1YTUA

Structural basis for 5'-end-specific recognition of the guide rna strand by the a. fulgidus piwi protein
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
426
structure length
410
Chain Sequence
MEYKIVENGLTYRIGNGASVPISNTGELIKGLRNYGPYEVPSLKYNQIALIHNNQFSSLINQLKSQISSKIDEVWHIHNINISEFIYDSPHFDSIKSQVDNAIDTGVDGIMLVLPEYNTPLYYKLKSYLINSIPSQFMRYDILSNRNLTFYVDNLLVQFVSKLGGKPWILNVDPEKGSDIIIGTGATRIDNVNLFCFAMVFKKDGTMLWNEISPIVTSSEYLTYLKSTIKKVVYGFKKSNPDWDVEKLTLHVSGKRPKMKDGETKILKETVEELKKQEMVSRDVKYAILHLNETHPFWVMGDPYEGTKVKLSSKRYLLTLLQPYPIKPLSVEIVSDNWTSEEYYHNVHEILDEIYYLSKMNWRGFRSRNLPVTVNYPKLVAGIIANVNRYGGYPINPEGNRSLQTNPWFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(P*AP*GP*AP*CP*AP*G)-3'
publication title Structural basis for 5'-end-specific recognition of guide RNA by the A. fulgidus Piwi protein.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Rna binding protein/rna
total genus 125
structure length 410
sequence length 426
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02171 Piwi Piwi domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1ytuA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ytuA02
2KYRA 4MS3B 3O3GA 2KFZA 3O74A 4RDCA 4EVRA 2YNFA 4CF0A 1VSKA 1VSIA 1BCMA 2MSLA 3GYBA 4CK2A 2PY5A 1JLQA 3P5JA 3H6GA 2R47A 2OQRA 1ZN2A 3LUKA 2HQOA 4ETNA 2YKNA 3OYHA 3L3VA 4OLBA 4PUOA 2G8HA 3Q9SA 4FM2A 3RMBA 1J53A 4JS5A 2PUBA 1B92A 3O3FA 1NK7A 4CEAA 5ABPA 3JSMA 4G0MA 3RVPA 4DTPA 2FMIA 3QIOA 1BHLA 4OKJA 3QELA 4TLLB 1JH9A 3EY1A 1JYEA 4Z4EA 2BE2A 4EYKA 4W5RA 3LZIA 2D0BA 4FZYA 4KQCA 4DTOA 4DFPA 2PYJA 3AVAA 3IP7A 4FK0A 5FRMA 2B4AA 4KPYA 4Z0UA 1BVHA 4Z4CA 4G0YA 3RVOA 5TPZD 5T7BA 4M3ZA 1C1AA 2WY2D 4FLXA 2LP4Y 3OM1A 2G8KA 3M9WA 3K5OA 2E4XA 4PE5B 4KNYA 3SJJA 4B9UA 3QEXA 4BDPA 4M3WA 2GKGA 3K5MA 3T1AA 3QEMB 1XWLA 3OYLA 4HCBA 4CJFA 4MRMA 4CHYA 2HMIA 1FK9A 4MFBA 3QNNA 1RTJA 1VRTA 9ABPA 4IKFA 1D1PA 2IDMA 4H3KB 2HNYA 1IKWA 4EGSA 4BWJA 4CJ4A 1BISA 2VUHB 1B9DA 3M9XA 4OKEA 4PA1A 1DBQA 3H5VA 3O75A 4H3HB 1IO2A 4KVFA 5C24A 4ELUA 3CTPA 5HSGA 1BCOA 3O1JC 1TGOA 4EY3A 3ZT4A 4EP4A 3OS0A 1QS4A 1E2BA 3JTEA 3O4NA 4RK0A 4LH4A 4O44A 1S8NA 4WT7A 2MYTA 1KSPA 1ASWA 2AYXA 3SAJA 4F2RA 1BIUA 4RXUA 3HP6A 3L8BA 4Z0NA 2X6SA 3C6TA 2VWJA 5I42A 2ZAYA 1LV5A 3H1FA 1D2AA 1TK8A 2GX6A 4FK4A 3F73A 3HUTA 1XHEA 2JRLA 4OBBA 3AO1A 1SXHA 5CNMA 1FKPA 1JLEA 4N5SA 3OQNA 4AHTA 3L49A 1Q9XA 3OQMA 4HUGA 5CNIA 1ZAYA 5DGCA 3A0UA 1SUQA 1C0MA 4MPTA 3PY8A 3DZDA 1TK5A 1EX4A 4EVQA 4LE0A 4G0PA 2X6NA 4KK3A 1DLOA 1QPZA 4CGGA 3OYDA 3S3MA 1VLZA 2QR3A 1SKWA 2GWRA 3OYEA 2EX3A 2ITGA 1QSLA 3VQ7A 4F3OA 3MF4A 5GQSA 3HXMA 1WN7A 3HDVA 1LK0A 2ATQA 3V9XA 4ZTJA 3KK2A 1KMIY 3FFWA 3NH0A 3B6OA 1VRVA 3QETA 4JRQA 3IP6A 4N47A 5DK5A 1JDPA 3SNNA 3OYJA 1RPJA 3K5NA 2FQWA 2DTUA 3ISNC 4MR8B 1SV5A 2Q3SA 3C3KA 3KS9A 5EU7A 1X9MA 2LSNA 3SUNA 2HJ9A 1MB3A 3I5AA 1DCMA 3T38A 5TPZA 3V9UA 3N75A 4H8KA 5KGWA 2LIVA 1NOZA 1HEYA 3I8DA 3AVJA 4CEFA 3ROFA 4OPKA 4KI6A 4OPJA 4NYFA 2VK2A 4E7PA 2PZSA 4FJIA 1DC7A 3TMYA 4CCHA 3MECA 2QK9A 4N0PA 4Q6BA 3UIQA 4BE0A 3EAFA 1NXOA 2O20A 1DCKA 3NHGA 4LDAA 2OPRA 3GBVA 4B08A 3TAPA 4D6XA 4DN6A 3THVA 4M41A 2OPPA 4I7FA 3H5LA 4GMJB 1JF8A 3GA5A 4CESA 1MB0A 5JS2A 4B9LA 3SPYA 1FSPA 2IPLA 3QELB 3PUFA 4JP1A 1TAUA 4JB2A 3LMKA 3HSTB 2G8IA 1T7PA 2LBPA 1TKTA 3V1RA 1RT2A 2JLEA 4DU4A 1QSSA 1Y97A 4E19A 2L17A 1J56A 1EFAA 1JHZA 4QPJC 4OTZA 4RK1A 4AILC 4ZMRA 2R7YA 3H75A 2HQRA 3FDFA 1QO0D 3VQ9A 1KLMA 2XY8A 3QLVC 1L3SA 3VNBA 1LW2A 4CEBA 2RJNA 1VPWA 2RPIA 5B3JA 3TD9A 4DSEA 1K66A 4P1ZA 4LSLA 4ZJPA 4E0DA 3KLHA 4GPAA 4KQ9A 4XARA 4ZHRA 5HRSA 4YR7A 3KK3A 4YGXB 4GNRA 2KZZA 2FEKA 1SKRA 4O1HA 4O55A 3KLEA 1DZ3A 3CQ8A 3ZSQA 3O1IC 4QOZB 5J2MA 3H5OA 3DOLA 3I0SA 4HUEA 2IPMA 5KRSA 3JYTA 4CEOA 4CHNA 3KIOA 1RTIA 1RXEA 1YTAA 4CJKA 5HRPA 4L4UA 3PV8A 4M3TA 1VRUA 3NFAA 4MYRA 3ZSZA 5IC5A 3HUUA 1NXXA 1RT3A 1YS7A 4I2QA 4D74A 4EZ9A 2EHGA 3OS2A 4IRXA 3HM9A 7ABPA 2XY6A 1PEYA 3OVNA 2OZSA 1NK6A 1NY5A 4YO7A 5BRJA 2XO7A 1ZBLA 4E1NA 1ITGA 3N6VA 1TK0A 4Z99A 3RVLA 2D0AA 2P51A 3OYIA 1YMVA 1U47A 3TAMA 5JNRA 3HZHA 4DQDA 4EYQA 2LPMA 4DTRA 3SQNA 4OVLA 4FJHA 5TE9A 3Q15C 3A3KA 3IP5A 1RT6A 3DGFC 2GUIA 3L2UA 1HYVA 2QVCA 1URPA 4HYEA 3DI6A 4PYRA 1Q9YA 3H1EA 3QEIA 1M5TA 1DRKA 4CJSA 4E89A 3F6CA 1RILA 1EXQA 2FN8A 1KRPA 3ZSVA 5KC9A 3IS9A 1Q8IA 5SZTA 1MAVA 3AO4A 4IF4A 3SQ0A 2YNIA 3FGZA 4TMYA 1F51E 3A10A 4RZSA 4LE1A 3D02A 3HVTA 1ABFA 1HNVA 1SXGA 4MLCA 1D9DA 1XHXA 4CF9A 3VQQA 1S1XA 1ZBIA 1KCFA 3CZCA 4PQUA 3PO4A 3SQ2A 2P4UA 3VQ4A 3OS1A 4XLTA 4QYMA 4DTNA 2NZUG 4E1MA 4TSXA 5E3JA 4B8AB 3VQBA 3NGYA 2ZWMA 4KREA 4FW2A 4XASA 1QKKA 4DU1A 4K8XA 1LJLA 1X9SA 4NICA 4KHYA 3NE6A 3OLYA 3OYCA 1F21A 4C8KA 4TN5A 4N0QA 2QSJA 3QK7A 5EWLA 1W25A 3QINA 2Y1JA 2FBVA 4NYNA 5TQ0A 4FJGA 2IOYA 4CGIA 2E4YA 4YV7A 1QQBA 1QO0A 2WMYA 1A04A 3N8IA 1RT4A 3AVKA 1NXSA 2FSPA 4DFKA 2PUEA 4BE1A 1KVBA 1BL3A 2GBZA 1L5ZA 1QMPA 3RVRA 3CFPA 4Z4IA 3MIZA 5FDLA 2NT4A 4KRFA 3KKEA 4FJMA 4KTWA 1T05A 2HB5A 2PUDA 2QW1A 1S6PA 1LWCA 1KFSA 5KI6A 4JB0A 4E7LA 4Q5VA 2FVYA 5CNKA 2M98A 4DTXA 4YS6A 3PX6A 3M8SA 5FWYA 4PWDA 1FQWA 1CZ9A 3EQZA 3L6UA 1TMYA 5HRRA 4RSMA 1NK5A 5KRTA 3HPOA 4OATA 4CFAA 3RVMA 3SCXA 2MYPA 4CK1A 5C25A 1K6YA 3H5WA 4ICLA 4RV5A 5IX8A 4NCGA 4CIEA 3FFIA 1JLFA 3H08A 3OYAA 4FLYA 2KFNA 1XHFA 3E61A 3V1QA 3DRPA 4WZZA 6ABPA 1CYEA 1RTHA 4FK2A 5IEJA 5CNJA 4CE9A 3RMDA 2F8TA 4N76A 4RW8A 4S05A 2NT3A 4F8JA 1RCHA 1TAQA 3MXJA 1CEYA 2JVJA 2FC0A 4KHUA 1FXXA 3VN5A 1JYFA 1RXIA 1HRHA 4HNSA 4G0QA 2WJAA 1ZYQA 4DQQA 3U6FA 1CXUA 5FROA 2MSKA 5TQJA 2IS3A 1JLBA 1J54A 4HHTA 1SRRA 1VK0A 3CG0A 4DSJA 1L3TA 3OY9A 2PMCA 3G10A 3WNEA 2IPNA 3C3MA 5J2QA 4E3SA 1E6LA 5CHYA 4FZZA 5HROA 2FKAA 1FKOA 1VKRA 3UKJA 3ZCMA 3RRHA 5J1EA 4LX8A 1TVMA 3K57A 3MM4A 1HNIA 3CYMA 4FJ8A 4FYDA 3V81A 4ZTFA 4KFBA 3AO2A 4Y9TA 3HK2A 4EYGA 1EWVA 2YNGA 3BILA 1C0EA 1VSFA 4O0JA 2VUIB 2DFHA 3DMJA 2WOMA 3DM2A 4Q0BA 1DBPA 1RNLA 3N0WA 2WWVD 3VA3A 3TAEA 4B9MA 1NXTA 2X78A 4W5QA 4N56A 4Z9AA 3DLEA 3PO5A 4B9NA 3I0RA 2YV0X 2HHVA 1RDAA 3GV0A 5C5CA 1Z26A 4FJ9A 3CU5A 4KB1A 4KHSA 2ID7A 1M2EA 4DSLA 1JL2A 3RWUA 5HRNA 4WWHA 2OPSA 2W42A 4FVMA 3HEBA 2NUBA 4CJUA 2RN2A 3P1GA 4M88A 1J9AA 1M5UA 3K2PA 1WSIA 2DFEA 3AVCA 1L5UA 4AHRA 4FLVA 2G8FA 1A5XA 4G0ZA 3SQ1A 3KG2A 5HP1A 1R0AA 4MS1A 4ID5A 4ID1A 3AA4A 1L3UA 4RW6A 3IPAA 1VSMA 2VWKA 3OJSA 4CEQA 3L2WA 2XRIA 3KLFA 3V9WA 1ZHHA 3N53A 1ZBUA 3MYYA 2L18A 4OLAA 1A5VA 2O4GA 1SL2A 3H5TA 2FEWB 4CFBA 4IBNA 3M6MD 3S3OA 4FLZA 4DQSA 3LKBA 4DADA 4FXDA 1SKSA 4CGDA 1W9HA 2D5RA 2OENG 2HVHA 4CGJA 3OO0A 4CJVA 3HPHA 1KVAA 3LUDA 5IUKC 3MEDA 4F8RA 2O4IA 4M3YA 5TQ0B 3BDPA 5B3JC 2Z1IA 3VQ5A 4K8ZA 4ELTA 3LUAA 4CJPA 4LY7A 1VSLA 3CM5A 1EKEA 1VSJA 4CGFA 2BANA 1HMVA 2L2QA 1IH7A 5PNTA 3QO9A 3NBMA 4M3UA 2JB9A 3W9SA 3NAEA 4R5PA 2FQYA 3KHTA 1LW0A 3LP3A 1TL1A 4O5BA 3B6PA 1T8EA 3OMXA 3O4QA 1NXWA 3K5LA 1E6MA 1X1PA 3NHMA 3H5IA 5FWYB 1RBRA 1HPZA 4YLEA 4DF8A 4RK6A 5HKOA 5FWXA 4DFJA 1JLKA 3EYZA 4JRPA 3IPCA 5IBQA 1DBWA 4EYOA 4IG3A 2RF2A 3NH1A 1CXQA 3CLKA 4G0OA 3DRRA 3VQPA 4AHCA 3LWLA 5TPWA 3Q7RA 1A0OA 3NCIA 3S3NA 4Z4GA 1BI4A 1GOAA 4KHQA 1ISRA 4MGEA 3KJXA 3O1HB 5T3YA 3GL9A 4C8OA 4E7KA 3H6HA 4E7OA 1NJXA 1JFVA 1JX6A 4IGAA 2E4LA 2L19A 3LPTA 1JXEA 4LD0A 4PICA 3AVFA 3TI0A 3T8YA 4MS4A 4YNQA 4CF8A 1C0UA 1NK0A 3SV4A 2MSWA 3WNFA 3LUCA 3NF8A 2Z1HA 5HQJA 2QKKA 1LBIA 1WSHA 4S04A 3CG4A 1KFDA 4XAQA 1DC8A 1GCAA 5C42A 4O4GA 1U2PA 4ZMSA 4YP9A 4RW4A 3BRSA 3QLTA 3LFTA 1NK4A 5BRAA 3OYFA 1S1VA 4CEZA 4MLDA 2H3HA 3A0RB 3S9HA 1D4ZA 3QESA 3V1OA 4MR7A 2ID9A 4MQ3A 3Q7TA 4RS3A 5EWMA 1QHTA 2FMKA 4RKRA 1T03A 4IFYA 2KW4A 1G15A 4KB0A 4F3TA 1BDHA 3KSMA 2ZE2A 1TVRA 1P6UA 2BDPA 2FXIA 2P5OA 1N5YA 1KVCA 3N0XA 2P9HA 1PNTA 4CHZA 1D5WA 4CFCA 4PZ0A 3AVIA 4KO0A 1SD5A 1DCFA 3AVHA 1DJMA 5JNWA 3BGRA 1ZBFA 1JL3A 1B9FA 1AB6A 4G86A 1TKXA 4CJLA 4RG8A 2HNDA 1IKXA 4MRMB 2G8VA 1UAXA 4RK4A 3O3HA 3HSYA 1IIBA 3RMCA 4NV3A 2I6FA 1BQMA 3MA0A 4CJQA 4JA2A 3AA2A 1U45A 4DSFA 4W5OA 3KYIB 1RBSA 3CHYA 4JAVC 3OYKA 5HLFA 4FJJA 1UA1A 4XFKA 4WE1A 1J5OA 3QLUC 3BBLA 1WSGA 1SL0A 3AA5X 3JVIA 4FJ7A 5KC8A 2ZQBA 4Y1DA 3LPUA 3TAGA 1HYSA 3HPGA 4ZPJA 2PAFA 2B6AA 1TL3A 4RY8A 1UWBA 1BDIA 3K58A 1BQNA 1FFSA 3MXMA 4KAZA 4RKQA 4FM1A 3MEEA 3L3UA 3ZT2A 4I9QA 4BE2A 3IRXA 3LUHA 2X74A 1REVA 5DMRA 2WB4A 4EZ6A 4OGCA 2JVKA 3KTOA 3S99A 4AHVA 3TANA 4YWHA 1IG9A 3DLBA 1IKVA 2XDYA 2PL9A 4DQRA 2HHTA 1TLFA 3C95A 3SY8A 3QEMA 3EQ2A 4FJ5A 3ZSYA 2CWDA 1BA2A 2PJUA 3RVKA 2ETJA 3I42A 3UUGA 3LP0A 3MQ4A 2WRZA 6CHYA 4LH5A 2F8SA 3T19A 3JS5A 1JL1A 1JWLA 2YHBA 3RVQA 2J48A 2QKBA 3VQ8A 2JGUA 5F64A 1TJYA 1DTTA 3CG7A 2FBTA 2BGGA 1CLQA 5FBKA 2B4JA 3DGEC 3KTQA 1U48A 1QP7A 3ZT1A 3U3YA 1E6KA 1YT3A 4CFDA 1XC9A 4IMIB 3RVSA 3F7NA 1QQCA 1H9CA 1NXPA 4F4KA 3ITHA 3HV2A 3LKVA 3LP2A 1LWFA 1T34A 1CZBA 1P6QA 3KLOA 5KQLA 4DQIA 2G8UA 1B00A 4G1QA 4KKOA 4Z4HA 3AO3A 1MVOA 4G97A 4CK3A 5KQPA 4CJRA 5HM6A 1BGXT 1AB5A 4YFUA 3LOPA 3GBPA 5TQ2A 4F11A 4BDYA 3GRCA 1A2OA 4LSNA 2WJWA 4RK7A 4Z9BA 2D0CA 1ZH4A 1D9FA 4IDKA 3QLUA 1GCGA 3LP1A 3NNSA 4CJ3A 5FWXB 1JXBA 3MMNA 1WLJA 2IDOA 3G85A 1ZGGA 4QCLA 3D45A 5CZ1A 5CZ2A 2TMYA 4RK5A 4MR9A 3HS3A 3EZ5A 3BREA 4QAGA 3URMA 2PYLA 1D5AA 3VA0A 4LE2A 1RNHA 4ETMA 2MYUA 1YMUA 5TPWB 4F06A 3T3FA 1C1BA 3G1WA 1BI4B 2Z1JA 4KFCA 3O2SB 2FBYA 4CHOA 4E7JA 4NCAA 4HNRA 1PNRA 2WONA 3T95A 1WAFA 2Z1GA 4O1IA 1EHCA 4FJXA 3RVNA 4MS4B 2JBAA 1U0SY 2FTKE 2FMFA 1YS6A 2KQ2A 4EP5A 4AHUA 4W5TA 1JBEA 2G8WA 2B1JA 3NNNA 4MAAA 2FBXA 4LDZA 2N9UA 3QX8A 3LANA 3OYNA 1JFTA 4HCCA 3F9KA 1DG9A 3ZSOA 5ED4A 3OYBA 3RRGA 4RW9A 3VNAA 1I39A 1C0TA 1RBUA 1L5YA 4F12A 2HVIA 5DTEA 2CD7A 2E4ZA 1YTUA 4MR7B 1YIOA 4HUFA 4IILA 4FZXC 4L8RB 5EWMB 2A9OA 1RDCA 4DU3A 4CIGA 4UQGA 1Z16A 1NK9A 4MQEA 4DQPA 4BWMA 1XWWA 4F2SA 1PUXA 1YK1A 5GOTA 4KTQA 2PUFA 3M8RA 3L2RA 4HNQA 1FFWA 1RTDA 2V0NA 4CIFA 4MQFA 1ZESA 4YRZA 2FLKA 3HDGA 3ZSWA 4DTJA 3NGIA 1ZGZA 3F6PA 4J2DA 3SM9A 2RGYA 2E4UA 2CHEA 4P98A 3SNKA 3EDCA 1S6QA 4B9SA 3EJWA 1YVUA 5D3GA 3KCNA 4DSKA 2HHUA 1EP4A 3HCWA 1GUBA 1MU2A 1KLNA 3V9SA 1LJUA 2PUGA 3JPWA 4ZYLA 2E6LA 3RQIA 1WSFA 3NBPA 4E7IA 4XIUA 3C6QA 1P2FA 1BIZA 8ABPA 3OLVA 4DSIA 2MYNA 3HL8A 2FW0A 1ISSA 3OLXA 3ALYA 4D6YA 3DOKA 3SQ4A 1VSDA 3CFYA 5C5EA 3PX4A 2F96A 1ZDMA 3KYJB 1K68A 3H1GA 5JNVA 1QQAA 1TKDA 3CKMA 3OLZA 2E6MA 5EWJA 3JVDA 1NTRA 1HJRA 4J2AA 1LBHA 1Z15A 2NZVG 2YNHA 2H0AA 1L3VA 2X7XA 3AVGA 1HQEA 2IC3A 4FM0A 1USGA 3OMWA 3P83D 4CJTA 2HNZA 1I3CA 2A9QA 4TLMB 2P5GA 1C6VA 4I2PA 3KKSA 4CJWA 4IFVA 5DKFA 2OPQA 2HQBA 3HVRA 3P9YA 3AV9A 3D8UA 3RTVA 4XXHA 4DTSA 3AA3A 2OYQA 3LUGA 1QTMA 2PUAA 1X9WA 1KGSA 3SPZA 2HHWA 3KK1A 5I3UA 3KKRA 3NF9A 4CF2A 2XHBA 4KTZA 2A9RA 4NQRA 1VSEA 4M42A 1UOCA 1Z18A 4M3XA 5BQ3A 3HP9A 3DLGA 2AYZA 2IYNA 4CJ5A 2E4VA 3FFTA 3HJFA 3TX6A 3GWGA 3ASMA 1KTQA 1Z12A 4DLGA 1ZBHA 4FLWA 1PHRA 1ZVVA 3KD1E 2XY5A 4RY0A 1N6QA 4UHKA 2VYCA 4DF4A 1RBVA 3DLHA 5IUNC 2PKXA 4C8MA 5TQ2B 2IGIA 1Z17A 1NOYA 3KD5E 1ZH2A 1QE1A 5EWLB 5FRNA 3IG1A 3TABA 4C8NA 5KWSA 2KZMA 1ASUA 3O2JA 1DRJA 3ZSRA 1KRXA 1EWKA 1S9EA 2PE5A 3PX0A 1S1WA 2Q5CA 1RDDA 4H4MA 1U49A 4MR9B 4KMRA 2FEPA 1Z2EA 3VQAA 3RH0A 2OZMA 1I3AA 4B9VA 4HTUA 3TO5A 3ULDA 2JVIA 4M45A 1RT1A 2HHSA 3MXIA 1RZRD 1F4VA 3T6KA 4G0XA 4N03A 3V9ZA 1C1CA 1IKYA 4GW6A 4B09A 2IPAB 2IOCA 3OO1A 4O0IA 3JPYA 1D1QA 3QX9A 4L85A 3C3WA 2JBAB 1Z2DA 2VG7A 2LUOA 4CHPA 4IMJB 2ZD1A 3CRNA 4LZLA 3M8PA 1NKBA 3RVJA 2IKSA 3O2QB 1EWTA 3SYZA 1QP0A 4J2EA 4ELVA 4E7HA 1EETA 2QV0A 4CEDA 3OM0A 5J2NA 1UA0A 4Z4FA 5I4CA 4WXEA 5IULC 4BDZA 3U3GA 1RT7A 4GVMA 3L2VA 3QERA 3SG0A 3OYMA 3UK0A 3DRSA 2FQXA 4MQEB 2IAJA 1EAYA 1JLCA 2QXFA 1W0HA 3E3MA 1RT5A 1JKHA 3LWMA 3AVBA 3TAQA 1QSYA 3HO1A 2DRIA 4MQFB 3C97A 4RY9A 1SXIA 3LAMA 1NXVA 4FJLA 3E01A 1WETA 1ASVA 4FLTA 3NDKA 3NF6A 3KLIA 4JLHA 4CF1A 2R25B 1BAPA 1NJYA 3Q41A 1FFGA 2A1SA 1HQUA 4CEEA 4KHWA 3K9CA 4DMNA 3AO5A 2CHFA 3OQOA 5CYMA 3MEGA 3CFRA 3NHZA 2RKIA 5KGXA 3VQDA 4MS3A 5E41A 5CYQA 4OG2A 3QEVA 3CFOA 2QVGA 3TARA 5KQMA 3KLNA 4AH9A 2AJQA 3TR8A 4NCBA 3BRQA 3RR8A 1C4WA 4DS5A 3GT7A 3EULA 2P1JA 3LZJA 3AVMA 1Y1LA 3B2NA 5EWJB 1ABEA 1U2QA 4KV7A 3IAYA 2DFFA 4QICA 2GBPA 3CS3A 1Z25A 3AVLA 3D0PA 1JLAA 1S9GA 4JS4A 5KTQA 3N0RA 4M3RA 5CY4A 3A2FA 1APBA 4W5NA 5JS1A 2VG6A 4ML3A 3CZ5A 3QEPA 4CERA 4HVJA 2A9PA 3LUFA 1MIHA 1LAVA 3IP9A 3TWHA 1U4BA 4H4OA 2XY7A 3G0ZA 3ZT0A 4KK4A 3LTEA 3QLHA 4CECA 3K59A 1USKA 3LUJA 3R0JA 3WNGA 3C94A 4EUKA 1OXKB 2OA8A 1XHZA 2E4WA 3Q7SA 3I45A 2YHAA 1A5WA 3QEKA 4RU1A 1RZRA 4UHJA 3RR7A 2RJOA 4MS1B 4Q6WA 5IEBA 3MAQA 1GOCA 2RDMA 3JY6A 3TAFA 1NKCA 4O5AA 2VG5A 4FLUA 2HPHA 4RW7A 2FN9A 4BACA 1TV6A 1S5JA 4WXMA 1R8JA 1WSEA 4OKKA 3VQ6A 4DG1A 1JDNA 1YK0A 1D8YA 4CBVA 2QU7A 4N41A 4J2BA 3M8QA 1TM2A 3DBIA 1S1UA 3DYAA 2DY4A 3RMAA 4RWEA 4WUTA 4B9TA 4PEVA 3QNOA 3NH2A 5D2CA 1NJWA 3L2QA 2A1RA 3LAKA 1Z13A 3IDOA 2HSGA 4DS4A 3O21A 5FBHA 4Y1CA 3SUPA 4B3OA 3TB6A 1DP4A 4FE4A 1WAJA 3SZ2A 4DTMA 1SL1A 4DWIA 1P8AA 3FMVA 2HHXA 3CM6A 4IG0A 4CGHA 4DTUA 2PLNA 3FFXA 1WSJA 4KI4A 1DTQA 3QEWA 3DLKA 3SV3A 1GUDA 2QXYA 1NK8A 2PL1A 3KLGA 1OXBB 4LRQA 4FJNA 3QLVA 4QYWA 1NJZA 2R48A 4JASB 4Q7EA 4C8LA 5J2PA 3VQEA 1HYZA 1XI1A 3ZSXA 1U8TA 4FE7A 3LALA 3LDSA 1QP4A 3CNBA 3KJVA 4EVSA 3SI6A 1GLGA 2FMHA 4FJKA 1RDBA 1UDRA 2B5JA 3ILHA 4DLEA 1GOBA 1LWEA 5DCLA 1ZITA 4RXMA 3ZT3A 4JOQA 4PY5A 5JNUA 4KZKA 4KV8A 4OJRA 3NGZA 3HYFA 1VSHA 4ETIA 3I09A 1LAWA 2Y1IA 2KTQA 2HW3A 5BR1A 3V4IA 3OLWA 4DFMA 4H60A 3QIPA 1PEAA 3ROTA 4FCYA 1USIA 1NKEA 1CHNA 2GI4A 2I5JA 1TKZA 3SUOA 2JK1A 1U04A 1JFSA 1WNSA 1JLGA 3HT3A 2FLWA 5KQGA 2PUCA 2JCGA 1QNLA 1BDJA 5HBMA 5JNSA 2R4QA 4FW1A 3ILYA 4YCSA 2YKMA 1RBTA 4CJEA 1KRWA 1ZY2A 3NNDA 4MR8A 2M1ZA 3WNHA 2HHQA 3V6DA 2QZJA 3EODA 3OYGA 4CHQA 5IUJC 1NATA 4RXTA 4FB4A 3OJUA 4AHSA 5SWMA 1S1TA 3K4HA 3EGCA 3AVNA 3NF7A 4B8CA 3DLRA 3VQCA 5JNTA 4KHNA 1M2FA 1O1WA 2GV9A 3SUQA 5DLEA 5K14A 4I9LA 4OGEA 3C6UA
chains in the Genus database with same CATH superfamily
3KZCA 1J1UA 1TK2A 1TE2A 1T2NA 3NC4A 5AW7A 4UD2A 1GAJA 3A6ZA 1M6WA 5A3JA 2HF7A 2YY7A 3CH4B 2ZITA 4D9KA 1KAQA 5HDBB 3ILXA 3GLFE 4PUOA 3IR7A 2PUBA 3JVUA 3O3FA 3NAZA 3C7KA 1WB9A 5TGTA 1RJFA 4TMVA 5CH5A 3EY1A 2BH1A 4X9XA 3ZTYA 5L45A 4NULA 1UBTS 1VZ3A 1NNI1 3WGVA 1EQYA 4G0YA 3C41J 4X20B 3TOXA 5CYPA 4ZVVA 1UZMA 3FCCA 1QC5A 2DMRA 4UHCA 3ZJUA 3CJCA 2HOQA 2ECQA 3HTXA 4MQBA 4BB0A 1OWPA 1QYIA 2BMFA 4YBZA 4YR9A 4A15A 4MRMA 5GONB 4KH5A 1FK9A 3GEDA 3ROGA 1Y9DA 3UTCA 4PQRA 4WZBE 3BIFA 3HYLA 2GKOA 2EJVA 2WTXA 2I7CA 4BWJA 1OROA 5J1TB 5BWLA 3D5QA 1D5CA 1W8DA 4I3HA 4E08A 1DIHA 5C5DA 2EGUA 5HSGA 2VF7A 2H6EA 4H3VA 4EP4A 3BXOA 3DMGA 2J9YB 3Q8LA 1VQKN 2BKLA 4QVKA 2Q6IA 1W5BA 4AQ7A 1H2XA 1BIUA 3L1JA 3WNDA 1QYCA 1RJ9A 2Z4TA 3EVZA 2W6MA 2GEKA 4DJAA 3LHSA 4ALKA 3SQOA 4TMKA 2NVUB 2IP2A 3F6EX 3Q6NA 4YDRA 4QA9A 2E48A 3OW2M 4KUHA 1Y8QA 4ZAVA 5ALPA 3A0UA 3O90A 4YRSA 2DLNA 2OO5C 3AHIA 4ZO9A 2IF2A 3HTVA 4DR5K 1AF4A 2ECPA 4JHDB 2COUA 3ENVA 3KD2A 3NLLA 2R11A 5CE3A 5JMPA 4RELA 2C4WA 5IBPA 2VZLA 3QETA 4JRQA 4N47A 1RYZA 3K5NA 1ZUNB 1N2BA 1I1HA 4AF6A 2WJ3A 3DTNA 1HL3A 1SV5A 2G5CA 5CA0F 2CZQA 2F4NA 1EUZA 1UBKS 4F6RB 4D42A 2ZCJA 2P5YA 4NBTA 1IEWA 4V0NA 4MB0A 4WINA 3N75A 2W4MA 3SIXA 3WEEB 4YJ3B 3RFCA 4CQJA 4TTJA 5LA6F 1WOQA 1M2VB 4CEFA 4WFIA 4GQAA 3HXPA 4DGSA 2I34A 5JSUA 3TYXA 4EYSA 3CCSN 4LWOA 5PGMA 3BD6A 1OVMA 1U4NA 3CLRC 4B08A 1LTHR 3MTQA 1AHHA 4M41A 1K8ZB 1GXSA 1G99A 4RKWA 4IOAL 2HBQA 3LMKA 1O5OA 1SU8A 1T7PA 3OOYA 4P4SB 1BYUA 1QPGA 2ZE8A 4DY4A 5KYYA 4CIWA 2EATA 3KWMA 4D9FA 1JCFA 3LXRA 3QUCA 1R50A 5TF0A 4JJKA 1PKEA 3V1YA 3K0AA 3U6KA 1UOQA 5I7WA 4ZJPA 2EAUA 1NV8A 3OG9A 4C4OA 1H5UA 4NJMB 3LGAA 3ZU3A 2FFBA 3BBPA 4RTOA 1K7YA 4ASUA 5B4TA 1KU6A 4G1EB 3SHVA 1W96A 4IV5A 1YXMA 4Z51A 3FOFC 2PTGA 1YTAA 5HRPA 3A70A 1IB0A 1FMCA 4WHMA 1TEHA 1IUNA 2XQKA 2OYCA 7ABPA 3UUFA 5KKNB 2DOKA 1Z45A 4WQ4C 3TDMA 3GJ8A 1KEEB 4YAWA 3CLUC 1VB5A 3R7LA 3LQRA 2G9QA 1P7WA 3JAKA 1MHTA 3ZGLA 3IPYA 5JDIC 1AMOA 4O0MA 4QBHA 3S55A 4D2IA 4C4YA 2OVFA 3MEQA 2GUIA 1ZCJA 3SD7A 2GN9A 4GOMD 3W6OA 1YIDA 4C3ZA 1EP2B 2IUEA 1CZAN 3MUEA 2OZVA 1K98A 4QVIA 5D87A 4TTAA 1A2QA 1M0WA 3WOHA 1YFZA 1BQ4A 3RNOA 4D98A 5DRTA 1AV6A 1F3OA 1ZJ6A 3MCUA 1KXPA 5JZVA 4BCDA 1WPXA 16PKA 1ZK4A 1PE0A 3B7GA 3NX4A 3FSGA 5SY9A 3CB4A 2ZWMA 1FJGB 3H65A 2YCLA 1VHJA 4I81A 5AQRA 1PVOA 3S5JA 2FFQA 2JEZA 3K70D 2WQ7A 1C3LA 3R44A 2YTZA 2VAMA 3TLYA 1O7JA 1ADBA 4X1KB 3UJ3X 3IDHA 3SLCA 1XFAA 4BE1A 4CF4A 2GRAA 1YJAA 1XZCA 4MZDA 1T05A 2HB5A 5EFZA 3C6XA 4BP8A 5CXUA 4MIYA 1XDGA 1H8ED 2VTKA 4WH0A 5BUSA 2MOKA 1C50A 1RLMA 4BX2A 2HMPA 2ZJZA 3MT7A 3HYSA 3QXJA 4PZ9A 1RKQA 2I0FA 5FPSA 4F92B 4UU1A 2I78A 1TO1E 4HWRA 2QN6A 4RTRA 4P2GA 3F49S 3WB0A 2CZGA 2BMWA 4MRVA 2FMTA 2PU5A 5B4VA 1E64A 4FC7A 3B1KA 3BE5A 1MPXA 5IEJA 2JNWA 4WFAL 1L5NA 4KI7A 1HYGA 4WNCA 3EGEA 1JYFA 1ZYQA 2Y71A 4BEJA 3FOWA 3U6FA 1ZMRA 2D0OB 3AFMA 5CXSA 3BRWA 3IV7A 2LGJA 1DFIA 4TS4A 1SG6A 4WBSA 1SRRA 4R2XA 2IT1A 4CMKA 3MQ2A 3WNEA 3C3MA 3GGOA 1MRZA 5LYJF 3TNYA 1ZCBA 5AJXA 2NMVA 4Q21A 3TBKA 5FPYA 1UDCA 1I8TA 4FJ1A 3UYLA 4GS5A 2WJPA 1A27A 1DC6A 3MWJA 5A5VA 4O02B 1M2OB 4MWTA 1YDEA 2OG2A 3ZY5A 2CLEB 4CTOA 4QKQA 2ANBA 5EQDA 3TAEA 4M63C 3IULA 2AZXA 4TKMA 4MDYA 1R0XA 4O2BA 4TWRA 2HHVA 1H69A 3E5NA 4WKNA 3RTGA 1ESDA 1QQOA 4WNIA 5FD8A 4MV5A 2CVHA 3UJCA 4FVMA 2VDOB 4XW2A 4FMPA 5DFAA 1V3UA 4KX5A 2ZTUA 4XA8A 4BX0A 3A6HA 3DLPX 1I6MA 2H4YA 1U90A 3NXSA 3ED1A 5BR4A 4IY1A 2ZF5O 4MS1A 4EIWA 2JI6A 2PAAA 1M73E 3PXXA 3WBBA 4JT2A 3SIPA 3N53A 1PLJA 3WIUA 4I2NA 3A8YA 2AGVA 2ZWOA 1NWHA 2WHPA 2FGJA 1E1CB 3LKBA 3B70A 3MRXA 4DADA 4JCOA 1NTOA 3PUYA 3N6XA 2D5RA 1ESEA 2OHXA 3M6VA 1L5MA 4ZEWA 3KYDA 3CPWM 1AQ6A 3LVFO 4NBRA 2F2TA 4HEA6 3I1YA 3K6SB 4D81A 3TOVA 4M3YA 3ZDZB 1VCNA 5TJ9A 3A25A 5B3JC 5BPLA 4W7SA 3LUAA 2D8MA 2G9VA 1LTKA 3N7TA 2BANA 3O0DA 1LCIA 2ZUWA 5PNTA 3OHRA 2FQQA 3K0BA 3IV9A 1Q7GA 2FQYA 3FLAA 3RSZA 4HTFB 1G21E 2XXAB 2DBYA 3CT6A 2CXHA 4CBUA 1RC1A 5HWSA 3ZDEA 4CTMA 1JHOA 3C3PA 5FCDA 1CZHA 2G70A 3HGQA 4NQZA 4GP6A 1ZJYA 2CLFB 4PNZA 3USES 2WU3A 4C43A 2POQX 1SVKA 2WI8A 4RGBA 4NG4A 5CAEA 2X1VA 4PX2A 4OHUA 1J6UA 5TPWA 3U7JA 2JATA 3FBGA 5LQSA 3BWYA 2BC9A 1CJTC 1K3TA 5TY0A 4YAFA 1NJXA 4IGAA 3LGXA 3U61B 2ZUTA 3KPWA 2EC5A 4KLZA 3K4QA 3IUCA 5KOJA 4MUAA 2GNAA 2VQSA 3CG4A 3PXBA 3J7ZO 4TVBA 5LD2B 3OF2A 3PR1A 1RLJA 4ECAA 3WGOA 1TGVA 3IBGA 1ATSA 3IVRA 4RV4A 1KSJA 2XJ9A 5MFPA 3R3JA 3OC0A 1O89A 1VG0B 1NGEA 5C0YA 1ST3A 3E48A 1H1LB 1TVRA 1P6UA 5ICGA 1FLNA 4PZ0A 3OX4A 4HN2A 5HUQA 1RRPA 3KXIA 4X24A 2HNDA 3FMIA 3L7KA 3RTCA 2Z04A 4COOA 2QVZX 3OUZA 4NXMK 1ZFNA 3O3HA 3NT2A 3M2TA 4IH4A 4D43A 4LGMA 2DYKA 5E26A 4JAVC 1Z5ZA 1C7FA 1BKDR 4FJJA 2JS7A 1RWMA 5JD6A 4TSRA 1JDVA 1BX1A 2ZZMA 1A9PA 3U4DA 2A9JA 2CJYA 1CQIB 4YK7A 2X8LA 1BDIA 3RBZA 5HBGA 4R8VA 1QMGA 2OBXA 2OAEA 3ZT2A 1ZC4A 1UADA 2XRFA 1L9XA 4A16A 1J1ZA 1M0TA 1JR3A 4OGLA 3O1WA 4YWHA 3WVNA 3EIUA 4ZN6A 5AUOB 3MT0A 1OOEA 3CX4A 4DCUA 5BW5A 5T6MA 3TR6A 4ZWNA 4RD3A 3T3OA 4GMKA 2ZTHA 2BHRA 4V0MA 5IK2D 5IJ9A 2OQ2A 4FKBA 1SQFA 4IIXA 3PQ5A 5JTUA 3FDZA 2UXCB 3G0DA 1H0RA 4OCZA 5LWQA 1QX4A 3MWPA 4Y2HA 1YJ5A 1QP7A 1E6KA 1BDGA 4OXYA 3G2QA 2ZBUA 3ZZUA 1Z4QA 1QCDA 1NXPA 1H8HA 2X58A 4NY1A 4XB1A 4XH9B 3GB9A 3LP2A 4QNRA 2IPOA 3PQ3A 5CB4F 4RW0A 2SECE 1PJ8A 1P44A 1HV8A 5C18A 1V3TA 2V03A 3I1FA 3LVQE 1HT2E 3WAJA 1H5NA 3OPYA 3KJNA 1HDXA 1GCGA 1WDLA 5CHEA 1DUVG 4Y2VA 4WQ5C 4IL5A 1YJCA 3BTSA 3MMNA 2IDOA 1O54A 1KKUA 2X6TA 2WVAA 2GBFA 4BBZA 2GFHA 3V1LA 4PZZA 4ZI2A 1H2HA 2N1MA 1F0NA 4NCAA 2YXNA 2GAJA 3IQEA 4UM7A 1UOOA 4MW4A 4U5QA 2JBAA 4EH1A 5IWCA 3AUXA 3EY9A 3N3AC 1QONA 3MTEA 3VPSA 2RHTA 3HJCA 3FGUA 2RB5A 3OYNA 2GD1O 5ED4A 4BEVA 5SY4A 2E7ZA 2HVIA 1YTUA 4GRDA 2A9OA 1YFKA 2V52B 5JLJA 2GFQA 1O0CA 4FLFA 1AD2A 3YASA 2NXWA 4MO9A 4PQEA 3IAHA 4UMEA 1TQHA 1ULUA 5AHWA 3EASA 4H5WA 1KAEA 5IG2A 3OKFA 5K3CA 1CS0B 2Y67A 4NNOA 5JE8A 3B51X 4QPDA 3X3HA 4ZCMA 2R6FA 4RNDB 2HO4A 4B9SA 2RHHA 5I47A 3HCWA 5CD9A 1K92A 3UYKA 4PZPA 1LJUA 3JPWA 4OUDA 3OZRA 1PWHA 1V2GA 2FRDC 2XUDA 2ORWA 1KP3A 3GH3A 1H1TA 4DV1B 5KQ8A 2A33A 2NO1A 1FXUA 4G1FA 4KR6A 2XYRA 4Q9LA 4BRIA 4FR5A 1RXUA 2XD4A 2P9PB 1MFPA 5DIFA 1RLUA 5CFQA 1WA5A 3CX8A 1HQEA 2IYZA 1PVDA 3O9QA 2QWMA 3KAPA 4K40A 1Q7BA 1XRQA 5EXWA 4U63A 3CCJN 1G66A 1GTVA 4B1WB 4W5HA 3EZNA 5LZ7A 4WCFC 4KXMA 4FDMA 4I50A 1UMCB 4ZOAA 2B99A 1E0DA 3EWAA 4JD2B 3AOEC 2C61A 5LJIA 5A03A 1JFFA 3S44A 1FVHA 3X43A 3I9MA 5AXDA 1XMXA 3I34X 3G0OA 1RMYA 4R68A 5ALVA 5A7FA 2XVYA 2DUUA 3QBVA 3C7TA 1SUCA 1TECE 1SKUA 1OZHA 1FS6A 1SQSA 4KOEC 3HVKA 4DNQA 4NB4A 5TMEA 2A35A 4Q3NA 4UHKA 1G55A 4IHKA 2CUTA 1RHQA 4WZBA 4NBWA 5ALOA 2YHYA 1VQ7N 3MWKA 5KTPA 2AF3C 3IG1A 4JI8K 5JS6A 5IFLA 1HPMA 1LPPA 3K94A 1TU3A 1U49A 2JAUA 5EY5B 1BGVA 4PO1A 4GPIB 1T2AA 4DSAA 3KR9A 5E6SB 2FPIA 5JSQA 2CXNA 2LWIA 3SS9X 3PUIA 2FA9A 2Y1LA 4TT8A 3T7SA 4BNWA 3ZV3A 4J90A 2A0UA 2ZRIA 4F4UA 1YV9A 3LPCA 4IMJB 3CRNA 1Q7TA 4Z9FA 2I71A 4FFLA 3GZNA 1EWTA 4DMRA 3VPGA 3G5TA 1EETA 3IEMA 2AD5A 3B78A 5KYTA 3E8XA 4RFLA 2JFUA 4WXEA 1HPLA 1RT7A 2VBGA 1QQTA 1N6NA 4JJ6A 2HWKA 5JATA 4KI0A 3S8MA 1D2HA 2Y27A 2H2DA 3L0IB 1C1HA 4Y1FA 1B93A 4TLBA 1JDZA 1KEZA 3EZ2A 3LDFA 3NEPX 4YRDA 2X0NA 4RIIA 3LYLA 4WOPA 2WDPA 3BE4A 2YC2C 5ETJA 1U6JA 3WWDA 1O3YA 1NVKA 1ZSNA 3OLQA 5K4HA 4NK5A 4KXFB 3MEGA 4FMCB 2GO7A 1F60A 4TUYB 2J7PD 4OG2A 5A0TA 2FYTA 1OGJA 2ODAA 1WW2A 2P9JA 4KIUA 2HMUA 4NCKA 3TR8A 3K2EA 1QDUA 3A6JA 3EULA 3TLZA 1H66A 3LZJA 1Y1LA 3IURA 3NC0C 2X4LA 4BCCA 3C39A 4ZHQF 1L4NA 3W1WA 2ZJ0A 1Z25A 2AZDA 4KTVE 3AVQA 1S9GA 3CLUD 4PNEA 1Z6TA 1VL2A 1SC9A 3SS8A 4FS3A 4GC9A 1I2AA 3HU5A 4BNKA 3E1GA 5HRUA 3LUFA 1YONA 4GU5A 3IP9A 1QHNA 3SWWA 4KK4A 4MW2A 1DAHA 2Q2VA 5K3AA 4OJKA 2D1YA 4EUKA 5DNYB 3IQZA 4NZZA 1T4CB 4I1SA 5LFAA 5A7HA 2LW7A 1JJ2M 1NJ8A 2BMAA 4K9PA 4X65B 4JOCA 2AXPA 2JD1A 5K8TA 5C81A 3GMDA 3OTWA 1HQDA 2F8LA 1KETA 4I55A 4CKWB 3PGJA 1D8YA 1KK3A 4Y30A 1UXJA 3RKUA 4LOLA 4MWBA 3RMAA 4WZAE 3VU9A 1WLSA 3K1YA 1Z07A 2Q1WA 1F38A 2B69A 4MGZR 4XLLA 4DTCA 5EJ2A 3IO5A 3WYNA 2C8LA 4BUCA 3HNPA 1K7EB 3TB6A 4CMGA 1J97A 4M98A 1HZZA 4L2IA 4ZZ3A 1Y6ZA 4H77A 3TK1A 1KS2A 4R81A 4IIJB 2P6OA 3S2GA 4Q3CA 4FPBA 4FEEA 4B40A 3U13A 1GUDA 1J2JA 2QXYA 2V4ZA 5HQTA 3KLGA 3BSWA 5KMGB 3SBXA 4H4EA 4RJLA 5EKTA 4HAXA 1HYZA 4MROA 1QE0A 1E2GA 1U5AA 1L5HB 3ITKA 4UM9D 2ZJQL 2OLJA 1ZJ4A 3RLFA 4AROA 1SWWA 4IQ0A 4TL6A 3P38A 2DTXA 1LAWA 2KTQA 3V4IA 4PGHA 1WABA 2YMLA 4NAHA 3ZOKA 3BMNA 3R8EA 1X86B 2GI4A 3KQMA 4H03B 1EHIA 1S3SA 1WNSA 2KS6A 3RC2A 2P2SA 3SNHA 3HM8A 1CY8A 4RCVA 4WFQA 2EFGA 2K2WA 3U4HA 3HKDA 3HYCA 4JODA 3CYFA 1YIJN 2HHQA 2EZUA 2JIDA 3V6DA 2ZIUB 1J5PA 3KV3O 5LZ2A 1UPCA 1LVHA 3SN6A 4HS9A 2GF0A 4B35A 3OH8A 3KHSA 2MSLA 3O93A 1GSHA 4B9EA 4C1NI 1PFQA 2OQRA 3KSRA 1SCNE 4OX9Y 1LNSA 1T4DA 2KSQA 5LKRA 3GJXC 1KKLA 4CQMB 1EK2A 1S8AA 4WOBA 3RVPA 4Y9SA 1N8NA 5DVZA 4KBFA 3L7OA 1NT4A 3ZH2A 2CVQA 1CEXA 5FRMA 1UZNA 2HL6A 4Z4CA 1UAYA 5MHTA 5JV5A 2R5WA 2JLZA 2DECA 4PPFA 3IUMA 2JKVA 2ORED 1CBUA 1PWEA 1G8SA 3CC8A 1E2DA 3GVHA 4RLFA 4U7HA 3LWZA 3T1AA 1E7MA 3Q7PA 5CDYA 1VYTA 1E5DA 4QG7A 3I62A 4DCNA 1R5OA 5BSGA 1XAHA 2HA3A 4XQGA 4H7FA 4K46A 4H5RA 4FGKA 3KJHA 2IVOA 3H5VA 1LV7A 5AOBA 2W6NA 1NQTA 1EBFA 4EB3A 3E4DA 1DAIA 2QYTA 4L4YA 3GEEA 2QTRA 1K88A 3ZYZA 2WYWA 3UFXB 1KO7A 1UPUA 2GTHA 4YQZA 4DLPA 421PA 3JQDA 1TAHA 1EEHA 5F7OA 5HKAA 4YRLA 1XU9A 3ZWOA 5CX1A 1RP1A 3ENOA 4RQUA 1C8BA 3PIIA 4K9SA 2DHQA 2OORC 2ECKA 1L6IA 2Q6KA 2QD2A 3D2LA 3M6FA 3P8ZA 1T9HA 1LBEA 3TLMA 2C9ZA 1E1RA 5JICA 1XZ8A 3HZRA 1GLFO 1C7IA 5C10A 5C8DA 4GLOA 4QU0A 3FFWA 1JAXA 2IHUA 5IH3A 2J3JA 3O92A 2GM9A 3ZEUA 2VP3A 1BQ3A 4DJDC 3R2JA 2X6RA 3CCVN 4IOKA 2RD2A 5AQEA 1J0AA 3FBWA 1MB3A 5EGSA 5JYBA 2F7SA 1TEVA 3G2HA 3EGIA 3ZU6A 1NW5A 1WHTA 3DBHA 2R7AA 2LIVA 1YDGA 4PNHA 2O05A 4B2IA 3AVJA 3ROFA 2PSEA 4JFAA 1JKXA 3TMYA 4LCBA 4FGSA 1BX3A 1RKUA 4JAXA 2D2EA 3EIOA 2FR8A 1BMTA 4C6SA 1CZLA 1ZD9A 2E88A 2HWWA 1BX0A 5JS2A 5IAKA 3VNUA 1OLOA 1WM1A 1BS1A 2Q3BA 5JH7F 3NVAA 4CHTA 3IKJA 5KVAA 4QQKA 4N6GA 4G23A 1BDBA 4D02A 5ILGA 3ZZMA 3FDFA 1XUPO 3H2KA 1XO1A 1VE7A 1XU7A 1GGVA 2BZ0A 3P9PA 1FMLA 3DE4X 4S0ZA 3K20A 3M6WA 2JJMA 1UBSB 5HRSA 2KZZA 1QHGA 2ATVA 1YDMA 3TMKA 4LWQA 1SUIA 4E2FA 3VTAA 2IPMA 4LG1A 1XX6A 2C58A 1G6HA 3L18A 4MUKA 1YZVA 3R09A 3L7MA 3ZKWB 2EWMA 1IQRA 4U02A 3DOEA 4C1BA 1NXXA 3UJ8A 2YW9A 1U0NA 3K1JA 4D74A 2Z8YA 1DEXA 1R0BA 3C6HA 4KQ2A 1HUXA 3AUAA 5F5LA 1RYHA 1NK6A 4D3SA 3DKRA 4GPZA 4NOJA 3N6VA 4JU9A 3Q1KA 1YMVA 2XTZA 4ZGBA 1P1IA 1Z73A 2JJ2D 2R8YA 2PT5A 4QOGA 2BTFA 1MO2A 2UUPA 2NSJA 1PG2A 4II2A 1KJ8A 4CJSA 3FYDA 4BLRA 4QQFA 3AJEA 3ZWYA 5D6OA 5SZTA 3DLCA 5LMNK 1A95A 2O8CA 4DJFC 5AO9A 5C80A 4L1KA 2GTIA 3O4GA 1ABFA 3KQPA 4JI8B 5CT6A 4OHVA 4MO4A 3DEKA 1IOWA 3DMNA 4CF9A 4EL0A 4R54A 4BNTA 3OZVA 3C6ZA 3OCVA 4BUZA 1M83A 3DFMA 4XLTA 1A9RA 5KWEA 4P93A 2IWHA 3HJNA 1QRUA 2JFPA 1QB8A 2XZOA 4OHZA 4MO5A 3E82A 4FP9A 1WQ3A 5DM0A 2QSJA 5JDCC 1W25A 2O0LA 1DO2A 4MARA 2QR5A 3CZRA 4A8JA 2WP8J 3SBTA 5HQ3A 1VG1A 4QT0A 3A11A 1QMPA 5DBFA 3CFPA 1P0MA 2X3FA 2ATXA 1KVUA 4MDBA 2HPAA 5EUMA 4CU2A 4KYTA 5CT4A 2QTWB 2V3WA 4DTXA 2WIAA 1W49A 2GRUA 1IZZA 4DJ5X 4ZQFA 1JCGA 4DHWA 4D0NA 3EQZA 3KZ1E 4GRIA 1NW8A 4RSMA 3ES9A 5FB3A 3VO9A 2NUPA 1LLCA 2WILA 3OWOA 4CIEA 1P81A 4B7XA 2G9RA 1AY0A 1CVRA 4FLYA 2PGDA 4C6HA 3E61A 2R6HA 1E4FT 1S2LA 4UDXX 4YJFA 4KPGA 4RW8A 1PRYA 1Z62A 1NN1A 3UBMA 4DR7B 5AFUA 1Q19A 1RPZA 4J4BA 2VUUA 4YVFA 3PNOA 4KX3A 3OY7A 2QUHA 2O2ZA 2AG5A 3JD2A 2EHDA 4Z0HO 1FRZA 3DE7X 1ENYA 2NRTA 5GJVC 1VKRA 1TNDA 3JWGA 1M76A 4DG8A 1JTVA 1MEOA 1LY1A 1P29A 2GZSA 4FILA 3K09A 5ARDA 4FYXA 1IN6A 4O0JA 1VJ0A 2POCA 3CNNA 3DMJA 1G4UR 2WWVD 2KX7A 4U3JB 3K9JA 3PO5A 3ND7A 2GR9A 2QTHA 4ZGGA 3FZNA 3IKMA 3NTOA 3P5BA 2ST1A 2WF6A 3UKUA 2YVUA 2JJQA 3FLCO 3ER6A 2D3WA 2V7VA 4KQEA 3ORFA 1M5UA 2PS1A 1N6KA 4R1MA 1EFHA 4YMHA 2BISA 1Z63A 5C8VA 1X7HA 1ZVJA 4J7UA 4QTTB 4G0ZA 1LPSA 2RHJA 1Z7YA 3GUYA 4X3CA 2VZ9A 4ID1A 3GGSA 1DFGA 1Y1RA 4CT4B 4BE7B 3ZE6A 2XRIA 2J09A 1VHDA 4TVOA 3S3OA 4X8HA 3BL8A 1M9NA 5ILOA 5JVDF 4RTFD 2HVHA 3RYTC 1I30A 3MEDA 3L6OO 3H5RA 1QF6A 2IYYA 4F8RA 4KQ6A 1ZC6A 3UV6A 4E5VA 1OF1A 5KTYA 4M1SA 3ZNPA 2D0PB 1NVXQ 4Y18A 2OK7A 3GFTA 5LPNA 3EXHB 1EKEA 2VR1A 5B6PA 1IPEA 1W88A 3WKEA 2K6GA 3G6EN 1GDDA 4I9NA 3T3IA 4DIKA 4L7VA 3FHJA 3B60A 4RMGA 2RB4A 3HCBA 3TSYA 1GUAA 5FWYB 1Z08A 2GJAA 3VDRA 4JK8A 4N3AA 2AR0A 1GEGA 5FWXA 1ABBA 2HSTA 1OFIA 1VI2A 1SK8A 2ZSIA 2O2CA 1MB4A 1T1RA 1DQRA 5BNIA 1LB1B 1XCBA 4WY2A 2MINB 3CONA 3I33A 3I6ZA 3VBEA 4JB3A 1IBCA 2GCOB 2D4HA 5IT9O 5JFTA 5EZQA 1F8GA 3TSPA 2UZIR 4Y2PA 2QKKA 1JR2A 3VYUB 1ODJA 4XAQA 2VSOA 2I4TA 1CR0A 3QSYA 4Y2XA 3M1LA 1E18A 3QLTA 2XTAA 1EUDA 4G8JA 1KAYA 1G4HA 5AKJA 5IJWA 3BCHA 3H11A 2WICA 3V1OA 4MR7A 3QKRB 2I6UA 3EUWA 4IAOA 4IXTA 1T03A 4AZ0A 1LPAB 2AQ8A 1UWVA 2ZPTX 1S4MA 1ODLA 1X3LA 2B5WA 1AA6A 4K9KA 1PWYE 2ODPA 4BX3A 3LYHA 1IKXA 3BFXA 5T57A 4UASA 3BEXA 3U4IA 3HSYA 3CO5A 5FPMA 3HZZA 4I99A 4RPCA 3IP3A 3M83A 3NCHA 2OCXA 3P96A 1PR2A 1ORHA 4DSFA 2NRWA 3KYIB 2XUGA 4C78A 1J5OA 2ZDGA 1NAHA 2Q1UA 4D4JA 5CPBA 1DGKN 3OCCA 5JRJA 4HFMA 1E59A 1FC0A 4UBJA 2QPLA 1MIOB 3KOWA 3KTOA 4XZ3A 2FFJA 1IKVA 2XDYA 2I91A 2PL9A 5L3VA 2Y93A 2JAQA 4ARBA 1IAQA 3SY8A 3IVAA 2XUFA 3P4UA 2QY6A 3GBSA 4D9IA 3UUGA 3HDHA 2DUNA 1EJ2A 1C9KA 5T8KC 5JXIA 2ZRJA 1KO1A 2YJEA 1JWLA 1GAEO 2WW8A 2I7PA 4L7QA 1E8DA 4M55A 2VDWA 3WSVA 3FUWA 1CLQA 3G88A 1XU4A 2GCEA 1LS6A 1J2RA 2OOKA 4I1IA 3E27A 4YRTA 3VKUA 1DAEA 3ETLA 2OG1A 3LHDA 4FHDA 5JS8A 1ESMA 1JZSA 3T1YB 2ORIA 2Z5VA 3CCMN 4MSUA 3L6CA 5EE5B 2IODA 3HV2A 4WCVA 4B4OA 5HYVA 5KQLA 3ZIAA 1MLDA 2EEZA 3ABQB 2O7SA 1ZS9A 4Z4HA 2ZBFA 4L9SA 1NAIA 4G97A 1XMPA 1QV6A 5CA0A 4FX2A 2PVCA 1GY8A 1F8FA 2BFAA 3BMOA 5CM9C 3O8CA 4FWQA 4MYSA 5A3SA 4L6IA 3ANMA 3F3SA 4HXYA 5H70A 1B14A 3GNQA 4F3CA 5CZ2A 3T1QA 1GKYA 4QAGA 5I51A 5LA6A 1NSFA 1YMUA 3ETNA 4Y2GA 1BOOA 4DA9A 3LM9A 3QFRA 3H3NO 1Q0QA 1GPDG 4K1LA 1UEIA 1TCCA 3LK6A 5F2KA 3ET5A 4W7HA 4R41A 2B1JA 2J32A 3ZLBA 2JHPA 2GTDA 3LANA 2P5SA 2TMGA 4TMTA 3F9KA 3VSCA 1ST2A 1Q18A 3MILA 1BOTO 4WBNF 1NVGA 4IDNA 4B43A 1KJWA 1EVYA 4HUFA 5EWMB 1F6WA 4CIGA 4CM9A 1DKQA 3W6PA 2P6RA 5DULA 3THYA 4KTQA 4NYIR 3SXUA 1FFWA 2P6NA 2PQ2A 5B64A 1VP3A 3F6RA 3QVGA 3EXEB 4HAUA 3UMGA 3SJ7A 1I24A 2G72A 1AHPA 3NS7A 4RCHA 2H1VA 3UBTA 3BAFA 3SNKA 2GEBA 4ZEXA 4ZT5A 4C21A 2VZ0A 4ZAWA 1XVIA 4QXOA 1AGPA 4JYMA 4XIUA 1JI0A 1DAKA 3GVXA 2RE8A 4YOXA 1KEWA 1Q16A 1XZLA 4F2WA 3SAFA 2FPGA 3SQ4A 5ALTA 5JZ9A 3AUKA 1KO4A 5I7SA 1JDUA 4LJ8A 1ZDMA 3H83A 4KBYA 5G40A 1AC5A 1P5JA 2WWIA 1CDZA 1YUNA 4JUCA 5K6AC 1RLTA 2X7XA 4D44A 2ZI6A 1XNHA 3CGWA 3T06B 4IDQA 4F3YA 5J2TB 3OFJA 4XH5A 3A3OA 3FHTA 3R6WA 1VHTA 3VX4A 1NI3A 3SHWA 2I7DA 1T3VA 4LJ7A 1VOTA 3HYNA 2OPQA 2HQBA 1XNRB 3P9YA 2ZYVX 3OQ6A 3RNLA 3DB1A 4NLCA 1M10A 3VMFA 4AUEA 4MPDA 4DTSA 4YC7A 4QTYA 2CEKA 1X9WA 4KXWA 1IV0A 3UG6A 1TYQA 3NF9A 3BYZA 3ENQA 2XHBA 5LMNB 3OJFA 1FP2A 2VLIA 1V11B 3ASMA 5ES4B 3CWQA 4N18A 4CM4B 2P2CA 2WYOA 1CRPA 1H2FA 2VKTA 1DB3A 4RZHA 2RC6A 2OTJN 4Y6SA 1COWA 3TSAA 1NOYA 1UJBA 2UXCK 4BQQA 1QE1A 2AT1A 1QOPB 4IKPA 4B6JA 3E9ZA 4C04A 5C12A 2WKRA 1TW2A 4BRWA 3T1TA 3WK8A 2D7JA 1FFAA 2KI5A 2GWJA 2DSNA 1FU8A 4UMFA 2IOCA 1WCIA 4XGNA 3P39A 4O33A 4EKYA 1SOAA 3OECA 1Z2DA 4QM6A 3GJZA 4ZZ0A 1UUFA 2ZD1A 3GA7A 3WGHA 4IUYA 5ALIA 2G4LA 3OIGA 2PZKA 1P18A 2IS1A 3QGMA 1X7YA 4LFBB 1E2MA 3SYZA 2NXNA 1GPMA 4CGZA 1EGAA 4ELVA 3L8YA 1NBOA 2QV0A 1JJ7A 4KSYA 4QRDA 4Z49A 1YQ9A 1T2UA 1OI7A 1SCDA 4F56A 5M1NA 2REXB 3OYMA 3UK0A 1QZ3A 3P45A 1EX1A 1L4LA 5H80A 1ZISA 4U0JA 3ZYYX 3D1VA 1NM5A 3A6DA 2IY7A 3LAMA 3RRJA 3AM3A 4AZ3B 4P81A 4B87A 4BG9A 4FLTA 3NDKA 3D7MA 2A59A 1Q1NA 1SJ9A 4GW3A 3D6JA 3SSMA 1FP4B 1TA0A 3QRWA 1Y1PA 5LYJA 4FBGA 1W4RA 3GU3A 3SIWA 1ZA1A 4Q4DA 4BGBA 1EX6A 3SYMA 4X6LA 221PA 3LLUA 1VECA 1O94A 2ZI5A 3OZFA 4TTQA 1J07A 4EW2A 5HF9A 5IJZA 5FUMA 2NQTA 4HAIA 4DCGA 2Q4OA 4D99A 3EVCA 1NNUA 2CNWD 1JLAA 4Y2YA 4TSFD 2V1XA 4OXQA 3NKVA 4RHYA 6ADHA 4MVWA 2AQIA 4YV1A 2VEOA 1BXRB 1CUHA 4OP2A 1MIHA 1WKVA 2QZ4A 1K1EA 4DV1K 3IOEA 2V7QA 3UAGA 4RDHA 2OA8A 2IY8A 2BFEA 3HFJA 1TJNA 1BCSA 3ADOA 2NRZA 1GRQA 3K16A 4OXRA 4GQIA 4JEMA 1II8B 2HRRA 2EW1A 2BUPA 5FI1B 1EK1A 3ZHQA 2QU7A 4YRIA 4G4SP 2ZVQX 1JDBC 1TM2A 3NANA 2JEYA 1YGYA 2QLNA 2B83A 4G9GA 2HX1A 3D9QX 1XNJA 5FPTA 1A71A 2VHEA 5KX5B 2A67A 1NJWA 4UU0A 5DTIA 2ZYGA 2ZWVA 3EO3A 4R71A 1M54A 2Z08A 3D7LA 3MINB 4ISGA 4DWIA 2Q6TA 4TL7A 1JHUA 3R23A 2C8JA 3B5JA 1OREA 1DTQA 4B34A 3RYIA 3HZOA 1V8DA 3V1TC 1NK8A 1GG8A 1ZCZA 3E15A 1PR0A 1IE3A 1V9LA 4E2XA 4E12A 4EVSA 2FMHA 2ORYA 2BBTA 3I2GA 1IIRA 4RXMA 2XIQA 5AD1A 1IBRA 2X0FA 4CMBA 4E5KA 3UJHA 3QXCA 2YXEA 2VP6A 4B6OA 4FEGA 2YHXA 2H2HA 2HU7A 2VCPA 3O31A 2FPUA 4MYTA 4DIDA 1VXOA 3DKVA 3SIRA 1STOA 4HVLA 3EY4A 3O38A 3UF0A 4CV0A 5G3YA 5FLXO 1JLGA 3KZXA 3D7KA 1PF7E 3GW8A 2IHTA 4MR8A 2XF2A 4IINA 2V7YA 3EODA 4DSZA 3QPWA 2PUTA 5ALLA 3UPUA 4FUQA 4Q7QA 2CEAA 3VR1A 3W8EA 1RWXA 1W93A 3JQ9A 3VQCA 4E14A 1B3BA 1PJLA 5DLEA 1SOVA 5J5CA 4WY8A 4K6OA 4LZNA 3A9UA 1S3XA 4Z1MA 2WJVA 2YQ5A 1V1MA 4C4AA 5C35A 2XMSA 5DYYA 4C5CA 4IDEA 4D4KA 1E58A 1EM6A 5A9SA 5CFRA 1MTOA 4OLBA 3TZEA 1NW9B 4JVLA 4HH4A 4BNIA 3FZLA 2CMGA 3FCYA 4WECA 1BHLA 4YRRA 1CS4C 4CKZA 4KR9A 3FTNA 1WCXA 3AEQA 3LZIA 5AKZA 1SBZA 4MAFA 4A0SA 1BVHA 1E2LA 3WRXC 1IBKB 2GASA 3VVLA 4FLXA 2Q49A 3KDSE 2BZGA 4W9NA 3K5OA 5G4KB 4E21A 3SJJA 3A1FA 3QEXA 3HUDA 4R2JA 2WK1A 1MU0A 3IR6A 4JEIA 2DR2A 4HNTA 3QNNA 4G1BA 1ONNA 3SBEA 1K86A 4MVJI 4CM3A 2CDBA 1HH4A 3QHPA 3VSEA 3FNEA 1BISA 3TVTA 4EECA 3FI9A 2VPWA 3MAGA 1LSJA 2H1CA 4ZVQA 5C24A 2C0PA 3AGPA 4RTSA 3O1JC 1LEHA 1XZEA 3UB3A 4X65K 3P0HA 5F5NA 3RU2A 3ZLVA 1OI3A 3JASB 1D2RA 4YUVA 3Q8KA 4QBFA 2V6JA 1GUFA 2X8AA 5CB4A 2HXSA 1XLVA 1LV5A 1SZJG 1U9IC 1ZOOA 5GADl 1HDYA 1BOFA 4QXRA 2C4NA 4EY5A 2HT1A 4L3VA 4PGGA 2ZYIA 1DJNA 3IHWA 4NE7A 3ZU5A 4R2KA 3M6XA 3SXJA 5CEEA 1ZK1A 2FJ0A 3T1VA 1KMHB 2QR3A 1PR9A 4GLBA 3OYEA 4LJLA 2AC2A 2RMKA 1QR6A 2ITGA 3FAZA 5GQSA 4BC3A 2ATQA 1N25A 4IGFA 4A2PA 4Z4QA 3DAGA 2H48A 4BVAA 3T5TA 2JFZA 4KQFA 3CVYA 4OJMX 5UKDA 5G1OA 3COYA 3F47A 2JGJA 2ZWPA 4J6FA 1AN9A 3IDZA 3T38A 3MMZA 3MWEA 1L6RA 4J2OA 3RF7A 1S0UA 3K1ZA 2O0JA 4WVLA 4BB5A 1GYRA 4RUKA 3TAHA 1HEYA 4JLVA 4KI6A 2V51B 1Z2NX 2ZE6A 3AR4A 4MULA 1G8GA 3HKEB 5COQA 3AETB 2V7GA 2YMPA 1CYDA 3F5FA 3S2YA 1AE1A 3PIOL 3W5JA 5JEEA 3TAPA 1R15A 3THVA 2Q50A 2XCIA 1R8XA 4GMJB 3GA5A 4MAMA 1OX4B 3BCSA 2C78A 1S1MA 3HBMA 2RG7A 4BTEA 4L28A 4LVUA 1A8PA 2CVZA 3V1RA 4DIMA 2VH1A 5D3ZA 3AVTA 1SQ6A 1TM1E 4H7EA 1J56A 3OT1A 4N5DA 4FCVA 4RK1A 1T24A 3RYCA 1XDZA 1LRKA 4DB3A 2HQRA 3KL4A 1RDFA 4A0HA 4N8EA 2IQIA 4MW9A 4PBSA 4P7BA 1P19A 5DI3B 1D0VA 3VDNB 1VFNA 3I5YA 2A7QA 1EFLA 1JG7A 1COZA 4Y67A 3WMFA 1NUTA 3LBYA 3VJMA 4FDUA 3O73A 4CEOA 2PS0A 5EHIA 1QCZA 4CMEA 3RFTA 3LWDA 4KODA 4LHSA 5E0KB 3HSSA 2QD1A 3REGA 4ECEA 2NPFA 2OZSA 1J0BA 4A03A 3ESRA 3HWX1 2I1VB 2VT3A 3LPDA 2VHXA 2UZ0A 2QLBA 4OIMA 1OXUA 1F0YA 1P9OA 3D4OA 3SYKA 4BNGA 5CHIA 1SHTX 2IVPA 3VSAA 3IXMA 3G7NA 4Q48A 1P9LA 2PSHA 3IP1A 3QEIA 1MJGM 4P2BA 5DIZA 3ABRB 1RILA 2EERA 4ALJA 1PL0A 2RHRA 1F51E 4LE1A 5IYZF 1PGQA 2Q3LA 4MDEA 2P9TA 3FRJA 1NXQA 4MLCA 4Q37A 5DT2A 4XCQA 1R0WA 4DV2K 3EEQA 3EMVA 3QYPA 3SQ2A 3VPCA 2OLKA 5L3SB 2F9LA 4HNAB 5FWAA 2QYSA 3K6RA 1LSOA 5AUNB 4LZAA 4IUBS 1N36K 2MSDB 2NQ8A 1YZUA 2PBLA 4Y9RA 4NICA 3OLYA 1KOGA 2FE1A 4GIBA 3R6MA 4MKGA 3MTBA 4H5NA 1CF4A 3AVKA 3HI4A 3HB1A 2FSPA 5C5IA 1O6FA 1NMQA 4B3DA 2RGDA 4LSMA 2OGUA 3ZHZA 3G23A 5TJHA 4EK9A 3P0IA 4GWKA 3S8EA 1WVMA 2OXIA 3DDHA 3W5IA 1X9GA 2NT4A 4PYKA 3VTIA 4E5NA 4ZHSA 4KLCA 2FOIA 5FA6A 3C85A 3PEYA 4Q5VA 2V9PA 4F96A 3VUEA 3LQQA 2YZMA 3PX6A 4YRAA 3H84A 5CH3A 5FFNA 3SR0A 2K87A 4BNDA 2BEWB 1JXQA 4Q82A 1Z5WA 4TQAA 2G06A 3G0BA 2WAMA 2N46A 1YJQA 4RV5A 4BRKA 4LIPD 3CGGA 3OAAA 2I8LA 5EIHA 5K0EA 4FOSA 4GVEA 5AQSA 2WJGA 3OA0A 2H8KA 4FK2A 3OJXA 3R5FA 4JYAB 1TT7A 3DS8A 3MGGA 4G5GA 2JLVA 5E9AA 4ZHQA 2JLCA 3ZQKA 3THXB 3ZD9A 4MUEA 1JRLA 3PXEA 5DISB 3RUPA 4FZRA 2WKPA 2QZPA 1DIAA 1JLBA 3NHWA 2W90A 5FPHA 1VK0A 4K6MA 1U0RA 4BO4A 4MGYR 4E3SA 5CVDA 1GQOA 4CMCA 3UKJA 1PK8A 5EXPA 4D5EA 3KB2A 3RRNA 1OR8A 2ZXFA 5LWHA 3NO4A 5EMKA 3JYOA 3KR2A 4F2DA 1MO6A 4QDTA 3T35A 4P82A 6NULA 1NVAA 4DM7A 2BGNA 1G20B 3ELWA 2CLKB 3S68A 1EUCA 3RTBA 5C5CA 2RGNC 3A1VA 1G7CA 3CJ9A 1JZQA 2QEQA 4QGBA 4LMRA 2OPSA 3A1UA 2XA2A 4M88A 2G17A 1U8YA 1KEKA 2AHOA 4HAWA 3ZZ1A 3JQAA 1JHAA 5ALKA 1NUHA 4JD5A 4BVFA 4MUMA 3QBEA 4BNVA 1NWKA 4ID5A 2JA1A 3K7EA 3VAYA 3VVMA 1KK2A 1GPNA 2WINI 5F9HA 1L7DA 1SL2A 2QX7A 3T5AA 1OBHA 4FLZA 3IDFA 4HADA 4TS9A 4O5FA 4JKOA 4RM3A 3CEJA 2B9EA 1K8KB 4GXRA 3R7BA 2WWWA 3X1DA 3BY5A 2ARKA 1DTWB 2PCLA 4CJVA 3KZOA 4LCJA 4EO7A 4QXPA 2A9VA 3BDPA 2QD4A 1E2UA 4E33A 4ELTA 2ZUUA 4C30A 1VSJA 1W4CA 1QF7A 3WDSA 1V4SA 3ZHTA 3LP3A 4LJ4A 4FW8A 2BD0A 2Z6AA 5AOAA 4YRQA 4AYXA 3O0TA 1I13A 1X1PA 4R84A 4JBHA 5EMLA 5JSYA 1MAUA 3NHBA 4IIDA 2NTEA 1X3MA 1W2BM 4BZQA 2RF2A 1ULZA 4G0OA 5DHRA 4AHCA 1QV9A 3Q7RA 1RI1A 1B8OA 3GRUA 3JW8A 3ZWMA 3VKGA 3A7EA 3I0MA 2P5UA 2QM8A 3ZETB 3QA9A 4KXUA 2E4LA 4DJEC 1HLFA 3T8YA 2QTMA 4ZO4A 3WWPA 2NN3C 3RSLA 4ARAA 3AHCA 3OZEA 4NU6A 4B1UB 5KNBA 2NW6A 1NJSA 5I8PA 5ADHA 3K73O 2IIPA 3DTVA 2WYHA 4UOQA 2ZB8A 4KRGA 4M83A 1F9AA 1NBAA 4MLDA 1IDN1 3ZNNA 4A5BA 5IDYA 1D4ZA 5B1YA 3PLNA 3C45A 1WD5A 4MCHA 4NDNE 2AMLA 4ZV7A 1JYSA 2C7BA 3OTGA 3VTFA 4NYJQ 1RYNA 4KGXA 2WZCA 2PEYA 2H59A 3M70A 3EUEA 5BWOA 4DR7K 3ZHUA 3D3EA 3ELYA 4HLCA 4IWYA 4QDUA 1BEEA 1QIJA 4NV3A 1GNLA 3LL7A 3I2JA 5IF3A 3EA4A 3KJIA 3U7GA 2VHZA 3QEBZ 3S4YA 4ZPJA 2B6AA 1UWBA 2OECA 3JSXA 2VQEB 4OGWA 4FM1A 4IRUB 4TMWA 1J7KA 1ETUA 2WB4A 3GAFA 4FOEA 3S40A 3HJTA 4JLBA 3ORHA 5EP1A 3MS2A 1BMDA 2A88A 2JGIA 4YNBA 2A0XA 1LNQA 4HH0A 5EJIA 5K0SA 1PCXA 5GJWC 3IJPA 1ZJJA 5FV4A 3I42A 4FSVA 3QWBA 1VIYA 4BKQA 4CMIA 5C1PA 1KI8A 1SC4A 1VLQA 1FFBA 4GV6A 3WNZA 2J48A 3BMQA 3OC6A 3E7FA 4HRYA 3HEAA 2YX6A 4Z6KA 1BS2A 4QFCA 1WCV1 4JI0B 3ELUA 4QUKA 4K81B 2R85A 3DBLB 4A26A 2NUAA 1R6DA 4KACA 1FFYA 4ZJYA 4NZPA 1T34A 1L7EA 3KFXA 2ZUVA 5ECGC 2IEAA 4C05A 4XH1A 4ILEA 5KQPA 2DUJA 2ZEJA 1FS4A 1T8SA 3D7RA 4LSNA 4OAQA 4C0AC 4KLRA 4QIHA 1NP6A 4IDKA 5E3IA 1D2GA 3NNSA 3SDSA 1JXBA 3UWMA 1ORRA 4YALA 3ID8A 1U0FA 3G85A 2OMEA 1H85A 4GY2B 3PDJA 4RK5A 4GM4A 1K5HA 2C95A 3O8OA 1C1BA 4E5DA 4BO0A 4RANA 4HDMB 4E7JA 4PAQA 2BGIA 3IIKA 1IUPA 1Q6ZA 1R9NA 2QX8A 5JJBA 1UXKA 2PJRA 1SKBA 2ZT8A 3KWLA 4BP9A 3B1YA 1N4DA 3P4IA 3O4JA 5AHOA 1J49A 1YB5A 2FK7A 3H2ZA 3TS1A 1V8ZA 1I39A 2G07A 3PNQA 5JH7A 3HJGA 5YASA 4F12A 2ILVA 1WDWB 2YRWA 4R6XA 3C3YA 5IN4A 1P0CA 2F59A 4L5AA 4DFDA 3LCRA 3DCYA 4NENB 1C9JA 2DWOA 1YK1A 3FYUB 4YMWA 2XSZD 2LZ0A 1ZGHA 3EVGA 4Y0WA 3ENWA 4GNKA 3UC9A 2QAIA 3RUCA 3DQQA 2DSTA 2I4IA 1K8AO 2IDZA 2IHVA 2RGYA 3EZXA 4X93A 2GZAA 4R3WA 4P98A 4DZRA 3D8NA 3AGRA 4PZYA 3RS8A 3T7DA 3TE6A 5DXAA 5E6RA 5IVHA 4X94A 2NU8A 4FCTA 1ECLA 4PAOA 4TXHA 4KH0A 2PXHA 3GLHB 1SZPA 3QI2A 3TTDA 4KR3A 1XXHB 2QIOA 3V34A 4OQQA 2VPIA 1WBBA 1Q5PA 4PWYA 3CFYA 4A1FA 3EF1A 3BIJA 1ULBA 3DMDA 2BTEA 2RGUA 2YNHA 4MVJF 2OGZA 1P3Y1 2IC3A 2HNAA 1MD9A 2JGLA 4ZZIA 4F4HA 1X7DA 1JHVA 1NLFA 4CJTA 3TKAA 3H19A 1J5EB 3THWA 3DVAA 3M34A 4FFBA 5GGXA 3HB9A 3CSSA 5K4AA 4Q05A 2A9FA 5LC1A 4BU1A 1FJ2A 4OSPA 3RUEA 2UYQA 1SAYA 3QV2A 3VERA 1P0IA 2IYWA 1VRCA 2HHWA 3NWEA 4Q9HA 4K03A 4E70A 4NQRA 3S81A 2O14A 2VNIA 2IYNA 4AO6A 3CZ4A 4X0EA 5IAOA 5LP6B 4DV3B 2TSYB 4F5EA 3R9XB 1UANA 4FLWA 2CNOA 3X2EA 3OEHD 2QAGB 4K3VA 5D00A 4EKDA 2OP0A 2VFAA 4G4GA 2BFCA 3MJTA 4DV2B 2VYCA 5IT5A 3ZIDA 1IJKA 3OHMA 2HK7A 3KWJA 3LYAA 4I5IA 1GADO 4OB7A 3B9RA 3COWA 1N36B 2CLLB 1Z4KA 1RDDA 2V97A 4H4MA 1QO9A 2WA2A 3OEWA 3S2IA 3WBJA 3T1YK 2CVOA 1D6NA 3T5GA 4KDFA 3BKXA 1FDUA 1GQFA 3OO1A 1ADGA 3HDTA 4CGYA 2E2OA 4HQLA 5H3LA 3F7TA 3RSEA 5IZ4A 4XUEA 1ZINA 1LPMA 2XCRB 3OU7A 2HFJA 2ZIXA 1SWVA 3ZWVA 2HBZA 3TN7A 3U8XA 1BUPA 2YJNA 2QE7A 3I9V1 1PLKA 2FQXA 3GOQA 1EAYA 3K96A 1W0HA 1ZQ1A 3RCBA 4PTLA 4V0KA 3TAQA 3P19A 3UO8B 3SM3A 4A57A 1GGKA 3D8SA 1K0FA 4JOSA 1VL0A 3UATA 3E01A 4RIFA 2MSCB 2RH8A 1NBMD 2H4ZA 3VZBA 1OSNA 1DJOA 3Q41A 1JHYA 2CE7A 1X7XA 4KHWA 4GMXA 3K9CA 2V4UA 2APJA 4HY3A 1E6UA 2QU8A 3EXAA 1LF0A 4FFPA 1KQSM 2QUAA 4WESB 1XZPA 5C1BA 1YO6A 3CEPB 3A4LA 4UW9A 5AM0A 2HRDA 1CQWA 3UH1A 2CLMB 3PRYA 3LF1A 3S2FA 3EC7A 1IY0A 3GNLA 2E37A 3E0QA 1MC1A 4JN6B 1NUPA 2QP9X 1LAVA 3G0ZA 2NPOA 1KQFA 3LTEA 2WF8A 4EQZA 4HDKB 3N07A 3ENZA 4MW6A 1OXKB 1WO8A 4EI7A 2Y1FA 4CLHA 2VXBA 1E3JA 2ZK7A 3VDMA 4Q6WA 1J09A 3V42A 3BB3A 5CK4A 1QFXA 1IZ0A 4PIVA 4GX2A 2CUKA 2CKMA 4HDSB 4DEYA 1IVYA 1QIKA 4J2BA 3UKDA 4CN8A 5BOVA 2KE5A 5C53B 1XNRK 2BR5A 3EH1A 5LBIA 5JVDA 3EGXB 1BGWA 3FGNA 4I46A 2PKRA 2J0VA 3OCZA 2CLOB 4DUZB 1FBNA 2ZR8A 1FVOA 3C3XA 2PX0A 3UKRA 2G40A 2FF3B 3CM6A 4KI4A 3NYIA 3MJSA 4P3NA 3VBCA 4ZQBA 1C1XB 5WRFA 5L7TA 3M8KA 1N6LA 3D1JA 2AC4A 3ZTWA 3W2EA 3PWKA 3WV4A 3RSCA 1XMJA 2VLBA 2GNPA 3OD1A 3IOCA 4OXXA 4J0QA 4J7XA 3VGMA 1UDRA 2ZJ3A 1GOBA 3MCZA 1UJ6A 5DCLA 2VJMA 4IOJA 5JNUA 1HNXB 4U6NA 5KDLA 2PK3A 1L4FA 2OO7A 1PJ4A 1IQUA 2X0DA 2FZCA 3A2LA 4MWZA 3PYLA 2NLOA 2IW1A 4AZSA 3TX2A 3SVLA 4BC1A 1ZIXA 3HN6A 1YKGA 1VQMN 3OU6A 4HLUA 4IIEA 4LFBK 5TDHA 1ID8A 2YYAA 3VA7A 4R7ZA 4WD3A 3A5OC 2VF5X 5KNCD 1F4PA 1IHOA 3I4LA 2YNMC 1M2FA 3SUQA 3ZK7A 5K14A 4B6QA 1CNMA 1WNFA 2KYRA 3UAWA 1PJ2A 3R0XA 3O74A 2XVXA 4EVRA 3ZD8A 2VWPA 3CPHA 3ZHOA 4KN9S 5LU9A 3MSCA 1IZ7A 1E9CA 3IYLW 2D2VA 3K9BA 1J53A 3JSMA 4XDGA 5EKDA 2FZGA 5CLLA 1WNTA 3AVXA 1E5LA 1K2VN 2NU7A 3WL7A 1YIAA 2VDUE 4DWWA 1XEWY 5ESRA 1D2NA 4RD1A 3MWFA 2O54A 1D0SA 1U2VB 3HVHA 3JWPA 3DO8A 4O2RA 1JNXX 5CBPB 3FCOA 2G8NA 1OZ0A 2XVZA 2ZRHA 3RHZA 4JBWA 2ASMA 5EP2A 2ZB3A 4LISA 3M9WA 2HA7A 4N82A 4V2IA 2E4XA 1OT3A 5ECWA 4BDPA 3QEMB 3HEMA 5BSRA 3OYLA 4M37A 2WUVA 3P1JA 3WGMA 4E15A 2WYIA 1Q84A 3BB1A 8OHMA 4J07A 1P1FA 2JLUA 4PA1A 4LJRA 1DT3A 4NPHA 2IDJA 2QUJA 1U2TA 2XCQA 4IJQA 1WUJS 5AQXA 2RKWA 5JW6A 1KORA 1JQLB 1RACA 4GDMA 4K26A 9GPBA 3HQ4O 3RQSA 2NQ2C 2AOUB 5DSXA 5BT9A 1W6UA 3OFNA 4D3FA 2Q0UA 2B34A 1B8PA 2DHRA 3VR4H 3NPAA 1YACA 3G7UA 3V8EA 4B32A 3GPLA 1XMIA 1XDBA 1NF9A 2OV6A 2GTPA 5ALXA 4ZV9A 5JMWA 1WZEA 3ISJA 4FNMA 1BWSA 1XF9A 2XODA 3HP4A 5FLEX 3DXMB 4AHTA 4PLYA 1O58A 1YNSA 4BKOA 4BNFA 4PYMA 4DWJA 1NT2A 5F3RA 1G6Q1 1ZEMA 3U16A 4QU5A 1XTIA 3S3MA 1P7PA 2AHRA 2BDUA 4B82A 4F3OA 3H4MA 1L5LA 3HDVA 3VGLA 1SS6A 4JLOA 4RESA 4YUAA 4UFNA 3GCXA 4RHFA 1KZ7B 1NYQA 1NKTA 5AVQA 2MIIA 2Q3SA 1T2CA 4CLEA 3NTUA 3I01A 4F9EA 4WBNA 3I56N 2H9AA 3VPAA 4UBOA 3V9UA 3CO0S 3GUUA 1I3NA 4C1NA 4FMDF 3WSTA 2IPXA 1Q50A 4MI3A 2ZRGA 2P90A 1DT9A 2VPPA 1JLSA 4H0XB 2PKYX 3NQ41 1FZTA 3JCZA 3PCRB 2VZ8A 4YCBA 4QTUB 4R9RA 3II6X 1DC7A 2B8NA 3GELA 2C4MA 3IV6A 2IOQA 4YUZA 3RIHA 3F1LA 2OPRA 2JAOA 5D3KA 3A5MC 5JD5A 3LPNA 4JLMA 4V1CB 1OPRA 4DN6A 1XAIA 2OPPA 1MQAA 2XWQA 1Q83A 1H2WA 2AN5A 1UPXA 3L9XA 3GRZA 4YOUA 1YF5L 1SA0A 2AI1A 3G2KA 3OEED 2P9IA 3QLEA 1ZX1A 1WMAA 3USCS 1TJ3A 3FLBA 2BONA 4YMTA 4BLVA 4KVGA 5IZCA 1KI1A 4MW1A 1SO8A 2PVPA 1QH1B 4CEBA 5KU7A 2R7KA 3NM6B 4NZMA 3WXJA 1K66A 3ZHSA 7GPBA 1GZSA 2ZRNA 2HCJB 4Q9NA 3QOYA 1DZ3A 1PJ3A 2GHTA 3O1IC 1CZRA 1WG8A 1HXHA 5E8JA 2A1IA 5P8WA 1A9QA 2OQVA 1IBKK 4WPGA 3HJBA 1KSHA 3EEOA 1BH2A 3ZV5A 3G2OA 5EE0A 5I7FA 4IRXA 3T5DA 4CIBA 3UVEA 1WMBA 2WIDA 2Z5FA 1PP4A 4BVJA 4UPDA 3T99A 4HBZA 3IC5A 3P9IA 1EFPB 5DV9A 3OYIA 5T4FA 3BHMA 4XVCA 1XALA 3QFTA 1CQPA 2J0UB 5IKXA 4ZDJA 3C65A 3I73A 4LTMA 1M5TA 2A1UB 4QDOA 4M0EA 1Q74A 3MQFA 3KVNA 3RUHA 4TWJA 4PFQA 3SQ0A 4AS2A 1YA6A 3A10A 3EKSA 2B2NA 4M7PA 4ZEVA 5TEVA 3EXFA 3ITDA 2Y2VA 1FRNA 3I28A 5FV7A 3JZDA 3N2ZB 3WISA 3VQQA 3FUCA 4Y1RA 4F5ZA 1V41E 2FNAA 3VTHA 5AVUA 3VPZA 3V46A 2VSYA 2NZWA 3AR2A 4XASA 2JIBA 4M1KA 4U2GA 4EAQA 2FW1A 3IT1A 2C8KA 3N2KA 1F21A 1YOBA 2R68A 2NO4A 4B6RA 5EWLA 2XDAA 2O23A 2Z98A 4R79A 2E4YA 5B1SA 3ESBA 2WMYA 1VJDA 4ZDWA 4EI9A 2P69A 2VYND 4R6WA 3WLEA 4L08A 2J87A 2CXPA 1S6PA 2ZRQA 1O08A 1KFSA 3DEHA 2AH5A