1YTUA

Structural basis for 5'-end-specific recognition of the guide rna strand by the a. fulgidus piwi protein
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
426
structure length
410
Chain Sequence
MEYKIVENGLTYRIGNGASVPISNTGELIKGLRNYGPYEVPSLKYNQIALIHNNQFSSLINQLKSQISSKIDEVWHIHNINISEFIYDSPHFDSIKSQVDNAIDTGVDGIMLVLPEYNTPLYYKLKSYLINSIPSQFMRYDILSNRNLTFYVDNLLVQFVSKLGGKPWILNVDPEKGSDIIIGTGATRIDNVNLFCFAMVFKKDGTMLWNEISPIVTSSEYLTYLKSTIKKVVYGFKKSNPDWDVEKLTLHVSGKRPKMKDGETKILKETVEELKKQEMVSRDVKYAILHLNETHPFWVMGDPYEGTKVKLSSKRYLLTLLQPYPIKPLSVEIVSDNWTSEEYYHNVHEILDEIYYLSKMNWRGFRSRNLPVTVNYPKLVAGIIANVNRYGGYPINPEGNRSLQTNPWFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for 5'-end-specific recognition of guide RNA by the A. fulgidus Piwi protein.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Rna binding protein/rna
molecule keywords 5'-R(P*AP*GP*AP*CP*AP*G)-3'
total genus 125
structure length 410
sequence length 426
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02171 Piwi Piwi domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1ytuA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ytuA02
1C1BA 1L5ZA 3ZSXA 3DRRA 4Y1CA 2DY4A 3CS3A 2FMFA 1ZYQA 3HP6A 3TARA 2F8SA 1SXGA 3T1AA 4EVRA 3RR7A 2A9PA 5CYMA 6CHYA 4IG3A 4FK4A 2FMIA 4CEEA 1QQAA 1WSEA 3ZT2A 2JBAB 2FC0A 4CIEA 3SNNA 4RY9A 5J2PA 4RY8A 5TQ2B 4RK7A 1EP4A 4AHVA 5EWLA 4KNYA 1Z2DA 1JXEA 3NCIA 4C8NA 5FRNA 3PX0A 3D02A 3I8DA 4FXDA 5IEBA 3G1WA 4FJ5A 3N0XA 3NGYA 4JP1A 5BQ3A 4N76A 3MXIA 2MYUA 5B3JA 1KRXA 4W5QA 3KIOA 4MQEA 3IP7A 4XLTA 4FZZA 1D1QA 1VSIA 4KREA 3NNNA 4E7LA 1U0SY 4CK3A 4CF8A 3NNSA 1SV5A 1L3VA 1JFSA 4RG8A 5CHYA 1C0MA 3ULDA 1C0EA 1JYFA 1WNSA 1XWWA 5EWJB 3CG4A 4CEBA 4KTWA 1VSKA 4F11A 1X1PA 4GW6A 1ASWA 3CFRA 3TB6A 4M3ZA 4FLTA 1S1TA 2M1ZA 3BGRA 4E7HA 4B09A 5HM6A 5PNTA 4H3KB 3N0WA 3D45A 5DMRA 4LH4A 4HUEA 1U45A 3CLKA 4FJ8A 2XO7A 4RW6A 3KLEA 2W42A 1TKZA 3IRXA 4ELTA 1Z18A 1LAWA 5E41A 1KFDA 1CYEA 1APBA 5KTQA 2XY5A 2IKSA 3H5TA 4BACA 1Z13A 1U4BA 3DM2A 4J2EA 1EXQA 1GCGA 4B9VA 2CD7A 4JRPA 3HVRA 1RNHA 1UA1A 3QEMA 1JLGA 5IX8A 4OKKA 3O3HA 1C4WA 4D74A 2QVCA 4HCCA 3IPCA 1USGA 3I0SA 3TI0A 3VQDA 5JNSA 4G0QA 1RBVA 5I4CA 4I2QA 3CM5A 4W5TA 3IS9A 1RDDA 4H60A 4IBNA 3FFXA 3KLIA 1ZITA 1EAYA 1FFWA 4BWMA 3IP6A 4CF9A 2VG6A 2LP4Y 2A1SA 3JPYA 4ZJPA 5IUNC 2PUAA 3KLGA 4Z4GA 1QP7A 2WY2D 3RVMA 4HUGA 2XY6A 3A0UA 2JRLA 4FZXC 2G8FA 4C8MA 4FK2A 4CGGA 4K8XA 3O2SB 5C5EA 4E7JA 1TMYA 3LAMA 4CECA 3EQZA 1JXBA 1IH7A 4J2AA 4L4UA 4Q6BA 1D9DA 5BRAA 4RDCA 4NYNA 4LE0A 3HCWA 4NV3A 2YV0X 2HVIA 3NGIA 1RT2A 4UQGA 1KFSA 1J54A 3G0ZA 4KHQA 4BDZA 4KK3A 2KTQA 2IAJA 1JX6A 4Q0BA 2QSJA 2ZWMA 3KJXA 4P98A 1JF8A 1DRJA 3A3KA 3RR8A 1RNLA 2AJQA 4HNSA 3TABA 3ZCMA 2OZSA 3IG1A 2IYNA 1D2AA 2QXYA 4KTQA 2GUIA 2QW1A 3QLUA 2L2QA 1BDJA 3IP5A 4MLDA 1WAFA 1QSSA 3HSTB 3SG0A 3L2RA 4KHNA 3LTEA 3DYAA 3OYCA 3DOKA 3SUPA 4LDZA 3V1RA 4HYEA 1Z26A 1TJYA 3F9KA 2VG7A 1J5OA 4Z99A 1QTMA 3LANA 4I7FA 3ZSWA 3BRQA 3DLGA 4M88A 3DI6A 2Z1IA 3T3FA 3R0JA 1ITGA 4H4MA 3HP9A 3L6UA 1EKEA 1FK9A 3O3FA 3GYBA 1W25A 1NXSA 4DSJA 4W5RA 4F8JA 1JHZA 4FJMA 4L85A 2HB5A 1JLAA 3B6OA 3DLRA 5FWXB 3LDSA 4KVFA 5C42A 1D1PA 3CHYA 3RMAA 4CGIA 1SD5A 4PYRA 1LBHA 4DTPA 5ED4A 3RMBA 3ROFA 2QKKA 4KKOA 5FBHA 4KI6A 1KMIY 1VRTA 2FLWA 2FQWA 3L2VA 2B5JA 4M3YA 1XHFA 3H5WA 1UWBA 3OYFA 1ABFA 2E4VA 5TQJA 2HHQA 2ZD1A 4CHYA 2MYNA 3MMNA 4HTUA 5EWLB 3SZ2A 5CZ2A 4D6XA 5KQGA 4FLXA 3KTOA 3OVNA 1BA2A 2PL9A 2DTUA 1SL0A 3K5NA 4EYQA 3EJWA 3C6UA 3BBLA 4OKEA 4RKQA 2OYQA 5KQMA 1KRWA 2D0BA 2GKGA 3E61A 1WN7A 4G0MA 2A9QA 3LOPA 4CFDA 3ZT3A 1RT5A 4FK0A 1CZ9A 3NBMA 1S9GA 4MR9A 4DTXA 5GQSA 2B6AA 3QEVA 1DLOA 4CJPA 1T03A 3H5OA 1B9DA 1QSLA 1T34A 2LPMA 3LPUA 3AVJA 3CM6A 2X6SA 3EULA 1RZRD 4ZMRA 1IKVA 2YNIA 4N47A 1NXTA 4ML3A 3GA5A 2E6MA 3Q7SA 4RKRA 4PEVA 4HNQA 1G15A 2R7YA 4O44A 3FFTA 3EAFA 4CEOA 2G8HA 3LUGA 1TK5A 1GLGA 4Q6WA 3RTVA 1SKWA 3AVIA 4F12A 2YHAA 3ZT0A 2EX3A 3NHMA 3S3OA 1VPWA 1SXIA 4E7PA 3DLKA 3QETA 1ZH4A 4MR8A 2ZAYA 2Q3SA 3OO0A 4D6YA 4G0YA 3MECA 3NDKA 1RT6A 1HYVA 2YKMA 5HLFA 3GV0A 1RTIA 1KSPA 1Z17A 3VQ5A 3UUGA 2KQ2A 5C25A 4MS3B 4M3TA 5KRSA 3HO1A 3LP2A 2FEPA 1L5YA 4DSKA 3OYHA 2HVHA 3OLYA 1FSPA 4EY3A 3SI6A 3UIQA 3LUFA 4LZLA 1NY5A 3NNDA 3NH1A 5CNJA 1NK9A 4KB1A 4E19A 1EWVA 4E89A 3OYMA 3JTEA 3K2PA 1YTUA 3D0PA 7ABPA 3EYZA 1E6KA 4DF4A 4B8AB 4KFBA 3O21A 5BR1A 4F2RA 1T8EA 5HRSA 4YV7A 4CK1A 3KG2A 5SWMA 4CJ4A 5DCLA 3N75A 1C0TA 1WSHA 4B8CA 4N03A 1M5UA 4BE1A 5TQ2A 2HHTA 3H1EA 1Z2EA 1KCFA 3KYIB 4PE5B 4QPJC 3V1QA 4MQFB 4WT7A 3AVFA 2DRIA 4HNRA 3S9HA 1KLNA 4FJ7A 4DFKA 4FLYA 2ZE2A 4FJGA 4OVLA 3ZSYA 4OTZA 1WSJA 2D0AA 3OYGA 3THVA 4CESA 3JSMA 2RDMA 3K5LA 3ZT1A 1YVUA 1PEYA 2GI4A 3KS9A 3LZIA 1RDBA 4CFAA 3KTQA 2FEWB 3VQ4A 3GRCA 1VRUA 1NATA 3SNKA 4FJNA 3I5AA 4JRQA 2OPRA 4G0ZA 1C0UA 4OBBA 4RK1A 4NCBA 3SAJA 1HMVA 3WNGA 1H9CA 4ETMA 1SL1A 4YP9A 4G0XA 2L17A 2JVIA 2OA8A 4MS4A 1YK0A 3VQAA 1ZESA 2BGGA 4MS3A 2P1JA 4FJKA 3DMJA 4CHNA 2WRZA 4WZZA 2IPMA 1A2OA 1DCKA 4FE7A 4OPKA 3K58A 5I42A 1VSLA 5T3YA 1NOZA 5JNWA 3V1OA 3MEGA 3OYEA 2R48A 1TV6A 1P6UA 4IG0A 1USIA 1ASVA 1SRRA 2OPSA 4CJTA 4IDKA 4CIGA 4CHQA 2O20A 5IUKC 4MGEA 1QMPA 3JYTA 2FBTA 1S5JA 4RW8A 3F7NA 1C1CA 4DQDA 4DQQA 3LWMA 2RPIA 5J1EA 3NGZA 1C1AA 4PQUA 5J2MA 4CGFA 1L3TA 1SXHA 1F4VA 3PV8A 1FFGA 1B92A 4UHKA 1YTAA 4DFPA 3RH0A 4DN6A 1NXOA 2I5JA 1BIZA 2IPLA 1ZBFA 3LZJA 3H1GA 1F51E 1KVBA 1ZH2A 2AYXA 2HHSA 5CYQA 4OATA 3ROTA 1JDPA 4FVMA 4DTSA 4IF4A 1BDHA 3MM4A 1IKWA 4PY5A 3RRHA 2MSWA 2FMHA 1TAQA 3E01A 2Z1GA 4FLUA 3AVAA 2HSGA 2QZJA 3N8IA 1CEYA 2A1RA 4O1HA 1IKYA 2G8VA 5T7BA 4FW1A 3KHTA 1NK8A 3M9WA 5HROA 1RPJA 1S8NA 2PKXA 4JOQA 4RSMA 3OS0A 1DC7A 1PUXA 4C8LA 4MS1A 1ZY2A 2GV9A 1IIBA 4BWJA 1X9WA 4MR9B 4XAQA 1JL2A 4DTMA 1M2EA 4FJHA 3HPGA 1CHNA 2FTKE 1BHLA 3M6MD 1JFTA 3SV3A 3JY6A 4Z0UA 1JYEA 3AV9A 2Y1JA 4RW7A 2FKAA 2FSPA 4IFYA 2HHXA 2IS3A 4C8KA 4ZMSA 3KKSA 2HPHA 1KTQA 4O5BA 2PL1A 3EDCA 1RTDA 2FLKA 1JLFA 1ZGZA 4QYMA 4DU4A 4CJEA 3Q7RA 4DS4A 4FJJA 3ASMA 4EUKA 1IO2A 1NTRA 1ISSA 2IGIA 4F06A 2VUHB 3E3MA 2YNHA 2PLNA 1T7PA 4WWHA 1ISRA 3K4HA 4WXEA 3N6VA 5KRTA 3WNHA 3HK2A 2Y1IA 3IAYA 3LWLA 3Q15C 2PYLA 2RN2A 3M9XA 3G85A 1Q8IA 1L3UA 3HT3A 3P9YA 2E4LA 1I39A 4PUOA 4RS3A 1NJYA 5TPZD 3QLTA 2IDMA 4AHUA 1MIHA 4RXMA 4DLGA 3OYJA 3IPAA 3OYKA 3AO3A 4XXHA 4M41A 4KHSA 3SPYA 3GL9A 2QR3A 4YR7A 5J2NA 2F96A 1RT3A 4RK0A 3H5LA 4Z4CA 3ILHA 1Z25A 1RBTA 4MFBA 2HW3A 2PUBA 4RK5A 3QO9A 3A2FA 8ABPA 3HPHA 3QELB 3T19A 4JS5A 3IP9A 3K5OA 3SQNA 3RVQA 4KZKA 4CJUA 2LSNA 1JLCA 3OLZA 2WWVD 3BREA 4LY7A 1XWLA 1WSFA 3NH0A 1ZN2A 4KFCA 1ASUA 3H1FA 4JB0A 3OMWA 3NAEA 2YNGA 3LUKA 1S6QA 4DMNA 3QNOA 4CHPA 4DTJA 3UK0A 1GUDA 4B9SA 3ZSZA 1NOYA 4BDPA 1D5WA 2WB4A 1S1VA 2MSKA 1W9HA 3SUQA 2FMKA 2JLEA 3AVGA 5K14A 3MQ4A 2HJ9A 4IGAA 1QQBA 1XHZA 1JKHA 5CNKA 3QEXA 1XHEA 1B00A 4MR7A 2R25B 4DS5A 4CIFA 1KVCA 3MEDA 3V9SA 3K9CA 4H3HB 5TQ0B 1DTTA 4OLBA 4FB4A 2CHEA 4TLLB 2RJOA 4J2DA 3PO4A 3SQ2A 3OYIA 2R4QA 1NXWA 4LRQA 2NUBA 4XIUA 3RVRA 2DFEA 3SQ1A 4CF2A 4I9QA 4HHTA 4R5PA 4ELUA 2PJUA 4M3WA 4C8OA 1WLJA 1NJWA 3TANA 3NF7A 1WETA 3OYDA 4CE9A 1RILA 5JNVA 3KK1A 2KYRA 3AA3A 5D3GA 3H75A 1ZBLA 1KVAA 4KHYA 1YT3A 3CFOA 1EWKA 4JLHA 4CEQA 2QKBA 3OYAA 2KZZA 3SYZA 3K59A 4DTRA 2I6FA 2RJNA 3AVLA 3DLBA 3F6CA 1SKRA 5HSGA 1A5XA 3OLXA 4Y1DA 2OQRA 1A5VA 4M3XA 1RDAA 4YLEA 4AHCA 3OS1A 1ZBIA 1R0AA 1DBPA 3HDGA 1XI1A 3KD5E 1CZBA 5TPWB 1S9EA 2P4UA 3SY8A 4NICA 4DSIA 1PNRA 2JB9A 4O0JA 2HQOA 5DK5A 4Z4EA 3L3UA 4EYGA 2JVJA 3O74A 2OENG 1I3AA 4CJWA 2G8WA 4XARA 2WJWA 4CJQA 4KAZA 1Z16A 4PWDA 4N0PA 1NK0A 1VSHA 1NJXA 4FZYA 1ABEA 1PEAA 5FBKA 3AVMA 4JB2A 1A0OA 5JNTA 4DU3A 2NT4A 2MYPA 1MU2A 3FGZA 1DBQA 3AO4A 1Y1LA 3DZDA 4EP5A 2FVYA 2E4YA 4Z4IA 1FKPA 1OXKB 4DTUA 3C97A 3V4IA 5DGCA 1BCOA 2QV0A 2B4AA 2HHWA 2LIVA 4KTZA 3RMDA 1A04A 1NJZA 5D2CA 2PY5A 4EZ9A 3MEEA 1YS7A 4ZYLA 4RW4A 1A5WA 4LSNA 4PZ0A 5CY4A 1Z15A 4UHJA 4IRXA 2JCGA 1EX4A 4IMIB 1BQNA 1J53A 1EWTA 1RCHA 3WNFA 1BGXT 4G1QA 3VQBA 5HP1A 2MYTA 4TMYA 3VQQA 4OJRA 1N6QA 4ETIA 1JL3A 3Q7TA 5KC9A 1LBIA 1MB0A 4E0DA 4G0OA 3QIOA 3H5IA 4CCHA 2BDPA 2J48A 3SUNA 4F3TA 3KKEA 1TVRA 3WNEA 3L8BA 5KGXA 1XHXA 2ID9A 2MSLA 3W9SA 4F3OA 3HUUA 2B1JA 2PE5A 4ETNA 3AVHA 1TL1A 3S3MA 1HNIA 4CHOA 1I3CA 5TPWA 4P1ZA 2TMYA 1QE1A 4HUFA 2VUIB 3DRPA 2E4WA 2HQBA 3RVJA 4CEDA 4KRFA 5KQLA 1SUQA 1U47A 1GOBA 2AYZA 1VSFA 4GPAA 4G97A 4RU1A 3QINA 5KC8A 1NKCA 1TLFA 3CTPA 3DGFC 1Y97A 1U8TA 4EVQA 4O0IA 4YCSA 3O2JA 5E3JA 4HCBA 3P5JA 3TMYA 3OQNA 4MPTA 2OPQA 2PZSA 1L3SA 4LX8A 4YRZA 5IUJC 3TAFA 1RT1A 2Z1HA 1ZAYA 2ITGA 2E4UA 1FFSA 4MYRA 2RGYA 3LUHA 1WAJA 4AHSA 3LMKA 2PUDA 3EQ2A 2HNZA 4N5SA 2X7XA 3KYJB 1QO0A 1TKDA 4E3SA 1LW2A 3KK2A 4DLEA 2VK2A 3N0RA 3OM1A 4RZSA 1U49A 3QX8A 4BE2A 2HHUA 4AHRA 1ZHHA 3O3GA 3KSMA 1RDCA 1TL3A 1W0HA 4QCLA 2V0NA 5C24A 1K6YA 4Z4FA 3LUAA 3BILA 3OM0A 2L18A 3TAMA 3QK7A 1KRPA 3QEPA 2QU7A 2KFNA 4DQRA 1CLQA 4TN5A 2WJAA 4WXMA 1QHTA 4DSLA 1UDRA 3VN5A 3C3KA 4Z0NA 3QESA 3OJUA 1YIOA 4RK6A 3TAGA 5JS1A 4M45A 2PUEA 1UA0A 3TAQA 3LAKA 3QEIA 5B3JC 2IOYA 4QYWA 4E7OA 5JS2A 4B9LA 1JLBA 5KWSA 3FDFA 3L2QA 3O1HB 1VRVA 4RY0A 1FKOA 4KQCA 4DTOA 4MRMA 1JH9A 5TPZA 4KO0A 3VQCA 5JNRA 5EWMA 3S99A 5CNMA 3DLEA 1HYZA 2OPPA 2Z1JA 1MAVA 4F8RA 2LUOA 3B2NA 4B08A 1Q9YA 3MIZA 3TR8A 4E7IA 3M8QA 4OPJA 2Q5CA 3HYFA 2VWKA 4NCGA 3NE6A 2BANA 4W5NA 1NK7A 4WUTA 3LKVA 2PUCA 3SJJA 4CEZA 1AB5A 4H4OA 1BI4B 4MAAA 5ABPA 2RF2A 4FJ9A 3RWUA 4OGEA 2GBPA 3NHZA 4F2SA 1LWFA 1J56A 1X9MA 1NK6A 4M3RA 1BCMA 4CF1A 5FROA 2ID7A 2XY7A 3TAEA 2PMCA 4KMRA 1U04A 2E6LA 3LFTA 3RQIA 3VNAA 4DWIA 2IOCA 3T6KA 3QLHA 4DTNA 4H8KA 3LALA 4G86A 5FWYB 1RTJA 1BL3A 3NF8A 1LK0A 2L19A 3M8PA 3P83D 4HVJA 3HVTA 3L2WA 4MQFA 3RVNA 3CG7A 1QKKA 1K66A 2NZVG 4BE0A 2H0AA 4AHTA 1RT7A 1QS4A 1F21A 1JLKA 3GBPA 4LSLA 4YNQA 5KI6A 3TWHA 1WSIA 1HQEA 1J9AA 2FN9A 3H6GA 3LKBA 4I9LA 3Q9SA 2ATQA 5CNIA 4LH5A 1LJLA 1JLQA 1NK4A 5IBQA 3K57A 2HNYA 1P2FA 3OMXA 2P51A 4TSXA 3MA0A 3RVPA 4MR8B 4RXUA 4FCYA 4LD0A 3AA4A 4KHUA 4O4GA 2FEKA 4CBVA 3LUCA 2HHVA 3SPZA 3DLHA 3I45A 3VQ6A 4FJXA 3AVCA 2VYCA 3QERA 2GBZA 5EU7A 2M98A 1VSMA 4Z9BA 2WMYA 1YMVA 4DQSA 1GOAA 3L49A 3LPTA 4DQIA 1BIUA 2GX6A 1HJRA 3JS5A 3PX6A 4MQ3A 3U6FA 4YGXB 2XRIA 2WONA 4LE1A 4DG1A 2JGUA 3V9XA 3AO5A 1DP4A 2A9OA 4FW2A 5IC5A 3U3GA 1GUBA 4RW9A 3GBVA 1HPZA 3KLNA 4Q5VA 2P5OA 1LWEA 4CHZA 3V6DA 3CKMA 4MS1B 1HEYA 4N0QA 1RBSA 4FM2A 5HKOA 4PA1A 4YO7A 1EFAA 4W5OA 4FE4A 3D8UA 4KK4A 5FRMA 4KV7A 2O4IA 3CRNA 1GCAA 2NZUG 3NBPA 1RTHA 5HRRA 4CFCA 4MQEB 1S6PA 3AO2A 4ICLA 2G8IA 4YFUA 4QOZB 3TAPA 3N53A 3V81A 2D5RA 4OG2A 2IC3A 1SL2A 1E6LA 3QEKA 1JWLA 1ZGGA 3HPOA 3F73A 4CJFA 4LE2A 3O75A 4DSEA 6ABPA 3CQ8A 3TX6A 1BISA 4FM0A 3T95A 1JL1A 1R8JA 4DADA 1LW0A 4CJRA 4JAVC 5FWXA 4O5AA 2FQYA 3HEBA 4F4KA 3JVIA 1L5UA 3AVNA 3CU5A 4ID5A 1IKXA 4FJLA 1DTQA 4CJLA 2FQXA 3SV4A 1RXIA 3A0RB 3V9ZA 3OYBA 3EODA 2CHFA 3RVOA 3HUTA 1UOCA 3H08A 4NYFA 2OZMA 4QAGA 3VQ8A 2X6NA 4IKFA 4IFVA 4FLWA 4NCAA 1BVHA 1VLZA 4LDAA 4YS6A 3MXJA 1C6VA 3KLHA 3ZSQA 5FDLA 1DBWA 5DTEA 2P9HA 3PO5A 2FXIA 2QXFA 3UKJA 3PY8A 4Z9AA 1LJUA 3FFWA 1JLEA 1NXVA 2B4JA 9ABPA 4J2BA 1LWCA 3BDPA 3EY1A 3LP1A 3HJFA 1HNVA 3ISNC 4N56A 3Q41A 1ZBHA 3VA3A 1JDNA 4BDYA 1YK1A 3P1GA 5F64A 2XHBA 4GNRA 3QEWA 3RVSA 4GMJB 1BI4A 3RVLA 3OO1A 2XY8A 4FYDA 3TO5A 5HBMA 3CFPA 3I09A 2O4GA 4M42A 4CEFA 1DCFA 5IULC 4Z4HA 3HXMA 1P6QA 4L8RB 2E4ZA 3GT7A 3VQEA 4B9TA 1P8AA 3OQOA 3OLWA 5CZ1A 5TQ0A 3M8RA 4EYOA 3ZT4A 1D4ZA 4CJSA 4DU1A 3LUDA 1IG9A 2FBVA 3KCNA 2FBXA 1MVOA 3T8YA 4RXTA 2KW4A 5DKFA 1TKTA 4EP4A 3QELA 3ZSOA 4JS4A 3QEMB 1QO0D 3V9UA 1EETA 4CK2A 1FQWA 5KGWA 2A9RA 3O1IC 1M2FA 3T38A 1RZRA 3MAQA 4CGHA 3HDVA 4DQPA 1CXUA 4CJ5A 1LAVA 1S1XA 4XASA 3KLOA 1HRHA 1UAXA 3SM9A 4FLVA 2D0CA 1YMUA 2PAFA 1BDIA 3HSYA 1E6MA 2YNFA 2YKNA 2JK1A 3AA2A 3CYMA 1S1UA 4EZ6A 5BRJA 3NF6A 1NXPA 3ZSVA 5SZTA 1BQMA 2R47A 1VSJA 3U3YA 2GWRA 3SQ0A 4O1IA 5J2QA 3URMA 2FBYA 5KQPA 4M3UA 2KZMA 3NF9A 3QLVA 4MR7B 4JA2A 3HM9A 1USKA 4IILA 2DFHA 1SKSA 4B3OA 1MB3A 1DZ3A 3ITHA 5I3UA 4DFJA 5HRNA 1TKXA 4I2PA 2HNDA 3K5MA 3ALYA 5C5CA 3O4QA 1U2QA 4B9MA 3CZCA 3VNBA 3LUJA 3HZHA 3C95A 3NHGA 1HQUA 4CJ3A 1FXXA 4O55A 3HL8A 3OQMA 1URPA 4TLMB 2FW0A 4ID1A 1JBEA 3QX9A 4CGDA 4E1NA 2ZQBA 3EGCA 3H6HA 3I42A 3O2QB 3NFAA 3QLVC 1YS6A 1DJMA 4YWHA 1TK8A 3V9WA 3L3VA 3FFIA 3C6TA 1RBUA 3CFYA 4QICA 3JPWA 1GOCA 3C6QA 4RV5A 3C3WA 3EZ5A 1CXQA 2IPAB 3FMVA 3AVBA 1KLMA 1K68A 4OGCA 2LBPA 5GOTA 4OLAA 3MF4A 4B9NA 1TVMA 3QNNA 4N41A 2H3HA 2VG5A 3L2UA 1DG9A 3OYNA 4KPYA 1ZBUA 2F8TA 1E2BA 4EYKA 3PX4A 1U48A 3LP0A 1TM2A 1O1WA 4RK4A 2X74A 3DBIA 3AO1A 3KKRA 4DF8A 1DRKA 4NQRA 3VA0A 1RT4A 4E1MA 1LV5A 5EWJA 3S3NA 2XDYA 3C3MA 4S04A 1N5YA 4FM1A 3BRSA 2WOMA 1TAUA 3HS3A 4MLCA 4ELVA 2CWDA 1REVA 3C94A 3SCXA 4CEAA 1T05A 2G8KA 4RWEA 2HQRA 2JVKA 4WE1A 2HMIA 2PYJA 1QSYA 3KK3A 1VK0A 1M5TA 1TK0A 4IMJB 4ZTFA 2QK9A 3CNBA 4EVSA 3RVKA 5FWYA 3G10A 3OS2A 2G8UA 2QVGA 4CFBA 1NKBA 3PUFA 3DGEC 1BAPA 1PHRA 4Y9TA 1ZDMA 4CF0A 3I0RA 3VQ9A 2KFZA 3QLUC 1RBRA 3GWGA 4Q7EA 2X78A 1B9FA 3CZ5A 3ZSRA 1RXEA 1VSEA 1EHCA 2IPNA 3OLVA 3DRSA 2YHBA 1PNTA 1ZVVA 1VSDA 4G0PA 3RRGA 1U2PA 3JVDA 3ILYA 4PICA 2PUFA 2E4XA 1D8YA 1JFVA 4XFKA 4CJKA 1OXBB 5HRPA 4GVMA 3O1JC 2EHGA 4CJVA 1DC8A 4KB0A 2N9UA 3M8SA 3H5VA 3B6PA 2PUGA 5EWMB 4S05A 2P5GA 4MRMB 1TGOA 3KD1E 3NH2A 1NXXA 3IDOA 1HYSA 1D9FA 4K8ZA 3A10A 4MS4B 3DOLA 2ETJA 3AVKA 5JNUA 3VQPA 3CG0A 1AB6A 3OY9A 1QNLA 3KJVA 4KQ9A 2BE2A 4CGJA 1Q9XA 1DCMA 2JBAA 3TD9A 1XC9A 3O4NA 3OJSA 4KV8A 4AH9A 4ZHRA 4JASB 4KHWA 3QIPA 2FN8A 4DSFA 3LP3A 1NK5A 5HQJA 1QP4A 4EGSA 3RMCA 5DLEA 4OKJA 3MYYA 3SQ4A 1WSGA 3MXMA 1KGSA 3F6PA 4FLZA 1S1WA 1QQCA 2NT3A 1QP0A 2DFFA 3OYLA 2RKIA 1X9SA 4AILC 4B9UA 4ZPJA 3KLFA 5TE9A 1Z12A 2IDOA 4CERA 4KI4A 1NKEA 4ZTJA 3AA5X 2VWJA 4FJIA 3SUOA 3VQ7A 3HV2A 4E7KA 5IEJA 1QPZA 1D5AA 4DFMA 1VKRA
chains in the Genus database with same CATH superfamily
5ADXA 1JIKA 1L5ZA 2ZJ2A 4CZGA 4DUGD 3D5QA 4QFBA 2DY4A 1X1QA 3TTCA 1JEQB 2QWXA 2AJ8A 2FMFA 5AJUA 4MINA 1QPGA 2W6IA 3Q40A 3T0GA 1PI3A 4IDCA 2O9JA 4UAVA 4YXFA 1ENZA 1SXGA 2A42A 4BBPA 3OAAA 3UH1A 3DTVD 1G9TA 1N33K 3RR7A 2XYQA 3DBRB 4MJ7A 4QGFA 2BFWA 2A9PA 2PXAA 5AOCA 4K9KA 5EFOA 4IG3A 3DP7A 1RWVA 4CEEA 1QC5B 1T24A 5L3SB 4D57A 3OEWA 1ZJ5A 4LV5B 1TA0A 4N12A 4X7MA 1QQAA 1BDGA 1GLJO 1FFHA 2OAEA 2QTTA 5FQNA 3UH0A 4U02A 3W2FA 5CXXA 4PKHA 1L4NA 2D5BA 2VR1A 1JBKA 3VBEA 4ESOA 2A94A 3E9NA 5LQJA 3KB1A 4RK7A 3VX3A 1F8UA 1AM4D 4IBOA 3CPHA 5ALRA 2MMCA 2IHNA 1OKKA 1V4BA 3E22B 1OFUA 4ZK2A 1KVUA 5KTOA 3ORHA 3GEGA 2PUAA 2PO5A 2XNCA 1KU0A 3BD6A 5IP5A 2X4GA 3WGUA 2XUAA 2Q2VA 2R96A 4GW3A 4HFRA 3UK7A 1DXHA 4YDUC 1H2RS 2JLRA 1AZWA 3D0RA 1UF9A 3PPWA 3L7DA 4KFUA 4MGIR 1NRJB 1N5DA 1GQQA 1E3MA 1HLFA 1JPJA 1JT9A 4XPZA 1QQ5A 2BFCB 4P7FA 3KOYA 5DHSA 3U13A 5LYYA 1SC3A 5H82A 3G1WA 4HQNA 3IHKA 4BNZA 5IZCC 3DJCA 4IGKA 1CETA 4MO2A 4MUNA 3MWPA 3NGYA 1H1DA 3NUGA 4JP1A 3OHSX 5B7GA 4JUAA 4R0VA 3SDZA 5BQ3A 1WTAA 2MYUA 5FFMA 4EA9A 2PFGA 2CXTA 4DA7A 3C0KA 5BVHB 3JQBC 2YHIB 1N9GB 3DT9A 1JVSA 1ZEJA 1VHQA 1XLTA 1NF9A 3CT4A 5IT9A 3LDQA 1O9BA 2ZULA 4FXPA 4FZZA 4DARA 4PN3A 1TVEA 3VEYA 1F48A 1XZIA 3T7JA 4AQYB 2ESRA 1RYMA 1FUKA 1ISMA 2WNIA 4PYLA 2OMKA 3ELBA 2H3EA 3Q7IA 4CK3A 1YR2A 1S1MA 4JBHA 4ZVSA 3IUNA 2Q5QA 3LLSA 4NU8X 4QC2A 3ZDEA 4YRNA 4F9EA 1WXQA 2DWOA 3MFYA 1VRCA 3FWKA 3PL5A 4JGBA 3ULDA 1K8RA 5BMOA 3GRUA 4BC2A 3CG4A 4JGIA 5JAOA 3FOEC 4BJ1A 5B36A 2A35A 3FVTA 4X8LA 4F11A 1JXAA 4GI7A 4GW6A 1JG3A 1G7TA 1TLLA 1V47A 3TD6A 3AONB 3TB6A 4RANA 2AR0A 4YAWA 2M1ZA 1KYQA 1X3LA 4EITA 4B09A 4KWTA 1SNYA 4DLZA 5HM6A 2WTAA 1A69A 2PXHA 2ZIFA 3ZV5A 1N3BA 4DA8A 1E1KA 1GITA 4IZHA 3F47A 3LS2A 2FDCA 4UNNA 5DMRA 1G19A 2GZDA 2P0YA 2QS9A 4HUEA 3P9IA 1U45A 3BRWA 3O8OB 4NH0A 4RV4A 3KSAC 2JFPA 4CLDA 1KL7A 4BPRA 3S3TA 5GADl 2XO7A 4X60A 1YDGA 3AFMA 3DOUA 4L6IA 5JISA 3ZX0A 1CB7A 4Y3UA 1JNYA 4YJDA 4E21A 3Q3CA 4F9GA 4BJ6A 1B73A 3AWIA 4AJOA 1NWCA 1QDEA 4KFRA 5K6RA 1XNGA 4C7XA 4IZ6A 4EJFA 1N92A 3HB5X 3VPHA 3MUOA 1SUSA 1TL7C 4XX0A 5KTQA 4MKXA 5M5BA 3BCRA 2XY5A 2RONA 1SC1A 4YGYA 4RMNA 2H48A 3DOOA 3STHA 3KM0A 3SXPA 4F56A 1GTL1 1W36B 2ZYTX 2H9IA 2UUAB 4TKZA 4H03B 4HQOA 3AIMA 5L7TA 4V0LA 4BACA 1Z13A 1U4BA 3MJTA 5D5PA 4BNXA 1UM9A 1EXQA 3VOTA 1GCGA 3ZD8A 4B9VA 1TEHA 4D8VA 2J5QA 4R71A 4NMWA 1VQ5N 4CU2A 2W2NA 5I9NA 3HVRA 1ZPDA 4DTCA 1Q86O 1P80A 1RKBA 4Q16A 5JICA 3DR3A 3E9YA 3G2KA 4XVQA 5T41A 3PP8A 4NNOA 3U7HB 4L6CA 4ZOCA 5IX8A 2H11A 1XAJA 5JVDF 1C4WA 4Y7CA 2LDBA 1ID1A 4CHTA 4MYUA 2ZQZA 2QVCA 2FZEA 4QKQA 3N8HA 4IS2A 3ENNA 3IPCA 3OFSA 4X71A 3I0SA 2V3VA 4HXGA 1MHTA 3OHPA 4C7BA 1Z2OX 3HZOA 1NI4A 1PWZA 1X9GA 4DJAA 2EYQA 5I9LA 3C3PA 3D3WB 1WP9A 4E1JA 1THMA 5LL6Z 2IUYA 1OR8A 1QF9A 2Q46A 3B5JA 3CLRD 4FYMA 4KQMA 2QLTA 1QYWA 4S0ZA 5HILA 2P4EA 1IRXA 2R66A 1P44A 1T13A 3IVRA 4OMCA 1LQTA 4H31A 3WADA 4CFSA 3P2KA 2BFEA 1Y9EA 4IKEA 5BN5B 1Z29A 2G4CA 4H60A 5IKOA 3V33A 4IBNA 4M4SA 1O0BA 3BIOA 2O3TA 4AJ4A 1WPGA 3HLTA 1GG5A 3A1CA 2O0HA 3W9UA 1ISFA 3G9XA 4K2AA 3TK1A 4U7GA 3F5MA 1JKFA 1IG0A 1VE7A 2KHZA 3KWFA 1BZYA 1QGOA 3MC1A 4BMNA 3R3WA 4FBLA 1NM5A 2HBJA 3E23A 1CVRA 5FTWA 1G3IA 4U7DA 4CF9A 4B3HA 4DLSA 2VG6A 1U1CA 5AKHA 4OHMA 4DLPA 4A0HA 1DE0A 2C95A 5A3QA 2MSNA 5IUNC 3AYZB 3L7NA 2VK1A 3PC8A 4FFLA 3KLGA 4BRSA 6AT1A 2WY2D 3V34A 4RD4A 1I7SB 4TTJA 2IU3A 3GLKA 4W5HA 1N6IA 1UKAA 1U9IC 1XOIA 3A0UA 3FPBA 3V1UA 4XRRA 2OL4A 5DYWA 4C43A 1ULUA 4IV0A 1NBAA 2JRLA 3K0EA 2C4NA 4GMFA 1XAHA 1NW4A 4WN3A 3UMVA 5K20A 4X92A 3C6HA 1KEVA 4EO9A 2OTJN 1YZGA 1E1RA 821PA 1KEEA 5ISMA 1DINA 2C0QA 2JIOA 2FZCA 2IV2X 1P5FA 3GJSA 2I65A 4P22A 1KKLA 1MPXA 1ODSA 2HTEA 2Y0BA 2Z57A 4E7JA 5AKXA 1G9SA 3LAMA 4CECA 3BXOA 3O4RA 4LSZA 4R2HA 1YRHA 3KDSE 1ZD8A 2IXAA 1QVFM 3W06A 1JI3A 1BHSA 3U4AA 3VR3A 4ACAA 2FXUA 3C7KA 4GZ6A 2IHZA 3RT7A 5L3QA 1V5WA 3KZOA 3O3CA 4C4AA 2E21A 4NU5A 4DM7A 1CYDA 2I8CA 5B64A 2CVHA 5U9CA 5K2OA 3NEPX 3HFJA 4A73A 2UYOA 1OB5A 3UWPA 1J54A 1KIAA 4C7OA 1YR3A 3U7RA 4YP7A 4MMYB 1P1JA 3FGOA 3B6IA 3OTQA 3CCJN 5DHFA 5B2ZA 1I3NA 2HEGA 4EBFA 1ESEA 5JBQA 1Q1NA 4U9IS 4W7HA 4FM9A 3F8SA 1MO5A 3FDXA 5KSOA 4EHNA 2VJCA 4EPXA 3LWNA 4O59O 3PJDA 1KC3A 1T6XA 4B2IA 3E8SA 5KAMA 4MLPA 3Q1KA 5J1TB 2P7HA 5GP1A 1UR5A 1DRJA 4JWKA 4WLOA 1CF9A 2X1VA 4MP8A 1JKIA 3LVRE 2HHAA 3P26A 4HLNA 3H1BA 3QTLA 3JVEA 5DU2A 3UJ6A 3TABA 3IG1A 3R77A 4EX7A 3IR7A 3TAXA 5L3RA 1D2AA 4ZANA 4D4MA 1OX4B 1ISIA 1U0LA 5E4FA 1LB1B 5KX5F 5THKA 2BGJA 1WZUA 4NZPA 2BEVA 1K0UA 3NGLA 1A71A 3ZEUA 3LFHA 3LHSA 4B4WA 1D2GA 3B9PA 1M72A 1ATNA 1R0RE 1M1KO 3NHPA 2GPAA 1H2EA 2QY9A 3QFSA 5BR4A 1MAHA 4N18A 3N3AC 1HPMA 3B1VA 1JQLB 1V9SA 3KLBA 1NYQA 4DRZA 5EIEA 2CLIB 5JY6A 3VKHA 2WHYA 4OGWA 3A58B 2V55B 3CVYA 4TT3D 3FXAA 4L4ZA 2OK8A 4DNOA 2GN6A 2YFHA 1XQWA 2Z5VA 3NO4A 4BKUA 1E4VA 4J07A 5DASA 4DSZA 3ANXA 5I7HA 5BOSB 2X6TA 3OYCA 1AK1A 5KSWB 3SM3A 4LDZA 5DX1A 1R6TA 1E2UA 1SN7A 1Z26A 4Z99A 1JALA 4GGOA 4JI7K 1QTMA 4REMA 4U8GA 2CFIA 3BRQA 3O95A 5KTNA 3DLGA 3L7AA 2XW6A 3T3FA 3SR4A 3CEMA 1ITGA 1YITN 2YIVX 1CC1S 3L6UA 4GZ3A 1FS6A 3FPFA 3O3OB 3SR0A 2HA5A 2ZR7A 3D4OA 1JFRA 3GH3A 4LMPA 1NZJA 4NK5A 2QG9A 2FFHA 5KPDA 2XRZA 3J7ZO 1HUQA 4EMUA 1U6ZA 3S8EA 1U7XA 2CHVA 1CG6A 2GT1A 4WDRA 4W5RA 1Y8QB 2AEMA 2G06A 4Q4HA 4EATA 2CVFA 1JLAA 3B6OA 1NR5A 3CC2N 2H0QA 2YFKA 1F3LA 3DWGA 2X4DA 1ENOA 1TO1E 2V3WA 4G36A 3KB8A 3C7NA 4QO8A 4AMZA 2IGTA 4IJQA 4YA6A 4CKZA 4FWTA 5C42A 2IHUA 4RA9B 4A3SA 4A8JB 4M36A 1MO3A 2OFFA 5C4GB 2OCLA 1QHAA 3TOVA 5C0YA 1D1PA 2NW6A 3HDJA 3NKVA 3QXJA 2YI1A 1UJBA 4U4AA 3BGOS 4C4SA 2PXCA 3PFKA 4CGIA 4HH3C 2XUPA 1SD5A 4PNHA 5K3FA 4M46A 3RYTC 4PYRA 4OXNA 1AQNA 1XFDA 4DTPA 2W8BA 4M98A 2AZDA 3MG9A 2QKKA 3TGPA 3K1YA 4QT4A 4NE9A 2BH2A 1G8FA 2Q1SA 2H1CA 1OLUB 4IPTA 3II6X 4KVZA 4CT0A 2BFFB 4FKMA 3I3SR 1POXA 2C9MA 4DQUA 2PUJA 5JNLA 3DAHA 1E3WA 1AA9A 4LPSA 1BE0A 1VQ4N 1I2BA 4ROTA 3L0QA 2FQWA 2HL6A 5CVTA 3L2VA 4P93A 4BZPA 1FLDA 2OHVA 2IYSA 4D98A 3UBTA 2JATA 3EXG1 4N49A 1DX4A 3FAZA 1XN1A 2PS3A 2OOKA 5TEVA 2IJGX 3AIKA 3RJ9A 4QXPA 4AF6A 1R0XA 3V2HA 4WZAB 3MMVA 1W2BM 1PVOA 5JZ9A 5I7EA 1OFUX 3DXFA 3MT9A 3AVOA 2OK7A 4ND8B 1FNSA 3BMXA 4PPYA 5JSZB 2OC9A 2R1VB 4XTCS 4HR7A 2ZG6A 3OZAA 3IILA 3KLPX 2HHQA 1Y1SA 4RCZA 5JR3A 3AAPA 1LU9A 2IYTA 1EGAA 2J4FA 1OZHA 4HTUA 1YZYA 3QKUA 4HQKA 4LY9A 4D56A 2OCIA 1ZK0A 2BH9A 3DMPA 5LXTF 4BQOA 4JI0B 4CMIB 1KORA 4FZRA 1M1XB 1PBTA 3V9AA 3FKSD 4JI2K 1WCV1 3GFQA 2GCGA 2I7TA 2V6MA 5HOQA 3F78A 3U44A 2IW1A 1B15A 5TT0A 4OHRA 1F5SA 4UCXA 1BUPA 3BRWD 1V4VA 1SM4A 3HB4X 1SL0A 3LGSA 4LGMA 5DN9A 4ARAA 4IF6A 2NSHA 3H6KA 5EN4A 4BOYA 3EJWA 1LRJA 3C6UA 1OLXA 5EE3A 4QELA 3KXPA 1ESMA 2JIZD 4OKEA 3RYHA 1Q7EA 2WP8J 2I99A 3VR5A 1BH2A 1GKUB 1XVUA 4BGBA 3M6LA 4CGZA 2I6SA 3HBJA 4ZQCB 3SMVA 3DG9A 4LIPD 1QGUB 5G0SA 4M1SA 1G0OA 1NBWA 1SQSA 3J81k 2V98A 3EVFA 3PYMA 1YS4A 2G4LA 3E61A 1WN7A 3OJEA 3R6MA 4Q4CA 4G0MA 3CF6R 1GSAA 3S8YA 3VFDA 1YSCA 2DUJA 2G17A 2G77B 4BGIA 4CFDA 5K3OA 3LC2O 5KCZA 3L18A 5KUTA 4W7SA 3QVOA 3SHWA 2BZ1A 5CCXA 4DC9A 1K3UB 5CA1B 2ORYA 3TX2A 4C20A 5KIAA 1FBTA 1IQPA 1XA4A 1PZEA 3C74A 3NCTA 1MX5A 2Y66A 3EZWA 1OAOA 1A5BB 2I6XA 2B6AA 3HA5A 1NDHA 3EC7A 2HYIC 4N5MA 2DPGA 4N5NA 1X8JA 3IR5A 1MOQA 1QSLA 1T34A 2LPMA 1DFIA 4EKGA 1VLQA 2QJOA 1QQ6A 2Q6KA 1PU2A 2P3OA 1HGXA 3EULA 3Q3EA 1RVDA 4QLOA 1IKVA 1ESZA 2HREA 2ZJ8A 1NXTA 3E3NA 1XDWA 4AS2A 4CZHA 3ZH2A 1F2VA 4ZCMA 2W2XA 2E6MA 3GA5A 3IPXA 3QYPA 1A7JA 4UMFA 4DCUA 4HNQA 1M5RA 2R7YA 4O44A 3AVQA 3FFTA 1GZ6A 2X0RA 2JJ2D 5K8LA 2JGDA 2ACVA 2OV4A 4IDAA 1JMKC 4AJ1A 2G8HA 3RUAA 2XRFA 2WAOA 3ODPA 4PCAA 1GLGA 4Q6WA 1DAHA 4HEQA 5DBHX 3AARA 4XQ9A 2P9PB 1DU4A 1O95C 5SY6A 1JECA 1L4FA 2XAUA 2Z08A 4JJIA 3H3JA 4RZXA 3WP0A 3WNBA 3DT6A 5HP4A 5H8WA 4P7JA 1ACJA 3GOHA 2UUAK 1SXIA 1U8CB 4ECEA 1VPWA 1Z5UA 4EUFA 1BWRA 2PGDA 2WMOB 3OO0A 1SEVA 1W8IA 5DULA 4IJWA 3RVBA 3TZ6A 2Z30A 2QLBA 1S8FA 2C3YA 2WHPB 4Y67A 3SLRA 3DJFA 4MW0A 1U2RA 1WXXA 1HSOA 5AQTA 5CA0F 2QUAA 3ETLA 2I2FA 2YKMA 1H8HD 4KUHA 4BFVA 5HLFA 1EEHA 1VLHA 2DPXA 4N01A 5DBIA 1W19A 2YHXA 5DT2A 2VP3A 1NU0A 2H63A 1NNUA 2FE1A 2PO7A 3VZRA 3X43A 4LY6A 4F2DA 5JZMA 3DTVA 2P5SA 4E3WA 3LBHA 1OASA 4URYR 2J3MA 2KQ2A 3D8SA 2CCJA 3OZDA 5GAJA 4HDSB 4MW5A 3EZ9A 3TNFA 4CM4B 4NJMB 1A9PA 3FFAA 4DM4A 1CUDA 4MUJA 2ZT5A 1VA5A 4MO4A 2WT4A 4GVPA 4R8KA 2MMGA 2DXIA 2PVPA 4JI4B 1BKDR 4Q3CA 3DFMA 1H4QA 5CE3A 1RRFA 2XVYA 3IA2A 1UADA 3NM6B 3DHVA 4HDMA 4DC0A 4LZLA 2OD7A 2YFYA 1YR1A 3NNDA 1ZW6A 3LDPA 1NK9A 1KBOA 2KW5A 5CJJA 3CLSD 4CZLA 4E89A 2F67A 2QHXA 1EQYA 1PDWA 3IQWA 4H6XA 4OLFA 4X7BA 3UJAA 4LRYA 3KL2A 3MWDB 1VTKA 1BU8A 1JEOA 5LM3A 1ZC3A 2NXWA 5FA5A 5FWDA 2EQBA 1EVKA 1FFYA 4EKIA 1F2TB 2ZIUB 2PMEA 4A9AA 1L9XA 1H65A 2B4YA 2X9VA 4MMXB 5AKEA 3EZFA 6REQB 5D6NA 4UVEA 5HNKA 4MKIA 3HN7A 3G0BA 3IVXA 3JZIA 9MHTA 7ABPA 3N2ZB 2P6OA 3M8KA 2AFIB 2WIKA 4W9NA 5HKLA 5FPNA 3ZETA 2VBGA 4DF4A 4UVDA 4X84A 4B8AB 2A5GA 5ALFA 4TMFA 5EQFA 3VJKA 4CHGA 1J5EK 3E9LA 4I3GA 3OOEA 3ICEA 2ODBA 3KJIA 5HRSA 1NSFA 3UW1A 2C9CA 3KZNA 5L3ZA 4CK1A 2VP6A 3KG2A 2PVSA 4GECA 3T3GA 5EPEA 5DCLA 2RB5A 3KYDB 3W0LB 5AZIA 2Z8YM 1AGXA 1Y42X 4AICA 1C0TA 3NONA 1W76A 1M6EX 1W36D 2H9AA 4FI3F 5EJ8A 4ENTA 2QAJA 4UU0A 3QLJA 5ESRA 1N34B 1YGPA 5B58T 2CH6A 4TM7A 4X20A 2QWMA 3IALA 3TUIC 2JJYA 3AF5A 2HHTA 2F90A 4WBNF 2DHEA 1KCFA 4RMIA 3UHPA 4MWZA 3UV3A 5F9HA 2HNAA 1JIXA 5IAEA 3RASA 2XE6A 3VKWA 4Z54A 3S9HA 4MHSA 3EVZA 5LYJA 3PSAA 4HAXA 4Y6QA 4REQB 3L6RA 3ZI0A 4PNPA 1FVOA 1PJ3A 5H5JA 2EP8A 2ZE2A 4FJGA 4OVLA 1FXUA 3F4KA 4G23A 4OTZA 3WB1A 1WSJA 3OYGA 4ZVTA 1JCEA 3G71N 3COZA 1TJ4A 3OTWA 3R5SA 5C32A 2AW5A 1YZHA 1Q12A 3DAOA 3HE3A 3C5CA 4IRUB 3HCBA 2GI4A 2CL0X 2VOEA 3KS9A 2JLAA 4HI0E 3KZVA 4Z9FA 4O8KA 3LZIA 1RDBA 2NV6A 4KZPA 2HT6A 2JZOA 3B51X 3OM9A 1IY8A 4M38A 5HRUA 1LWNA 4WLVA 1B6RA 3NIBA 1WABA 2F1RA 3I5AA 4JRQA 3C14C 1KP3A 2GFQA 4KLZA 4IJ5A 4EW3A 4H0NA 5IRCD 1GDHA 1GLNA 3GCGA 4LZAA 1QRUA 1G41A 2O0LA 3ELWA 3LCUA 2I2CA 3IKMB 3WNGA 3M3ZA 2CJPA 4ETMA 3BFVA 1XNJA 3ITKA 5TIIA 1EP2B 1VJRA 1ZUHA 2IT1A 3EVCA 2JVIA 3LQFA 3J80O 4RTJA 2SNIE 4PYQA 3VQAA 2OWDA 1DEXA 1ZESA 4PBTA 2IELA 4N39A 5DM2A 4BNFA 2G07A 4IDPA 3HTVA 1F4LA 4PFSA 5AQRA 1EK2A 1N2CE 3TM4A 5MN4A 4Q4LA 3EKSA 2YWFA 4CF4A 8AT1A 5A4KA 1A2KC 3G7NA 3RC2A 1V8DA 3R9XA 4CHNA 3ANTA 4LBYA 4Q9DA 4ZOAA 3EXG2 2R5FA 3M9LA 4HX5A 4KLRA 3UFXB 5GINA 1OX5A 2WHRA 2C31A 4GOLD 5A6SA 5IWAB 4FWNA 2V97A 3ZWWA 3LUPA 3QVMA 1ZBSA 2BGLA 4FE7A 4D2IA 4R1PA 4ROSA 3UJ7A 3DZBA 5T3YA 4F4JA 3PGJA 2HPZA 3LG2A 1RAAA 3M5RA 3WUHA 3CCEN 3PR1A 3T7DA 1TEVA 5HE8A 3R6DA 3OX4A 3K9WA 4BFLA 1CJCA 1N8KA 4AM6A 1VJCA 2CUNA 2YFQA 3BY5A 2H51A 3H11A 4PG7A 4XPIA 4TZ6A 1ZNXA 4XGRA 3ENBA 3ZN2A 1HDOA 4CIWA 1T8WA 1USIA 3TL6A 3V4SA 3FA2A 1Z5ZA 4QDJA 3O4HA 4CJTA 4CHQA 2AXNA 4B83A 3P9SA 4ERXA 4Q4DA 5IUKC 4RIEA 2JAXA 1HNWK 2ZBUA 1OZAA 3IB3A 1D9XA 3JYTA 3AEQA 2FBTA 3ULEB 1DIHA 2B61A 1JMVA 2IXDA 3PPYA 1U4OA 1WTCA 2CXRA 2DMRA 2QYSA 4QJIA 1S5JA 4RW8A 4V0QA 1C1CA 4QEKA 4MQ5A 3TE7A 5ALEA 4NFHA 1N2SA 4O2AF 3VTHA 3A4NA 4DQQA 4WEQA 2Q27A 2RPIA 4LGVA 3UMCA 4HZGA 2ALJA 4I14A 3BZCA 1T1IA 1YCDA 1OWPA 3NGZA 3IOCA 4CDMA 5DOVA 1SUEA 3N6XA 5HK9A 1BVYF 1L3TA 1EZ4A 1SXHA 3GQBA 3H4TA 3TKAA 4KR2A 2CL6X 3ZD9A 2YC4C 3OKAA 1YKGA 1FFGA 3ERCA 2YV2A 3OOHA 1ZO8A 1YTAA 1ULSA 4N5LA 1QU2A 4FXOA 5B2EA 1LPOA 2RGDA 6ABPA 5DFAA 3RH0A 1NASA 3WEEB 1YQXA 2OGWA 5FFFA 1YIJN 2YJ5A 4WBNB 4YPOA 3MUFA 3DHEA 1C9YA 1ZH2A 2IUFA 1DIAA 1U81A 4LC0A 2QN3A 1KK2A 3ECSA 4ZAXA 5CYQA 4QTXA 1JDPA 1QH9A 3ED5A 4H1VA 4FVMA 4DTSA 3R7WA 5BR9A 2HLHA 3D6JA 3BWBA 3FB4A 4HHEA 4V0KA 5TVKA 4EEKA 1IATA 3I2FA 3LXUX 4CMEC 5BWCA 1BDHA 2H1LA 1JQBA 4D25A 5GIOA 4A23A 1M1YA 1IKWA 1XA0A 3RRHA 1QYVA 2CXPA 3ZEUB 2UVPA 3EMDA 3KYCB 4JLPA 3FB1A 5KVCA 4DG8A 1Q7TA 2YXEA 4X6YA 5JJCA 2F8MA 4YECA 1L7EA 1SXJB 3MOSA 4DE5A 3AVAA 3HJRA 1D0SA 2QZJA 3N8IA 4PPGA 4XEUA 1G1MA 5T3UA 4U2EA 5AOAA 3LY8A 4O1HA 1KFEB 2Z09A 1DS6A 3RAEC 5TRTA 3KHTA 1YJ8A 3K8ZA 4OB6A 4YOTA 4KIJA 2GR9A 4OV6B 4BRHA 1RPJA 2J5RA 4XDHA 1SUDA 4YLYA 2XITA 4UHHA 2WSBA 1OVMA 4YY3K 1AD2A 3P5BA 2DR3A 4DLUA 3V55A 2EKQA 1YQUA 1N4DA 3KKPA 1Q95A 2W2TA 3H5NA 4YT2A 1DC7A 2HU5A 3RYCB 1JWBB 2Q6IA 4MS1A 2GV9A 1JJBA 4EDHA 3DD5A 4PX2A 4BWJA 1N9GA 2JFUA 2R6FA 3OA0A 3CR3C 4XAQA 1PFUA 5EVJA 3Q11A 1Z6TA 1JL2A 4DTMA 1NOKA 5G4KB 2Z9CA 1GZDA 4Z1MD 3H9UA 3KZMA 3NTLA 2XE4A 4HF7A 5H68A 2ZXFA 3WHIA 1HE4A 1BHLA 4P3XA 4EG5A 3OQ1A 1JFTA 2ZPTX 1NMEA 3GOIA 2Y92A 3RM3A 3B1JA 1ZH8A 3BL6A 1WSWA 5HMMA 2GEFA 1VHJA 4MVJM 4QT0A 3BF1A 4JK8A 5B37A 1Q19A 5GAGP 5BV0A 3GPLA 3U19A 4IHAA 1M66A 3G9UA 4NESA 4IFYA 2HHXA 3RHZA 3WZLA 5K3EA 1QJCA 4Z7NB 1RPZA 2HPHA 4DUYB 4O5BA 1B8VA 2PL1A 1QVWA 4PS1A 2HA4A 4GI1A 1ND5A 4Q9IA 5JJIA 3C4JA 2HO5A 5MF6A 1H8HA 1N0UA 2JIRA 2IIQA 4YCMA 1G8KA 4DU4A 4DA4A 4R2MA 4WACA 1ZKMA 2QTHA 1PRYA 4ZI5A 3CLHA 3LKDA 2CZCA 3Q7CA 4FJJA 2X3FA 3BE6A 3GAAA 5IBRA 3ZU5A 5JBIA 1ISSA 4NKRA 4FMDB 2W6JD 4KUGA 5ALNA 3OZCA 3E3MA 5EZQA 2ZJFA 4M9UA 3M83A 3L0SA 1S1CA 2FUEA 2XGOA 1Z2CA 1T7PA 1S3FA 2NRZA 1Z5GA 2GF0A 3DB1A 3NDPA 4WLUA 4WWHA 3K4HA 3A6DA 3PRHA 1O54A 2HFJA 3W05A 3N6VA 1UEJA 1YBVA 3WNHA 3MCVA 1CZOA 2HRCA 5LQCA 2I4LA 3IAYA 5TNXA 1XVVA 2PYLA 3DUWA 3CW8X 2CB9A 3QVGA 2JD0A 3MRSA 2WF9A 4IUDS 4CM3A 5A5VA 5J58A 5TGZA 4DR3B 2G8NA 4PGMA 2IS4A 3JATB 5CDUA 2XZPA 2JI4A 1TA4A 3CCSN 1ZVMA 2WZDA 3MTIA 1PT5A 3LK6A 4NQZA 4ZODA 1SBZA 2Z4RA 4YRJA 4AYWA 4MEJA 2GWJA 1R3DA 1T2EA 4XIGS 4CL8A 4R2IA 2ZJOA 3QLTA 4W9RA 3WLQA 3SMPA 1DTWA 2P9UA 1C7FA 1W49A 2PMWB 1MIHA 4XWOA 5I4BA 3TIFA 4DLGA 1A77A 3VPAA 1YAGA 1J07A 3OYJA 2DQZA 4INPA 3NIWA 5HJ7A 4JKOA 2IZOA 2WLSA 5ENDA 2R97A 3AO3A 1HJOA 3DMRA 2X7HA 4IVPA 5CVCA 3ND8A 4YRSA 2VJAA 5IASA 3FOAA 4OH7A 5D51S 5JZSA 3OICA 1XU7A 2PZAA 3R9IA 2VRBA 1FEZA 1UMBA 2R6JA 4CLRA 2HK6A 3WLIA 4B81A 5C2JB 4BX3A 2JFVA 5ALOA 1RT3A 3BGSA 2HLNA 3FMIA 4HQ0A 3W3AD 3H5LA 4TN1A 5EG5A 4Z4CA 4B7AA 1C7JA 4MV1A 4BATA 1U0OC 2ISSD 4EH1A 1RBTA 1VQNN 4LKOA 5AM2A 2PUBA 4RK5A 2YWHA 4BO3A 4Z0HO 4KFCA 3D3QA 1KDOA 1HNWB 3GNLA 3HI4A 1HBJA 1ATZA 5J4HA 2C98A 3I04A 5CRIA 1SPXA 3WE7A 1FMCA 2ACWA 1Y5LA 3N87A 4TS1A 1P31A 1QF7A 4QHTA 1CUJA 4QIHA 2VK8A 3K5OA 4B4DA 1AKMA 3EIHA 2D1TA 3RSFA 5E1OA 4LDQA 4HN9A 5BN4B 5HS4A 2E18A 1ECCA 2LSNA 1L9KA 3ABZA 1OYOA 3RG2A 1T9DA 1JLCA 4B0PA 5DM70 3MINA 3JAWB 2UXCB 1L1QA 5A3JA 1AKVA 1HE1C 3INGA 1FB5A 3AF4A 3KKLA 1B8NA 4LY7A 2BUAA 1FJ2A 3PRJA 2XB4A 1XEXB 3NCHA 3EW9A 1T5OA 1FLAA 4ZRNA 1UPXA 1LF5A 3VKGA 1DDGA 2YNGA 2OAQ1 4CT5A 3E1KA 1S6QA 3VNUA 1X7YA 2GZSA 1H66A 4CHPA 4PN7A 1D7OA 5LUAA 2P9FA 1KJWA 1XB2A 1CIVA 4GKJK 1Q91A 1W94A 2OCPA 2VPYA 2ZRCA 3FWNA 1D5WA 3LECA 4NFYA 3DC7A 4U1RA 1YZVA 4R54A 4EUNA 3U16A 4O1MA 4PWZA 2Q6LA 3PEYA 1Q7GA 1ZJYA 1RI5A 2MSKA 1K6MA 3ULEA 1J0BA 4IH9A 3SUQA 1MZVA 1NONA 5T4BA 1PQPA 2OA0A 4EGCB 4D26A 3WLAA 3MQ4A 3KXLA 4C1NA 5AW6A 3FIJA 1KDTA 3PQ2A 4G1MB 4IGAA 2IYWA 1QQBA 2CMFA 3QA3E 5HGJA 1U1IA 3EFHA 1JR3D 1TFUA 3QWHA 1JFFB 1XHZA 1JKHA 1OWMA 1MFZA 2CLKB 2CKMA 2D0OB 3BK1A 3GR6A 3OT4A 1XHEA 4HNAB 4JP2A 1L7QA 5THQA 2IZ0A 1D0IA 5CLJA 4YJ2A 2BC9A 2R25B 3FPAA 4GY2B 1W29A 3ETDA 5ALQA 1KO5A 1QORA 5DYGA 4RTOA 2X2OA 3T5PA 3HJBA 2N42A 2J3KA 1MOZA 3HKDA 1P90A 3E9MA 4C0QC 4DCGA 1AO0A 1JG7A 4H3HB 4WLEA 3KL4A 3WJ1A 3WO0A 2IDKA 2VHZA 5EC8A 5EJ6A 4PYKA 4FB4A 4J2DA 3QF4B 1NYLA 3E7PA 4QPCA 3PO4A 4KR6A 2B3DA 3PYLA 4NMMA 3OYIA 4ZZ2A 4I4LA 3TJZA 1KHHA 1J9GA 1PYDA 5LR6A 4PYOA 1JR6A 2H2FA 4XIUA 1COWD 1RWPA 4A0QA 4YAKA 2FF3B 1SCDA 3DWFA 5I48A 3SQ1A 4U7TB 3CH4B 2DFTA 4LECA 2P9LB 4NZYA 2YWBA 3RROA 2JI8A 3NFRA 3LDOA 4IDGA 4RVOA 4FL9A 1C3XA 1SKQA 3E22A 4FE3A 1SVMA 2EVWX 2O5VA 3EZLA 4H59A 4NU6A 1PVVA 2OKGA 4OGLA 1K5HA 2E2OA 1E3JA 2R62A 3L7LA 5H1YA 5FPKA 1WLJA 3FBGA 1K4YA 1LPNA 2WC1A 3OYDA 2B20A 3A6JA 3JATA 2PZGA 3U9SA 4C0XA 1RILA 3IDSA 4GKAA 4XM2A 1XK7A 1RBYA 3LPMA 5JNVA 1GTRA 1COWA 2JASA 2YWGA 2NVBA 1K86A 4KXMA 5GJVC 3BZWA 4ZALA 3JZMA 5DLYA 3RJ5A 1HZZA 3VR5H 3QEBZ 5CAEA 1RAEA 2IXTA 5JDIC 4KHYA 5JJBA 4CQLA 2HNBA 1U80A 1NJ8A 1JH8A 1YT3A 2BL4A 3CB4A 1M10A 1VLVA 1PR3A 3AGKA 4IOKA 1T9KA 4OMDA 3BBPA 4POAA 3ZZMA 4TS9A 3CX3A 4MJLA 4WCFC 3ODGA 3V4LA 3D2BA 5KQ8A 3SYZA 4DJTA 3NHUA 1J2JA 2I6FA 1BE8A 3AVLA 3IRUA 3KZKA 1BQ4A 3DLBA 2H2AA 1FY2A 1UBUS 1SKRA 1X7WA 3N2EA 2CJFA 3NRCA 4HZUA 1ZMOA 4NJEA 4P4UA 1A5XA 5EFZA 4BDSA 5AVXA 1I4EB 1RQPA 1X8LA 2XHZA 1Y3FE 3E4DA 3PIOL 4KQKA 4TQUS 2LRHA 1A5VA 4U2DA 4ZT3A 2QB5A 5EIOA 2G71A 3FZGA 5AQZA 2K6GA 1Q50A 3K2IA 1P3JA 4B3RB 3OZIA 2PPLA 3AHIA 1F06A 4KCGA 3MGKA 4IGFA 2CHUA 1R0AA 2QN8A 2QM1A 4F8YA 3T5CA 3ZCTA 2BMAA 4XCXA 4BL5A 1CZBA 4PTLA 2EJCA 4M0DA 4AO7A 1KETA 1V4SA 4JV5B 3VSCA 2I2BA 3E3LA 1OXSC 3DNMA 1Y34E 1E32A 3SE0A 4CFYA 2JIBA 1PFGA 5AKGA 4DSIA 3GEMA 4LUCA 3RSCA 4ASUA 1MF7A 5JPIA 4KFTA 3GBTA 1RWWA 1RTKA 3EOAI 4O0JA 4X20B 1XBTA 3TRDA 5B4VA 2A40A 4F46A 5JC8A 2ENWA 4IH1A 4DA6A 4FHEA 1Q5PA 2JJ1D 3EAQA 2JVJA 1NW9B 2WJPA 3N28A 1DJOA 2ODNA 2AVNA 5HIMA 1YF3A 1MAUA 4XARA 1IBKB 3WIUA 3H5RA 4CJQA 1TZMA 2GZAA 2CUTA 1JGTA 1QYCA 4PWDA 2O8DA 1C3JA 4NBLA 1VG0B 2L42A 4EHTA 1KSJA 2YUIA 1GTJ1 3CO0S 2Y0CA 3PCXA 5PGMA 3H45C 1KH1A 2R6CA 2Z58A 5FBKA 4JB2A 2QR5A 3D6VA 3JQ8B 2NWQA 4IWYA 1X86B 2YYZA 3FGNA 4P5DA 1ZH6A 1OQAA 3WY9A 1LGYA 1JDVA 1DBIA 2XRMA 4XH1A 2AI3A 1MU2A 1E1LA 3FGZA 1SQKA 1FP6A 3KQOA 1T6NA 5ALTA 1UP4A 5AQXA 5IWAK 4W1RA 1FYEA 3FDZB 1T25A 5C31A 4BMSA 1DAMA 1UP6A 4EARA 1F7UA 2UZIR 4OO1J 1KPGA 3AUAA 1MRSA 2E4YA 2XYRA 3G2OA 3D5TA 3PCTA 4AJ2A 4IUCS 3I9NA 3MX5A 4MTCA 5C1DA 4DTUA 3FTCA 3NETA 1AT1A 4IR7A 4OVKA 4UOQA 4D4GA 2O3SA 2IK8A 3OKCA 4OA8A 3EZNA 5JAPA 2NO9A 2X8JA 3NBKA 4NJOA 1N36B 4OI0A 1ZNWA 5KKNB 2LIVA 2PLWA 2YHYA 3R7WB 4D6PA 1GO2A 4E1BA 4GPZA 2TSYB 2ZIXB 4HQFA 4K6GA 4H3SA 4BP1A 3L1KA 5BO5A 3VYVA 1MA9B 2V6BA 5IKEA 1XZGA 1YUWA 1H2WA 2HIHA 2W6ID 2YR0A 3AKCA 3KELA 4JKIA 5D2CA 1BRMA 1YS7A 2C8LA 2X6QA 3A2KA 1GPBA 1Z4QA 4K9NA 2RHGB 3VM6A 1DI0A 1JXOA 1NYRA 4AWBA 3IUBA 3AY9A 4CTNA 5IABA 3DE4X 2DTXA 3CLUC 1XJWA 1AE1A 1MQAA 1HWYA 4Z94A 2GRUA 2RH4A 1ZQ9A 3HCFA 2J0SA 1NT2A 4IINA 1YD7A 5E8RA 3IV6A 1WA5A 1OIXA 1SA0A 4UAGA 5KYYB 1TYEB 2HA2A 4PZ0A 5B55A 1T1EA 3JZDA 4JVMA 4KIWA 2PBLA 2ZVQX 3KKMA 2XVAA 3DKVA 4R9NA 4X62K 1SKBA 3UJDA 2GXUA 2VG8A 2NSJA 2ZIGA 2H29A 5JHGB 2VCPA 4Z1OA 1EX6A 1YJ5A 1T8YA 4I3FA 1RCHA 4D8XA 3H0EA 2K7ZA 4COKA 3Q5DA 3VQBA 1VXRA 2QUBA 2H1WA 4DUYK 2R65A 3GLFA 2CCKA 4CBWA 1QIHA 2A14A 3D0OA 2RHRA 4MVJI 4TMYA 3ZCUA 2IKQA 1C4XA 1G20E 1UT5A 1N6QA 1SBCA 1JJ7A 5B1SA 1JL3A 5A7GA 4ETIA 4TYNA 4ZZ3A 3C87A 5HQ3A 3N4QA 1CQXA 2A7QA 2EG5A 2IEDA 2XVXA 3KVOA 1VMEA 1KR5A 1XTPA 3MS4A 4MYDA 3W2EA 4B3DA 4G0OA 3PPXA 3NHAA 2AJTA 1NBOA 4MUXA 3HR7A 3U4DA 1ZAKA 1H1LB 3U4MA 1P5RA 5F3RA 1RE1A 2CBZA 5FBLB 2WC9A 1MGPA 1WV0A 3E35A 1PTJA 3JD0A 1P5JA 5JRZA 3C1OA 2C8KA 3GUCA 2N0SA 4OUDB 3UMMA 3ZDAA 2MSLA 3IUCA 3D6UA 4DJEC 1OCEA 3Q7PA 4R7TA 1E9SA 1U2GC 3G23A 3L6EA 4AROA 4Q1FA 4JL8A 4AXXA 4BLWA 3HUUA 4EUHA 2G1JA 4B43A 1QGUA 2HEIA 2JLSA 4DDVA 2YZNA 3U0BA 1FBNA 4JEMA 3S3MA 3JAMO 1R4MB 3O2NA 2XOXA 4UCQA 1GTSA 2IHTA 3KJQA 3WKDA 3GJYA 3L6OO 2Y6UA 4HUFA 1BXRA 3IO5A 4PNEA 2VNIA 1E1NA 1TW2A 2HQBA 2WD7B 4BLSA 4KRFA 5GAEP 4F3NA 2OKCA 4B1ZA 5KQLA 4QGSA 1SUQA 1HZZC 3COVA 5K6TA 4ZO6A 4GPAA 4PL7A 3O93A 4E2ZA 4OQPA 3QINA 1UPTA 3WLLA 5CB4B 1T0HB 2QAIA 2YYAA 4J3JA 4C06A 3MN1A 3V7WA 2CK3D 3UAWA 4KPEC 3ESZA 4JJAA 3DZCA 5LMNK 3B2QA 4IGEA 1TQDA 2PCLA 1ZXBA 3DAGA 1Q21A 1QK4A 4J0IA 4L8LA 3RGWS 1PJRA 3T4EA 4YH1A 1NULA 1X13A 2FWMX 4BTVA 5J5VA 4DNPA 3U7QA 3HJHA 4BNMA 3EEFA 2PM8A 1ACMA 3GLUA 4XD7D 4JVSB 4LFAB 3T3OA 4DV2B 4LF4B 1J70A 2J7KA 4AJPA 4IZIA 4D3SA 3OQNA 1CJMA 1FX0B 4I9GA 3UA4A 2YXPX 5LQKA 3WGZA 1M3SA 1E89A 3OZBA 3L8GA 4ALIA 5C37A 5ILOA 2PZSA 4JI1K 2DUUA 2O1WA 3E27A 1L3SA 1V8ZA 3DL4A 3PGKA 5CLGA 5C2DA 1RT1A 4G1BA 2Z1HA 3EZGA 1GV1A 5EPOA 3HLKA 4RVFA 4HVLA 2W00A 3PUHA 3KTFA 4KDEA 1RM0A 3GUYA 1XMQK 2V5AA 3NAGA 4QS7A 2BFFA 4LWZA 3FPLA 3VVCA 4EHLA 5IJZA 3A9CA 2E4UA 1FFSA 4M0FA 2ZVDA 3KOZA 1EJ0A 4LJ4A 4N0EA 3J7AC 4DY6A 1KVTA 1Z33A 3BQNB 3LPNA 4D7AA 3VPSA 2XA2A 5KNDD 3HA7A 1OH7A 1KERA 3A1SA 4A10A 4CM6A 5JSFA 2WNSA 3FCCA 5FCDA 4FX2A 4B48A 5HE9A 3O08A 2O8EA 2GBIA 2IEGA 2Q6TA 2QLJA 2XT6A 2ETVA 1QO0A 1YRQA 1DV2A 4R51A 3IVGA 3LP5A 3S1AA 4LNUB 1QQNA 4DLEA 1OAAA 3N0RA 5JZVA 1TE2A 2GO7A 4RZSA 3QE4A 2I7VA 1EP3B 4TWBA 1H2ZA 4BE2A 1L2TA 2HHUA 3KEQA 1I2MA 2IZZA 3JZAA 3MWYW 2QJRA 5DNEA 3MCAB 4DABA 4QCLA 1NU8A 3LV8A 2V0NA 3Q6NA 3WWYA 3LQQA 4OSPA 2C03A 3UPUA 3ICOA 3ZX4A 4LKRA 3FNQA 1CXZA 3VOAA 2ADOA 1U28A 1K3TA 2IOFA 5JXHA 1J33A 2L18A 3TAMA 4Q39A 3NDRA 4M2LA 1GADO 1KRPA 2PIDA 3KYCA 1CCWA 3QK7A 3UUEA 5KNDA 4O2LA 2C8VA 1I51A 4ZI7F 2EKBA 4RTLA 4OBEA 3QUCA 3F6YA 2JHAA 3K2EA 4WOPA 5EJ2A 1CLQA 3S2FA 4P9NA 1OU4A 4BTLA 2O2XA 5K8IA 3B1XA 2HCFA 4GICA 3VMFB 2VPWA 3LZDA 3OJWA 4MRSA 4Q19A 4DSLA 1DX9A 1XLUA 3PNBA 1NOIA 1T26A 1O58A 3FFKB 3NBUA 1XCJA 1KYWA 2ZZKA 1GLDG 1IY0A 1EFTA 4WZBE 3FETA 4FBGA 2BTOA 4J03A 1Z6YA 1VL0A 1YIOA 4RK6A 3QU5A 4MVYA 1C50A 3HACA 1DAFA 3QH4A 3PDCA 3FLEA 2RG7A 3TPQA 2XGSA 4MQLA 4GM0A 2I66A 4CV1A 4D02A 5BNWA 4C88A 1SR8A 3R3JA 4BUZA 3HDQA 1UQUA 1MVLA 1Q77A 4FMBB 3LX8A 5JT1A 2P0EA 3ZR4B 2F1JA 1XP5A 1H0RA 1U0NA 2QRNA 2C2HA 2IOYA 4JKEA 4DF3A 5B3JC 1VI5A 4QYWA 1KQOA 5DCYA 3RJMA 3WDMA 3E0XA 4NOLA 4M1MA 2R9VA 2LXNA 3WZMA 3UHOA 1DC6A 5KQRA 1HLUA 2XKJE 2O05A 4HFMA 5KB3A 2QN1A 4GR5A 2YS6A 3PVZA 1G6Q1 5J4YA 1YRAA 5F35A 3RHFA 2Q4DA 4KQCA 3PDJA 4Z6KA 3A27A 3H8VA 4LDPA 3OT1A 2QUIA 5E4YA 1XXHE 5IN5A 5TPZA 1OW3B 3ZE2B 3J7TA 5AIBA 5I7RA 4HAIA 3M3DA 1BRTA 1T4BA 1EWRA 5I9IA 1GA4A 4UVIA 2H2GA 4KO0A 4ZI7A 2A33A 1NQOA 4GL2A 2W6MA 4B6JA 3VQCA 3KSUA 5HR5A 1NBME 2H4FA 4B3SB 4RFSA 2OG1A 2Z6UA 3C7DB 2EKPA 2X8BA 5LP6F 3Q8MA 1P75A 3ICVA 3L6QA 1OPRA 2OLJA 3N3BC 4HAVA 2Z1JA 2EKLA 4J9VA 4F8RA 4L9SA 1R5BA 4NXNK 3FRHA 5B1HA 2WUVA 1ORRA 1XVAA 3R8CA 3WG9A 1Q9YA 3HXPA 4H0FA 1XAGA 3QFRA 3WQUA 2AOVA 1MO4A 1X3MA 3U5TA 5ALHA 4N1AA 3L82B 4DOMA 4MWOA 3WXIA 4I9NA 3HM8A 4BUJA 3CF4A 3LF1A 3O8DA 5LVAA 3RB8A 4DWOA 2H16A 4W5NA 2SBTA 3ADBA 3ZWDA 2AQ8A 1R8QA 4DLAA 1GAXA 2PUCA 1Y82A 2ZBPA 3I56N 3PWSA 4JBXA 2RF2A 1M73E 4MO5A 1C0IA 4RLSA 4OGEA 1M2VB 1IDOA 1U02A 5J3JA 5AQSA 5I45A 4KFSA 2P75A 1EDOA 3E1SA 3T1HK 1Q0PA 1PJLA 2BGTA 2R86A 3LVQE 2XY7A 4X1KB 1YO6A 3FJYA 4OX9B 4NLLA 1U04A 3PXAA 4XM0A 1DLIA 1E9FA 3C8HA 3KKQA 3LFTA 4IHJF 3RQIA 3WB0A 4B8ZA 1IOZA 4NYMQ 1H2AS 1PYGA 2UZ0A 2XUOA 3CWCA 5EZYF 1M7BA 2C8JA 3G2NA 3H2JA 4D0NA 2GD6A 1M1YE 3PQ4A 3FHOA 3RLIA 4ECAA 1DKRA 1G7CA 3TRKA 1DT3A 2P9JA 5LMNB 1PSWA 1W0KD 4L73A 1LK0A 4BR7A 2IYVA 2PJZA 4AKIA 4ZV4A 2Z4TA 1OFTA 4W6QA 5KYXA 3WTCA 5JLHA 4EQZA 2QBYA 4FQ8A 2VZ0A 2CGJA 1L4KA 5LUBA 4OP2A 4BEBA 5CIYA 3RVNA 3UT6A 1WW8A 1WR8A 2HXGA 1EDDA 1RW4A 1BOFA 2ZBVA 3U7FB 3P32A 3QG1A 4MCAA 3T3PB 5DMXA 1R0CA 3O6WA 3WHLA 3WGTA 3IBCA 3ITNA 4KH0A 3CG7A 2R1ZA 4CZKA 1GG9A 2K87A 4V1CB 2NZVG 3TN7A 4BE0A 1E1QA 1BO6A 2C0CA 2G7ZA 4KEAA 5AI4A 4EHBA 4BFUA 1C9EA 2YINC 3ROEA 3A9TA 3B9RA 2NN3C 3MPOA 4JIGA 3RYIA 1WSIA 2EV9A 4XQEA 2WICA 1HQEA 4PLPA 5D01A 4YP1A 1M8KA 3B9QA 2OYCA 3H6GA 1J0AA 1N8SA 1FUIA 4JHLA 3SI7A 1Y8RA 2EJTA 1G42A 1Z88A 3EVBA 1YA8A 3E70C 4M6WA 3IUPA 4OB7A 5FO0A 5K4AA 4E12A 1WHSB 2ATQA 1DV1A 4BRZA 3NU1A 4AKEA 1QPBA 1LJLA 2Q5OA 3WYBA 1MD9A 5LB4A 1BX1A 3C24A 4EO4A 1HE2A 3HR4A 1IXZA 4RQAA 4N0MA 2HNYA 4E5PA 3DAWA 3E66A 1E2GA 2QGZA 1P2FA 3EDOA 4TGLA 5K0GA 5IVKA 1K5DA 1RHKA 2P51A 4TSXA 1SOAA 2I33A 1OT5A 5FTKA 1XZJA 1NVVQ 4MDBA 2P78A 1UXHA 3FSGD 4MR8B 2R79A 2XWJI 2J3LA 4RXUA 2O8CA 2GZ1A 2B1GA 2FEKA 2OORA 4J3FA 4KYTA 3LUCA 2PBFA 1D8TA 2NPFA 2HHVA 3FE1A 1H05A 5F1OA 2PFUA 4EHDA 3VC2A 3KWIA 3CXUA 3OD1A 4GOND 3GGGA 3VQ6A 8OHMA 3AVCA 1G21A 3B7WA 5K0FA 2VYCA 4N6OA 5KTSA 3HOSA 2IHBA 4I6MA 2XX3A 3P5SA 1H5UA 2WYWA 4M53A 3NP7A 5ER6A 4PBRA 1T43A 3EPLA 2RE2A 2VPQA 1T0BA 1QWOA 4HTFA 3JCZA 3RI3A 4NENB 3JQ7B 3HDHA 2V8BA 3V48A 1PJZA 4GM4A 4BWFB 4E5DA 1NHWA 2JS7A 3BWDD 3L49A 1KKMA 4U6NA 4YBRA 4DR6B 4G0WA 3JS5A 1ZIOA 4HK4A 4TWZA 2G88A 2I34A 5HW0A 3PX6A 1M1UA 4XQ0A 2W2KB 4OI4A 4MQ3A 2CLHB 5JW6A 1YHQN 2JH8A 4U3JB 4G09A 4GH5A 1S4QA 3SF8A 1NN3A 4UM9D 1RMTA 1VQ9N 3DZJA 4DG1A 2W5UA 4WINA 2B3TA 4JT9A 2JFGA 3UM9A 3ER8A 1WUAA 2JGUA 3N2GA 1T6ZA 4HFNA 1UBCA 2R8ZA 5AI9A 4IHJB 5TDHA 4BP9A 1NP6A 4PHTX 3U4IA 5BNTA 2A9OA 1N5MA 3U8XA 2C4VA 2RBEA 3RRNA 3HCDA 4HXFB 4N48A 2VTBB 5KO2A 3QV2A 3NHRA 2P9CA 4YQEA 3E5RA 3D2EA 3HNOA 4XSGA 1H4SA 3GBVA 3COJA 2F62A 2AS0A 2NAFA 5EUCA 3EGXA 3BHMA 4KAAA 5LXTA 2Y1EA 4D9IA 4IV8A 2IHJA 4CHZA 3CR8A 1SVNA 1ZVKA 2XTMA 1KA9H 4B1XB 2ZXEA 3KR2A 4PF1A 3TEMA 2WT9A 2Y1KA 2ZJZA 5CEEA 2HPVA 4ASUD 5TEWA 5I7OA 5DYYA 1I10A 5AJWA 3HP4A 3MTQA 5DN6D 5LQNA 3I62A 2O0MA 3D6AA 2X9QA 2H85A 2P62A 3UWOA 4RUKA 1ZGAA 2HPAA 2ICAA 3DP9A 1ZJJA 4DG9A 1KO7A 4FE4A 1H93A 1RLIA 4BKRA 3TECE 4KK4A 5H9WA 1MB2A 2BR3A 2PG3A 3LOUA 1BGVA 3ZDZB 4CTMA 2COKA 3H8SA 1Q16A 2ZKLA 2V4ZA 3LL4A 3RIMA 2DPYA 4KV7A 3ZLBA 2O4IA 2PWYA 4ZOEA 5LP6A 1IVSA 2NZUG 5AQUA 4IOLA 1KYYA 3QE2A 3NBPA 5BRDA 1GPYA 3AYXB 1CR1A 4I46A 1Y5MA 4ND3A 3ONDA 2HBRA 3MD0A 3QU2A 1P2SA 1P9RA 4ICLA 3G6WA 3GP5A 1IJBA 2AC4A 2X8LA 4MQEB 3CLTD 2XB8A 4F4DA 4AJEA 3WGOA 2CLMB 3H18A 5ITWA 4KWIA 2VF8A 3K6KA 1WX1A 3KQUA 3TAPA 4HADA 4C0WA 3OFNA 3RV4A 2PSFA 3HBFA 3WMGA 5FUVA 2Z3ZA 3PHCA 3ZC3A 4DSAA 2YNMA 3I1YA 4LYHA 3PIIA 4OG2A 1L3IA 2XUJA 3ELYA 1FXWF 4J7XA 4JFAA 1SL2A 4L15A 1E6LA 4XWGA 1D2HA 4YVFA 4PANA 1CS0B 1SCUA 4HDNA 4WW0A 1H2FA 4D82A 3FVRA 4KODA 2Q2RA 2GD0A 2IU4A 5KJEA 5EJIA 2Q36A 4GYKA 2B4RO 4MDEA 1IH8A 2QG6A 3DLCA 4BN5A 2MSEB 1UC5B 3D3NA 3O75A 5J4LA 2Q4BA 5B5SA 1DGKN 3HU1A 3TQSA 3R5XA 1MNQA 1M7GA 3GT0A 5AICA 4TUYB 2QWOA 2DHCA 3OESA 1BEZA 2ZTLA 5L4LA 3AF6A 3CJRA 4KI0A 3T95A 3C3JA 1K8KB 1U0JA 4QNMA 1PS0A 1JSRA 4TZTA 1YB2A 4DIUA 4MEBA 1UIRA 3EPKA 2ZS7A 3RABA 3W04A 1HKCA 1FE8A 4O5AA 2NSDA 3Q8WA 1I0LA 1T8TA 3W5VA 1T0JB 1U8ZA 3T1YB 3OZXA 4UEWA 4CM8A 3U4GA 3I04M 1I0IA 2GF9A 3O9MA 4RMHA 1WQ3A 1U0FA 3QE9Y 2OTCA 1SOVA 4B1YB 1LNQA 1H3EA 2WTNA 5D87A 2VT6A 2VAVA 3LQ1A 4DQKA 4ID5A 4RA6A 2FU5C 4Q7LA 3VHXB 2QQFA 1IKXA 1QQ7A 1HKHA 4H16A 4Y6RA 2FOLA 3NZEA 4ME6A 4JCOA 5DNWA 4G07A 3CVUA 4MW2A 4ND2A 3LL3A 1QHFA 4CJLA 3H1QA 2FQXA 3SV4A 3F2VA 4HB2A 3RR2A 1RXIA 1FIUA 1QHSA 3A11A 1DXYA 1J4AA 4HWRA 2ZJ6A 4XB2A 4UTRA 3TGWA 4HLUA 3RF6A 4DT1B 2CHFA 3ER9A 3HUTA 1ETHA 2VNAA 1UOCA 3TTVA 1MDFA 2C94A 3CJBA 4NYFA 7MDHA 4XUCA 3EC2A 3BL8A 3SHOA 2G5PA 3OQPA 2NO6A 2OV8A 2Q5IA 5BN5A 2WU0A 1CBUA 2CHQA 3K9HA 5L7WA 3B12A 2PRSA 2QMUA 4CQMD 2XMCA 2ZE6A 3KBOA 3UFBA 4NB4A 4RACA 3C6BA 3AU9A 2NUAA 2DHQA 2PGOA 1L5GB 2PHZA 3VI4B 3MXJA 2F4VB 5BUZA 1DBWA 3C7NB 1XD8A 4IX1A 4RPKA 2P9HA 1WDWB 1F9AA 5E9AA 5CG2A 2UXCK 3DEHA 3W7BA 1U1GA 3EWNA 4FMDF 2GBGA 4GG1A 4UW9A 1FCJA 1VIDA 5FPHA 3BERA 3UKJA 3OCZA 4HYQA 5T57A 4ZGWA 3UJBA 4L07A 2XNDA 2NAPA 3DZFA 4HS9A 3AUTA 3DUFA 4JJFA 3ZWXA 1J8FA 2B4JA 2CT8A 4J2BA 3W9YA 1G17A 2I67A 3VTKA 2I2DA 2VJDA 4OA5A 5DTQA 4QM7A 1C2TA 1JIIA 4ZC1A 1HNVA 1MJHA 3AY7A 3DV2A 5BWLA 1DWUA 3EZ7A 5C8ZA 1LVHA 4KQ1A 4YAEA 3EHEA 3DZKA 3Q41A 5LQUA 1NAIA 3A37A 3JD3A 4S3MA 1ZBHA 1JDNA 1YK1A 3SDBA 3HB0A 3BTVA 4BS9A 2L0XA 2VN8A 2OSBA 2IH5A 3TJRA 2HSZA 5C8YA 3GDQA 1C80A 1MN6A 4KGXA 4KN6A 4GMJB 1JRLA 1LC0A 4EKYA 1SK9A 1NJ1A 1QVRA 1YXQA 1BJKA 3Q2OA 3R41A 5AXBA 4YUWA 2XY8A 1GN8A 1FFEA 2J85A 5FPYA 4EI8A 5JJLA 1VLMA 2P1RA 3NYQA 2O57A 3SIRA 3U7IA 3D8NA 3IVMA 4R8LA 1OBCA 4AM8A 4KNWA 2B6HA 1MC8A 2E9SA 2F4NA 3ZW9A 1XYYA 2ID4A 2ACEA 1IWOA 4P2GA 4V03A 2ZKIA 3GPCA 2C7BA 2E4ZA 3NEYA 4OU4A 3WVNA 1MX1A 2XDQA 3OZGA 3RSHA 2DP4E 3ZWPA 4EELA 4WH0A 4PYMA 1ABBA 1ZGBA 1I7QB 1E4OA 2DFVA 2XCRB 1ARZA 5JASA 3U3MA 1ZJWA 1X19A 1GZ5A 4FB5A 2YWCA 4WK6A 2QX9A 1IC6A 1R8XA 3COSA 4JNCA 3ZT4A 1U31A 3GLIB 3K7EA 4CJSA 3THYA 3LUDA 1DZIA 4L5AA 3D1LA 4OK3A 4MZXA 1HNZK 2B25A 1W0JD 1HT0A 4IIJA 5DRTA 5F1YA 2GA9A 4WI1A 5EGSA 3S5UA 4RXTA 3T8YA 4N8SA 3GRYA 3VSDA