1YTUA

Structural basis for 5'-end-specific recognition of the guide rna strand by the a. fulgidus piwi protein
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
426
structure length
410
Chain Sequence
b'MEYKIVENGLTYRIGNGASVPISNTGELIKGLRNYGPYEVPSLKYNQIALIHNNQFSSLINQLKSQISSKIDEVWHIHNINISEFIYDSPHFDSIKSQVDNAIDTGVDGIMLVLPEYNTPLYYKLKSYLINSIPSQFMRYDILSNRNLTFYVDNLLVQFVSKLGGKPWILNVDPEKGSDIIIGTGATRIDNVNLFCFAMVFKKDGTMLWNEISPIVTSSEYLTYLKSTIKKVVYGFKKSNPDWDVEKLTLHVSGKRPKMKDGETKILKETVEELKKQEMVSRDVKYAILHLNETHPFWVMGDPYEGTKVKLSSKRYLLTLLQPYPIKPLSVEIVSDNWTSEEYYHNVHEILDEIYYLSKMNWRGFRSRNLPVTVNYPKLVAGIIANVNRYGGYPINPEGNRSLQTNPWFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(P*AP*GP*AP*CP*AP*G)-3'
publication title Structural basis for 5'-end-specific recognition of guide RNA by the A. fulgidus Piwi protein.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Rna binding protein/rna
total genus 125
structure length 410
sequence length 426
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02171 Piwi Piwi domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1ytuA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ytuA02
4HNRA 3KD1E 4YO7A 1U2QA 1LW2A 2QV0A 1S9EA 3SJJA 2CD7A 4JRQA 4B08A 2BGGA 5KC8A 1RT4A 4CGDA 3OJUA 1QO0D 4FM2A 4DLEA 4JS5A 1BDJA 3RH0A 2N9UA 1L3VA 3HL8A 1U47A 3RVNA 2YKNA 1RT1A 2FKAA 2P51A 4FLXA 3LP0A 1HYVA 3AVNA 1GUBA 3AA2A 1E6LA 1KLNA 5EWJB 1PHRA 3HJFA 1VKRA 3NF7A 3ZSVA 2D0AA 1I3CA 1JFSA 3AVLA 3LUGA 2GBZA 2V0NA 4DTMA 4MFBA 3LWLA 4F06A 5B3JA 2HHVA 4MR8B 4RV5A 2RF2A 4BDPA 3EQ2A 4NICA 3ZT4A 1ZH2A 2HQOA 3H08A 5C5CA 1W25A 4Q5VA 4BE1A 3NNSA 3NBPA 2G8IA 1SUQA 4B09A 3JY6A 1KRXA 2RKIA 2PUCA 1QMPA 4CHYA 4E1MA 3VQ6A 3KKRA 4WE1A 1BL3A 1SL2A 4LE0A 2Z1JA 4QOZB 3Q41A 4IG3A 3OLVA 3DMJA 1GUDA 1M2FA 3T8YA 1W9HA 3HPOA 4Z4FA 2PUGA 1QKKA 3HK2A 4N76A 1U2PA 3DM2A 1DZ3A 3O1HB 1S6PA 4M45A 4PICA 3H6HA 1HYSA 3DGEC 4JB0A 4JA2A 3V4IA 4XXHA 3P5JA 2YNFA 3V9UA 4FCYA 3QO9A 1D9DA 1KLMA 2OPPA 4F12A 3I0RA 4CJUA 4DTJA 3HP9A 1QQAA 3HSYA 3KIOA 5DLEA 2AJQA 1N6QA 3SV3A 1SKWA 4BWJA 3QESA 1ISRA 4FW1A 4RK0A 3LP2A 3RVLA 5TQ0A 2IDOA 2FEPA 2Z1GA 4CECA 4EYOA 3RMAA 1NJZA 4DTSA 2D0CA 1RILA 1DC7A 5KQLA 1QNLA 1LAWA 3LPUA 1A5WA 1VRUA 1SRRA 1B9FA 4F3TA 3C3MA 2FBTA 3HVTA 1U04A 1USKA 1C0MA 3MEGA 4OPJA 2DFHA 1JDNA 3LUHA 5IUJC 3PY8A 5IC5A 3F73A 5D2CA 1NK7A 4QPJC 1NXPA 3CHYA 1A5VA 3AO5A 1WSHA 5IEBA 3N75A 3CFYA 1J56A 3H1EA 3LOPA 4ZPJA 3T38A 2XY6A 4CHOA 4W5OA 5BRJA 1YTUA 4DQQA 1YK0A 1D2AA 1REVA 4JOQA 4KQ9A 3SUPA 1TV6A 4FLWA 3SG0A 3SAJA 1QO0A 3HCWA 3ZT1A 1JKHA 4E7PA 1HPZA 3SUOA 1T34A 3H1GA 4PWDA 1QTMA 3VA3A 4ML3A 2IYNA 1Z2EA 4MRMA 5BRAA 1TM2A 3P9YA 3PX4A 2TMYA 1XHFA 3W9SA 4UHKA 1M5UA 4CIFA 3H1FA 3UUGA 1O1WA 4CJPA 2DTUA 1DLOA 4CF2A 3NCIA 2NZVG 1Y97A 3AVAA 4CEOA 3ILHA 2L19A 5DGCA 3H5WA 1C1BA 3LPTA 1U48A 5I4CA 2RPIA 3HDGA 1K66A 4YNQA 1TAQA 1PUXA 3LZJA 2VG6A 3CFOA 3ZSWA 1U8TA 3K5MA 3GA5A 2P5OA 2GWRA 1YS7A 3NBMA 1RDBA 4CIGA 3F7NA 1X9MA 4L4UA 4F2RA 4M3WA 4PA1A 3IDOA 4E7KA 3QLUC 3HT3A 3LP3A 1TL1A 4IG0A 2LP4Y 1TK0A 4CHZA 3VQ7A 4OJRA 1Z26A 2L2QA 3SNNA 3B2NA 2BE2A 3LUKA 5EWMA 3NGYA 4FJNA 3T95A 4E7HA 2P9HA 4J2AA 4WXMA 3TAGA 4MR7B 1ZBLA 4N0PA 3NH1A 2FEKA 3OM1A 4DU1A 1EP4A 1CLQA 2MYUA 3NHZA 1QP0A 4EP5A 3TAPA 1TLFA 1S1WA 3N6VA 4MS3A 1MB3A 4CEDA 1EXQA 4F4KA 3GBVA 4GVMA 1KCFA 3SQ2A 2YV0X 4O0IA 2VG7A 2WJAA 4HHTA 4D6XA 3KTQA 3VNAA 4H60A 3AVHA 4G0PA 4KK3A 4CFAA 1QQCA 4O44A 4IILA 1B92A 2VG5A 1UA1A 4KI4A 4DG1A 3DGFC 5TPWB 1KFSA 4FLYA 3SI6A 4CCHA 4JP1A 1FKOA 1XI1A 1J54A 1QSSA 4FK0A 1B9DA 1NXWA 2QXYA 1T7PA 4DS4A 2QU7A 3M8SA 4KTZA 3L2QA 2IOCA 2LBPA 4FM0A 4E3SA 2OPRA 4Z9BA 2FC0A 2ATQA 3HO1A 1ZH4A 3BGRA 3SUNA 2HMIA 9ABPA 3RMDA 2QSJA 3OYMA 3KJXA 4MR9A 5HBMA 3TMYA 4LSLA 4XIUA 4DF4A 4KHSA 5ED4A 4I9LA 2A1RA 4N47A 3AA3A 4FLTA 1DBQA 3JVDA 2FXIA 5B3JC 4KNYA 1VSJA 4KHNA 3AA5X 2FBVA 4Z99A 3M8PA 4C8NA 2DRIA 3H75A 2Z1HA 1D4ZA 3L2UA 4RDCA 1A0OA 2PJUA 1F4VA 3OLZA 3PX0A 3UK0A 2ID9A 1RCHA 4RY8A 3AVIA 2G8VA 4RY0A 4W5RA 1ASWA 3CM5A 5EWLB 3QELB 1JL1A 4HNSA 4FZXC 3O2JA 1ZHHA 3M6MD 2Z1IA 2OZSA 4C8KA 4H4OA 4I2PA 3ZT3A 3ZSZA 4DTNA 3FFTA 4CF8A 5HRRA 2MSKA 4CHQA 1CXQA 1RT6A 2F96A 3OQNA 4LD0A 4CGFA 2P1JA 1VPWA 4CE9A 5FWYA 2NT3A 3M9WA 3OYAA 5FDLA 2Q3SA 4FE7A 4E0DA 4LSNA 4ID1A 3OO0A 2YHAA 2I6FA 1SXGA 3KK2A 1BI4B 5GQSA 3IPCA 1BAPA 4LE2A 1A2OA 1RT2A 2JLEA 4JASB 1LBIA 1NJXA 5KGXA 4KRFA 2QW1A 4JAVC 1NK0A 4G0QA 4CEZA 3KK3A 4LDZA 4S05A 4KTWA 3K4HA 3U6FA 5K14A 1NKEA 1P6UA 2RGYA 3DRPA 4C8OA 2IPLA 4WXEA 1Z17A 5KGWA 3LKBA 3T6KA 4IFYA 4KZKA 2LIVA 2XO7A 4M3TA 3KHTA 1Z13A 4JRPA 3WNFA 2HHTA 3IP9A 1E2BA 3QELA 2BDPA 5J2PA 2MSLA 3VQAA 1Z12A 3OMWA 1T03A 1LJLA 1BA2A 1QHTA 1S1UA 4YWHA 5HROA 4ZHRA 4B8AB 4HUGA 6ABPA 5CZ1A 4O55A 3JS5A 4RK4A 3DLHA 3JPWA 3PO5A 4KVFA 1FFSA 2ZE2A 1L5ZA 2O4GA 1D1PA 3I5AA 4M3XA 1ZBUA 3V6DA 3ASMA 1BCOA 3LAMA 4BDZA 4D6YA 4B9NA 3O74A 2JGUA 1UOCA 3AVKA 4W5NA 2B4JA 1WNSA 1BI4A 4YRZA 1ZGGA 4AHTA 5KI6A 3G1WA 5J2QA 3JVIA 3QERA 1NOYA 5IEJA 4XARA 3OYJA 5KWSA 3OQOA 5J1EA 1OXKB 4JLHA 3O3FA 3LUAA 4B8CA 4FJ5A 2EHGA 3RRHA 1EAYA 5CYMA 3V9WA 1UWBA 4CJRA 1DRJA 5KC9A 2FQWA 3CFRA 3RMCA 1K6YA 2PZSA 2ZD1A 3HZHA 1BIZA 3CNBA 4KHUA 2H3HA 1ZGZA 5HP1A 4KTQA 3KSMA 4QYWA 1HNVA 1ITGA 2FTKE 3VQDA 3KJVA 5IUNC 1TK8A 1KVBA 3CLKA 4O5AA 4W5QA 1BDHA 2IPNA 3QEMA 3LUFA 3B6PA 2WJWA 5GOTA 1Z16A 3QEIA 1TKZA 1QPZA 1UA0A 1HRHA 1WSGA 3MXIA 3A2FA 4H3KB 4DTRA 2Y1IA 3MEDA 3Q7RA 1F21A 1C4WA 3KLHA 2ZQBA 3ZSYA 3P83D 5TQ0B 3L6UA 4N03A 1EHCA 1T05A 3DBIA 4F11A 1P6QA 2ID7A 4OKKA 5KRTA 4N0QA 3Q9SA 4E7LA 4DFPA 1ABEA 5HQJA 2EX3A 1RTIA 1QP4A 5ABPA 1MIHA 3OYNA 1JWLA 4IFVA 2IPMA 1TMYA 2FBYA 4C8LA 3G0ZA 2FMFA 3EYZA 4GNRA 1MU2A 3KG2A 2FN9A 4HCBA 4CF0A 1E6KA 4N56A 4ZMRA 2PUAA 2CHEA 4RXUA 1HMVA 5KQMA 1NOZA 1SD5A 5TQ2B 1X1PA 5CNMA 1WSFA 5BR1A 3LAKA 4XAQA 3QX9A 3KCNA 1HJRA 3OYDA 1YT3A 1X9WA 1FFGA 4MS1A 2F8SA 4MRMB 4DN6A 4FLZA 4P98A 4EZ6A 3Q7TA 4Z0UA 4Y9TA 3Q7SA 2GUIA 4RW9A 3VQ5A 1BCMA 2G8FA 4RW7A 4C8MA 1C1CA 1JBEA 2QK9A 4KQCA 3DLBA 3ZT0A 3O2SB 2ZAYA 4LY7A 3ILYA 3MXMA 1NTRA 3HDVA 4AHUA 1YMVA 2IDMA 3G85A 3OLYA 3OYBA 2PY5A 1Q9YA 4L8RB 4ZTFA 4ICLA 2FSPA 1LWFA 4KREA 4FLUA 4ZMSA 4IF4A 3N0WA 3TI0A 2VWKA 3GBPA 3Q15C 1RT3A 5CZ2A 1IO2A 1GOBA 4RW4A 5C24A 3KD5E 3HV2A 3KLNA 2OQRA 4FJMA 4CGIA 3DLKA 2WB4A 4TLMB 4B9UA 3RVJA 1NXTA 1Q8IA 3BRSA 4AHSA 4NCAA 4IMIB 4CJ3A 5TQ2A 5KQGA 3NGIA 3VQEA 5F64A 1JLKA 4WWHA 5DK5A 3AO3A 1C0EA 3DRRA 2RN2A 4FJ7A 2BANA 4F3OA 1TL3A 1APBA 4BE0A 4M3YA 3CG4A 5EWMB 3GWGA 4G1QA 4O5BA 3N8IA 4MQEA 4MGEA 4FJ8A 3RR7A 3HXMA 2A9OA 5J2NA 3TARA 3SQ1A 4FJJA 2D0BA 3OYFA 3RWUA 2LSNA 4MS3B 2RDMA 2VWJA 2RJNA 2R7YA 3TAFA 5D3GA 2B6AA 4OGEA 2WONA 5HRSA 1NXOA 5KTQA 4RXMA 1NATA 3TB6A 1NJYA 1VSHA 4HUEA 1RBTA 3KKEA 3K5LA 2IOYA 3K57A 4XFKA 5IUKC 1VK0A 4CESA 3VQ9A 1RBVA 1DC8A 3I8DA 2QVGA 2XRIA 2XHBA 3L49A 4CEBA 4DSLA 3V1RA 4B9TA 3HYFA 4J2BA 3FFIA 4PZ0A 2QR3A 4OLAA 2ITGA 4MAAA 1KRPA 4F8RA 4BE2A 1JL2A 4HNQA 1C1AA 3OO1A 1WSEA 3OS0A 3DYAA 3R0JA 3DLGA 2X74A 1X9SA 4FJ9A 3NHGA 4RY9A 5FBHA 1HQUA 1DCMA 1BHLA 2JRLA 1H9CA 2FMKA 2R47A 4MR9B 2P5GA 4S04A 3L3VA 3QLTA 3TO5A 5T3YA 1DP4A 1RTJA 1JLQA 4EYQA 5JNSA 1IIBA 4XASA 2JB9A 3OYCA 2MYNA 4CEAA 2A1SA 3N53A 5IBQA 1TJYA 1CEYA 4CIEA 3WNGA 1RBRA 4KB1A 1T8EA 5DCLA 4LH4A 1XHEA 4IBNA 4NYFA 1TVRA 1MVOA 1WAJA 1D1QA 1D8YA 2IS3A 3VN5A 3AVBA 5CYQA 1SXIA 2JVIA 1R0AA 1FFWA 3SQ4A 1C6VA 3C3KA 1IKWA 3NH0A 1Q9XA 3QLHA 1U0SY 4KV7A 4FXDA 1NK4A 3SPYA 3PO4A 4FB4A 5HM6A 2J48A 2HHWA 2FBXA 3O1IC 3KYIB 1N5YA 3UIQA 4F8JA 4RK6A 3BREA 3KLGA 3QX8A 2W42A 5FWYB 5IULC 2PUDA 3MQ4A 1JXEA 2PMCA 3FDFA 1JX6A 3AO2A 3UKJA 3ZSRA 1GLGA 4Z0NA 3G10A 4UHJA 4FK4A 1C0TA 1WLJA 2HJ9A 2A9QA 1J53A 1VSDA 1DBWA 3IP7A 4DSEA 1VRVA 6CHYA 1PEAA 3T19A 1D5WA 4KO0A 4DFKA 3PV8A 4H8KA 2Y1JA 3OYGA 3JPYA 1WETA 3PUFA 4HVJA 3VQQA 4M42A 3C97A 1NKCA 2PYJA 1HEYA 1LBHA 4D74A 4CFBA 3CRNA 2OENG 4G97A 2GV9A 2X78A 3NGZA 5C25A 1ZESA 3O4NA 2FEWB 3OJSA 4NQRA 3SNKA 3ITHA 3HPHA 1SL0A 3NFAA 1VSLA 3ZSXA 2XY8A 1TK5A 2JVKA 2H0AA 1HYZA 3EJWA 3RVSA 3DOLA 1LK0A 5JS1A 3CZCA 2KZMA 4FJKA 1CHNA 1UAXA 4G0MA 4B9MA 2D5RA 1JLFA 4EGSA 3EULA 4RW6A 4CK3A 3O1JC 4NV3A 4DSIA 1JH9A 1WSIA 2JK1A 3EY1A 4NCGA 1EETA 2VUHB 3ROTA 4G0XA 2YKMA 1VRTA 1KFDA 4M3ZA 3NHMA 3S3NA 1WSJA 3NNDA 3H5VA 4KK4A 3V9SA 1C0UA 1S9GA 2LPMA 4RKRA 4FW2A 4RZSA 3CS3A 1RT5A 1S1VA 3C6TA 1JLAA 3QEWA 3OVNA 4MQ3A 4CEQA 4DTUA 1FK9A 4I9QA 4L85A 1ZAYA 3U3GA 1YTAA 4KAZA 3KTOA 4E1NA 1E6MA 2AYXA 4FJGA 2FQYA 2PUFA 5C42A 5TPZD 3DLRA 4JB2A 1FKPA 1FSPA 3I0SA 4CJEA 5E41A 2F8TA 2G8UA 1BDIA 3A0RB 3S99A 1JYFA 4KMRA 1UDRA 3C6QA 4CBVA 2IAJA 2FVYA 3QNNA 4CEFA 2E4XA 3C6UA 3OYKA 4FJHA 4DU4A 1NY5A 3OLXA 4PY5A 4DF8A 3VQBA 4E7IA 4FZZA 1U45A 3K2PA 2MSWA 1GCAA 2GBPA 2P4UA 1G15A 4Q6BA 4FJXA 1YS6A 3V9XA 3SZ2A 3LP1A 1D5AA 1MAVA 3QIPA 5FBKA 4LZLA 3QEMB 2O20A 3CYMA 3EQZA 2PAFA 2JVJA 4O1IA 5TQJA 4GPAA 3BRQA 1USGA 3HEBA 3MXJA 5JNUA 3L3UA 2OPQA 4B9LA 5FWXA 4P1ZA 5HSGA 2QKBA 3URMA 4AH9A 3A10A 1NK5A 2OZMA 1RT7A 2E4WA 1DJMA 4OPKA 2DFEA 1RDCA 3MEEA 2PYLA 1RXEA 1QS4A 3SPZA 5TE9A 3TAMA 3SQNA 1KSPA 4G86A 1YMUA 4RSMA 4OATA 5PNTA 3OYIA 3S3MA 1A5XA 3GL9A 3GRCA 3ZCMA 5JNWA 1M5TA 4E19A 4LE1A 1DBPA 4XLTA 1VSIA 1SKSA 3NE6A 3O3GA 3F6PA 1A04A 4LH5A 1ZDMA 3MIZA 2GX6A 2E6LA 4DQSA 4CJTA 4TLLB 1U49A 4CJKA 1NJWA 2HHUA 1LWCA 4CFDA 3D45A 1WAFA 4MQFA 4FLVA 3O3HA 1VSKA 3AVGA 4QAGA 2HVHA 3NF9A 4ETIA 4JS4A 1WN7A 1XHXA 4OLBA 1KTQA 1W0HA 1JLBA 4CJQA 3H5LA 1Y1LA 2R4QA 1NXXA 1FXXA 3OM0A 3O75A 4HCCA 4G0YA 3PX6A 1XWWA 4RK1A 2HVIA 5HKOA 2HB5A 3D02A 1JYEA 4HUFA 4IRXA 4MS1B 3OYLA 3LFTA 3BDPA 3T3FA 2G8HA 3I09A 4FE4A 2B1JA 3KS9A 4DLGA 2KFNA 3EZ5A 1S8NA 1RDDA 1TKTA 4KI6A 1Z15A 3M8QA 4MLCA 2VK2A 5T7BA 4RXTA 2PUEA 4CHNA 3KLOA 4E89A 4FM1A 4WZZA 2L17A 5TPZA 1LV5A 2QKKA 1DCKA 3WNHA 4DQIA 2DFFA 1DCFA 3ROFA 3HP6A 2WMYA 3RMBA 3SV4A 2ETJA 1B00A 3NH2A 4UQGA 1ABFA 3VA0A 3SYZA 4RWEA 2XY7A 8ABPA 3KLIA 3C94A 1P2FA 4YGXB 3EDCA 1XC9A 5KQPA 2FMHA 3H5IA 4EYGA 4DTOA 3BILA 2G8WA 1BISA 2IC3A 4PE5B 1BVHA 1KGSA 4MS4A 4CF1A 1IG9A 4TN5A 3ALYA 3OYEA 3MA0A 3OS1A 2PLNA 2E4ZA 2FMIA 4DSKA 3EODA 2XY5A 2KZZA 4EYKA 4DQRA 4Q6WA 1ASVA 4IGAA 1RTDA 4MYRA 1QSYA 4W5TA 3KYJB 2OPSA 3SQ0A 3A0UA 3QLVC 3ISNC 3K5NA 3TWHA 5I42A 3KLEA 4MQEB 1VSMA 3OY9A 1S1TA 3KLFA 4YS6A 3DRSA 4TMYA 1ZBHA 1TKXA 4Z4GA 4CJVA 5EWJA 3DLEA 1PNTA 3ZT2A 3NDKA 4K8ZA 4J2EA 5CHYA 1L3TA 2PL1A 4KB0A 2GKGA 4G0ZA 1KVAA 3L2RA 1ZYQA 4AHCA 4FJIA 4OKEA 4DADA 2YNHA 2E6MA 2HSGA 1URPA 3AO4A 4MR8A 4AHRA 4YFUA 2E4LA 2L18A 2KW4A 3QIOA 1L5UA 2DY4A 4H4MA 1ZBIA 4TSXA 4Z4HA 1DG9A 4CK1A 3WNEA 3FGZA 4HYEA 1EKEA 4KHQA 2M98A 3CTPA 1VSFA 5SZTA 5BQ3A 3A3KA 4Y1DA 3E3MA 3LUDA 1U4BA 2HW3A 4KKOA 2KTQA 4ZJPA 1USIA 5CY4A 3CFPA 4K8XA 1ZBFA 3D8UA 3M9XA 1PNRA 4YLEA 3HUTA 2VUIB 2QVCA 4CJLA 4WUTA 3K59A 3C3WA 3OMXA 2X7XA 2QXFA 2MYPA 1ZY2A 4DS5A 4QICA 4PEVA 4YCSA 1QSLA 2KYRA 3N0RA 5FRNA 4RU1A 1YVUA 3ULDA 2YHBA 4DSFA 3LZIA 1SV5A 4Z9AA 1Z18A 2CHFA 3LUCA 3RVOA 3M8RA 1ZN2A 5KRSA 1EWKA 1RNLA 4KHYA 4QCLA 1GOAA 2VYCA 4CJ4A 2WRZA 4PQUA 4CJFA 3LDSA 1RBUA 3HUUA 1RZRD 4CHPA 1QQBA 3NNNA 4E7OA 4BDYA 3O4QA 2HPHA 3P1GA 5DTEA 1RTHA 1ISSA 3LWMA 4KPYA 3V1QA 4DWIA 3QEKA 2X6NA 4CK2A 3QEXA 4OKJA 2HHSA 4M41A 3FMVA 4B3OA 4OG2A 1PEYA 3CU5A 4Q7EA 1HNIA 4CFCA 3RVPA 4EP4A 4OGCA 5JS2A 2HHXA 3E61A 1QP7A 3HVRA 3RRGA 4ELTA 4NCBA 3KK1A 2HNDA 2GI4A 2ZWMA 1KRWA 1J5OA 3H5TA 4EVQA 1BIUA 3ZSQA 3RR8A 1JHZA 1P8AA 2MYTA 3AVMA 1YK1A 3F6CA 2R48A 3AVJA 4FYDA 1JFTA 1IKVA 5E3JA 2HQBA 2OYQA 1S5JA 3CG7A 4GW6A 3QNOA 5DKFA 4O1HA 1RDAA 3IRXA 1LJUA 1XWLA 3QEPA 3K9CA 2WY2D 3F9KA 2IKSA 2PUBA 4RW8A 4FZYA 2FW0A 3EGCA 4CERA 5I3UA 4MLDA 3E01A 3TAEA 1BQMA 5JNRA 1S6QA 3HS3A 4FK2A 3AVCA 4N41A 3JYTA 1TAUA 4DTXA 1JXBA 4IMJB 2RJOA 3TD9A 1EFAA 2YNGA 1SKRA 3U3YA 3OYHA 1BGXT 2X6SA 5CNKA 3OS2A 1IKXA 3V9ZA 1NXSA 1TVMA 3MECA 2NUBA 3DOKA 1MB0A 3JSMA 1LW0A 1OXBB 4CGGA 1XHZA 3IPAA 1NK9A 4ELUA 3L2WA 5HRNA 4KFBA 1HQEA 3BBLA 4GMJB 3KKSA 4RG8A 1KMIY 5J2MA 5HLFA 2B4AA 3SUQA 1Z25A 2LUOA 1K68A 4YR7A 3HM9A 3B6OA 1L3SA 2XDYA 4CJ5A 1ZVVA 3IP5A 3IG1A 1DRKA 2HNYA 3QLVA 4LX8A 4CJWA 3JTEA 4IDKA 4KHWA 4FJLA 4O4GA 4DFJA 3V81A 1ASUA 3GT7A 4EVSA 3OQMA 4J2DA 4MR7A 3VNBA 2HQRA 3SCXA 2G8KA 2FLWA 1JLGA 1EX4A 3O2QB 2WWVD 3HPGA 4RKQA 3ZSOA 3IAYA 3OLWA 3LKVA 3LUJA 3MM4A 3CG0A 4MPTA 1RZRA 3VQCA 3THVA 5FRMA 3GV0A 3GYBA 1CYEA 4M3UA 1YIOA 3RVMA 2A9RA 4M3RA 4PYRA 4O0JA 2Q5CA 2A9PA 1GOCA 4B9VA 4Z4IA 1JL3A 1KVCA 4EVRA 3C95A 4CF9A 5EU7A 3LALA 4WT7A 4H3HB 3FFXA 4RS3A 2NT4A 4QYMA 3CQ8A 5TPWA 4DFMA 3VQ4A 3N0XA 4E7JA 4ELVA 3L2VA 4YV7A 5SWMA 3MAQA 4RK5A 5HRPA 1VLZA 3EAFA 2I5JA 3NF8A 4OTZA 4LDAA 3S3OA 3DI6A 3TX6A 3SM9A 4Q0BA 4I2QA 3O21A 3QINA 3LANA 2CWDA 4OVLA 4PUOA 1IH7A 1GCGA 1R8JA 5FWXB 2QZJA 1I3AA 1JDPA 1CZ9A 1EWVA 3SY8A 3TABA 3DZDA 3CKMA 4CEEA 2B5JA 1JLEA 3VQ8A 3RVQA 3AA4A 4AILC 4CJSA 1D9FA 1Z2DA 2E4UA 4BWMA 4LRQA 4M88A 1AB6A 2HNZA 2E4YA 3NAEA 1NK8A 1NKBA 3HSTB 4OBBA 1RPJA 1IKYA 1CZBA 5CNIA 4R5PA 4DQDA 4BACA 4NYNA 4DSJA 1F51E 2KFZA 1NK6A 1L3UA 1DTTA 5IX8A 3TANA 1TKDA 1NXVA 5EWLA 4MQFB 2PKXA 4FVMA 4N5SA 3RVKA 2IGIA 2FN8A 4IKFA 3IS9A 3D0PA 2PL9A 3LTEA 3S9HA 4Y1CA 3MF4A 4G0OA 1S1XA 3IP6A 4KV8A 3T1AA 3VQPA 3I45A 2AYZA 4ETNA 2JBAB 5FROA 4B9SA 3RVRA 4DU3A 3FFWA 2FQXA 1JF8A 3QLUA 2O4IA 1VSEA 4ZYLA 1I39A 3CZ5A 1J9AA 3K5OA 4AHVA 2KQ2A 3AVFA 1AB5A 2R25B 5JNVA 1RXIA 2FLKA 3V1OA 3H6GA 7ABPA 2IPAB 5JNTA 4KFCA 4CGJA 3TR8A 1M2EA 5CNJA 3QEVA 1ZITA 1QE1A 1FQWA 1SL1A 4ETMA 1L5YA 3AV9A 4DMNA 2M1ZA 3NF6A 4RK7A 3TAQA 4Z4EA 4F2SA 1EWTA 4YP9A 4Z4CA 1LAVA 2WOMA 3H5OA 4DTPA 2E4VA 1JLCA 3RQIA 2NZUG 3K58A 4HTUA 4EUKA 3MYYA 3L8BA 2PE5A 1BQNA 1RNHA 4DQPA 1SXHA 1RBSA 1JFVA 4EY3A 2OA8A 3AO1A 4ZTJA 3RTVA 2HHQA 3I42A 2JCGA 3QETA 3CM6A 3MMNA 1DTQA 5DMRA 3LMKA 5C5EA 1TGOA 3QK7A 4MS4B 4CGHA 1CXUA 1LWEA 2YNIA 2JBAA 4EZ9A 4I7FA 4ID5A
chains in the Genus database with same CATH superfamily
1U2QA 1LW2A 1GQOA 3A36A 1US8A 1N9GB 1M2KA 1NN1A 3LXMA 1QH8B 1FFCA 5J1TB 1NUUA 4GKKK 3ZHXA 2N9UA 3EVZA 5JDCC 1CNEA 1E2MA 4IL5A 1CUCA 3CURA 1E3WB 1GUBA 2O2YA 5BT9A 3HJFA 1NQOA 2B83A 4DYVA 5JXJA 3CSSA 5FOSA 2AEFA 2A5YB 4BG9A 4PU0A 3HB4X 3GT3A 2BEJA 4UEOA 3B7PA 4QBGB 1JZQA 1CZLA 1KC3A 4R3UC 2ZJ0A 4BN0A 1QMPA 1NJGA 5IFKA 2CYBA 1TU0A 3NHKA 1UAGA 2BKXA 4UU1A 1GGHA 2I4TA 4EG1A 2PSJA 5FI5A 1GCOA 1TF2A 4DMKA 1C81A 2Q27A 3UT5B 4RTPA 1XCBA 1UZUA 2R00C 5LQJA 5LJLA 4L9SA 3VPFA 4ZIRA 5AJTA 1UMDA 4YMLA 1NUSA 2QUHA 2YQ4A 2A57A 3WB9A 3V1MA 3GJZA 5DLEA 4ER3A 1I5RA 1AV7A 1MP0A 4IV0A 3VEYA 1E2GA 1J9ZA 2FEPA 3WAGA 5KQLA 2XJ9A 1SRRA 3GEDA 2P2YA 3MEGA 4EDHA 1XEFA 2A92A 3V4FA 1F5NA 1J8MF 3AO5A 3KSDO 3X44A 4WK0B 4D9EA 1OWNA 3ZS8A 3EYWA 3SUPA 2UZIR 2IS2A 1KAMA 1JKHA 4GMXA 3P38A 4NAUA 3GVHA 2MSEB 1XHFA 2WU4A 3HCEA 1I3KA 1A7JA 2COEA 2H1FA 2BDTA 1Q0TA 2ONKA 4H7EA 3ZHCA 1PDVA 3QVXA 3UENA 1PR2A 2VFAA 1W30A 4A59A 3H5WA 2J33A 5A0VA 2RPIA 4MROA 1G7CA 4G1MB 1ESMA 3RNOA 2OPBA 2O3SA 4FXOA 4JQYA 4IDFA 4BEBA 3A58B 1H6CA 3WE7A 1TCAA 4QC2A 5C8YF 2VHUA 3S8EA 5G0WA 1OREA 5DT9A 2HDWA 1BWQA 3NDJA 2JJMA 4JLDA 3DMGA 3KBBA 4LC0A 1Z0DA 2UYHA 4YRAA 3BFXA 2Z5LA 3AOGA 3AERB 3DL0A 4WDQA 1WMBA 1P80A 4AULA 3CJ1A 4NOLA 1FP2A 5EWMA 4E7HA 2FF7A 1U7UA 4LSZA 3O08A 2NXEA 1EK0A 1ZBLA 3OM1A 3S81A 4BWVA 1EXMA 2MYUA 4P7GA 5AI6A 4UUPA 4E5VA 4F8EA 4C7XA 2D2FA 4DR6K 1FYVA 2PGXA 3J7AC 5M1KA 3U3JA 4A27A 1M8JA 3BA1A 1Q0UA 5JMTA 4KK3A 3D4BA 3W4JA 2I2WA 3OH8A 4YDRA 4FWNA 1HDRA 4JI1B 1LF5A 4RL4A 2CFSA 3DMYA 4YEDA 1OLUA 4V2UA 5LSAA 2Q0UA 4Q5IA 3MWPA 3KHYA 1NXWA 1U0NA 1MJGA 2OM2A 3BMCB 3DWGA 1FVXA 3SQWA 3AM4A 2PRIA 1ZVMA 3AINA 2GM9A 1T2AA 1WM1A 1Q77A 2WC9A 4PXSA 2YJFA 2AF4C 3VTIA 2RI6A 4JMLA 3NATA 4CCAA 4RDCA 3VEZA 2CLDX 3AHGA 4INZA 1PL6A 3Q3VA 4F3YA 2A6AA 2AE2A 2ZRNA 1T9CA 3TTXA 3H42B 2YIVX 3QNWA 2Q6VA 1KIAA 4IJQA 1XDWA 1Z4MA 4M55A 3BERA 3NTXA 5IC6A 5BNIA 1RT6A 1FU4A 1WXEA 1R0KA 4E08A 3FOZA 4XJVA 3TW0A 3PGA1 3FJ1A 4BRQA 1TT7A 1B0ZA 1ZOSA 1VKOA 5IVIA 3HKEA 1K5PA 2DM6A 1FYXA 4KVGA 4LC9A 2WC1A 4HAXA 1ESCA 4KTWA 3UJPA 5J5CA 5BWMA 1EXNA 4LCJA 2HB6A 1S6YA 1JWAB 2ATCA 4QUGA 4NS4A 3I04A 2RKOA 1Z13A 3M1IA 2H4YA 3OQHA 2PRKA 4ALLA 4N5HX 4D9GA 4QGHA 4UTRA 5HFAA 3E3AA 4QDTA 3OT1A 4JHXA 4YRMA 4U7BA 1CUFA 3K73O 4CPDA 4NZZA 1J5PA 4CT4B 3Q6NA 2C4VA 3HUEA 3WK9A 4BVHA 3NYRA 3H5AA 4KBGA 2DT8A 1UOCA 1Z8DA 3DUFA 3EASA 1I3NA 2B4JA 3C85A 1IMJA 3DP9A 4YRZA 2FVXA 5B2EA 2BN4A 4PYKA 5F78A 5A4IS 2PTGA 1TGYA 4JLWA 4M8SA 4B8CA 1EAYA 3V9WA 2UVQA 2GTIA 4D92A 4XJSA 4Y2VA 4CQMA 2YVLA 1MX9A 4PHTX 2V8BA 5JD4A 1EFUA 1MFPA 1X7GA 1XU7A 1R5OA 1KK2A 1WOMA 1PN3A 4KKXB 1F9EA 5DI9A 1T8SA 2H9YA 4I19A 2X8JA 4RETA 3DWEX 3UW3A 3GN1A 3A2FA 1KK0A 4HDKB 3ZWWA 2O8EA 4FMCB 4LJYA 2PH1A 2B9VA 3T54A 4AX4A 4EARA 5CEJA 5HUHA 2PKQO 3DLCA 2Q5FA 2FPOA 3FNRA 1FY2A 2JCSA 4K6HA 2E1PA 2BFFB 3COJA 1JPVA 1QP4A 1ID8A 3VR3A 2IPMA 4JBYA 1PZGA 4QDUA 1TTTA 1A95A 5JU6A 5SY9A 3LX6A 5ETJA 3UG6A 1K4YA 3W2EA 4CM8A 3WWEA 3BWVA 1A8UA 4TTAA 1LC0A 2P2ZA 3K30A 1Y4DE 2GAJA 5J63A 5EY4A 3GOIA 3HRGA 4TV9B 4Q37A 4GMGA 3W8EA 1WNTA 1Z8FA 1GAJA 4BNYA 4DN6A 2W58A 1J8QA 1SEPA 4W9NA 5KZMB 1SVOA 4P98A 5DSTA 3BB3A 1E64A 1VJ1A 1P0IA 1RABA 3VQ5A 2OUKA 3GBSA 3VJLA 2QTAA 3BBPA 4UHCA 4DV6B 4AJ2A 1Y1SA 4RF4A 1G41A 3D6VA 1RKBA 2VI5A 2YS6A 5C35A 1L0BA 5LZ7A 1U81A 3KDAA 4HAOA 4L8YA 4L8GA 4DG8A 4CGIA 1MTOA 4C06A 1QTNA 4MV5A 3SI7A 4XA8A 1I6MA 4JBXA 3DRRA 5IABA 4DLNA 5AZIA 3CG4A 2VF5X 4G1QA 1S4QA 5EXWA 1VA5A 4W82A 4TMKA 4D79A 1W5TA 1ZUNB 1G3UA 3DMTC 3DJCA 1RAAA 1SG6A 3H7IA 1GZ7A 1UOEA 4FJJA 3IEUA 5FCDA 2FZ5A 3PGMA 3SSAA 4GBMA 1HDYA 2RBEA 3FW1A 3BK2A 4NZNA 2PD6A 3U9ZA 1HOTA 3L6BA 2FSVA 4CM3A 5HPYB 1RDUA 3ZGNA 3OIGA 2YWGA 1B0UA 1VHWA 1KZ1A 4NARA 2FK7A 3GDWA 3DE4X 1GVHA 3CLTC 1RBVA 4CF3A 1O0CA 1J22A 2QLMA 5EJEA 2H4FA 3HKBB 3MWKA 3OCUA 2O0KA 3AH8A 1WCIA 4Y2QA 1Z4QA 4II7A 1EM8A 3KPJA 2PYDA 2ACWA 1VKNA 4BCDA 3H4MA 4CZFA 3PC8C 4L28A 4MR9B 2OPHA 2C4UA 3EUFA 4LYJA 4CDNA 3ZW9A 1VCOA 2EIHA 5BWLA 2ZIXB 3WRXA 1QG2A 3HN2A 4B1XB 4NPAA 1EP2B 4C7VA 4DOMA 1S2LA 4U9UA 2V52B 3PCTA 3VNSA 3BDVA 2WUEA 1XMVA 1G66A 5DCLA 1TUEA 3T9BA 3L3BA 1Z33A 4BFCA 4EHBA 1D1QA 3QVKA 5IAAA 2JVIA 1H66A 3DTTA 2HGSA 3LW8A 4PR3A 2NUPB 4DVJA 3KQTA 1PGQA 2AFRA 5KYWB 3KWIA 5KYUB 1EQUA 4L7QA 3GFSA 1JPUA 4BMVA 2QVLA 2RIPA 5B58T 2ZI5A 3E7WA 2IK8A 3MQ4A 4QXRA 1WB9A 3UJ9A 1F0KA 2B30A 3CH5A 3GY0A 5C1OA 1QZUA 1WA5A 2WAMA 3M7IA 5EKTA 1M2VB 4HH4A 2A9QA 1OIXA 1E1YA 4QVKA 6CHYA 4J4TA 1QV9A 3Q1LA 1E9AA 2Y1JA 3ASZA 1Z7WA 1WETA 4NBWA 3L7JA 2A1UB 3BFKA 3F7MA 1CCWA 4MARA 2EYUA 3AU9A 1I1NA 3N2ZB 2OZLA 3QRWA 3DVQX 1QHXA 2X78A 4F0JA 1U7DA 1SL0A 1JDBC 3B7WA 4R9RA 4PHFA 2FYTA 5FLYA 3AY3A 3CZCA 1RLJA 1SQ0A 5M1NA 1RRVA 2H06A 1MDUB 4JAXA 4QQRA 4CV0A 1Q22A 4FZRA 3NW9A 2OOKA 4KK4A 5JQWA 1OH5A 3OE7A 1YZKA 3KQMA 4GZ3A 3BSSA 1N8TA 2RH8A 4DTUA 1RLUA 4LISA 3W79A 2HT6A 4FJGA 3DXMB 1OPRA 3DDSA 1U63A 2P2NA 2HLPA 4RF5A 1EX6A 1ZI8A 2ZQYA 4ZOEA 2JIOA 4R9SA 3WGJA 3QNNA 1Q1BA 3F4LA 2MMGA 4KYUA 4D9KA 1LSSA 1CVRA 5EKUA 1GJRA 2F1IA 1HDOA 2FF3B 4TTTS 1ZOOA 4D0SA 2FWPA 3GDQA 4O4LA 1G9XA 3EQZA 1V0JA 2BUCA 5TQJA 3ZV5A 1HE2A 2B8NA 3P9IA 3AKYA 4RV9A 4L5YA 3KUKA 3Q7EA 5EMLA 5FFNA 4MV6A 1BGVA 2I6QA 2O5CA 2PYLA 3VZSA 4YQEA 4CV3A 1TIPA 4BNKA 5PNTA 3GL9A 1NPDA 1M8FA 1JKJB 1AS3A 1TUIA 2OBLA 3TCNA 3D7MA 5IYZF 3JZFA 5DNVA 5KYKA 1GSAA 4XM2A 1BZYA 4CKBB 2G7MC 4UBKA 1GPBA 3YASA 2DMRA 2JFZA 3ZWMA 2PVCA 1KTQA 3WZMA 2NQTA 2WT9A 3U5TA 1VRWA 4WFKA 1PWZA 2QAIA 5H3HA 2GCIA 3BC1A 2VEDA 1VBFA 1TC2A 4MS1B 4PXYA 3TSOA 3GMSA 2VAPA 3NX4A 4HDOB 3H45C 1RDDA 1GKKA 2QGFA 2V6IA 3JQBA 3M8QA 1QBKC 4M1TA 1ODLA 4E89A 4G56A 1LV5A 1JT9A 3U3ZA 4BQEA 3I58A 1W19A 3VR6D 2ECOA 1M8GA 4I6JA 5KNBD 4UQGA 4YRBA 2H9AA 1R8QA 4RD1A 1GQQA 3SYZA 4F92B 1H8HA 3O2NA 3O8NA 2HTFA 3E8SA 5F5XA 1QFYA 5KCMA 1WCXA 3IAS1 4D98A 4ZEMA 2D4WA 4DTIA 3IE2A 1J0EA 3BFPA 4TN5A 1IDN1 2DT5A 1Z2NX 3ENWA 3T9DA 1LEHA 4DSKA 4M86A 4YXWD 2UUCK 1E59A 3SQ0A 2WJPA 4LBWA 3K5NA 3OF5A 3SQDA 5ESDA 3IAEA 4N8EA 1VSMA 4A57A 3L4EA 4YS6A 3WBJA 1DQPA 1CTQA 4HFJA 4TVSA 1ZYQA 3V42A 2YNHA 3MCAB 1VXOA 4RIHA 1DU4A 3ETDA 2KW4A 4RDHA 4ZI7A 4C6HA 2GFQA 1ISFA 4I1YA 4MYHA 3TCXB 4RIEA 1VSFA 2VKTA 2D1YA 3B2EA 4JOCA 3KL4A 1XAIA 3ND9A 1LX7A 3E35A 3MCWA 5ECGC 4LY6A 3Q5EA 3FSGD 4BR4A 2C5SA 3PKZA 1LDBA 1MXFA 2FF5A 1RFLA 3GB9A 1MG5A 2YHXA 1KH1A 2XB4A 5DX1A 1QSLA 1SOMA 2XMPA 4JIMA 5FRNA 4LQ4A 3IT3A 2BKLA 1V41E 2YHBA 1TU3A 4QPDA 1TVKB 4QTXA 1CJKC 3F5MA 3FLAA 2ENWA 1RNLA 2J5QA 4ETWA 3HVKA 2VYCA 3UOAB 3LDSA 4CN8A 3EE9A 1Z5GA 1K6JA 1NPYA 3LWMA 1OKKA 2HAEA 1YR1A 2RHCA 1QYIA 1D6JA 3KPUA 1X7YA 3X3HA 1A5BB 2NNLD 1K8XB 2N42A 3GGJA 2GPYA 2VPQA 3C0BA 2GBLA 3P26A 2V4UA 4G8BA 3ADCA 3U19A 1WMFA 5ARBA 1BIUA 4V3BA 3RFUA 3QEBZ 4RTLA 3N7UA 1NVVQ 3AVJA 3EMDA 4PTYA 4X6XA 4WEQA 1JFTA 5E3JA 1YJWN 5BNTA 1GL3A 3W3ZB 1CNFA 5GIPE 4BX3A 1RDAA 2WUGA 4EUEA 1YE5A 1LJUA 4KIFA 4OJNA 5I47A 4NV1A 3BH0A 1N7JA 5LQSA 5E26A 4AKTA 4ON9A 4W5HA 4FK2A 2XR1A 1RQRA 1L5KA 3TD9A 3WL8A 4BRNA 3BB1A 1RPAA 2XCIA 1BGXT 3S1AB 2RBGA 5JMWA 1IQRA 5TT1A 3P5SA 1EFVB 1ZXXA 3D43A 3HVIA 3LH5A 1K63A 1GL7A 1TE2A 4E4RA 2HA6A 1TPZA 4RQUA 1M34B 1I2MA 2HA5A 4OP3A 2GZ1A 2WG2A 1JMKC 4J76A 1QTRA 5I7VA 3G2JA 3R6DA 1E2NA 3JTEA 2OP0A 4HWKA 1V8PA 4HWTA 2FZLA 4EVSA 3IR5A 3A6LA 3WGMA 2R6ZA 1HL7A 5HK8A 5AKHA 2HQRA 1MD9A 3WXKA 4UM9B 2BGMA 3ZW8A 3IERA 1Q20A 4BNDA 4H5TA 3BORA 3OOJA 1K97A 2R9VA 2VYND 3QMMA 3THVA 2I7TA 1CYEA 4M3UA 2OR3A 3QVSA 5LQRA 3GFTA 3NT5A 3F4KA 3LTNC 2XDQB 4O0JA 2XYHA 4RTQA 4DQ8A 5JZ9A 1KVCA 2EATA 4B81A 3ODGA 2J41A 5A5DA 3MT0A 3EF1A 1EDEA 3N0XA 1YZFA 2P2DA 3V4SA 2PEYA 5SWMA 2GEMA 2NSLA 3VF2A 1AN0A 1LQTA 1NRWA 3JQDA 2F8MA 4G09A 4L3VA 3HADA 4FK8A 2GTPA 1TK3A 4R1QA 4I2QA 4HWOA 2YINC 1YRLA 1CZ9A 4FWSA 5E6RA 1NMNA 4KUGA 1XEWY 1S8OA 3U4DA 4AK9A 3KCQA 3CX8A 4DKJA 3I4CA 3DM5A 3ESYA 4BWMA 4BVAA 3C5EA 4JOSA 1AB6A 3F0TA 1T2DA 3M1YA 1Q6ZA 1X1AA 2JLRA 4DSUA 4LVUA 4W1QA 4V0RA 2VATA 4G4JA 4IW3B 2N3ZA 2PAVA 1RQ2A 3GARA 1Q2XA 3TW4A 1OC4A 2ZPAA 1K7FB 4FVMA 3IT1A 2CNNA 3D0PA 3EK2A 3REQB 4ZYWA 4KUEA 1CZUA 2BI4A 2G0AA 1RWNA 4JLNA 4TXLA 3TBHA 4NYJR 2AOTB 2JI9A 1J9AA 1ZLYA 3AVFA 1PG0A 5JJKA 3D6JA 2XSZD 3DAFA 4CDMA 4CKZA 5K4AA 4TUYF 4TV8B 2OQVA 5BYJA 3WGQA 1M2EA 1VJTA 4XKJA 5K8VA 1NBWA 4WK4B 4X93A 2H4XA 5JC1A 5A5EA 3H5OA 4DTPA 1C7RA 3B82A 4ESVA 4L4ZA 2CV2A 2OA8A 4D0RA 4IUYA 3I2KA 1GA6A 4C29A 4IOJA 1CXUA 3DZHA 3WA6A 2G8LA 4I7FA 4RV5A 1CJSA 4HNRA 3B1KA 3K1JA 3DOFA 4B08A 2GAAA 2VCYA 1RT4A 3D4LA 3BL5A 3KTAB 3PEVA 4EEZA 1ZN7A 5UKDA 2HA0A 2WSSD 1JEQA 1Y3BE 4RTKA 5AW3A 1L3VA 3UPUA 1XLUA 4J16C 3A9WA 3AGRA 3KDSE 1NLZA 4YJDA 5HEKA 4JGGA 3AVLA 3EEQA 1XI2A 4KO3S 4ER6A 3E9RA 1SQ5A 4XZ3A 1Y7IA 5F35A 3E8MA 5ER6A 4JYZA 4NMLA 1L4LA 3T7EA 3RGWS 1ZWLA 2JFXA 2O1XA 1ZD4A 2J9ZB 5D6OA 3FR7A 4HDMA 4NDNE 1NP7A 3DE1X 4OSPA 1V16B 3RIEA 1W9HA 3LQ4A 3R8XA 1ZD3A 1X7DA 1M2GA 3I76A 1W73A 2KM1A 1SUWA 4LXGA 1YUNA 1UXHA 3OPNA 4TXNA 5BORA 1JHDA 4RJLA 3WRYA 1JHUA 4XXHA 3T7SA 2B36A 1SZDA 3UB5A 3ETCA 3ELYA 1D9DA 2OPPA 4CJUA 4DTJA 3EPLA 2VSFA 2WJYA 3L18A 2O54A 2OO3A 1SKWA 2QN8A 3QKRB 2WWXA 3U4HA 4BR9A 1RILA 4RQAA 2XADA 4RUKA 2PH5A 2EP5A 1L8XA 1FVHA 1KI9A 1NVVR 1A98A 2Q4OA 4WJZA 1P77A 1Z2CA 1MJHA 5U4XA 3F73A 3NC0C 5J2UA 1K7XB 3VR0A 3CHYA 5AIAA 1NHGA 4PAWA 2GHQA 4ZOLA 3P8ZA 4TRMA 4KXLA 5IT9A 2YWHA 4UPDA 3VPBA 1EM6A 2JFOA 5ALXA 4UNRA 3A3YA 1GKYA 2E82A 3CERA 5LNK1 2Z6QA 3JASA 3M4NA 3OX4A 3VU9A 5DYYA 4B7ZA 3HXPA 2EQAA 3G17A 2WJGA 3DO8A 1NW5A 4S24A 4CIFA 4A36A 4CT5A 4OOFA 1DLOA 2WHPA 1DKPA 5FLXO 2GETA 2EG5A 1GAQA 1GR0A 4MWCA 2PT5A 3LNCA 5E6UA 3FWNA 5F77A 1ZUD1 3ND6A 4DUPA 1IEVA 5FBWB 4ZVOA 5EP2A 4TXMA 1T9ZA 4TZ6A 3DW1X 4BR2A 4IS2A 1KYVA 3EOAI 3IX7A 3PSFA 1HTTA 3ON5A 2IXBA 3QLUC 1K8QA 2JIZD 3IAS6 3TUZC 1VSVA 3KWJA 2I22A 3HBMA 1L9XA 3AR8A 3T95A 3K1AB 1C2TA 5I9BA 3L4IA 4EY6A 1CXZA 4D9FA 3NH1A 1QS0A 3PDIA 4ASUD 4BRFA 3EGDB 1ACLA 2FWAA 1NM1A 1S1WA 3N6VA 3ZE0B 2G9ZA 3AIOA 1L4UA 4WADA 2X0IA 4ZOBA 5CLHA 5D3KA 2D0OB 2H31A 1XQ1A 3KTQA 3WIBA 5H16A 1SZPA 1J7JA 1MQAA 4C0SA 4LI3X 2CFOA 2G1PA 4RGBA 1YI8A 1GR1A 3BWMA 3DGFC 2MOKA 3PQ5A 3O9MA 2AG5A 3VHRA 1H1LA 4TWAA 3I73A 4QUHA 2FGJA 4FGLA 2COUA 2IYTA 1OX4B 1M7BA 3C6MA 1AT1A 1CUVA 2ZATA 3V3KA 1B6GA 1J07A 4IJUA 5KX5F 3T1QA 4US2R 2EX1A 2AZ4A 2J9FA 2XH8A 2RG1A 3NZEA 2NIPA 1DQRA 1VBMA 3A27A 4JKGB 4D4JA 2Y1WA 3B6IA 2AN4A 5K8LA 3JVDA 4U2KA 3WDKA 1TZJA 1NG1A 4DUZB 1SBHA 2CMKA 4M0MA 1L3BA 5JECA 2X42A 3U4GA 3NC4A 1V96A 3N9IA 4UEKA 4O2AF 3D8RA 4Z9FA 2C57A 1QU3A 5ALWA 5JZOA 2OZSA 2WHQA 3D54D 1ZK3A 4NESA 1V1MB 1E92A 4UTZA 5H59A 1CXQA 1AXGA 4NSNA 1T8PA 4NAHA 4OLJA 2EAUA 3CJAA 1YVNA 5E8JA 3WWZA 1JHAA 4IHKA 4E2WA 4URXR 1SXGA 1BI4B 2J0UB 4IIJA 3O8BA 4JT8A 4NCJA 3B85A 2E4AA 1A2OA 5CCEA 4GX1A 4FDAA 1NK0A 3ZJVA 4YIKA 4B71A 4CEZA 3IQDB 1S9DA 2BFMA 1EKXA 3DOUA 4PZAA 4RZXA 4TKUA 4KW7A 4WCEL 3NONA 4DMLA 1E2BA 2HHTA 4KG7A 1SU4A 1H2AS 4JNKA 3OMWA 4G9ZA 5CZ1A 1DXOA 1PZMA 1RHRA 1U1GA 2AUMA 3I5AA 4H0YB 2W6JD 1RMTA 4D3FA 4DR4B 3ZOZA 1GYQA 4D6YA 4HVTA 3AVKA 4KI7A 5ALHA 1KEKA 4M9CA 1WNSA 1E89A 3HPQA 1XEWX 5J2QA 3TTYA 3KQHA 3MLAA 4BLRA 4F1WA 4QWMA 1I3OA 4F1JA 1NVMB 4A7PA 1R4MA 3LUAA 5HILA 3F6YA 1WB5A 1O97D 3OAAA 4KHUA 3ILVA 2WQ6A 2BZSA 2FN3A 3TI9A 2HBKA 5AQXA 1QHHB 4PS0A 3AESB 3MWJA 5DYGA 2QM1A 5J4LA 4PAMA 1ESDA 1SKQA 1C7QA 2Q07A 3M8KA 2PA0A 1CBUA 3CCLN 3CRMA 1BROA 4XQ0A 5IUNC 3GJ6A 3GLFE 5BMOA 1KVBA 4TSFA 4G84A 3LUFA 3FUXA 4MI9A 4QJ5A 1E62A 2VAMA 1J90A 1IY1A 1WSGA 2WF7A 5DBFA 2CMDA 5L4LA 3CIOA 1Q7GA 1SCDA 3PE3A 2PPVA 3GRPA 4EPXA 1C4WA 4DDHA 4G85A 4F11A 3RYIB 2CNWD 3OZIA 5KRTA 1CDDA 3U0BA 4CCYB 2ZWIA 4JP8A 1NBHA 1QQMA 1QCDA 4G1VA 3OZXA 2XKAA 5D5PA 1SC9A 3TEMA 3UK2A 3IHKA 1MU2A 4JYAK 1LVHA 4HCBA 1WL8A 3LBAA 1T0IA 1S3IA 1SD5A 4NXMK 2P1ZA 3MBIA 1UBLS 2FJUA 1AK2A 1JZTA 5EP4A 1CRWG 3CF4G 5JS7A 2P5SA 4E46A 2ENUA 4AJPA 3P9CA 5DCWA 4W1PA 4IO8A 1T5SA 4ZYYA 2G8FA 1Y8QB 4K0KK 3CZ9A 2EC5A 1FMLA 1T15A 4NBUA 5EIAA 1E2UA 3HDVA 4IGEA 4L8RB 1Z07A 4WLOA 3ND7A 4CV2A 4YNBA 3FRJA 3W8FA 3GBPA 1IO2A 5C24A 3GCGA 3UPDA 4CRWB 2UZ1A 2ZJ8A 4QASA 2O8FB 2ODPA 2OAP1 3N2GB 1C30A 3T7IA 3HY6A 1DRWA 3FM9A 4EO4A 2K7FA 2WKSA 4X91A 1NJ2A 2W11A 3IUMA 3GJ5A 3GBTA 1ZKDA 1Z3CA 3LCJA 4PGAA 4B34A 2VDJA 1NGGA 4EFMA 2IZZA 4F5WA 2PGDA 1N34B 4TWBA 2DFNA 4OGEA 1UR5A 3C45A 2Y92A 3N76A 4RS4A 2X76A 2HREA 1ECPA 3K5IA 3QTLA 3KOOA 3M3ZA 1XZBA 1NJSA 2J1LA 3Q8WA 3IOYA 4JQCA 3EC7A 3OE4A 3K57A 2R7NA 1XRLA 3VQ9A 2ZRPA 5J1SB 2D0PB 2AG0A 4NJMB 3GEPA 5AXCA 3KVRA 4FBGA 2YXNA 3LPNA 1GPLA 2HIMA 4F8RA 2XUPA 3A4IA 2X77A 4B83A 4KGVA 1U02A 1JQEA 2EBHX 3R0JA 3DTYA 3LBHA 3CC2N 3C3XA 3CE6A 4L16A 3CZPA 2P5GA 2ANCA 3WMFA 2G04A 2H5LA 5T3YA 3RAGA 2NZWA 2GA9A 2I1WA 2OCPA 2VQSA 2MYNA 1VKHA 2A1SA 3I4LA 1TJYA 3L0OA 5JQGF 3EVBA 2VNAA 3VO9A 1VXRA 4ZT7A 1Z4PX 4U2FA 2IS3A 1Y4SA 3KPWA 2AE1A 4KXWA 4M4SA 3T7RA 4DCMA 5IU6A 1OUMA 1J0AA 4YRFA 5KOHB 5I4KA 3DMNA 4P2BA 1MX3A 1N7HA 3WL5A 5F1OA 3PDWA 4Q4AB 2ZF5O 5BOSA 4LFAK 3L9XA 1PSWA 2HHWA 1L1EA 1OLSA 1N5MA 3D6MA 1R6TA 3TFWA 3KLGA 3Q3EA 2R6GA 2VJOA 3QX8A 1P4HA 3RI3A 4EA7A 2IE0A 1IN7A 3PPYA 4IIYA 3QFCA 3I8XA 1HKGA 1UZAA 1MO4A 1CY4A 4FQ5A 1ITZA 2XRFA 4I1SA 1FP4B 4DQVA 2ZJ5A 1ZD8A 3C97A 3TYXA 4PHTA 4GH5A 2J9YB 3CH4B 3HVJA 1W93A 5JD3A 2WBNA 2RGGA 1WKCA 1A9OA 3FZNA 3KZ1E 2CHVA 5FEMA 1TF5A 1R0XA 5A4AA 4YJHA 2BONA 3B8HA 4W9NC 3E1YA 3S3NA 3V9SA 4YGYA 1EO1A 4R1SA 1U3FA 1ZAYA 4N3GA 3M6GA 2LTAA 2HF7A 4HG2A 4J1NA 1K7CA 3IVAA 2C5AA 5KPDA 1FSPA 1MJNA 3FVWA 10MHA 2JIBA 5C32A 3NGXA 4JY7A 3C6QA 1RVV1 4B79A 2A1TR 1CIPA 1G9TA 4TN1A 5BPNA 4FEYA 3E7FA 4B7CA 1EFPB 3IUPA 5F2EA 4D99A 1XYVA 4OEHA 4DF8A 4N3AA 3ZY3A 4RH0A 1U45A 2WU3A 3K2PA 4YAGA 2VIIA 1DQNA 1XA4A 3TLJA 1M6VA 1YZ3A 2Q0QA 4BKRA 1HFEL 4BNLA 2AVNA 2CSXA 5IDXA 1UWCA 5JO9A 1AS2A 1ZI9A 1DJPA 1EB8A 4I50A 3ONVA 3FF4A 2HWUA 3A10A 2VP0A 2XUDA 2REXB 4J3NA 3D3WA 1R15A 4BLPA 1CNMA 1RDCA 1S5PA 3DEFA 4MQ6A 2R751 1XMIA 2BFCA 4ECAA 1DJNA 4N7JA 3OZAA 2FSVC 1Z6QA 1Z0IA 1VSIA 2IPOA 3UCXA 2OORA 2O5EA 5AHOA 1N5JA 3EQ6A 3OIWA 2AYYA 3V8MA 3INGA 3IDZA 3TKAA 4F96A 4KFUA 1JDBB 2J6CA 5LXTB 1QP8A 3CHWA 5HZMA 2RIRA 1M10A 4HCCA 4HMPA 2OWDA 4M1SA 1OHHD 5HKOA 1P60A 2VNSA 3VZCA 4NHEA 2QZZA 3STXA 3KXDA 4RD3A 1L5VA 3F67A 4UPEA 4DJJA 1HE4A 1T3ZA 1RYDA 1JTEA 3NDIA 1UXOA 2PUEA 1L5OA 3FZFA 2GD0A 5ALTA 4PYQA 1CQWA 2WF5A 2WMNB 2GESA 3MQ2A 3B6KA 2OOSA 4FFBA 4P31A 3BXXA 4MZDA 3L7CA 3I32A 4AYTA 2C2KA 2C7OA 3BILA 1BISA 4EG0A 3FPJA 4F6CA 3IV9A 2D62A 1UKCA 5FD8A 3THSA 3Q3CA 2KZZA 4Y0AA 4D82A 4QVIA 2JGDB 3TSPA 5CCXA 1N7IA 3HBTA 1OGJA 3OLQA 5BN3A 1G8AA 1TKXA 4A2PA 3PV0A 1PNTA 1N8RO 2R8BA 1NOJA 3T94A 3AY7A 1WO8A 3R7WA 1N8KA 5EIWA 4OYRA 3M0EA 5I48A 1KQ3A 2L18A 3AF4A 2M6KA 4U7PB 5I4BA 1HX1A 4GC5A 1ZBIA 2R6R1 2APJA 3QBTA 3MTIA 4DCSA 1RPZA 1F0PA 3CB4A 5TF4A 1WS6A 4IO9L 3K9FC 2AA3A 5F2KA 3PDJA 4YLEA 4D9IA 3DLLL 3OMXA 3AZPA 4LRSB 3DDUA 4FUTA 1J5EB 4K6KA 4Y0VA 4PYMA 1P4GA 3JD4A 2UYYA 4ZT5A 3MRXA 4JJEA 3GJTA 1WMAA 4GP6A 4AZTA 3STYA 3N8HA 2AXQA 5CVTA 3G0CA 4ZVLA 5DP2A 4Y2TA 4XVUA 2Q3CA 4EVIA 4CJFA 4NKRA 3ETNA 4I5EA 3PQ7A 4MLPA 1A9XB 4A23A 2IPXA 1BCRA 2GJ9A 3P1GA 3IQWA 3MXOA 1QZTA 2DF8A 4KPYA 1Z5PA 2LKCA 4ARZB 1A76A 5EYPB 4OKJA 1KKMA 1NMEA 1SUPA 4CFCA 2Y9MB 3SZMA 2AOXA 4ELTA 4ND8A 2HV8A 3K0FB 4QU9A 5HKLA 5A4FS 3BEXA 4M3NA 2DUWA 4AJ9A 3AVQA 3LX8A 3AEKB 4TLDA 1XYYA 3EMVA 5IDYA 1P8AA 1YK1A 1FDVA 3K2QA 1V4NA 4QO8A 4HX5A 3KJGA 2ZXEA 2HJGA 4XIJA 3WWCA 2OZEA 1AKQA 1IN6A 1PJ4A 5LOVA 3CVVA 4MX8A 4XD7D 4X7MA 3E01A 5KSPA 2Q9BA 1KDZA 3X1KA 3UHOA 2YNGA 1SKRA 2JL1A 1IG8A 4OXNA 2R2AA 3MECA 4G41A 4IVNA 5FUMA 4ZGBA 1DXQA 2AFHB 3NEPX 4WYBA 2PSDA 1RC1A 5BW8A 3C3JA 3FOFC 1NVGA 1FE8A 1K68A 3GEMA 1ZVVA 3L0PA 1MRNA 1Z06A 4M7OA 2V7PA 2AG8A 3TDNA 1G2IA 2HBQA 3HR7A 1YZYA 5D8DA 3OQMA 3Q7IA 4YRGA 4QDJA 1CDZA 3QVTA 4Q66C 5M5BA 2ZTMA 4AN1A 3V8NA 3OLWA 3ORHA 3DMFA 3I56N 3LG2A 4OI0A 5AQZA 3CUYA 3Q3IA 4GI2A 2CJFA 1GOCA 3WVNA 1BA0A 2BZ1A 3AK4A 4JI8K 3RABA 5EIBC 4XWYA 2AT1A 4QYMA 1ECCA 4DQKA 4Z8XA 4MUIA 2RE8A 4AUMA 5THQA 4QUIA 3WDMA 1K0FA 1GTVA 4FZ3A 3W7VA 3SIRA 3F9IA 4MDAA 2VWPA 3ONFA 2I5PO 4A1OA 4ARVA 3DI6A 2XKBA 1JN0A 3GFRA 1JVNA 3UMVA 1BTOA 3O21A 2WNHA 4HL6A 4KI0A 1W96A 2YRWA 4B2IA 1IC6A 3TABA 3F5SA 3JAMO 2V03A 5D5HA 4R4JA 4KZPA 3HXTA 3K94A 2HNZA 4FWBA 3K8OE 5EC8A 2C2ZA 5DBHX 4O6VA 4N5LA 4ER0A 1D6NA 4DA6A 5B12A 1NK6A 1HFKA 3Q5DA 1DFHA 3IBYA 4E5KA 1CUWA 2NSYA 2W40A 2IHUA 1NJFA 5JW6A 2QTVA 2HBZA 1D5CA 1UBGA 1Y8ZA 3LTEA 1GL9B 4GLOA 2V58A 4BFWA 4J2HA 5KU1A 5CFMA 3IP6A 1ZFNA 3THXA 1Z05A 2FQXA 5KU7A 4LY9A 3Q98A 4IQFA 1FB5A 4JJAA 4YRDA 1QJ4A 5JCPA 2UZ0A 4FOLA 3L1KA 5EEHA 1J24A 2I7XA 3LT1A 4FW9A 3HTVA 4U7JA 3MCZA 3TN7A 3RYCB 3K58A 3ZC3A 1VG0B 1M2OA 1QHAA 1YFJA 5AFUH 4OFWA 2HHQA 4COOA 3JQ7B 4QKQA 3FB4A 1SOWA 1WF3A 1TI7A 4IUCS 2GBLC 3QK7A 4MS4B 2YNIA 4GLJA 1E7WA 1E3QA 3RAFC 3UQZA 2PO7A 4FB5A 3L8EA 3MT8A 3SJJA 4JRQA 4C0QC 3CRVA 4K8RB 1ADBA 1PDOA 3UOGA 3KSBC 4KBFA 4FM2A 3TD6A 1QF9A 3RTEA 5ERYA 3RH0A 5L8VA 5HZGA 5BR4A 3I1JA 3RKUA 1JDZA 1KXZA 2DQ4A 3GJRA 1S8AA 3BRWA 1NSYA 1P0MA 5KYYB 5DN9A 1T0BA 2FZWA 2VZ8A 3LYLA 4FI3F 4FR0A 4BB5A 3SEAA 1WUYA 1C9EA 3O83A 4MGIR 3GIWA 2RF2A 4XDZA 4FN5A 4U7TB 3RPEA 4EQ6A 3DXYA 3NBPA 2G8IA 1SUQA 3JY6A 3VEXA 2AOUA 2PFKA 2H0QA 2NUAA 4IINA 4URFA 1U8ZA 3QIVA 4U6SA 1COWD 3DMJA 5C8DA 1P2GA 3SBOA 4ZDIA 2AZXA 2BYTA 4C4ZA 4H7HA 4FGZA 3NDBB 1XJ0A 3K09A 1QKKA 4B4OA 2MR5A 1QB7A 2W6PA 1U6KA 2DQZA 4OQXA 1IY2A 4P36A 1GOTA 1FNBA 1MT3A 3ZE1B 3UT0A 1K1EA 4FCYA 2WIFA 1KAQA 4WZBB 4HR7A 4XYLA 3HSYA 3M81A 2R96A 3OPYB 5IASA 1ISRA 3WWPA 2PGIA 2IDOA 3VMFB 4EYOA 3RU9A 1XIVA 1E0DA 3WA7A 3TD2A 5BV2P 1LPMA 4YB8A 4G81A 5IZ4A 1BD4A 3WICA 4JHDA 1KY4A 3LUHA 2QRVB 4EAHD 1ZBDA 2V3VA 2X7HA 3AEUB 3O1WA 4KJXA 5KTSA 1QQOA 5LP6F 4K1XA 2GVZC 3G89A 4CZEA 4FJ2A 4RABA 4ZHSA 4Y2RA 3V2UA 3NJ8A 2ATEA 2HWXA 3FD8A 1RACA 4Y9RA 2H85A 3I8SA 1JW9B 3LQ2A 3HSCA 3BF8A 2H7VA 3T1OA 1Y9DA 1RDFA 2IYNA 3ZR4B 3EY9A 1F4LA 3PHBE 1M76A 5HFJA 1C9JA 4JA0A 3HXLA 4NONA 3JD3A 1C0LA 1KOJA 2R8YA 2CDNA 4U00A 2JWLA 3WAJA 4TL8A 4BPBA 3AF1A 4ZPXA 3WL3A 3OTHA 3C8DA 5TY0A 4RZHA 1F60A 1O08A 2I80A 2Q21A 2PXCA 5LQAA 4DEYA 5JCZA 5KDLA 1U8TA 1A2BA 4ZAYA 2XTZA 2ZJPL 2GWRA 4FOSA 3I9KA 1NJIO 4FC6A 3JRXA 4BZZA 4F2RA 4Q1FA 1E2IA 2V6BA 4PA1A 3IDOA 3AR7A 4QLAA 3IAFA 4QXMA 3CEJA 1XTKA 4CHZA 2PHZA 2BBWA 1KWKA 1P7CA 1KO8A 3RUAA 2XWJI 3D1VA 5DNUA 4CKWB 4Q1AA 4N0PA 3OJLA 4RQBA 3ECAA 2Q3DA 2FV8A 1A9PA 5JD5A 3IJPA 1W7AA 3GPCA 5JSUA 4C2TA 1I33A 2WWTA 5F4BA 1E3LA 1K2VN 2ZT5A 4IAOA 3VU1A 2XAUA 1VPEA 1C9MA 3WC4A 4AUNA 2ZE7A 4CIWA 3LWBA 5JPCA 4HHTA 2Z57A 1N6OA 2AZTA 1GLAG 1EXDA 4CFAA 4BTEA 1KDRA 2H5EA 6AT1A 3FMGA 1SMKA 1QFZA 2GZAA 3ZNOA 1QSSA 1B9DA 4F9OA 4DA8A 4NXNK 4NG4A 3K20A 5C2JB 4X71A 4Z5XA 5SZIA 3NQ41 4INPA 4MUEA 4O4IA 4D42A 2P9UA 1A7AA 1V4SA 4NDZA 3ZTTA 2BPOA 3KJXA 2R44A 3A6KA 3K0HA 2H18A 3TSYA 3OQPA 4BFTA 2A1RA 4AJEA 1U7HA 1YE8A 3D7EO 2CEAA 4QNMA 2Q0SA 1JR4A 3O4VA 1V6CA 1WUIS 2CVFA 3HYSA 3MTBA 1D4ZA 1XVUA 1UBMS 4X20B 3RSFA 2ZUDA 1DV2A 1HMYA 3UKOA 1SM4A 4HNSA 1IWPB 4F9EA 3SVLA 3WLAA 3NCTA 1Y1KE 2HF8A 5DM1A 3ESBA 1C7FA 5C4GB 2IOFA 1DJOA 1KI2A 1DKNA 2R79A 3DEJA 5AJZA 2FPMA 5HRRA 1M34E 4LHSA 3WRYC 2CDCA 1YE3A 2ON6A 2ZYTX 3PJRA 9LDBA 5CB8A 2QMQA 3EMBA 2O2ZA 4E0DA 4QJIA 4KRGA 2A5FA 4M9RA 3CKKA 3NR2A 4WZ6A 1TVEA 2A8YA 2BGNA 2NU7A 4H1UA 2OCXA 5I7RA 1RT2A 2JLEA 4JAVC 5DP1A 5KNDA 1X7ZB 4ZVMA 1RRMA 1RZUA 3T5AA 1F6BA 3FAZA 3ABRB 3Q72A 4POOA 5AD1A 3LKBA 3TKYA 4J2TA 3KHTA 4U7WA 3IP9A 4DWJA 1WG8A 3SHOA 1NI4A 3GVPA 2ZWPA 3SSOA 4HATA 5CDFE 4CR7A 4DC1A 1L3CA 4Z7JA 1BE0A 1CJBA 4INOA 4B8AB 4EECA 4PN7A 1FUKA 1VQKN 4O55A 3Q5GA 4F5YA 1MEJA 3L0CA 5G2OA 1US8B 1UBEA 2O4GA 3P2KA 1D1PA 2QSZA 4L08A 2ZWHA 5CR9A 4Y0NA 3LAMA 4M9QA 4UOQA 1Y37A 1VHDA 3AKDA 4QXOA 2WNIA 3QMLA 2JFGA 2C3OA 4FINA 2AQHA 2OQ2A 2DHQA 2PRYA 4OKIA 2IDKA 3JQEA 3OQOA 4Y8VA 3VUFA 3WLQA 4FHZA 4G5YA 2CK3D 3RRHA 1M6YA 3WZLA 2C7VA 4NOJA 2WZQA 4JJ6A 2PQ2A 2YY7A 1ENYA 4PRZA 1SELA 4INAA 4YI3A 3IJRA 3WGVA 5I5GA 1BW9A 4KHPB 3ULEA 1P4AA 1LJ8A 1FDWA 4L95C 1Z16A 1J33A 2Z58A 1FK8A 5J5VA 1UMDB 3TTCA 5DGHA 4L76A 1CSEE 4PG5A 3IA7A 5J4YA 1CUYA 5CVUA 4D1YA 3L6UA 5JSKA 3A6ZA 5IN4A 5TV2A 4OPMA 1RBQA 4FM9A 1JDVA 5BSHA 2BF7A 3GLTA 4WASA 2QWPA 4BL5A 2L0XA 4KH0A 2CXTA 3ZIDA 3OYNA 3I6YA 2WMDA 1JWLA 4NYJQ 1VQ9N 3G0ZA 3AVUA 1TW3A 5C37A 2QZSA 2QR2A 4KXVA 2FU5C 2KHOA 3RJZA 4REOA 1N4AA 1FSZA 3ZIAA 4KC0A 2E9SA 1S0UA 3E2IA 2ORED 3DBOB 3LVRE 2DWOA 5EPUA 4J4HA 4E11A 1ENPA 3OYDA 2BISA 1YQEA 3MD0A 2IQ5A 4Y9TA 2C5HA 4KACA 3SZLA 2XKKA 2M1XA 4L0MA 4WDRA 5HGJA 1TXGA 3ZT0A 1SD1A 1II9A 3O95A 3MXMA 4UVIA 5ILOA 1CR4A 4BKMA 2WQ7A 2PY5A 1DO0A 3GYGA 4ZMSA 4IF4A 5DMXA 1AOXA 3E7PA 4PL8A 4WLUA 1U1IA 1FJ2A 4GMHA 1AKWA 1QQ6A 2JGLA 1K6MA 5HRCA 2AUTA 1WP9A 2OAEA 3C98A 3VVBA 3VQEA 2XWBF 3K9LA 1CLEA 3AKEA 5EWMB 3PYMA 3CCBA 5F1XA 4CZKA 1NUTA 1V8OA 3LM9A 2D74A 3UWDA 3E53A 1JHMA 4P3XA 2P69A 1RXCA 2EGUA 1GUYA 2ZIVB 3GGOA 1BE1A 5KQ8A 3L7NA 3CUSA 3OBWA 4QDOA 5K8CA 4HUEA 1HYQA 3PDUA 3R7NA 1VK0A 2DG2A 3MN5A 3MELA 4QNNA 3C6HA 3I8DA 3QUTA 2RARA 2NTJA 2EX4A 1QG0A 1WKBA 3LYAA 3UC5A 4JLOA 3RS7A 3SLCA 5E7MA 1M9NA 1WSEA 4QQFA 2PSHA 2B4RO 1V26A 2FMKA 2GZMA 3QLTA 3WNVA 3GJ4A 2W0SA 1DP4A 1WMSA 1QOQB 4BASA 1IIBA 2V9PA 2WOOA 3OJXA 5AFSA 1C4OA 1RM0A 3M1AA 4S3MA 5CIQA 5JJLA 2ZAIA 2FDRA 3MWTA 1U2SA 5F51A 1HNZB 1R27A 2JFQA 1KVRA 4HQNA 1OXSC 3NWBA 1EI9A 3SQ4A 1PHPA 2C98A 1YB7A 4KVZA 2EG9A 3MW8A 3I30X 1TC1A 1WSBA 2YIJA 5JMVA 1SBTA 5IS2A 3CINA 1TUBA 3CQXA 2YFQA 3B38A 2EX0A 4RVOA 2GX9A 1RXVA 4IRMA 5KREA 2ZUWA 3R0ZA 2CNKA 1AE1A 2K5UA 3CVUA 3HKEB 3CBGA 1XMQB 4GQAA 3ZETA 3IHWA 1J53A 2W48A 2ZJBA 3L07A 4HDQB 3KEQA 3PC6A 3IQXA 3F3KA 1E9VA 3GHYA 2UVDA 4NYIQ 3QFPA 1E98A 2HU7A 4QUAA 5CK4A 4AU1A 5F2OA 3UZUA 5AVRA 3LY7A 4FONA 5ICCA 1KFCB 2IZ5A 4B6GA 1XCGB 5DNWA 1DI0A 2QM0A 1KYZA 5JS1A 3I64A 3OT1B 1PKEA 5D87A 2X0EA 2D5RA 4XVRA 1HR0B 4LMRA 4WW0A 1KC1A 2A88A 2P9SB 4QM7A 5TS3A 3G2IA 3GHHA 3DUFB 1C3OA 3UJBA 1UBFA 3LM8A 3EVCA 2FPGA 3QEWA 5JFGA 3A3PA 2XCTB 2IYSA 3PL5A 1E7QA 3ZBUA 4IEIA 5EPOA 4KYTA 3KOXA 6NULA 3H8WA 3SQXA 4GR9A 1EJ6A 2HEIA 4WFQA 5GPBA 1W9MA 4GR4A 2INGX 4HGQA 1A8IA 2VTVA 3SAHA 4FJHA 3FNIA 4CQMB 4LGYA 3Q10A 1SU8A 2G6TA 3D3EA 1KA9H 4WNYA 1XNRK 4GI1A 3M9LA 1W5BA 2J3HA 3MAGA 2YBDA 3I3OA 4QGSA 2V6JA 4I4NA 4P3OA 2I4RA 3HOTA 4AZWA 1KE1A 4URZR 3URMA 1P8JA 1QB8A 4RA9A 4TWIA 4OQYA 3QICA 5KDOA 3A9UA 3LDNA 2O8EB 4WFBL 5BRFA 4P53A 2IIQA 4G86A 1YMUA 3EISA 4EG7A 2VUSA 5I7HA 4C0HA 4HT3B 4CKEA 2GPBA 3JWJA 4RPGA 2IYAA 4AZ3A 1DEXA 1R10A 1ZDMA 2Y0CA 4MVJF 1W0KA 1MUUA 2BVNA 2R0QC 1VSKA 2FZKA 5LMZA 2WD9A 4CM8B 4IIFA 3EY4A 3BWBA 4CJQA 1CY0A 2VT2A 2NU8A 3HI4A 1FX1A 1ID1A 3I55N 5BRNA 1XALA 1NVUQ 4IRXA 5AKXA 1Z9BA 2V7XA 5K99A 1ESZA 3KQNA 1Z7GA 3I09A 1RKXA 3LIPA 2PJRA 3OPQA 2F2TA 2FN4A 2Z08A 5IBRA 3FH0A 5C5IA 2Q6TA 2EL7A 2W2PA 2F4VB 3WNHA 1LNZA 1PTKA 3R6LA 3ZZMA 4WIAA 3KYDA 5CLJA 3U7EB 3A2LA 2XY4A 4RMGA 3QSGA 2XGGA 5FEUA 3OZTA 1VE6A 4DM4A 2ZUFA 3TX2A 2VP4A 4KUHA 5C2FA 3DMHA 1JIIA 2DX7A 4S0XA 3S41A 1QSYA 5AZIB 5TGZA 2OPSA 2HDHA 3NBAA 3V9AA 3CCVN 2DPMA 5IVKA 1CHDA 1CEQA 5B1HA 2Y9PB 1IY8A 3OY9A 5E6SA 4C1NK 1ODCA 3H65A 3WHKA 4YJGB 3W6OA 1XNJA 1OROA 1KZ4A 4OH1A 1H9AA 2Q4EA 2HJRA 4PV7A 5DYWA 2QTZA 1L7QA 4JYMA 4JD5A 1S2IA 1QKJA 4Z4HA 2AN1A 3IKTA 3FGZA 1J00A 1EKEA 4CHGA 2Z4TA 4IHAA 5EAIA 1G8JA 1PLJA 4YRCA 1JG6A 2PS0A 2WB2A 3HSSA 1AHNA 3JV7A 4DR2B 2BL4A 1RW4A 4ZAXA 4ENQA 4IOAL 5CTAA 1VCMA 1EM8B 3TTWA 3OEED 3D1JA 3TW8A 3WADA 2PKEA 3C5HA 2A14A 3U0VA 4DSFA 4Z9AA 1WMDA 2QT1A 1R0WA 1T8UA 2VRNA 3UGKA 1LWOA 3GFQA 5IFLA 3W2TA 1BGWA 2X9GA 1HJOA 4WY2A 1A4RA 4O4HA 1U7TA 1S4MA 3OJFA 2FK8A 2C8JA 4BIMA 3IEMA 3TINA 4V0ME 4ZARA 4BQNA 1FCJA 2QT9A 4E03A 4OHXA 5JROA 5M1FA 4NYIR 2HK8A 5TDHA 1VG1A 5DBGA 1PT5A 1L7VC 5DVZA 4UM7A 2J6BA 4KLNA 3ZSQA 1SCBA 2ANBA 4UVDA 1PP4A 4W8GA 1A5ZA 1BQ4A 1NJ6A 1IKVA 2VQ3A 1I4DD 2CVOA 5JXGA 1UBNA 1GGKA 1U9CA 1QTIA 2GDJA 1Q0RA 1RWOA 4QOSA 1HNXB 2B1RA 2P35A 4CERA 5JY1A 2OZLB 5KTPA 1Z6XA 3OJCA 4A03A 2ZZNA 1RP7A 1Q1NA 1IZ0A 4M53A 1FRFS 1XHZA 4F72A 1N9ZA 4IGFA 5ANRB 1TTQB 2IYEA 4C23A 3KKSA 4RG8A 1DOAA 1QR2A 3NYQA 4JXKA 4IICA 4B5LA 4IHJF 3HM9A 5FF9A 1LSJA 2H57A 1TK2A 1U0EA 1ZW1A 3CX7A 3QLVA 4O4GA 3MLBA 1EFTA 1ZA1A 4GPZA 3NTOA 4RFVA 4XLLA 1TO2E 1QRTA 2R8OA 2BR3A 5AUOB 2W2XA 4RORA 5JEEA 5IM4F 1DIRA 2DR3A 3BPSA 2HYIC 1UDWA 4BRAA 2HUPA 3P20A 2HRQA 3EFHA 4EJFA 2EDCA 3GEHA 3QKSA 1U6ZA 1KBOA 1P90A 3LE8A 1U0GA 4XUDA 3V2GA 5H80A 5B5SA 2W83A 4JI7K 3W1VA 3WQQA 1EX9A 1XP5A 3DAYA 4ND6A 4E7JA 2ZETA 1FZQA 3VPHA 3MTGA 4FDVA 4O4LB 3SVZA 3NF8A 5H83A 4OTZA 4CMBA 3K53A 2J07A 3WSWA 4DV2B 4IFBA 1Q44A 2JDIA 2QL7A 5CDYA 1T25A 4L9AA 4CLEA 3DZDA 4Q48A 3CKMA 4ZU6X 2CB0A 1O9BA 5EP3A 1P9NA 8ADHA 3F2IA 4ZQCB 1THMA 3C2QA 1AKVA 4RMHA 4YMSA 2IHKA 2SHKA 1KQGA 3RIMA 1G8SA 3HSTB 1Q16A 4AJOA 4ZC1A 3G8DA 3KSZO 4JJKA 2DJ5A 4J75A 3PNKA 2CHUA 2R84A 1LPOA 1PYOA 3RVKA 2IGIA 4IKFA 2PL9A 3ICPA 1AA6A 4FOIA 3STTA 1QLJA 4ZZ3A 1V35A 4I5FA 5LA6B 4NF2A 5MFPA 3BYZA 2O4IA 1GPMA 3IMGA 2Q0XA 1YA8A 1Z5VA 3E1KA 3B51X 5J40A 1NY6A 2R1TA 2HSDA 3GMIA 3TF5A 1C5KA 3WHIA 2P5UA 4DMNA 1L7AA 1PT6A 1NDUA 5F7XA 3TAQA 2HOQA 2H2DA 2YXDA 3WLPA 1I7LA 4XYBA 2PTHA 1JLCA 1XU9A 2KKZA 2A9KA 4CL0A 1DINA 4XW2A 3P2OA 4E33A 2ERYA 1GITA 3UMMA 2JIRA 4H08A 3QETA 2EV9A 3ET4A 4YJ3F 3LMKA 4BNJA 4XH1A 2J0QA 1RWWA 2ZCUA 4P6VF 1FLVA 3OTGA 3RAJA 2D8AA 4X1OA 1XZFA 4DLEA 4M0PA 5AVYA 5JHHB 1FLNA 5ELZA 1T9BA 3P0HA 5BMVF 1UK8A 1ZJ4A 4HX9A 1JLHA 1RT1A 5FNVA 2P51A 3ZE8A 1DEAA 1ZNYA 1T9GS 1PHRA 1Z5UA 5EJMA 4M1YA 4FWOA 2X1VA 4RTNA 3GL1A 3ER9A 1L4BA 3FUCA 1ZH2A 2C00A 4ZI7B 2HQOA 3ICQB 5F9MA 3VHXA 3ZX3A 5C31A 3DD5A 5ALRA 1TFRA 1ZP6A 4W5WA 2DUMA 4CHYA 1ISGA 3NRBA 4DCUA 4EITA 4AXBA 1J6UA 2QWQA 1J5XA 3TSWA 2ZUTA 2A0FA 5EXDA 1GG9A 4PAOA 2HMPA 4QE3A 1JAYA 1LPAB 1CRZA 3QO9A 4JENA 5J58A 4HGPA 3NAZA 3I0RA 3BULA 4GRDA 5F9HA 4K6OA 5ADWA 4DTSA 1DC7A 3QLEA 1LAWA 3HNOA 3LPUA 2UUAK 2Z9DA 3BJEA 1Q18A 2D8MA 1QHGA 1GPYA 3BXZA 4UDNA 1RM4A 3U1VA 5HX7A 3B78A 4MUFA 1LQ2A 1N4DA 2SKEA 1PYGA 1X7YB 2QRJA 3CFYA 2Q3BA 3LOPA 3OWXA 4WZAA 4QT4A 4E21A 2BUAA 3DE5X 3BJZA 1GLBG 3O9ZA 4H5WA 2H00A 1QO0A 1UMCA 1MORA 1KMCA 3BL6A 4LGMA 4EG3A 3HCFA 3NH6A 3B3FA 4GLFA 2HC9A 4UHKA 3B3AA 1WZNA 3GG4A 4M7YA 1E60A 3TAUA 1LW6E 2W6CX 4AKIA 2NZVG 4JP5A 1XJQA 3AFMA 2L19A 3VH3A 1U48A 4JDPA 4I55F 1FUEA 1F2VA 1PEDA 4ZCSA 4YJ2F 5F2NA 3ZDDA 5JIBA 1J0DA 4YRLA 3EZ2A 3CW2A 4IBOA 3GA5A 3WIVA 5KWVA 1VHJA 3NHWA 3FYSA 1WBDA 1NVEA 3DOIA 3BMQA 1L5SA 1VLLA 4NPHA 3H4VA 3UMYA 1V39A 3HB9A 4DMFA 3QMVA 2LP4Y 3WSTA 3FFAA 1A1SA 4RCZA 1OOEA 1EK2A 2XMGA 4CZ2A 1EVKA 3FPAA 1X15A 1LQUA 3TAGA 1Y8CA 4UDOA 1XZPA 4ZP1A 4JI4K 4XM0A 4BNDB 2PMDA 1V7PC 1KQSM 3R4CA 2V7ZA 1EK1A 3QPUA 1FUYB 4CHTA 1NNEA 5GZ1A 4XWTA 1V2GA 1YB4A 5SZKB 3ONNA 3KZOA 4AT1A 2W6LA 3BP8A 1NBME 3H9GA 5JDIA 3OQ1A 2F1HA 1G42A 4DG1A 3P97A 3R23A 1GZ3A 1L7EA 1RWVA 3MBOA 3LHFA 1WDTA 3E22A 4K9OA 3ORYA 4M9SA 4E3SA 3C41J 2WYUA 3BGRA 2V6MA 1ADCA 5E6RB 1A3CA 5KNCA 2B98A 1DAKA 4KHSA 2QVZX 2IU0A 3PIPL 1A9QA 2X13A 5LNK6 5LZ8A 4HFNA 1OV6A 3UFXA 1NQ5A 4RZ2A 4O4JF 2YV2A 2D54A 1XRRA 2YWDA 1NULA 3AVIA 1FRQA 2XZPA 2F3SA 1I2CA 4GW3A 2AFHE 2C78A 3HXKA 5LYJF 3E9LA 2Y1FA 1EVJA 3K09C 3ZT3A 1UK7A 5IKEA 3U3MA 13PKA 3H17A 3U7HB 5TB5A 3OQ6A 4ESHA 5FWYA 4YAEA 1SXJA 1RWQA 5LQMA 3AETA 4MWEA 1P5FA 2EWVA 4K7JA 2RGWA 3CH7A 1ORTA 1XZDA 4YRTA 4K9KA 4Q1CA 3WY9A 5C0YA 1NGFA 2VQFB 5TNXA 4P5EA 4ZAZA 2J09A 1NGHA 4RX1A 5AQOA 3SQMA 1NBWB 4DBVO 4DIDA 1LDYA 1NKEA 1P6UA 4C8OA 4ALJA 4BV3A 3GGPA 3EZFA 1L4YA 2LIVA 4A15A 4AY2A 4K41A 3PC2A 5T67A 4HB4A 5G4LA 4AF1A 4CKXA 4PSAA 2P6NA 1WQ1R 2QXLA 4OSEA 3TIIA 3DL2A 2YOHA 3QHQA 1OVGA 1WBBA 2PX4A 1PW5A 2BKUA 5DHUA 3FHOA 3MJSA 1IUNA 4ARAA 3JYPA 4E15A 2BGKA 3WMXA 1SXPA 2VDNB 4G0NA 1WU8A 1EWQA 1HWYA 1NM5A 1XEAA 1QM5A 3AB8A 1ZGGA 1A72A 4BZXA