBTA 4B4UA 3UT6A 2BFPA 2PRIA 5A4JA 1BAPA 4MWEA 3LW7A 1NW3A 5IJWA 2GKSA 1BA1A 4RZ2A 1SCQA 3CF6R 4D4JA 1PT9A 3I2HA 4GX0A 4B3DA 1GQYA 2QGNA 4ID3A 3G2MA 4M22A 1Z8DA 3DMTC 3T3PB 2RI6A 3ZIDA 4C23A 2E4AA 4L8LA 3TYXA 4HDRA 4W1PA 3WZ2A 3ZGZA 1WL8A 3E7DA 3MXIA 1GO2A 2WT4A 4K9MA 4MP6A 1ZR4A 1DDGA 3BIOA 4YFYA 3LK7A 4NYIR 2O2XA 2IT1A 3PVZA 4ZU3A 2BZSA 3H42B 4PZDA 1ECBA 3G68A 2PGJA 5G2OA 1TJPB 4HPWA 1F4PA 1XEAA 1D07A 3HDTA 3DFUA 5EE1A 3LPUA 3HJRA 3UIEA 4BO1A 1JPUA 2PYIA 5KPJA 1P2SA 3OYKA 1R8QA 2VN8A 3IAXA 3NAEA 1M5TA 2IXGA 1QYVA 2MYNA 3PCXA 2XGMA 2HCTA 1XMSA 3PNPA 4XYEA 2AA4A 3OYAA 5TMEA 1NQOA 2LPMA 3CT6A 2HF7A 4MR9A 5EIHA 2J6BA 1V1JA 3LT1A 4HMPA 1NN3A 4L6CA 2Z30A 2D4WA 2ZULA 1A69A 3CZ9A 3D0RA 3KXIA 5JCZA 2RGRA 1XTSA 3ZDXB 1X2EA 1XMXA 4RW8A 4K28A 3ND7A 1ZH4A 2R5FA 4G5XA 5BWMA 2PR7A 1TAQA 3FUCA 5K51A 4IHJA 4J1TA 5FBKA 4HNUA 1NJXA 2CVZA 2DFTA 1FKOA 2RGBA 2FUNB 1AUOA 2I62A 3OC0A 1YFJA 4DSNA 3P9PA 3ZX4A 1CJSA 4CM9A 3H84A 1FYFA 1LTQA 2J5KA 1FY2A 2PH3A 3WLPA 2XY5A 1OTXA 2GF2A 3AF1A 2IYTA 4E4YA 3QSYA 2BHSA 1RQGA 4S12A 3W5DA 1NGAA 3KLNA 2IZ6A 4NK4A 3IP3A 2DT8A 3PICA 1VQ8N 1T15A 2VC2B 4ND2A 4C1BA 3KHSA 5LLSA 4JI4K 1GSAA 4QOSA 4HGRA 1JR3E 1J56A 3UC5A 3TQOA 3U2QA 4LOIA 3UMBA 3LX4A 1XDWA 3W5CA 2OQ2A 3JU3A 1OQAA 4FFLA 1XJWA 4JP3A 1FNNA 1YACA 2EGHA 2BUCA 2A5DA 2GPSA 2NU9A 3DOUA 2VJPA 4M9CA 2GJKA 3RSSA 3EA4A 5DU2A 4FKBA 4US1R 1MB0A 4LQCA 5G0UA 4DV1B 2CVQA 3QEMA 4ND1A 1T1EA 5J3JA 2JDID 4KRGA 5CM8B 4F2HA 2NTYC 5IYZB 2XD9A 5F1XA 3O4RA 5CMLA 2VWJA 3AMVA 4MEAA 3Q8MA 5TKWA 2LW7A 3JVEA 4HX5A 3HQ4O 1VKZA 3QEAZ 1XLVA 3T6KA 3OZEA 2EJBA 4YPVA 1XKLA 5KUTA 1EJBA 1JZQA 2WFBA 4IRUB 2HOEA 1OFIA 4E5YA 2PLNA 2CLDX 4NS4A 3CG7A 3QKRA 1DAIA 1WAJA 3VTIA 4RTNA 3IAS1 4BLWA 1BMQA 4G6ZA 4OHFA 4Q6WA 4TV9A 3WNZA 1T0HB 1JG3A 4YH1A 4X6LA 1QRTA 2FW0A 1X7GA 2Q7XA 2HTFA 4ZT4A 3D6FA 2MYTA 2NW6A 1CQJA 4LTNA 4QPCA 4M8NE 2YNIA 1TU0A 3TTWA 2I4MA 4KHPK 4D8YA 3C6AA 2N1MA 5A1TA 3SHWA 2XB2A 1AV6A 4ZVUA 1MO3A 4BTVA 1BQNA 3JYNA 3TPFA 2C3YA 3VZQA 2JLWA 1JCFA 4G1EB 3ZWYA 4AW9A 3FH0A 5FR1A 4PBRA 2V3VA 3TSQA 1C1YA 3HVIA 4C7OB 1VQNN 1VSKA 5K0CA 1NPYA 4QIHA 1EWQA 2NSYA 4BLPA 13PKA 4CLDA 1NGDA 1K3UB 3Q10A 2D2VA 1Q0QA 3BGDA 1FL9A 2XHEA 3F3KA 1E4GT 1EUDB 2GPYA 4N5DA 4BNGA 4C2AA 1KI6A 2AN5A 3GFTA 4RJIA 4I66A 3KLBA 1F7UA 3R23A 3S40A 4QOGA 3WGNA 4CZMA 4LZLA 1LBTA 2JBAB 2RONA 4BQLA 3OLWA 3QVLA 4M36A 4B6QA 2QTCA 4BGIA 4BLQA 4OJQA 1RKVA 3MD0A 4UFNA 2J3DA 3TG8A 1U9ZA 1EXNA 2WPNA 3RASA 3BQMB 4AYTA 2WRZA 3U9TA 1XFAA 1G55A 3NOXA 5AKEA 4UUNA 4ZK2A 3OE5A 1VG9B 1CLUA 2YHYA 4QS8A 1U5BA 4I7FA 4DA4A 3FTCA 4XQCA 5BPNA 2CB9A 5JQGF 4H77A 4Y1EA 4G81A 4QXRA 2D1TA 1ORDA 4HAXA 5DX8A 1BGVA 5KGWA 2OHIA 5BMVB 4U2GA 1CJTC 4XCQA 2GZ1A 2NT4A 1ENPA 2A9JA 2NZ8A 4L73A 4PFSA 5AKJA 5H4HA 3BZKA 3FOAA 2XB4A 2XUDA 1QP7A 4FYHA 3M83A 4AJEA 4S2UA 3DEZA 2H57A 1GU7A 5FJIA 3RVMA 4L8VA 1AOXA 3R3LA 4YECA 4JKGB 1VI2A 3GZNA 5JRZA 1EVEA 1WXXA 4A0FA 1BOTO 4ZI7F 4ZYTA 1K27A 3JQAB 4D4MA 2OTJN 4DEYA 2BYTA 4O8KA 4KN6A 4RW4A 3HCCA 1SUSA 3RMBA 4AS1A 2VWKA 1T3SA 4LKRA 4K9DA 5EN4A 1N6RA 2G8UA 4MW2A 5ALJA 2IH5A 4MR8A 2DFEA 1AN9A 2WWYA 3EG9A 1GVHA 4HDAA 3G49A 4RF3A 1TKCA 2HA4A 3KOZA 3NHYA 1UZAA 5AQHA 3O6WA 3ZWNA 4Q03A 3PXGA 5HJ7A 3WGHA 3JARA 5DISB 1ZNWA 3B85A 3Q7EA 3WSWA 3I56N 1ZVMA 1KZ1A 3ED1A 2YFYA 3VKVA 3AF3A 2MSNA 3GAZA 1TYQA 1CUHA 3K8YA 2C78A 4MCJA 5I7VA 1RCUA 3R0ZA 3K9KA 3I04A 1AT1A 3L01A 3REGA 2PL9A 5FPNA 4Y30A 4H5VA 1XXHA 1QONA 2G8NA 5BRHA 4LDRA 1T4DA 4Q9AA 4BQIA 4BC1A 1G2OA 4ER3A 4PKIA 5KQMA 3CJ9A 3TGPA 3ZX0A 1Y34E 2XH8A 3GLKA 5U1PA 3ROFA 2W2XA 3HJBA 5JXJA 3L8FA 5LYJB 1R3DA 1JLLA 3K5MA 4UBNA 3IQIX 3UGJA 4A03A 1N5MA 4EUSA 2Y2UA 2ZAGA 4FOIA 3PTZA 4EQ6A 2GZMA 4II2A 1QOPB 3HHPA 4IH4A 1CUCA 1UWCA 3MZ0A 4TGLA 4AP9A 4EVIA 3VQ7A 4KR7A 4PO8A 1GTMA 4H1UA 4R1SA 4DGSA 2XOEA 4OQDA 1IM2A 4EIAA 3QFSA 3PPIA 1O0BA 3TQSA 3NB0A 3PQ3A 4YRBA 4J6EA 2G3YA 3TI7A 2VDKB 4ARZA 5D3KA 1W581 3NBUA 5BP7A 4D0SA 3MTDA 5IKEA 1TO2E 2QVXX 4DLPA 3OS2A 1SKYB 1SCAA 4G5RA 1Z4LA 3M8PA 4NICA 4YP9A 4CLOA 2Z2YA 1MOPA 2A4KA 4V24A 2VUSA 5CDSA 3I8XA 4JN4A 4GPTA 1I2DA 3VC1A 1IH8A 2BWJA 4GT1A 2YKMA 4IIGA 2PE5A 3U3KA 1T6BY 3MJEA 2Z9BA 1O08A 1TPYA 5AM0A 4D1YA 1UUFA 4W5WA 4ZKEA 4JT8A 4EZ9A 1U9YA 3AILA 4D7AA 4XTCS 3KBOA 4OY3A 2P4EA 5TT0A 4XB2A 2QORA 2NTEA 3OLQA 1YVEI 3PV8A 4PFKA 2HSZA 1FS5A 2JAXA 3IOCA 2UVDA 2E4YA 2QUAA 4GBMA 4Q37A 4MKIA 3AP2A 3M2TA 1U1GA 3VNSA 3OTQA 2FGKA 3CKLA 2ID9A 5ALHA 3MFYA 4LJSA 1KETA 1PYDA 1YV9A 3OKCA 1I01A 3G2QA 1O95C 2HKIA 3HR4A 3O9VA 4QICA 4EFHA 3RIEA 4RENA 1VQ7N 1XP5A 1QO0A 2H1WA 5BV2P 1HDIA 1CUUA 3ENOA 2JIPA 3L8MA 2HCJB 4MSUA 5TPWA 5K0EA 1GG5A 1NQWA 3RFVA 1FW8A 2WBLC 3ZVLA 1J8QA 4OUDB 2XQIA 1I3CA 4DSJA 1DKGD 1HG1A 4EGQA 5K99A 4NG5A 2XHBA 4G0MA 2GK7A 2PMDA 3I9V1 3QI7A 1C8BA 3DWFA 2PT6A 4FUQA 1UXHA 3LY7A 5FRDA 4DR2K 1SU8A 1K88A 3A32A 4UHCA 1XCMA 1PK7A 3ZS9A 4Q9DA 3ICOA 1A4UA 3GE1A 1RJEA 2D5CA 4H6XA 1CZAN 3TRDA 2I66A 5IJ9A 3ZQ4A 1A7UA 2XMDA 1J2YA 1HFKA 2ETJA 3U8XA 4Y7CA 3NEYA 3I37X 1QZUA 2EJVA 1X1BA 4FWLA 1AUVA 3VNUA 1XAHA 5AFUA 1D5WA 4X8LA 4FYMA 4ES6A 3RKRA 4F3YA 5KREA 2W90A 4B82A 3U7RA 3RWOA 4IQ4A 1DLJA 4IIBA 1PF7E 5ALMA 3QMLA 1Y42X 4OK6A 4ABTA 1P2FA 5COQA 1Z06A 2YIJA 2UZAA 4YP1A 3WFZA 3PVSA 4X1IB 3UKRA 4RF4A 4FCTA 4EJSA 1JXBA 3VU8A 3GDFA 2J5XA 1COWA 2JFZA 3OM1A 3B1KA 1E5XA 5FPDA 1CVLA 4AJJA 1A9TA 1M1UA 3HACA 1W25A 4F92B 2WMOB 4DUZK 2ZUUA 3NQ41 3EXFA 1P6XA 1GTL1 4MDAA 1Z3IX 2COKA 1AVTA 2HJSA 2O3SA 2X40A 3HCOA 3LZ6A 1N9GB 2GLXA 4YJKA 3VNBA 3PXUA 2XDQA 4CTMA 3FAZA 3LBNA 4DSIA 5FDFA 2G8FA 1Y7LA 2CZQA 4R41A 1L3UA 1DTTA 1QS0B 1VZ2A 2FSVC 2W6ID 1Q5PA 4XZ3A 4P4SA 4ITUA 3SF0A 4C6HA 1R0AA 1W5BA 5LDDC 3L0YA 4KI6A 4TKVA 2YJ3A 3EXAA 3V3KA 3PY8A 5AXCA 4EY4A 1RJFA 3O8NA 4Y2RA 3SJHA 2YC2C 4JQZA 1GG8A 1W30A 3EULA 3UO8B 5JYDA 1KP3A 4FW9A 4JFRA 3ZJ5A 3N2YA 4QU9A 2HUPA 4PKGA 1P29A 4HAIA 4R68A 3ADCA 3EIFA 4BZWA 1WABA 3CUTA 3DQZA 4YALA 1Y3AA 3DKIA 4HRAA 4R81A 1K8ZB 1Q0HA 2HSWA 2WJPA 2IEIA 3CYFA 4I1PA 1A97A 4YUYA 1OXBB 1VKRA 2E48A 1KEUA 1YZLA 4AQYK 2QEQA 1B42A 3QF7A 5FBHA 3LHSA 1UF9A 4TTVA 1Q7YO 3EUFA 1XP8A 4EY6A 1QJCA 4QGAA 4AMBA 1RDDA 4CL3A 1B26A 2WWWA 5C2JB 1NZJA 4M6WB 3JPWA 2D00A 3FB1A 4KLZA 3B1VA 1JHYA 4EPYA 1EEXB 4C7MA 4MRVA 2C4TA 4EVRA 3C8MA 4CCWA 2F17A 2F1OA 1TVEA 3LO5A 4YT5A 3C7AA 2ZJOA 3QEIA 3NI2A 3P4UA 4HLCA 4E89A 2ZBEA 4Y0VA 1IL0A 5I45A 2J30A 1OYVA 1S2LA 2JCXA 4X91A 3VGMA 1O94D 2D5AA 3LANA 2ASOA 2FTKE 3PA8A 1P0MA 2WA2A 4IVRA 1QH8B 1F21A 2XNKA 4WUTA 1VL0A 1YOBA 5F2NA 1NONA 1A2QA 2WM8A 2VHWA 3QPDA 2AI2A 3MAGA 2CFSA 4Y0AA 5IW8A 4ZGWA 1OJ7A 4JBHA 2F1RA 3PRHA 4OTZA 3A6HA 5FOVA 3AVWA 2AN9A 4A0QA 2DH5A 4MQ3A 1EDDA 4QVIA 3JD4A 3D6TB 3RS3A 3TTYA 1RD4A 1FIUA 1RBZA 2XUAA 1R6DA 3BUSA 4W8OA 1DO2A 3VN5A 3SM9A 3HA5A 2IYZA 4H4CA 1HKUA 1JVNA 1HM5A 4LHEA 2VSOA 3WGQA 3UIQA 3TCKA 1EVQA 3VJMA 3ZU6A 1H8HA 4J2DA 4EKYA 1P7CA 4NXNK 3WY9A 4JD2B 4R84A 5AICA 3VSAA 5JO0A 2HHUA 2IUYA 2RSLA 4ALJA 1ZOSA 1XDUA 2EHDA 1FZQA 2X6TA 1L5NA 4MI1A 1W97L 5HRNA 121PA 2UZ1B 3CRW1 2WD8A 3A0RB 5HE9A 1FDVA 1G5RA 4QYWA 2Q1YA 1QSGA 2PM8A 4GMJB 2VBGA 5AJVB 3GOIA 5HCIA 3EF1A 4Y2YA 5H83A 1WSDA 4P36A 4B40A 1C3EA 3VETA 4Q18A 1G7SA 5BN5A 3LLUA 4RJLA 3ANNA 4BWMA 1H2ZA 2JIZA 1RPTA 2GZ2A 2O2ZA 3BMOA 4GYJA 3EVFA 4FCWA 4B31A 5KQGA 3ZJYA 4DUPA 2BP7B 1YZNA 5B1SA 5T67A 4RL6A 1T8EA 4I4LA 1QVRA 4PEVA 3K1AB 2WMDA 5IABA 2CLEB 4Z54A 3WLAA 5KSOA 3BULA 5JJLA 2COUA 3Q88A 1JLKA 1XI2A 1O5IA 2HRRA 2UYGA 1VKHA 4JU8A 3UXEA 4PANA 3ZN2A 3P4XA 1CZHA 4IQFA 1HNVA 5FROA 4K8ZA 1RQ7A 4TM7A 5LYJA 4H4EA 3TLGA 1BA2A 2AQIA 1FBTA 1JL2A 2NADA 3ANLA 4BDSA 4I5FA 4CIFA 2VGMA 1ZH0A 4M3ZA 1D9FA 2NO9A 2HWYA 2K6GA 3LBIA 2ODEA 2QLLA 3C65A 2VH1A 4I08A 5E9QA 1YR8A 3LZJA 2ZJ7A 4KH1A 3SZGA 1PR3A 2I6SA 3C7NB 1Q7CA 5DKFA 2XA2A 2HGSA 3LLMA 4FZRA 1PV4A 3V6DA 2VBCA 2D1YA 3EZ7A 3B13B 4IO8A 2YFQA 3OCJA 4MQLA 5BT9A 3ZHUA 1JQKA 1L4NA 1Q1ZA 3UA3A 1GCUA 5AXBA 3OTIA 1OU4A 1QP4A 3IT1A 1X39A 4WZ6A 4D46A 4X7MA 1KRXA 2BGIA 3CQ9A 2BFFB 4TT3A 3WUHA 4DQUA 5BRNA 1Z2DA 3STYA 3VC2A 2OB2A 1CUAA 2C07A 3ZT1A 4HRVA 4CHQA 1ZXXA 4HWRA 3TZCA 2BRUA 2VWBA 3RRGA 4L4SA 4E2FA 1DQZA 3WVNA 3MD9A 2I7CA 3JQ7B 4ISCA 4KE8A 2OYSA 3D2FB 1NFFA 3F7NA 4QDTA 4TVKA 4BPRA 1LK0A 3LQKA 2J3QA 3G79A 3JQAA 2FOLA 4WOPA 5IX8A 2QJWA 1BVHA 1EAYA 1Z7YA 2JFGA 2HBRA 2XHZA 1YZFA 5C35A 1H85A 4YJ3B 3RS7A 3FNEA 3DO6A 3V9AA 2ZRGA 3MX2A 4C4ZA 4F9TA 5BUSA 1RTHA 2OT3B 1LV8A 2FYTA 1QIEA 1WMBA 5JVDB 3T4EA 4NV1A 5GJVC 5C24A 5ILGA 1FU8A 1ZI6A 3VHXB 2FPMA 4CZGA 4F3RA 1DQNA 1KVTA 5JD3A 3BCUA 3G88A 1WU8A 4N0MA 1O96A 4I4TB 1FXSA 3S2FA 3SNKA 4E5DA 2ORVA 1RJ9A 2DF8A 4L5AA 4C43A 4DFMA 2XLCA 2ZWMA 3MWJA 3T52A 1QG6A 3QEJA 4C7BA 3U44B 1KJIA 2BEWB 4FWRA 1N4DA 1JFRA 2BTQB 3FX2A 5HRSA 3H6KA 4P3YA 3RSFA 2AZ4A 5KSPA 4BVBA 3VYSB 5FEUA 1HNIA 2VUIB 3AEKA 3FTPA 4BRDA 2QU7A 2WUSA 1FP4A 3IEKA 2ON6A 3HNRA 2EP5A 1A4XA 3SQ4A 2CDAA 1YB2A 4O0LA 5DGDA 5IMSA 2HDOA 1TXGA 1KYXA 2AN4A 3T1HB 1RDWX 3NKVA 4BRLA 3KEOA 3IOEA 1G8PA 1M90O 4O44A 1C4OA 1KI6B 2BBOA 3O0TA 3AFHA 4XIJA 5AJYA 3A6ZA 1JFTA 2C9ZA 4LF4K 1PR5A 3OJFA 4B9VA 1QYCA 2I6FA 3IOMA 4S1PA 5KVQA 4RPKA 1PD1A 1XMOK 1I32A 2ZBVA 4GZLA 4S0ZA 5EESA 3DDHA 4M1KA 4YDSA 2DTUA 3WOHA 1QYXA 1Z56C 4D9JA 5HUQA 3BDPA 4CEZA 3LP2A 4NCAA 3KFVA 5K3FB 4DANA 2ZAIA 1A9XA 1HUQA 2QZ4A 1JH9A 3B82A 3HE3A 2UAGA 1O8BA 2JJ2D 4J7UA 4Z4EA 3TS1A 1G3IA 3SXJA 4KRFA 4K6OA 3PQEA 4GSKA 3Q3GE 1XVTA 5ALDA 1FTQA 3M82A 5A6SB 1W76A 4WXRA 3VUEA 2I5PO 2JJ1D 2JLCA 4IKEA 5BSGA 4MIYA 1XR3A 2WF9A 3HBNA 1QQ5A 4CM9D 5CJ2A 5JEEA 1QPBA 2FFRA 2AXPA 1ZXLA 1GKKA 3CCUN 1HG0A 2RG7A 4LHXA 1IQUA 1PWYE 3HUEA 4KPUA 4DV2K 3G4SN 1LBQA 1W6UA 3K0AB 2HQ1A 2J3HA 3AV3A 1U0EA 2J6CA 3D3KA 3D6VA 4BGAA 1QSLA 3H9JA 1QTMA 4KVAA 4ELTA 3TPZA 3QG5A 3VZSA 1FFAA 5GZ1A 2QWLA 4TMTA 3RSHA 4LDJA 3VQTA 2P6NA 3QBJA 1V96A 2GBPA 2VBIA 3A0UA 3OIGA 3K94A 4H9GA 1P4JA 1NXTA 1EFKA 5EQJB 3G10A 3P5JA 1MFPA 1Z0FA 1PGPA 4P3NA 1WP4A 3MUEA 1VJRA 4QXAA 3FFIA 4UHJA 1FCJA 1HEUA 5T4BA 2IHTA 4JD2A 4DUYK 2IHBA 2A1TS 4Q4HB 2GNPA 3VZPA 4EPTA 3QFUA 1N0HA 3UB5A 4QQKA 1E99A 3HXOA 1HX1A 3QA9A 4B43A 2B1IA 4WZAA 2BBWA 4TQGA 1GDTA 5E2AA 3GRKA 1RRCA 1CRLA 5EMMA 6AT1A 4M0EA 3OYEA 1AXRA 1MQSA 3AYZB 1ILYA 2N9UA 1PJ4A 3SQ1A 2A5FA 3C39A 4MJ7A 4YAOA 2IBSA 2I22A 3GWZA 2Q4EA 1E9FA 1HURA 5H4GA 4BWFB 2GTHA 1LFAA 1VBFA 2EIXA 2EC5A 2H4HA 2ZBRA 1RZ3A 3JWHA 3T1HK 5M1PA 1OD6A 3SHOA 2GAJA 3X1YA 1RT1A 1FP1D 2JD2A 4YNBA 2Q50A 4FJGA 2Q2NA 3A1TA 3TE7A 3WRYA 1J8DA