1YTUA

Structural basis for 5'-end-specific recognition of the guide rna strand by the a. fulgidus piwi protein
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
426
structure length
410
Chain Sequence
MEYKIVENGLTYRIGNGASVPISNTGELIKGLRNYGPYEVPSLKYNQIALIHNNQFSSLINQLKSQISSKIDEVWHIHNINISEFIYDSPHFDSIKSQVDNAIDTGVDGIMLVLPEYNTPLYYKLKSYLINSIPSQFMRYDILSNRNLTFYVDNLLVQFVSKLGGKPWILNVDPEKGSDIIIGTGATRIDNVNLFCFAMVFKKDGTMLWNEISPIVTSSEYLTYLKSTIKKVVYGFKKSNPDWDVEKLTLHVSGKRPKMKDGETKILKETVEELKKQEMVSRDVKYAILHLNETHPFWVMGDPYEGTKVKLSSKRYLLTLLQPYPIKPLSVEIVSDNWTSEEYYHNVHEILDEIYYLSKMNWRGFRSRNLPVTVNYPKLVAGIIANVNRYGGYPINPEGNRSLQTNPWFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for 5'-end-specific recognition of guide RNA by the A. fulgidus Piwi protein.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Rna binding protein/rna
molecule keywords 5'-R(P*AP*GP*AP*CP*AP*G)-3'
total genus 125
structure length 410
sequence length 426
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02171 Piwi Piwi domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1ytuA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ytuA02
3ZSQA 4XIUA 3KD1E 2Z1GA 2WONA 1KVAA 3TARA 3HYFA 5I42A 3L2VA 4MQFA 2QVCA 4FZXC 1NKCA 4MS1B 4OVLA 1SUQA 2X6NA 1W0HA 3LFTA 1ZGZA 4GPAA 2VWJA 4C8NA 4DTXA 4Z4FA 2FXIA 3L6UA 1P8AA 1ZITA 5CZ2A 4DMNA 1PNRA 2F8SA 3KK3A 3SV4A 3JYTA 4KHNA 4B9UA 1A0OA 3V1RA 2E4ZA 4DTOA 4MAAA 5C42A 4G0YA 4MS1A 4CF8A 1F4VA 4F06A 3VNAA 1E6LA 3H5WA 1TGOA 2A1RA 2VUIB 1ZBUA 3NCIA 1C1AA 3AA4A 4B08A 4FLXA 4JS4A 4FE4A 3O21A 2HSGA 3V9XA 4DFPA 3SUOA 3AA3A 5TPWB 3JPYA 4N0PA 3OJUA 1NXWA 4KVFA 3ILHA 4YNQA 1RPJA 1S1VA 1DBPA 3TD9A 2LUOA 2PUAA 3OYHA 2AJQA 3AVCA 4Z9AA 4CERA 3PY8A 1EHCA 3HZHA 2D0CA 3OM1A 3RVJA 2IPLA 1USIA 3OLYA 4FLZA 3IPAA 1T05A 4CGIA 2IPNA 3TANA 1QP4A 4IG3A 1KMIY 3O3HA 3V1OA 3NDKA 3NHMA 3K5LA 1DLOA 4HCBA 3KLNA 4LRQA 3C6QA 4FJXA 4MLDA 1S8NA 4D74A 1DRJA 1OXKB 3VQPA 3TI0A 4EGSA 4LY7A 3EODA 3AO4A 4CE9A 2FQXA 4KK3A 2OZSA 3L2WA 5CHYA 1A5XA 5CY4A 2VYCA 3KLIA 2RKIA 3MEDA 4Y1CA 1RT3A 4CEQA 1DG9A 4N0QA 4KTWA 3H1EA 1BVHA 2BDPA 2JVJA 3AO5A 3NH0A 1WN7A 3I45A 4FLWA 5J2QA 3RVMA 2IKSA 1NXXA 3MA0A 4CIGA 5HRNA 1Z13A 5CZ1A 3LUCA 4W5QA 4DSFA 3L8BA 3M6MD 3Q7TA 2QZJA 4B8AB 5EWMB 4OGCA 1TK8A 4ZMSA 3GWGA 4EYKA 1YTUA 2HHQA 2E4XA 4JASB 4G97A 3O3FA 2XY7A 1RTHA 3M9XA 4DSIA 1JF8A 1B00A 3T1AA 4YCSA 1EETA 4MLCA 2HNYA 2Z1IA 4CEEA 1NXOA 3QO9A 3V81A 4MR9A 1S6PA 3GV0A 4FJNA 2IDOA 1NK0A 1D9DA 1W9HA 3F7NA 5PNTA 2OYQA 2WWVD 4CK2A 3T6KA 5I4CA 1C0TA 1IH7A 3SV3A 4BDYA 1C6VA 3LKVA 1XWLA 3NE6A 2N9UA 3ZSXA 2GUIA 4IMIB 1T7PA 2FEPA 1QQCA 4O44A 4BDPA 2Q5CA 3A0RB 1J54A 4RDCA 4LE0A 3EAFA 4FZYA 3DLGA 4B9VA 3O2SB 3HDGA 1XHZA 3IDOA 5JNRA 1LW0A 3NGYA 1TKZA 2QV0A 3IRXA 4CJSA 4E19A 2P51A 4F8JA 1C0MA 3EJWA 2HMIA 1FXXA 4CF9A 4J2EA 3OO1A 2FQYA 4FK0A 1HEYA 1TMYA 2YHBA 1GUBA 3LTEA 4B3OA 3AO1A 4C8MA 3QESA 4M3YA 2IPMA 4J2AA 2NT4A 5CNJA 1U8TA 1RXEA 4AH9A 3WNEA 5TPWA 4CF1A 4E7LA 1AB5A 3BRQA 4TLLB 3D02A 4FJJA 3VA0A 4CK1A 3JVDA 3FDFA 3L49A 1NK4A 1KRWA 4IBNA 2E4VA 2JB9A 4CEZA 5TE9A 1VPWA 1WAFA 5DTEA 4WUTA 1SL1A 3QEPA 3LKBA 3RVPA 4CBVA 3NF8A 2H3HA 2PKXA 3AV9A 5C25A 2PZSA 1NOZA 2FW0A 2B1JA 3GBPA 1AB6A 5EWMA 4OLAA 3HP6A 5C5EA 3PO4A 4W5OA 4P98A 1JFVA 4FJHA 2ZD1A 3CKMA 1REVA 3U3GA 3SG0A 1TAQA 4BE1A 3CG7A 3OM0A 3GRCA 5D2CA 3C3KA 4FE7A 4KV8A 4CF0A 1JL3A 2B6AA 4H3KB 3RVQA 4M3ZA 3SUQA 2FEWB 1HRHA 2O4IA 4RW8A 4RK0A 1U2QA 2EX3A 4NCAA 3W9SA 3OYDA 4MQEA 5IUJC 1WSJA 4FYDA 4E7JA 4TSXA 4FLVA 3HPOA 4FJGA 1VSLA 3K57A 1MB0A 3N53A 3E01A 1NXPA 3OJSA 1FFGA 3OYCA 4G0MA 2KTQA 4EZ9A 2WOMA 1QP7A 4ZTFA 2QSJA 4JB2A 3AVIA 4NCGA 3N0XA 4BWJA 3LWLA 4DFMA 5FWYA 1FQWA 2MSKA 3RTVA 1GLGA 1IKWA 4MR9B 4EUKA 1NJZA 3O4NA 5DCLA 1QSSA 1ZH4A 1KRXA 4HCCA 2L17A 1TKTA 3RVKA 4DQIA 4HNRA 2B4JA 4KHSA 1F21A 3O4QA 4CFDA 2E6MA 4FM1A 1WAJA 1JHZA 1RXIA 4F2RA 4CJWA 1GCAA 4RW7A 3QETA 3KYIB 3WNHA 4OPJA 4YS6A 1QQAA 3HPHA 1BGXT 4AHRA 3CZ5A 4LX8A 4CJPA 4LE2A 3URMA 2ZWMA 3KHTA 4KFBA 5KC8A 2Z1HA 3IG1A 4I9LA 2P5GA 4RK7A 4AHSA 2WY2D 1NXVA 1UDRA 4FW1A 1NK7A 3TAQA 3RWUA 1U2PA 1UWBA 3AO2A 1E6KA 1LAVA 1HPZA 4H60A 1A2OA 2G8WA 2PLNA 4RZSA 3DOLA 1JLQA 1WSEA 4MQ3A 1JLAA 3G10A 4HTUA 3KKSA 1X9MA 4I2QA 2RPIA 4Q7EA 3AVNA 3M8QA 3NH2A 4KO0A 5FWXB 1EWKA 2CHEA 3T8YA 3PX6A 4RV5A 3KLEA 4M3XA 3LAKA 4AHTA 3MEGA 4EP4A 4F3TA 3D8UA 3EQ2A 2ZE2A 4OLBA 2NUBA 3H08A 4F3OA 3K5MA 2RN2A 1YMUA 1KLMA 1RTIA 1Y97A 2QXYA 4JRPA 2QK9A 1HYSA 3CFYA 3U6FA 1S1WA 1FK9A 2HHVA 1KTQA 4W5TA 1GOCA 3AA5X 1NJWA 5IUNC 1KLNA 3HEBA 2XY8A 2CD7A 4J2DA 1ZY2A 2QR3A 4XAQA 5F64A 3RVOA 1HMVA 1KSPA 3ROFA 8ABPA 4HNSA 5CNIA 5KGWA 4ELUA 1M2EA 1A04A 5SWMA 1TM2A 3N8IA 4RSMA 3C3MA 3CFPA 3AVAA 4HUFA 4LZLA 1Z12A 4DSJA 2X6SA 2X7XA 4P1ZA 1JBEA 3QEVA 2A9OA 1XI1A 3TMYA 3QEIA 1L5UA 3I8DA 4B9MA 3QNNA 3SUNA 3JPWA 3ZSWA 3M8SA 2JRLA 3NF7A 3QX9A 5BRAA 2GBZA 4L8RB 4GW6A 1YS7A 2PUEA 1P6QA 3OYEA 4M3RA 2FBXA 3HV2A 3UIQA 3Q7RA 1DC7A 4M88A 2FVYA 5FWXA 5FRMA 1D5AA 2LSNA 3EZ5A 3NNDA 3QIOA 2KZZA 1UA0A 2ZAYA 1NJXA 3SM9A 2KQ2A 2ZQBA 1LK0A 3O3GA 4N03A 1TLFA 1Y1LA 3ALYA 5KGXA 3O2QB 3ZSVA 4QOZB 5C5CA 1YT3A 4RY9A 4BE0A 4CJLA 3H5OA 2XRIA 1VRUA 3AVKA 4MR7A 4M45A 4ML3A 3GL9A 4TN5A 2QKKA 2ID9A 1S6QA 3Q15C 1GOBA 4CEFA 2PJUA 4MYRA 4OKKA 1RDCA 3KLFA 4F2SA 1Z18A 3RH0A 5HLFA 1IG9A 1ZN2A 3KG2A 3CYMA 3TAFA 3S3MA 4WT7A 2PUCA 1WSFA 4M41A 5IUKC 5HKOA 4CK3A 1Z16A 4OATA 2DY4A 4M3WA 2KZMA 4G86A 4M3UA 2HB5A 3A3KA 3LALA 3OLVA 3TAEA 4DTSA 1S1XA 4NICA 3ZSZA 3G1WA 5EWJB 4C8KA 1KFSA 2ETJA 2YNFA 3Q9SA 3LUGA 3SAJA 1HNIA 2MYUA 3CM5A 3A0UA 3FFIA 3HSYA 3VQ5A 4W5NA 1BDJA 2YNGA 4WWHA 1VLZA 3C95A 2IDMA 4KPYA 3TX6A 2LP4Y 4QPJC 3BILA 4PE5B 3HUUA 2HHUA 1BISA 1QNLA 4KHYA 1WNSA 1HJRA 3C97A 4LH5A 4CF2A 1R8JA 1JYEA 3WNGA 1Z2DA 2MYTA 1QO0A 1JL2A 4O0IA 5T7BA 4ELVA 3SI6A 4Q5VA 4FJMA 4O5AA 1E2BA 1C1CA 3B6OA 1Q9YA 4ELTA 4CFAA 2FKAA 4G0OA 4CFCA 1RT5A 2VG5A 3CFRA 4ETIA 3GA5A 4LDAA 1DJMA 3ZT3A 4CJ3A 1BIZA 2PYLA 3IP7A 1TK5A 5TQ0A 4N47A 4DSKA 1PNTA 3OLXA 1ASUA 1C4WA 2IOYA 5KQGA 4I7FA 4EP5A 3QX8A 3LPTA 1X1PA 1JLKA 4E89A 1CXQA 1DBWA 3DBIA 1LWCA 2KFNA 3U3YA 3V9WA 2FMFA 3DYAA 4PZ0A 4E7KA 2FN9A 4CFBA 5J2MA 1XC9A 2O4GA 1RTDA 3EQZA 1XHEA 3RQIA 4AHVA 4Z9BA 3LDSA 1VRTA 4EY3A 4RW9A 2P1JA 4ZJPA 1VRVA 1I3AA 2OQRA 3SQ4A 3ZT4A 1ZDMA 3OO0A 4RXTA 1BI4B 4DLEA 1ZH2A 1KFDA 1JXBA 4XASA 3EY1A 3NBPA 3PV8A 2R4QA 3LZJA 2P4UA 3S9HA 3MECA 2I6FA 4OG2A 2JVIA 3DRPA 1TVRA 2J48A 1UA1A 2JBAB 1DC8A 3LP2A 2E4YA 1IIBA 3KTQA 1APBA 6ABPA 1L3SA 3RMCA 1PEAA 1FSPA 5KQPA 4RXUA 3F9KA 3I42A 4FLTA 3UUGA 2ID7A 2BANA 3F6PA 4K8ZA 3NNSA 4DQDA 3JY6A 4RKQA 3LANA 1HQUA 2QVGA 3PO5A 4ID5A 1KVCA 5FRNA 4DTPA 2NT3A 5HROA 4G0PA 2FBVA 1ITGA 2X74A 4RY0A 4ICLA 4PQUA 2BGGA 3AVMA 2WJAA 4CJTA 1A5WA 4DQQA 4FCYA 1YK0A 4MR7B 4PA1A 1VSJA 1ZBLA 4PYRA 2ATQA 3CZCA 5IX8A 2OPRA 2M98A 1L5ZA 1EWVA 4BWMA 3HVTA 2PUGA 3O2JA 4FJ5A 4AILC 1NJYA 4B9TA 2XHBA 3KTOA 3VA3A 4KI4A 1BIUA 2F96A 2LBPA 3ZSOA 1YMVA 5CYMA 5DGCA 5D3GA 2VG6A 2A9QA 3KK2A 1U47A 1JFTA 3L2RA 5T3YA 4HUEA 2RDMA 2FBYA 4FZZA 3CHYA 2GI4A 4CGJA 3CU5A 5HRPA 3O1HB 3AA2A 4NCBA 4KQCA 1RTJA 1U48A 4CJ4A 4G1QA 4S05A 4DS5A 3JTEA 4FW2A 4MR8B 4QYWA 3DLBA 2HHTA 3QLVC 1KRPA 1TKDA 2HHXA 1Z2EA 1LBHA 2MYNA 2QU7A 2XY5A 2PUBA 2P9HA 3MQ4A 1JX6A 4Q0BA 3VQEA 2PAFA 3DGEC 4UHJA 4FB4A 2JVKA 1RT4A 4CHYA 2FBTA 2Y1IA 4ZPJA 3N0WA 3IAYA 1BDIA 3HXMA 3VQBA 1WETA 4RG8A 1USKA 3AVGA 4NV3A 4Z4IA 2HNZA 4O1IA 1TL1A 4ZYLA 2OA8A 1XHXA 5I3UA 4DTRA 3QELA 1RBRA 4N56A 3OYGA 4FJKA 3ZSYA 4DN6A 5B3JA 1S5JA 3RRHA 1FKPA 2R25B 2D0BA 1JH9A 1X9WA 1RBVA 4LSNA 3O1JC 2R48A 5J2PA 4E0DA 4RKRA 4IGAA 3OYLA 1DZ3A 1LBIA 3O75A 4BE2A 4YV7A 2X78A 1C0EA 4IKFA 2JK1A 4KTZA 3ZT2A 3A2FA 1LV5A 4DADA 1IKXA 4DQSA 3MEEA 2YNHA 1PEYA 3DLRA 3P5JA 3IP6A 3WNFA 3ZT0A 4ZMRA 4WE1A 3L3UA 4KRFA 2B4AA 4JLHA 4IFVA 1DBQA 1ABFA 1U0SY 3H6GA 3OQNA 1SXIA 1NXTA 2JGUA 3QLVA 4BACA 2Q3SA 3KLHA 1QMPA 1WSHA 1ABEA 3OS1A 1VK0A 4C8LA 1FFWA 3DMJA 4RK1A 1J56A 3FMVA 2ITGA 3V9SA 1RILA 2GWRA 1JLGA 3AVJA 1W25A 4WXEA 1YK1A 4KK4A 3KIOA 4H3HB 1L3TA 3NNNA 1IKVA 3LUDA 1H9CA 3PUFA 2TMYA 4JA2A 4CGHA 1SKRA 4PY5A 4RXMA 4Z0NA 1T03A 3RR8A 3EULA 3H5IA 2XDYA 4OGEA 3HCWA 3S99A 1QE1A 3OYJA 4ETNA 1ZAYA 4UQGA 4IF4A 4Z0UA 1NY5A 1RBTA 3HJFA 3SJJA 1RT6A 3C94A 1I3CA 4HNQA 4EVRA 3D0PA 1QSLA 1JLBA 1ASVA 1QPZA 3OYNA 4O1HA 4RS3A 1SKSA 1SD5A 1TK0A 3QEMB 3QLTA 1Z26A 2DFFA 1LW2A 3OMWA 1PUXA 3LOPA 5TPZA 2DFEA 5FWYB 3KLGA 3DM2A 1ISRA 2JLEA 3CTPA 4KKOA 3AVBA 5HQJA 3V1QA 1NOYA 2IPAB 2BE2A 1DRKA 3HS3A 1ISSA 4WXMA 1BI4A 4UHKA 2RGYA 4IMJB 3LWMA 2HQOA 2WJWA 3I09A 2MYPA 3N0RA 1TV6A 3O1IC 6CHYA 3VQ9A 2IYNA 1P6UA 2YNIA 4EZ6A 2YKNA 3OS0A 1VKRA 3HUTA 4K8XA 4KI6A 3DRSA 4N76A 4JOQA 4XXHA 4CEBA 4E1MA 1BDHA 5GOTA 3TABA 2FLWA 5JNUA 3T38A 3I0SA 1SXHA 4XFKA 1B9FA 3F73A 3QERA 3EYZA 4EVSA 4CEDA 2GV9A 4CGGA 3CRNA 3KKEA 3QLUC 1D8YA 2OZMA 5JS1A 3QEMA 4O0JA 5IBQA 5IULC 2M1ZA 1CHNA 3MIZA 3NHZA 1TJYA 4FK4A 2CWDA 1VSFA 4JRQA 4YP9A 1RDDA 2HHSA 2Y1JA 2FTKE 2OPQA 4KFCA 1JLCA 1JDPA 4FK2A 5DKFA 4JS5A 4ZTJA 1BCOA 3I5AA 4QCLA 3NGIA 1IKYA 4FXDA 2E4LA 4WZZA 1D5WA 3BGRA 2HVIA 1URPA 4DFKA 5JS2A 1P2FA 4Z99A 3NFAA 3AVHA 1C0UA 3PX4A 3VNBA 1Z15A 2FMIA 1JDNA 4LE1A 1K68A 1ZESA 2H0AA 4CJRA 3RMAA 1QHTA 1HQEA 3L3VA 4I9QA 1J5OA 2R7YA 4XLTA 9ABPA 4DLGA 3EDCA 3M9WA 5KWSA 4B9NA 1RT1A 2L2QA 2Z1JA 4KHUA 5EWLB 2MSLA 3KKRA 3KS9A 2IOCA 4CJ5A 4DQRA 4JB0A 4FM2A 5TQ2B 2B5JA 4MPTA 1LJUA 2WRZA 3HT3A 4G0XA 1CEYA 4G0QA 1KGSA 4KMRA 3MYYA 5IEJA 4OPKA 1VSDA 3KLOA 3SCXA 3BREA 1SV5A 1VSEA 4CESA 2VK2A 1U49A 4LD0A 2NZVG 4Q6WA 1CZ9A 1L3UA 3A10A 4DU1A 2DTUA 2F8TA 3GYBA 1MB3A 1IO2A 1JYFA 1N5YA 4DWIA 1DCMA 1S9GA 1F51E 3C3WA 3MXMA 3H5TA 2PY5A 4DSLA 3QLUA 4EYQA 1NKEA 4EVQA 4E7PA 2V0NA 1WSIA 4YWHA 2FC0A 1ZGGA 3TAPA 3DI6A 3VQ6A 4DTNA 1NK8A 3OY9A 2IGIA 3HDVA 1WSGA 1QSYA 4ETMA 4AHUA 3P83D 3R0JA 4G0ZA 2GBPA 1USGA 5KTQA 4PICA 4Y1DA 1NKBA 3TO5A 3KD5E 1LAWA 4MQEB 4DTMA 4B09A 3MXJA 3VQ8A 4CIFA 2FEKA 4CHPA 3H6HA 5SZTA 3AVFA 3VN5A 4I2PA 4RU1A 3S3OA 3SUPA 1RDBA 4NYNA 1UAXA 3QEKA 1EP4A 4H4MA 4CECA 5KC9A 1NATA 3H5VA 5CNMA 3LUHA 4MS4B 3RMDA 4MS4A 3M8RA 4NQRA 4L4UA 3T19A 3G85A 3C6TA 3S3NA 3RVRA 4IILA 4CJUA 3DLHA 1ZBHA 4DTUA 4F8RA 4KNYA 4E3SA 4KHQA 1RNLA 3V6DA 1K66A 1MU2A 2A9RA 3AO3A 4CHOA 1CXUA 3CNBA 1ASWA 4IDKA 1B92A 2EHGA 4O5BA 5HBMA 2AYZA 4TLMB 5TPZD 2QW1A 4FJLA 4W5RA 1YTAA 3CFOA 4CHZA 3IP5A 4RK4A 1S1TA 3B2NA 2VG7A 1O1WA 4LDZA 4IG0A 2QKBA 2GKGA 4OKEA 2VUHB 3KJVA 4FJIA 2HVHA 3O74A 3NF6A 3NHGA 3LMKA 3V9ZA 4YO7A 4KZKA 1T34A 1JLEA 4PUOA 2A9PA 4C8OA 4YGXB 3OVNA 4O4GA 3GBVA 3NH1A 2RJOA 1BHLA 3NAEA 1YVUA 1WLJA 5BQ3A 3Q41A 4FVMA 1HYVA 1K6YA 2PMCA 3BRSA 5JNSA 1NTRA 1D4ZA 5FDLA 3CM6A 3SNNA 3CG4A 1QS4A 3ZT1A 2PL1A 3SNKA 2I5JA 4LH4A 1U4BA 4ID1A 5HRSA 3FFTA 5EWLA 1VSIA 2FN8A 4BDZA 4OJRA 2QXFA 3JS5A 3LUFA 1TKXA 3T95A 4EYOA 3RVLA 2HJ9A 4M42A 1X9SA 2AYXA 4MFBA 3MAQA 4LSLA 1L3VA 2HQBA 2FMHA 2E4UA 4KB0A 2FMKA 3OYMA 4S04A 2IC3A 5ED4A 1ZYQA 3FFXA 3HK2A 1CYEA 1SL2A 4JP1A 3LUJA 3HVRA 1FFSA 4RK6A 4QICA 1B9DA 3OYAA 3H5LA 3CG0A 3PX0A 3JSMA 5E41A 4CGFA 1XWWA 4IRXA 3SQ2A 1ZBIA 1NK9A 3KJXA 1JKHA 1D1QA 1Z25A 2L19A 1RZRA 2OENG 1CZBA 1ZBFA 2G8IA 4MRMB 4KHWA 1Q8IA 1MIHA 1VSKA 4M3TA 1MVOA 4KREA 1SL0A 4PEVA 1J53A 1TAUA 3QINA 1NK6A 3K4HA 1DTTA 3H1GA 3VQ7A 3DLEA 4OBBA 3HO1A 2HPHA 3DGFC 4Z4CA 3ZCMA 5FBHA 1VSHA 3UK0A 4DF8A 5B3JC 2RJNA 5C24A 3L2QA 3CQ8A 1HYZA 4MS3A 2HNDA 4RK5A 1GOAA 7ABPA 2P5OA 3N6VA 2KW4A 2WB4A 1DP4A 3DOKA 3E3MA 4PWDA 1JLFA 3OYBA 2W42A 4KTQA 4DSEA 4Z4EA 2YHAA 2FLKA 3K58A 4DS4A 4N5SA 1R0AA 5KRTA 1EWTA 1XHFA 4Z4HA 1EFAA 2E6LA 3HSTB 1M5TA 1RNHA 1DCKA 2JBAA 5HP1A 5CNKA 1HNVA 2HQRA 3QELB 3ASMA 3NGZA 4J2BA 2LIVA 2D5RA 3SQ0A 3B6PA 3QK7A 3VQDA 3MM4A 4RY8A 3VQAA 1YS6A 3OYFA 4D6XA 3RVSA 3K5NA 2KYRA 4YLEA 2VWKA 4N41A 5CYQA 1RBSA 4Y9TA 1ZHHA 1J9AA 3IPCA 1DCFA 4KB1A 3VQ4A 1U45A 3GT7A 1RDAA 1QQBA 3D45A 1D2AA 3TWHA 1BQMA 4E7IA 5DMRA 3RVNA 2G8FA 3ILYA 3RR7A 3LZIA 3LP3A 3CS3A 2FQWA 5TQJA 2IAJA 1RZRD 3VQQA 3LPUA 1M2FA 3C6UA 1TL3A 4NYFA 4MR8A 2CHFA 3SQ1A 5J1EA 5HM6A 2PYJA 3EGCA 1M5UA 1S9EA 4QAGA 3KSMA 1QP0A 3MMNA 3VQCA 1VSMA 3OQOA 5KI6A 3IP9A 4FLYA 4DQPA 3FGZA 3G0ZA 3QLHA 4E1NA 3T3FA 3H1FA 3L2UA 5FROA 3SY8A 3HM9A 3QIPA 2D0AA 5BR1A 2L18A 4CEOA 4XARA 5EU7A 4DU4A 2G8HA 1BL3A 3I0RA 1EKEA 3DRRA 4F12A 5FBKA 1YIOA 2G8UA 1JWLA 2XO7A 4AHCA 4FJ9A 2LPMA 4CJVA 2KFZA 1QKKA 5HSGA 4E7OA 4FJ8A 4CJQA 5IC5A 3Q7SA 3V9UA 1D1PA 4EYGA 1Z17A 3M8PA 1TVMA 2JCGA 2PUDA 4RW4A 1A5VA 1NXSA 3LP1A 1U04A 1S1UA 3LAMA 1RCHA 2FSPA 3BDPA 4D6YA 3OQMA 1GCGA 5JNVA 2G8KA 3SQNA 3FFWA 4OTZA 2OPPA 5DK5A 1RT2A 5K14A 3RRGA 4CHQA 1SKWA 3KK1A 4Z4GA 4O55A 3JVIA 3OYIA 2NZUG 3SPZA 1LWEA 2E4WA 1BAPA 2GX6A 2MSWA 4DF4A 4IFYA 1EAYA 1LWFA 2PE5A 4F4KA 5GQSA 4MS3B 1DTQA 4CGDA 1KCFA 4E7HA 1G15A 1EX4A 3E61A 1JL1A 5E3JA 1I39A 3ZSRA 3MXIA 4B9SA 2RF2A 5ABPA 3P9YA 1JXEA 4DU3A 4F11A 3F6CA 1QTMA 2YV0X 3LUAA 4L85A 1SRRA 5JNWA 4FJ7A 4CCHA 4H4OA 3QNOA 1C1BA 3K59A 2HHWA 4HUGA 3QEWA 5JNTA 4MRMA 3OLZA 1ZVVA 2PUFA 3SZ2A 3IS9A 3HL8A 3BBLA 3SPYA 2PL9A 1BQNA 2DRIA 4HYEA 4TMYA 1RBUA 3OYKA 1T8EA 4MGEA 1E6MA 3AVLA 3KCNA 2R47A 4CJEA 3OS2A 2G8VA 3LP0A 1SXGA 4CEAA 3CLKA 5J2NA 1PHRA 3NBMA 4R5PA 1Q9XA 1KVBA 5TQ0B 5DLEA 2XY6A 3QEXA 1LJLA 1RT7A 3P1GA 4CIEA 4CJKA 2DFHA 1NK5A 3HPGA 4Q6BA 1GUDA 4B8CA 1FKOA 1QO0D 5KQMA 1N6QA 1MAVA 3ITHA 3ROTA 4GMJB 1EXQA 3OMXA 5EWJA 4RWEA 1BCMA 4GVMA 4ZHRA 4CHNA 4GNRA 2A1SA 4H8KA 3KYJB 4DTJA 2WMYA 2OPSA 4RW6A 5BRJA 4YFUA 1JFSA 5KQLA 4HHTA 3OLWA 3V4IA 2HW3A 5TQ2A 3RMBA 3H75A 3TR8A 4DFJA 4JAVC 3ISNC 5IEBA 3K2PA 3TAMA 3MF4A 3N75A 2IS3A 3HP9A 4FLUA 1OXBB 4QYMA 3THVA 3DZDA 3TB6A 4B9LA 4CJFA 1L5YA 4KV7A 3UKJA 3SYZA 3TAGA 3DLKA 1CLQA 3ULDA 3K9CA 3NF9A 4HVJA 1UOCA 2YKMA 1BA2A 3LUKA 2O20A 4DG1A 5HRRA 5KRSA 1D9FA 4FM0A 4MQFB 4OKJA 4KAZA 4YRZA 4KQ9A 4YR7A 3K5OA
chains in the Genus database with same CATH superfamily
3ZSQA 4XIUA 2GJ4A 2YY5A 4OUDA 2Z1GA 4E14A 721PA 4WMLA 1UBJS 3IDSA 4IGIA 3G3EA 4MQFA 5TARA 2FZGA 3M6LA 3AAQA 4CN8A 1NKCA 1U7PA 2VJDA 1W44A 4EPRA 4LXGA 4CKZA 4X62B 4OVLA 1AKMA 3E53A 1F9EA 1P61B 1F7UA 3KZXA 3GCDA 4Y67A 1W0HA 3AJ9A 3LFTA 5C7OO 3H4VA 4PF1A 4EKEA 2PH1A 1AQJA 2P9TA 3ONEA 4LYJA 2JIZA 4Z4FA 5F73A 4CU2A 2AJLI 121PA 1L1EA 3BKWA 3Q7PA 3V7FA 1P8AA 1TRHA 5KU7A 4DR6B 4WRRA 5JICA 4BR0A 2A5JA 3OF2A 3NTOA 4URWR 4Q02A 4F38A 2YXLA 2HBQA 5HBGA 4MW5A 1LDBA 4YMUA 2EF1A 1PJLA 3J81A 3S1LA 4A5OA 4CKBA 2B3DA 4B9UA 3P9XA 4OXXA 2IYLD 3F7OA 1A0OA 4MAAA 4R8MA 4DUZB 2O5VA 4FLMA 1K86A 3OM8A 3PNKA 4L07A 4DSOA 3U19A 5JIBA 1ILEA 4DPMA 1R12A 1C7IA 2FSVA 4G0YA 4WXYB 2A8YA 4OQXA 2O2GA 4F84A 4MS1A 1JB1A 4B7XA 1OLSB 3ATVA 1ZX1A 4F06A 5DM70 2CMDA 3BGWA 4N0EA 4AP9A 2XCRB 1T5IA 4EDFA 1X39A 2GEMA 3OZCA 4UJ3A 1TXGA 4M76B 3DVRX 1ZU5A 2WE8A 3Q5GA 2OD2A 3PNBA 3V2GA 4BY9C 5AHRA 4K42A 2QJOA 4N82A 1BFUA 2A59A 5LXTF 2XUGA 1SBCA 4LXUA 1RLMA 1ULHA 3HB9A 3BXFA 4Z54A 5KTKA 2N42A 2FRXA 4Z4QA 2HSGA 3KTDA 3PGXA 4DFPA 3UMSA 4RZHA 1U7DA 1V1MA 4KX3A 1X77A 3A7DA 4DPLA 1KI3A 4OYLA 3ORSA 4RZ3A 3AINA 4YNQA 2UAGA 4IJWA 3E5MA 4TS1A 2ZQYA 5F1KA 5HILA 4BZPA 3Q4GA 2Y1DA 2ID8A 5BQFA 5BYJA 2LUOA 2PUAA 1KFCB 2CCKA 3EQ7A 3ZDEA 2J0SA 3NHPA 3MJRA 5HF9A 3AVCA 1X3LA 3BIWA 4PAQA 3WYDA 4FR0A 2APJA 1RZVA 3HZHA 1RFLA 1CFZA 2IPLA 1CY1A 3A1WA 1VA5A 4WK6A 3V8PA 1USIA 3WI7A 3LLCA 2H8GA 4DSTA 3N4QA 3D3JA 3WUHA 4FOOA 3O9VA 4CGIA 4PCVA 1TU0A 4Y2UA 5D85A 4HRVA 2QAGA 2IPNA 4TRJA 4ZU1X 1XC7A 1J2EA 5B1EA 1JBKA 1HFJA 3O92A 1QTQA 2CDAA 4JL8A 2ORED 3UBMA 4E1BA 2QM3A 3BSWA 3BEDA 3LQYA 2VR1A 1EX1A 4FT4A 3O3HA 3B3JA 3V1OA 3MMVA 1E8MA 1ZD1A 2LIPA 3CX4A 1RDFA 4RESA 1HYEA 4ZOLF 5AKKA 2MR5A 2Q45A 3NHMA 3K5LA 5TGZA 3CF6R 4P3XA 4E22A 4HCBA 3KLNA 3C6QA 1RACA 2PKQP 1T3HA 3EPLA 4MLDA 2PVSA 1S8NA 4C0WA 4LTDA 3PXDA 1WOQA 1DC6A 3RUHA 4HYYA 1EFPA 2GM4A 2MINA 4I1UA 3R76A 3M3DA 1X8XA 1R0YA 1PFUA 3M6FA 5LMCA 5J2UB 4ZKEA 4QGGA 2PV7A 1MDUB 5FQOA 5FWAA 2FUEA 1WZCA 4DB4A 5ALEA 1FVHA 1LSOA 1MX1A 1NGJA 1T0HB 1A9ZA 1KEWA 4M7WA 3CSDA 4P3PA 4R54A 2I03A 4UAJA 5BORA 1EWQA 3HKCA 3GRYA 4GKBA 3ZHSA 1LOTB 2CZCA 1RADA 3AHCA 4CEJB 3USCS 1TUGA 3FR8A 4HEJA 3L6OO 3E1KA 3PXCX 5EE3A 2DF8A 3P1JA 3Q85A 3T4PA 3H9UA 3KLIA 2RKIA 4IYJA 1DG9A 4B3RK 1G0OA 2P8SA 4TMKA 4TZTA 2WTXA 5K0TA 1E0AA 3H1EA 2A0UA 3GH3A 4B3GA 1S2IA 1NOJA 5F5XA 3LD9A 3TCNA 1G8HA 1JVBA 3DF7A 1Y1TA 3VHQA 5ALGA 4O6VA 2NNLD 5A5FA 1KEZA 3CWQA 1Y7HA 5C8XA 1KK2A 1RLIA 4CIYA 4CGZA 3DBHB 2BVNA 3A31A 4WCVA 2P4SA 2L42A 3I8XA 5GJWC 3T1HB 1NXXA 3MA0A 2BEKA 4ZOBA 2AZ4A 3OOHA 3GEEA 3LUCA 3GZNA 2C42A 1ZHFA 1PT5A 4XUEA 3AI3A 5B3KA 4I4NA 5GINE 1MT0A 3Q7TA 2QZJA 4RLFA 5IG2A 3ETDA 1GZVA 1WVMA 4IOAL 2YCBA 1Z35A 3BL6A 4OGCA 3GEDA 4E33A 3CPEA 4OHRA 5BN5B 3G9TA 1NNLA 2GBGA 3ZS9A 3CX7A 4J7UA 2WI8A 3L79A 3VOTA 1NBEA 4JASB 5HR5A 3BTOA 3SVLA 5IXYA 3O3FA 4ZZ3A 1DDGA 4HPWA 2XY7A 4PY2A 4V0MA 5HK8A 4OP2A 4B87A 1XDUA 2HJVA 3R7DA 1JF8A 1LQTA 1I2MA 3AL3A 3GRPA 2BDTA 5I7UA 1EETA 4MLCA 3H9EO 4A8JC 3L8HA 1G20B 2ZIFA 3M33A 5BVHA 3Q8KA 3EPPA 3QY0A 1QYXA 4IGFA 1AZLA 5FV4A 1W36C 1P0FA 4CG2A 4QWMA 4D1YA 2QS9A 4NF2A 1OKKD 3FCCA 4QOHA 4Q9KA 2H85A 2QVZX 2EL9A 1PSZA 1S6PA 4JN4A 2FPLA 4FJNA 1FOEB 1RYNA 2PGJA 2Q9BA 2QTFA 3G7UA 4HDRB 2QX7A 1SQ6A 4NU8X 3TFOA 1TIBA 1KC3A 4O0LA 2VRCD 4F5WA 1CUWA 4K7JA 4QQNA 2WB2A 3TTCA 2WMNB 3L3BA 4GRIA 2HGSA 4LF5K 2PUTA 3UN1A 4H0OA 3A3OA 4CUKA 4QTYA 3ROKA 1MRNA 4HO1X 4EA7A 3T6KA 2J3QA 1C0TA 5LKRA 1XNQK 1GLBG 2PL3A 3QX3A 1ULBA 3DJFA 1EFLA 1ZRSA 2KBEA 5AH0A 3K73O 5JQGF 1G8MA 3LKVA 4CI0B 3UHOA 4WK4B 3NE6A 1MQAA 1IEQA 1SCKA 2GXSA 3SX4A 5CX1B 1T43A 2G8NA 2Q4EA 3K4QA 3ROQA 1NVTA 1P8JA 1C9YA 5D5HA 2CT8A 4BDPA 4UW9A 2G08A 4MRVA 2BFBA 2CWWA 2XUDA 4GOLD 1R9MA 1T29A 3E8MA 2ZS8A 1U3GA 3DVAB 1XD2A 2CFIA 4LE0A 3EAFA 5JPDA 1QR2A 4FZYA 3ET5A 4X41A 4YRDA 2P4HX 1Y80A 4RX1A 1IMJA 3K53A 5AHXA 4A0FA 4RTFD 3HDGA 5IFLA 1KJ9A 2CNDA 4D9HA 4KSCA 3LPAA 3W5HA 5BY2A 5E1MA 2ZXUA 4GL2A 2X6QA 1GA6A 1LW0A 3NGYA 2GUPA 1EXNA 2G09A 3N2GA 4RGVA 3VKUA 3ZU2A 3UJBA 4P3NA 4S1WA 4G5HA 1NMQA 1D0VA 4FX5A 4LQCA 4GICA 2C88A 3KVNA 1K7FB 1GZDA 3EW9A 2ANBA 5FADA 1SELA 1B1CA 1GO2A 3GCGA 1DT5A 2Q2VA 3JATA 4U6NA 1E7MA 5AYVA 1HE3A 2PMEA 4O4LA 4MINA 5CHIA 3W1EA 1N1GA 2ODNA 3N07A 3NOXA 5M1QA 3J80O 2MTBA 4J2EA 3W8EA 5BNFA 2ATCA 1UBCA 1F4LA 5BNZA 2FSHA 4S05A 4FK0A 2HL6A 1NJ8A 3K7EA 4KJXA 1J97A 4FW8A 1S2LA 2G9NA 4YJ2B 3WRXA 3LTEA 3L4KA 4PZCA 5DCWA 2GR9A 4KLRA 4ENQA 1QLJA 2ZRJA 4B3OA 2FMUA 1RWVA 2G7ZA 3AO1A 3NVAA 4DCSA 3EZXA 4BKPA 4NMWA 3B8AX 1N34K 3DKVA 3L0QA 3QESA 3A1SA 4IJVA 9MHTA 1U5BB 1JEYB 3T3EA 5K8TA 4M3YA 3E23A 3HXOA 1JXOA 1X80B 2BELA 1EEXB 2NT4A 3BMQA 4MLPA 5DWDA 2IUYA 1RXEA 1E4OA 3WNEA 4JELA 2Y1WA 3U7HB 1FBNA 3U4GA 4AK9A 1TVKA 4LFBB 2V0CA 1XLTA 2OYSA 1G7SA 2YC4C 4M1YA 4PSAA 2H2WA 1L7RA 3GJ8A 2AXPA 3BRQA 3QKUA 3RDPA 1XMQB 4D80A 3VKHA 4MVJE 4FJJA 4NJEB 2B36A 3FYUB 2ONCA 4OGGA 3K0SA 3A4VA 1QLWA 3H4MA 1FYEA 3TLGA 1NWCA 1PX0A 4BGDA 3I2JA 3HP4A 4HQ0A 4UQOA 5L3VA 3FDFA 2NRTA 3L49A 3DM5A 2F64A 7ADHA 1NK4A 1MBZA 1UC9A 1THTA 4IBNA 2E4VA 3DXFA 3BBPA 3KXIA 1NNSA 4MV4A 1WAFA 4DQ0A 1CF9A 3MLBA 1ATSA 4KWHA 4LMBA 4WUTA 4ZT2A 1Q7YO 4B9QA 1TM7E 4J2TA 2H4HA 2AJCA 3CUWA 3RFUA 3NF8A 1MVLA 2H3HA 1U3FA 2PKXA 3RVPA 5J4LA 2CYBA 2OCLA 1E66A 3HVHA 1WXEA 2CDNA 2CZQA 2HJWA 2YY7A 1AX9A 3AV9A 1OI2A 2NM0A 1JCGA 3FLBA 4HJXA 4M49A 3RM3A 4EH1A 1YXQA 3TLAA 1PDOA 1TF7A 2E89A 3OLCX 4IG4A 5I47A 1K6XA 3ZNQA 2V3WA 5DXJA 4BUCA 4OHUA 1A98A 1XV5A 3VYUB 1ZS9A 2OB1A 4BC5A 4BIMA 3DDZX 2PR7A 4R7GA 4E5PA 4YAOA 3L8CA 1QRSA 1T0BA 1WL8A 1CDZA 3PO4A 3QE4A 1SCUA 2AOUA 1CQZA 3VESA 1PJ4A 4K6GA 1GSOA 3ZWDA 5COBA 5LLDA 3VH3A 3BMOA 2FOLA 3ROGA 4L5YA 2C59A 2QA5A 4ZAYA 5T57A 3TNLA 5ALXA 3NI2A 1MG0A 1NVVR 4RD3A 4PGMA 2QQGA 2R3SA 3AFNA 3MBOA 3CQ9A 2WUDA 3OUZA 4EI9A 1B2RA 5I3CA 1BH2A 3MWYW 5D2CA 1ISGA 1ZINA 3AG6A 3L7OA 3C3KA 2DQSA 3P2IA 5IK2A 3WRYC 2RH5A 2W4IA 4YP6A 4KV8A 1C4XA 1UPFA 3CXRA 4HDSB 3SDSA 5CA1B 2B6AA 4H3KB 1ZVMA 4P4NA 4JXXA 3U6KA 1CEQA 1VKHA 5G4KB 4DYVA 2EX1A 1ZJ4A 1XZJA 2FJUA 5EPUA 3T1NA 3C24A 1V7QA 4NBLA 2O4IA 4UD2A 3SEZA 1YGYA 2H1HA 3C3CA 2TECE 4YLGA 4FFRA 1JE1A 3A9TA 4J6FA 1B8PA 4LKRA 4DQKA 5C8YF 4DKJA 4R2HA 4Q4HA 4NCAA 4DYHA 1CDEA 3PDWA 3ZDZB 3I6BA 3NT5A 1NVDA 3T3NA 1ILYA 4LQLA 4FQ7A 4NHOA 2ZRDA 4HQNA 5GOZA 2JAXA 4RDXA 3NCHA 2QTLA 4FJGA 5G2OA 2XXBA 1MB0A 1SZCA 4LY0A 3BVPA 3E01A 1H2EA 3HCPA 2WPNA 4BPBA 5LMUB 2I6UA 4N6GA 1FFGA 3OYCA 1HDXA 4G0MA 4DV3B 3QBEA 1ML4A 3DZGA 1E5TA 2WOMA 5MN4A 4QQ8A 4I1PA 2RI0A 2DUUA 2QSJA 3RIMA 4OJNA 3ZKWB 5JFOA 1H6AA 2CJXA 5AKEA 3AVIA 5C10A 1U0EA 2LCIA 3W5SA 1A9PA 4DFMA 1GR1A 1OX4B 2BF4A 3N0XA 3OJWA 4IHJF 3VYRB 1LFDB 4BDSA 3BG5A 2PQ0A 5EN4A 4CVNA 5LQAA 5DHTA 3PSFA 3DEFA 1TE2A 2AK2A 4XIYA 1AKVA 2UUBK 1NLYA 1S2NA 2XRYA 3HUDA 2J7KA 1SVIA 4M8KA 5F77A 1V3TA 2JKVA 3Q72A 4TMVA 3RT7A 4P35A 1ODLA 2VT3A 4E4TA 5LU8A 1B0PA 4GAEA 2F00A 4B2IA 5INTA 1VE9A 1P9RA 4GEGA 1BRMA 5TF4A 3BHJA 2I6QA 1J6ZA 1K6IA 5EIOA 1YONA 1W0JD 4UMDA 2AJTA 5AVRA 3RODA 4HCCA 1XDDA 4FC6A 1JPUA 4UU0A 4ALNA 4X8HA 4EX6A 2I6TA 2HQ1A 3JWEA 3UJ9A 3SJ7A 4M0UA 2IY9A 1JN0A 4BC2A 2B4JA 1TRKA 4HNRA 4RANA 3HBTA 1LPNA 5JJLA 1PIWA 4YOTA 2OGSA 2ZRFA 4CFDA 2FP3A 1N4AA 4DTIA 1GN8A 1C7JA 1MJFA 3FLEA 3L02A 4A2BA 2A67A 2GF0A 1FX0A 4D5GA 1JHZA 3BIJA 4XRGA 4ZV9A 2G1PA 2P3SA 1O9BA 1QORA 4MROA 1OWOA 4RW7A 1TO2E 1DJQA 2GCPA 1QU2A 1VB3A 2WFMA 4EA8A 1O57A 5C3MA 3DD5A 3EFOB 3LXRA 4UCFA 3B13B 2K7ZA 3U4DA 4JYZA 1XUPO 3EXAA 1EZ4A 2P2ZA 2JAOA 1M90O 3UMFA 3CZ5A 3DZJA 1CLEA 1KOGA 3DF9A 2R60A 3G0HA 2BFEA 4Q9LA 5KC8A 4KFBA 4X8LA 3AUUA 2OGWA 4BO8A 1QIKA 4FWTA 3QXCA 1QRRA 4AZ3A 4I9LA 4MQ6A 1PK9A 4V0OA 4YP5A 3T3OA 4O3MA 5DGDA 1AIPA 1RQ7A 1TYCA 4AHSA 2CVFA 1U94A 3N6XA 4EHTA 4FR5A 4RK7A 1YRAA 2X0RA 4BQPA 3HSKA 4UOEA 5IU6A 2MMCA 3UAGA 2FFQA 3FMOB 3NANA 3OM9A 1ISHA 4GRAA 3GFSA 1UWBA 5DHSA 4C2UA 2FZKA 4L4ZA 1E6KA 3F2IA 3CXCM 4HDKB 5GJBA 3ST7A 3BB4A 5FOQA 4C0AC 2GZRA 4JLSA 2QEXN 1Z6QA 3HBAA 4RZSA 3KO8A 2XQGA 4DC0A 1SC6A 3EX7C 3BH6A 3FAKA 2EZ8A 1WSEA 4MQ3A 3GAZA 4FMCB 3NBAA 5ERYA 4ER0A 1RGIA 1BIFA 1AUXA 3QU7A 4YXFA 1I5OA 1EQAA 2EJWA 2WM8A 2RPIA 1BU5A 3B9PA 4X61A 2Y0DA 1KU6A 4KO0A 1ZM7A 4QTUB 4Y2YA 3SAFA 2CHEA 4L3VA 3T8YA 4RV5A 3KLEA 4NOMA 1XMOB 4OY3A 2P9QA 4QODA 4OLJA 2R5WA 4JQSA 2ZE2A 4WZBE 1MRZA 1W19A 3QWFA 4OLBA 4B34A 4PSUA 4PSDA 3H08A 5FV7A 5ITSA 3K5MA 1Z5NA 4AKEA 4DIUA 2W2KB 4UHEA 4RHEA 3DBHA 3P9RA 2I0FA 4KXXA 4OK5A 3EGEA 3Q6NA 1WAMA 5AJZA 4EF6A 2AN3A 1TKCA 2JIQA 5LC1A 5BSEA 3N1UA 3S2IA 1VQ5N 4GBED 3PS9A 3ONDA 1NJGA 1W5FA 5FBWB 1EBFA 2RB5A 1LCIA 3OQVA 2GJKA 2JAPA 1KI2A 2X42A 3RAJA 4ARVA 1FU8A 2FA9A 1GOCA 2BFPA 4I5EA 4KHPB 3IH5A 4X85A 2ZTLA 1JNYA 4JJZA 3RG2A 3TZQA 5JBQA 4PFKA 4U9UA 4R1QA 3A0IX 4ZI7B 4EPYA 1RPAA 1RKXA 4JOSA 4JI5K 5KVAA 2GETA 5DRYA 2V9ZA 2OHOA 1DMSA 2NU6A 2BRUC 3MWEA 4LAFA 1ZY2A 5FB3A 1TT5B 2CH5A 1II9A 2HUPA 2VDQB 4O4HF 4UTOA 5F64A 3RVOA 4JI8B 3A8TA 1MJNA 3OY2A 4HGZA 2JJMA 3MWTA 1KZ6A 2ZIGA 3OICA 2A14A 2WAMA 4DR1B 4JK7A 4L74A 3JQDA 1XVUA 1CRLA 1KPHA 1M2EA 4TYPA 1PD0A 1SXJC 1IC6A 1KY5A 4IXTA 4OQFA 1F2UA 3LYAA 1G8FA 4CZ2A 2JDID 5AW3A 5CT6A 1XZ8A 2I1VB 3R7FA 1XZGA 3WOHA 1TM2A 3ZV4A 2WYHA 2FG6C 5DM60 3U4QA 1MC5A 3EH2A 1V1RA 2J5BA 3KKNA 4ZYXA 3QPAA 3EAGA 1IY0A 5AXAA 2QP3A 1ZH8A 3E2IA 4MEBA 3AVAA 2G76A 4EDHA 4RTMA 5K0FA 1K7EB 3BC1A 4LZLA 4XRRA 4DSJA 4J0KA 3EIWA 3WHLA 1OXUA 5EKUA 3OA2A 1M2GA 2AV6A 3A36A 3EOBI 3Q3HA 3GGGA 3EARA 1XI1A 5FPDA 2IOFA 2O0JA 4G1MB 4KPGA 1U1CA 2VQ6A 1YWGO 4MDHA 4RAOA 4FL9A 5C8YA 3I4FA 3GG4A 3NB0A 3KSRA 2E1ZA 5HQ3A 3CCUN 1HKUA 3SQLA 2Q36A 1IWPB 1T1SA 2I22A 3CUKA 5CMLA 5LBUA 1U3TA 1YUNA 3KVGA 1U8EA 1YZTA 2NLOA 2D62A 7GPBA 5EJGA 4A26A 3PX2A 3OP1A 3ENHA 1QG6A 3K6SB 1FJ2A 4E70A 3MX2A 3NF7A 3WLAA 1OREA 1LBTA 3QP9A 1GYRA 5KTTA 3RUFA 5FLEX 3J80A 2ZRIA 3MXOA 1IBLK 2D13A 1ESVA 2GTHA 1KI6A 4GW6A 2IUSA 5THKA 5M1KA 1MORA 1QMGA 2JGDA 2PEYA 2Z9DA 3SSOA 3GUUA 3PXGA 1R4AA 2FBXA 2DG2A 1NSTA 2QRKA 3HV2A 2BTEA 4JR1A 1SKUA 2JBWA 4NZ9A 5JI2E 3QHAA 2H4FA 3HKEB 3SEFA 5BN3A 5L3QA 1DC7A 4Q1EA 3QDKA 4M88A 3UAXA 1HYQA 1C8BA 4LBWA 5FWXA 3EPKA 2Q31A 1OFGA 4A57A 3EDOA 3HU5A 4GKJB 5CE3A 5SY9A 1XTSA 1MXFA 3G17A 3NKVA 1U0RA 2ZCJA 3I8SA 3N0VA 4DV2K 5M5BA 1G6HA 4QNNA 2KZZA 3FYSA 5CBPB 1G9TA 3V6LA 3L6QA 2FMTA 3P4XA 2G7MC 3WB2A 3PGKA 1N9KA 1MEOA 3WKBA 2AEFA 4YRGA 4MPRA 3ZZ1A 2LGJA 4Z94A 4DV5K 1X80A 2GHTA 4F2WA 2QVBA 1FDOA 3TRDA 3HJRA 1KC8O 1GKIA 3U9SA 3K0AB 1QHSA 1YZGA 2OV4A 2WMOB 3CMMA 4Z2AA 2XWJI 3TR5A 3ZSVA 1M5RA 2AFHA 3FOBA 2VT7A 1X15A 1YT3A 4RY9A 1ISFA 1PR4A 2A3ZA 2ZJQL 1XDBA 3IELA 4XWOA 3SSAA 2CMHA 5DYNA 1BE6A 5JZ9A 5DOZA 5IM4A 1ZR2A 5SYAA 3FI9A 1DOZA 1HE5A 2QTCA 3Q7QA 4M45A 1CQJA 3HVUA 2H1IA 2FWRA 4MR7A 4RFLA 4RIGA 4RIFA 5CH3A 3U44A 2VUTA 2IBSA 2QKKA 2QQ5A 2FFBA 1S6QA 1CU1A 3LOUA 2YHWA 1U31A 3FNIA 4QJ5A 4CEFA 2H4XA 4JUCA 5DTMA 5KKAA 3TLJA 3WL3A 2G9VA 1SQ0A 4NNPA 4DA6A 2G1AA 1A71A 2WU3A 4XWWA 4CEIB 4F0JA 4P3KA 3VPFA 1A72A 1RDCA 1JAIA 4HGOA 4ID9A 3WO1A 3OFSA 4NYJQ 3KPUA 1Z18A 4U7FA 4WN3A 3RRMA 5HLFA 4ZVSA 2KLHA 1RXYA 2JJ1D 4WQ5A 3TVDA 2VOJA 5IKEA 4BO3A 1Z05A 4TWZA 3TAFA 3S3MA 2GWJA 2IFTA 4Q9IA 4WT7A 2BFNA 3X3HA 4FPXA 2UYHA 1GTRA 4WFJA 5IUKC 1Y4AE 3VOVA 1P7VA 5I9BA 4B81A 1YZQA 2VWBA 4C5BA 2QBYB 3O8CA 4I1YA 2DY4A 2KZMA 4YRLA 1Q0LA 1PJAA 2HB5A 1T3LA 3A3KA 1PLJA 1NQOA 3DDOA 3LALA 3CYFA 3M0EA 1BA1A 1JZTA 1WXFA 1W4AA 2ZE8A 4D4KA 2HHCA 3OLVA 1V39A 4IOJA 3RE1A 4U8HA 4WPGA 4OHKA 4NO7A 1RI2A 3LM8A 4EG5A 4EF5A 5ALMA 1UH5A 4YMGA 2EX4A 2HYDA 4D42A 3KYDB 3BFJA 1HKBA 5K5EA 3C74A 5ITZB 4G85A 1KFSA 2ETJA 3DVLA 3TBKA 4BAGA 4BQLA 1EFVA 4EJSB 3SSMA 2JIBA 1V71A 4BTEA 3ECAA 4ZIRB 4KE7A 1KAGA 3KQTA 4B32A 4BNHA 2WHPA 2RHDA 1CJSA 3B6KA 4JSTA 1GAXA 4QPNA 4B3SB 3QKSB 4NARA 3A2KA 3EEOA 4BXOB 5IF3A 1S01A 3AJ8A 3EIEA 4BE4A 4DDUA 3BF8A 1H2RS 5DI9A 1I4OA 1A8PA 4JB3A 4KPYA 4LXIA 3BFPA 3LQ1A 4GXNA 5TX7A 2FG7C 5HJ7A 1GKLA 1W8IA 2OR3A 3BD7A 2H3GX 2H1VA 3C8HA 3S27A 4I2VA 4DJAA 2DPLA 3O26A 1EINA 4GI3A 2IOQA 3LGSA 4AUMA 4QPJC 3BILA 4ZALA 3U7QA 2W2LD 1Y1QA 3I2KA 4PHHA 2SECE 3HUUA 3IXMA 1YJXA 1X3NA 4GYKA 5CT9A 5EZQA 1M0TA 1NVAA 3V6MA 2VDNB 1EMDA 4N5HX 1CJMA 2HHUA 5DYGA 3ERCA 4X54A 1T1RA 2FEAA 5TEWA 4BVHA 3CRRA 4L6AA 4WVFA 3LDQA 1Z7BA 5H0IA 4OFZA 3HUFA 4XKJA 5CB0A 3C97A 4AUKA 1N75A 1M74A 4MUKA 4C1NK 1R8JA 5H02A 3WNGA 2R6ZA 4GV9A 3CCJN 4FFNA 3NGMA 3MT7A 2O6LA 2IL1A 2TS1A 1B93A 3DL4A 3LZ6A 4V0LA 4BNWA 4EY4A 3BERA 4CW7B 3S81A 5MHTA 3EGDB 1U0LA 2QSUA 3O8NA 3VEXA 1DV1A 5T7BA 1YZYA 3PXUA 3Q2KA 3OQIA 4S3MA 3UV3A 3H18A 5KOJB 3D7EO 1XL0A 2JLRA 1DHRA 1KARA 2WWGA 1GU7A 2C5BA 2OL4A 3PX7A 2QPAA 3OCZA 3P4YA 1C1CA 2WNIA 1NKTA 3T1HK 2Y77A 3GF4A 4RW0A 2DLDA 4RELA 4ELTA 3DVSX 4BRWA 5CCXA 5EYPA 2FPGB 3ACDA 1CT9A 4BMVA 4CFAA 1EJ0A 1B4DA 1CDDA 3DQPA 1EWYA 5J59A 1RT5A 1JQAA 2D54A 4OKSA 2VG5A 2QY6A 3ZBUA 3CFRA 3BH7A 3R1XA 2H9IA 3GA5A 2C57A 1CRWG 5M3BA 3WAKA 3E9CA 3NIDB 1W6RA 3NM4A 1K92A 4JKBA 1N8NA 1VFNA 3ZT3A 2OBBA 2YRXA 2PYLA 1UM8A 4I36A 2OXFA 3KOYA 4G9ZA 4I5FA 4N47A 4DSKA 4UE2A 1X86B 2ZATA 5JAOA 3ACBA 3MPOA 4FHFA 1US8B 3QOWA 2V7UA 2OYRA 5IBCA 1KWGA 1L8QA 4OHXA 3OX1A 3U4CA 1WUYA 2Q62A 4GOMD 3LS2A 4PC2A 1T9AA 2EHDA 4LF7K 3KT3A 1E92A 3CCMN 1EVLA 4ZO4A 3RFXA 4JLDA 3UT5B 2QXUA 3FYCA 1YB5A 4O4JF 1OTYA 1UWVA 2OD7A 3TQSA 3KOUA 1K9MO 1EQUA 1OAOC 1KVUA 3KPWA 3VMFA 1ZMXA 2A84A 3F46A 3MINA 3QY9A 4TWBA 5JDCA 3IQIX 4PZPA 2YV4A 3T15A 3X43A 2OAGA 5HM8A 2IS6A 4MWDA 1ONBA 1HDIA 3U3YA 3QBWA 1M34E 2GMWA 3V9WA 3B70A 4MV8A 2FMFA 1W93A 1JAHA 4JI1K 1AXGA 3DYAA 4QE3A 4ROTA 2JFPA 4WOJA 5LA6A 3SCZA 4B3JA 4DV2B 1FX0B 1TZJA 4KE8A 4MLHA 1IG3A 2FOIA 4JLNA 1XC9A 4CIAA 2XITA 4QXAA 1L1RA 2O0HA 3RQIA 3Q7IA 1X1SA 1OFHA 4RF5A 4YHBA 4Z9BA 4BRMA 3ZD9A 2NO4A 2UYQA 4C3UA 1NLZA 4KH1A 3H9GA 3V1KA 4UOZA 4RW9A 1IQ0A 3K0KA 3PEEA 1W6UA 3U62A 4DARA 1GTSA 3DP7A 5CDUA 5JDIC 2RKWA 1I3AA 2BFMA 3ZZUA 3SQ4A 1SB9A 3ZT4A 1O94C 1BA3A 4U2BA 2D2FA 2VSFA 4UTXA 2ZANA 2DBZA 4PXYA 1M2OB 1P4HA 1CUXA 4DCCA 3LNCA 4XASA 5AQYA 1P74A 2REQA 3VUFA 2BPOA 1QF7A 2WTBA 4J7XA 4JBNA 4KXMA 4TMXA 2RBKA 3U4IA 1W5EA 4M37A 4O5FA 1ZLXA 1E7RA 1JSXA 3JSXA 2X19A 1SUAA 1E6UA 3RUEA 5M34A 2P4UA 1M2HA 1BQ4A 1JLLA 2WF9A 2ZRAA 4OAPA 1TL7C 1D1SA 4FMPA 2I6FA 1KJIA 1FUYB 2WA1A 3OEHA 3CJRA 1SVLA 2ZPUA 4QYXA 3MK31 4CFZA 1E2KA 1KEKA 2JVIA 1KJYA 1JKMA 4O0MA 4NLCA 2YCLA 1TECE 2P1ZA 3QV2A 5GMOA 3GA0A 3VR6H 3FZQA 5DH9A 1N2IA 1V1RB 4KH5A 1E9BA 1H8EA 1IIBA 1SCJA 1TF2A 3PVSA 4K9LA 4ND1A 2BTOA 5EVJA 3TPCA 4D4IA 1L3SA 5C7LO 3PEWA 2JH8A 1EK0A 3T12A 3ZWXA 3OBWA 1GARA 1A4UA 1V41E 4NNJA 4RXUA 3F9KA 1N1DA 3DOOA 4FLTA 2QRVA 4P31A 3UKRB 1MC1A 3A3YA 3IBSA 4QECA 4UHBA 3P0JA 5C1DA 2A35A 2GA9A 3IMKA 3LANA 3C4JA 3PLRA 3IOEA 3NWJA 4C3VA 1HQUA 4GGMX 4FQ5A 3RHSA 2QVGA 3ROFA 2DTEA 5AJTA 2IGBA 2PLFA 1UUFA 1RRFA 2ZU0C 3PGA1 3ABZA 4G0PA 3DKKA 5DX8A 1BJKA 4AY6A 3VOSA 2QW8A 1LLUA 3ZIAD 5JSQA 4PG5A 1QVGM 4YY3B 4V24A 4R6XA 1AV6A 3RS4A 2X74A 3WKEA 3BX1A 1VMIA 3C85A 3NTVA 3LYUA 5ECYA 3RUCA 4DV0B 4PQUA 2JZCA 1RRCA 2JIDA 4FOTA 1JHMA 2OC9A 2DY1A 4LQDA 4AULA 2XTMA 3HM2A 1ZD2P 5A9SA 9GPBA 3G8CA 1CQWA 4HAWA 3VPXA 3GPDG 4BEVA 1R8SA 3OPYA 3QEOA 2YVLA 4J4TA 3HXTA 3HUEA 4G9EA 4EB6A 2W2XA 4BCCA 2WF5A 1YK0A 4MR7B 3FM9A 4ZT5A 2W58A 1TK9A 1ADCA 1IQRA 4PYRA 1ECGA 4TMWA 2VCEA 1U1EA 1QKIA 1L3IA 4AECA 5JOQA 1A9OA 4BWMA 1K6JA 1O4WA 1WHTB 2CUZA 2PUGA 2B1QA 3M6VA 3IMGA 1P39A 5B7NA 4FJ5A 1SU4A 2AG6A 3IE0A 4K6KA 4YJHB 5BWMA 5KTNA 2NWQA 1QTRA 4B9TA 2WNSA 3C6HA 3HSCA 3DCIA 5B6PA 4X1OA 4KI4A 3L5KA 5JAMA 3LHDA 4B3IA 2F96A 4WFBL 4E6PA 3FFKB 1GZHB 2KLBA 4UDNA 1ZOLA 3VSEA 5BXQC 4FNOA 3KK2A 1JG6A 2A9QA 3THYA 4Q3KA 5JWHA 4YR9A 3HXQA 1JT9A 3L2RA 5T3YA 3ZQJA 2JKZA 3VGKA 2NXEA 5CR4A 3W34A 1SOAA 5DLQC 3R8XA 3CUYA 2GXAA 4CDRA 4I6MB 1WCIA 3P97A 2O19A 1Q1AA 4RVOA 1SUEA 1IWOA 4JVNA 1DB3A 4CTOA 3RYCA 2QUIA 2BEWA 3WMFA 4JI0K 5SZIA 5E84A 1L8XA 3CC2N 1GYQA 3MINB 3WK5A 1C5KA 4KLZA 3O93A 4PSVA 1P2BA 4XW2A 1CG6A 4JY7A 3K30A 2H06A 4BNDB 4DLXA 4KQCA 4OX9Y 2IEYA 1VQPN 4B3TB 1UMBB 3P9PA 4OB6A 1QCYA 5JISA 3HRIA 3JYLA 5K9ZA 3FOCA 4CZFA 4XH9B 4LMAA 4MKHA 3WGQA 3A2MA 3CPSA 4JZKA 4IO9L 2CVOA 4QYWA 5FTWA 1HNNA 5A2QO 2IHKA 4LHYA 5IT9A 3IP1A 1B73A 2CLEB 1L7VC 1QBKC 3U3XA 4CTJA 4Y6GB 2AG1A 1Z2EA 4TWIA 5FLXA 2P79A 1ODIA 4GXTA 3ZH9B 2FSGA 3BWVA 4BREA 2FX3A 4IZ6A 2G82A 4UZSA 1W34A 2P9HA 1ZL2A 1L5KA 1NGAA 1S8OA 1RM5A 1TMOA 1I0IA 1YCDA 3A4LA 5F78A 4Q9NA 3O0TA 5K09A 1KYTA 3HXKA 3HKCB 4HX9A 4LVNA 4R2XA 4G8JA 2VXOA 1P60A 3TBHA 4D9KA 1NPYA 2ILVA 3SZMA 3CVJA 1Z08A 1G18A 2WU4A 4MQ4A 1WHSB 3W5UA 2GNPA 4YORA 2VHVA 2ZT8A 3F96A 1WCWA 4YDQA 3GW8A 1QO7A 1C30B 3AW9A 4DMHA 2JWKA 2Y1IA 1GQQA 1BROA 4YYEA 3BE6A 1B8UA 4KLNA 1Q16A 4UQPA 5FPPA 3SF8B 3IAYA 3UUWA 3VU9A 1Y8RA 2CNNA 1NI5A 1SH7A 2P9CA 2Z43A 4IDDA 5AW7A 3B20A 3U4MA 3AVGA 1QFYA 1GAQA 3EE6A 4LSZA 3F0TA 2AMYA 4ZV4A 2KSQA 3NQ41 1O95D 4Z4IA 3KTAB 4FS8A 4CV2A 2PQ6A 2ZSBA 3GC6A 4FN5A 4U0KA 4MLEA 4Z86A 1Q7GA 1JE0A 1VHJA 1HNXB 1XHXA 5JCZA 1AKRA 2QD5A 3AYXB 4RC9A 4DTRA 1KAQA 1PJCA 3I9MA 3S0JA 4S24A 2XCSB 1KRXA 4N56A 4JLPA 4PPQA 4YUYA 1EWRA 5AZJA 1I32A 3J7AP 1QFMA 3NG1A 5CX1A 3SYRA 3C7KA 3QMWA 4NNOA 3VU1A 5JXJA 1WO8A 4FJKA 4AUNA 2HHJA 2CV2A 4H17A 2VRNA 4DNOA 3MAJA 2CNLA 2XUAA 3PHLA 1WKBA 3S2YA 1S5JA 3OEYA 2D8MA 1HMYA 2E6UX 3GT0A 2QWMA 3ID6C 3UJAA 4KQ2A 3VC3A 1N77A 4RDHA 3QVGA 1ZXBA 2AI2A 3ML1A 4LS3A 1PWYE 1T9KA 4E0DA 3OT5A 1NBWB 4WADA 3D2BA 1IXSB 4P2BA 3WGTA 4ZIRA 3CE9A 2A86A 3EIUA 3QICA 4GKAA 3OYLA 4YV1A 2AFIE 2FK8A 4EEZA 3IFRA 5C4MA 3KQUA 1IZZA 4GBGA 3WLEA 3ZE1B 4BNYA 1T3GA 1QF6A 5LL6Z 4BE2A 2R6CA 3GEIA 4BFXA 1QIMA 3DZFA 5CD9A 1M8PA 5IMSA 1C0EA 3RREA 3IVCA 2ZGYA 4N18A 1N2CE 1LV5A 4DADA 1U1DA 3JYPA 2R68A 2X6RA 1PEYA 3DLRA 3P5JA 3PC6A 3WNFA 4ZMRA 2HAEA 1TMKA 3AB8A 1D2NA 4GBJA 3BM5A 1Y81A 1XPOA 3BGIA 2I6XA 4Y2PA 5ADVA 3K0BA 1S22A 3RRZA 5I7OA 3ZDCA 3VNQA 2A92A 1DBQA 2AOTB 1ABFA 1U0SY 3GLUA 3HCAA 5ALIA 3UT5A 3SYNA 1FTQA 2ZB2A 2ZEJA 3E7WA 2CEKA 3QLVA 1WTAA 2C2XA 3HFSA 2Q3SA 1W2BM 4EY5A 3FUWA 1PBTA 4RV4A 1PL0A 1NR1A 1VK0A 3DAYA 4NCNA 1E2QA 1FFWA 1IB6A 4FFPA 3UAYA 4YJKA 4FZ5A 2FE1A 1J56A 3PF9A 1S9DA 3K09A 4BZZA 3FMVA 3MWJA 3GZNB 1DQPA 1R0KA 3CLTD 2VLIA 1MRSA 4FDUA 3UFXA 2ITGA 3V9SA 3ENBA 3MN9A 1QJCA 1VOTA 1W25A 1KI9A 1R00A 2QMUA 3K1AB 4OKIA 5AVKA 5FNVF 3RYTC 1ZUNA 3SX2A 1JHPA 4KAXA 4DR2K 3TD2A 4ZGBA 5LQMA 2GN8A 3CERA 1NE7A 3A6KA 2WTUA 1TYBE 3BXEA 3HL0A 3I9KA 4FFVA 4KK4A 4Z3KA 4D9EA 4YRSA 3KIOA 4OXQA 3VR4D 4W7SA 1U0TA 4GMGA 2ZB7A 4I19A 4C2BA 3LDGA 3NNNA 1T3TA 4PYQA 1DAEA 2TMYA 1SVOA 3D3WB 4JA2A 4CGHA 4BG9A 1H0SA 3WGMA 3ZWVA 4F21A 2FW8A 3HMQA 3T4EA 1X7ZA 3TJMA 3WLNA 1UJMA 1U4SA 1ZUIA 3RR8A 3H5IA 4M9XA 4WDRA 3SBXA 5BMOA 2OM2A 3LM2A 4G0NA 4OGWA 4UMFA 1QHEA 4BL5A 1K89A 1QFXA 4WX2B 5AI8A 1ZAYA 4ZMBA 2PIDA 2YWJA 3KP1A 1YR1A 4AO7A 4ZI3A 1V2HE 1CXZA 2AKEA 2ISCA 4B76A 4JWKA 3HJFA 1RT6A 1U28A 2IYOA 4UMEA 3HSSA 3C94A 1SAZA 1JQ5A 3ZI0A 4P0QB 3D0PA 1QSLA 4I66A 4OA8A 1ASVA 2D5CA 4M6WB 4FFLA 4O4HB 3CJAA 3DFZA 3B7GA 3OYNA 5D86A 4A23A 4RS3A 3IXQA 4MSUA 1R0WA 5J43A 1B0UA 2B4KA 2YS7A 1NUAA 1BU6O 1GEEA 2GASA 1Q14A 2YDXA 5FFFA 1NMZA 3UZUA 3QLTA 1Z26A 1QHNA 1A8UA 2FPKA 3KJZA 1GGVA 2BJVA 2I7VA 3PUZA 2G5TA 1FP4B 1LW2A 3JVUA 4EGQA 1FXWA 1U81A 3KYCB 4UPEA 1R6UA 4IOLA 2OCDA 4Q34A 5FWYB 4K5QA 4HLUC 3W78A 3QYFA 5HKBA 3EWNA 1KAZA 4O1MA 5CVDA 3ZNPA 3ZV5A 1U9IC 5HQJA 5B4VA 3ULKA 1ILWA 1H2XA 5EOVA 3UWOA 4BFLA 2BE2A 1DRKA 3BHIA 1RDWX 4I6EA 2YWXA 1WY5A 4ZCMA 3LQ4A 3PNLA 2DYKA 2O2HA 4FFDA 1AN9A 1QZUA 1V4VA 4Z9XA 4MW4A 1LY1A 2B61A 3PUKA 1DEOA 1ZICA 2WM3A 4KX5A 1XYVA 2A41A 1XEWY 3AVQA 1LV7A 1KBOA 4ZVNA 1ESDA 4OFWA 3B6MA 1JR6A 3EL2A 3K05A 2F17A 2HMTA 5CFRA 1UAYA 4J1NA 4S1VA 4DA7A 4BRNA 2H4WA 4D9IA 2Q9AA 3UKRA 3WFIA 3L46A 4W7IA 4E15A 3FYHA 3NVDA 4DGSA 6CHYA 2X0KA 2XWSA 2IYNA 3U1VA 4JUBA 4K03A 1IBKK 1IZ9A 4C89A 2WWIA 4EZ6A 2VO1A 3W2EA 1DFGA 1VKRA 2WJGA 3M6WA 4CT5A 3KQOA 4K8XA 4BB0A 3E9EA 1JMYA 1IG8A 1EFTA 4DMGA 3ZOKA 1H0KA 1BG6A 2VK8A 5D00A 4REOA 3IE2A 2OCXA 1UZNA 5F35A 2WF7A 3A37A 3TABA 3TEMA 2PRYA 4MPDA 2XYQA 1GAWA 1U3DA 4KYVA 4JL5A 2XUIA 1SXHA 1OWPA 1U6IA 2UU9K 1XGKA 3H8SA 4LZNA 4HQRA 3MIIA 4J0QA 3QERA 3RF6A 1O95C 4Q4AB 2O05A 5CP8A 3IDQA 5TXGA 4UAUA 1SIWA 2Z4TA 4MVJD 4EVSA 1WULS 4CEDA 3T52A 1OLXB 4UC0A 2OKCA 2REQB 2ZS7A 3ZEIA 5I7WA 3KWFA 1D8YA 3QLUC 2PWYA 4HWTA 5IZ4A 1SG9A 3UCXA 4RTSA 3QEMA 4UATA 2IITA 3DAPA 2D1QA 4DUZK 3HR4A 4NECA 3T99A 4EG8A 4ZO7A 4ZT7A 5CFZA 5K3AA 2GPSA 2M1ZA 1CHNA 4BKQA 3MIZA 3TTTA 1SUPA 3CE6A 4G37A 1H0HA 2AN9A 3INNA 2EJVA 1D4OA 3E9ZA 2CWDA 5EJ2A 1DEHA 4CBUA 4Q4JB 5IKXA 1QP8A 2R6HA 4JKDA 1Z2OX 4CDMA 5FIUA 3NHWA 4F97A 3RKUA 3NONA 1JG4A 4H1TA 4IMPA 1RDDA 2ZI3A 2IQIA 3RSEB 1E2FA 1XHLA 2AJ8A 2Y1JA 2BJHA 4FOSA 4WA7A 4JS0A 3V00A 3WR5A 2OPQA 4KFCA 1E1QA 4BNKA 4DDMA 5KKCA 1JDPA 2C0QA 2PKWA 4JVLA 3IO5A 4M89A 4S2UA 3RSFA 1RM3A 4I2NA 4JMLA 4U6QA 1BCOA 4R2JA 4UUMA 4Y2HA 1IKYA 2E4LA 1O6CA 2C9CA 1ZCAA 5KYUB 3ADDA 1U9CA 1HLFA 2X41A 1URPA 4DFKA 4GR9A 2OV6A 3GQBA 3GRVA 3CCBA 2WK1A 5DISB 2QE6A 4MI6A 3O08A 3PGMA 4N7JA 2NP7A 1QS0A 4IKEA 4J1QA 2C3YA 4YRQA 2O07A 5LN1A 3HM8A 2HDWA 4JYPA 2C4VA 4MRSA 4PWYA 2OVFA 3O4HA 3SS7X 3VNBA 1XVVA 3YASA 3LCVB 4LE1A 4ZOLB 4D9MA 5A06A 4XA8A 2W2LA 5CLFA 1GRRA 2VEDA 4M87A 4JKIA 5EXPA 5FUWA 1V95A 1DRVA 3WNBA 2EJBA 2UYYA 3K09C 2HNBA 2DT5A 2NSLA 5B7QA 1HDRA 1EX7A 2WD7A 3FJ1A 5AW8A 2IRWA 2GJAA 4UNPA 3GFQA 1Y3IA 1SG0A 3Q1LA 2AOTA 4M2LA 1Y7PA 4XLTA 2R8BA 3NHFA 4U3JA 1FDIA 1CZUA 4NESA 3VTAA 5KWSA 4Q21A 3B5EA 4LJKA 3LBIA 1C3JA 3L6CA 5D3MA 4IS3A 1E9SA 3DDSA 5K6TA 3DLLL 4LC0A 4QELA 2ZULA 3PDCA 4I8XA 3VI3B 4KNVA 4CL2A 3RAFC 2UXDK 1VG0B 4H2DA 2OANA 3WZMA 5BR8B 4ZGWA 1IONA 4DTCA 1SK9A 4WL0A 4HNGA 4JB8A 5IDWA 5FA6A 4WW0A 1FPQA 1HURA 4JB0A 3QKRB 2Q0HA 2A58A 3CURA 4FM2A 2OWDA 1DTWB 1QHIA 4HH1A 4YBZA 1R4NB 3GFFA 5ARCA 1L4EA 2VK4A 3PENA 1MO2A 1M1YE 1TEXA 2QGFA 5FTJA 3S68A 1CEYA 2OG1A 2PTGA 3GJ5A 4HDMA 3LF1A 2VATA 2QGZA 3BREA 3ETJA 1NMXA 4YRKA 1SV5A 2X4DA 3M3PA 2AE2A 2Q6KA 4D99A 1THMA 4A03A 1J8QA 4CR8A 3ZU4A 4X97A 1L3UA 1XN1A 3FE1A 3W5JA 4BLRA 4DU1A 2RFLA 5AXDA 4HFJA 1MB3A 3VF6A 5B53A 1QTIA 1IO2A 1GITA 4DWIA 1DCMA 4L51A 3ZIDA 5EMKA 1A9XB 3R3VA 2PY5A 4Q39A 3H8JA 4DSLA 1BW9B 2X9QA 1DVRA 2Z8YM 3R8FA 3QFSA 3N70A 1WZNA 1SURA 3N2EA 4DR1K 3H1BA 1TC2A 1UBOS 1BQEA 2J0VA 4TGLA 4B3HA 2IGIA 3HDVA 4R69A 2F3TA 1WSGA 3MWPA 1LWNA 2FR0A 2QI9F 3DV2A 1MMFB 4UVDA 5SZHB 1RE0A 5HJ5A 2N1MA 1NVKA 1T5HX 4G1EB 3OKPA 1RLTA 3QVUA 4UASA 3HMKA 3U44B 3O6WA 1X1TA 1VQ6N 2P6RA 1I10A 4FYPA 4NZYA 3JQ9C 2OTLN 4JX9A 5LLSA 5J2TB 5F7XA 4C1BA 3ILVA 2QTAA 2GBFA 2I7DA 3TO5A 3QITA 4JJ8A 1DXHA 4MVJA 2IVNA 4LV6A 2XWBF 4MQEB 4KN6A 4DTMA 5JZMA 3MXJA 1TCVA 1UXHA 3VQ8A 4CIFA 5JG7A 2FEKA 1E1CA 2WDZA 3E1SA 1Y8QB 3PJDA 4IDBA 4HXEB 1QFZA 1YS2X 4C88A 1M0SA 4EAQA 4YMIA 1IZ7A 3VUEA 5LP6B 1L5MA 1QFJA 3MX5A 4DT1A 3T3GA 2G9QA 5EE1A 3HKBA 3OFKA 4AF1A 5JS6A 3PFHA 1C7FA 3C6MA 3PUXA 3SUPA 4N0DA 1N0WA 2AG0A 4J0FA 3V7WA 3WGUA 2AR0A 3BFXA 4B79A 4PLWA 1NATA 2MT9A 4FNAA 3SIRA 2Z2XA 1Z8FA 2HIMA 4LJSA 3GVPA 2GSWA 5D7BA 1T2EA 2YWFA 3IC5A 5IVPA 5IAJA 4PN7A 4INJA 4BMOB 3LJKA 1V4SA 1U1GA 4MS4B 4N5IX 1RI5A 2CFTA 4IX9A 1SA0B 3M8RA 4NQRA 3TECE 4CMEC 2HNAA 4C2AA 1VDZA 3CHWA 2X2EA 3G85A 3C6TA 3V48A 1LRLA 2H08A 4LPSA 1RRVA 3AC0A 1CNEA 1O94D 5KYKA 5BN8A 1KZYC 2G63A 2C3PA 2WJYA 3NAGA 3Q87B 4IWYA 4NZOA 3E9NA 2DC1A 2G5GX 1WMEA 3O3NB 5EFOA 3WL7A 3MJ4A 2XE6A 2JASA 3GJ4A 4ZCLA 3TTWA 1ZBHA 1SIBE 1FSSA 5AQGA 1TTQB 4MUEA 4QBTA 4RLHA 4FWMA 1Z7GA 4QYTA 2OAEA 4PYNA 5HXAA 1HYHA 5E2IA 5IP5A 3X0DA 3OKCA 1JDUA 1UANA 5LPNA 1RU3A 1QIGA 1RNLA 1CC1S 5CT5A 5KYXB 2ZUVA 3LX8A 4GZ6A 1Y9DA 1MU2A 2YYZA 1Y3HA 4IVPA 2QNIA 4PYKA 4RADA 3WYGA 4AG6A 3AO3A 2FPOA 2LKDA 1KXZA 3PD0A 4M8SA 4RVSA 4DT1B 3EGOA 3MCTA 1H85A 4R2MA 4LF9K 1CR0A 2CZGA 2HADA 5AI4A 2X9NA 4BLTA 3CCSN 1FS5A 3P4IA 2X13A 4O5BA 3C5WP 1UFVA 2IS1A 5JAIA 1H4SA 2WC9A 2C96A 2PBLA 1GNPA 5EL0A 3VXKA 4Y6OA 4TRMA 3HN7A 3O9UA 1EVKA 1RS0A 2K4MA 2QW1A 5EAIA 1GTZA 3E1GA 4W5RA 1X94A 1M72A 2W2PA 3CFOA 3FMPB 2R65A 3G5MA 5KHOC 3DCJA 1YRBA 1N1MA 2J7PA 4ZQCB 2XX3A 5G1PA 2H9AA 4RD2A 1Z6GA 1N3BA 2PIAA 2ZJAA 2VP3A 4RPCA 5K8JB 1QYWA 4LDZA 4ZCTA 1NVXQ 1R0CA 1PG0A 2AW5A 3OAAA 5JATA 2Q46A 1TZMA 2IP1A 2UYOA 4MVWA 1LBSA 4D3FA 3UE5A 4FDVA 6REQB 1L7EA 1LLQA 3ASYA 4V19S 3W5CA 4K0KB 3NF6A 4JKAA 1B7GO 1KNQA 2YXDA 3WIDA 3ROMA 3LDLA 2XMZA 1EXVA 1HE4A 3UT6A 3VSAA 4BQFA 1WE2A 3CW8X 3RS7A 3V9ZA 5HDQA 1CR4A 5K3CA 2W6PA 1WQ3A 3HFJA 4GOND 3X2FA 5BOSA 1T34A 1XZQA 4IL5A 2SBTA 1LVUA 2PRJA 2PZAA 1L5OA 4YA6A 2HDNB 1YDMA 5AW1A 1YS1X 4O4GA 1P33A 3NH1A 1MTZA 2YIMA 4R9NA 1BVYF 1KEPA 2RJOA 2TMKA 3NYIA 1N2JA 3G2LA 3T9DA 3TE7A 2HUNA 4AKHA 4DR3K 1T6NA 4MUJA 1I2DA 4A0GA 1WLJA 1FFAA 2CVHA 2NU7A 3JD2A 3KD3A 5L40A 4V0ME 1NJFA 4FVMA 3G71N 3VTHA 1THGA 4IIJB 1TIKA 4XJVA 1NG9A 2CL0X 1CF2O 1G5RA 3N05A 4RH0A 2R62A 3W4IA 3W9YA 5TT0A 2XMBA 3STWA 1FJXA 4Z5XA 5AW2A 1FRVA 1WXGA 1FS4A 4GC9A 1OY1A 2REBA 4GWLA 5G3ZA 2ZUFA 3O80A 4LH4A 4UU7A 2R7KA 1YF5L 5JLAA 5JCJA 2F55A 5AQUA 3VR2D 2Z5VA 1VSIA 3AR3A 4BDZA 3FLCO 1GFWA 2WZQA 4OJRA 3ER6A 4JBGA 3COJA 1PUIA 4PPNA 4G4IA 3OU6A 5AKGA 4M42A 3R74A 3VFDA 3BYZA 3Q8WA 4CZLA 5HS4A 5F9FA 3QOYA 5NLLA 1I36A 3MAQA 2EWVA 1L3VA 2HQBA 2YBEA 1Y3BE 2WAXA 2ZRMA 3DWEX 4NL4H 3IXLA 3SYLA 5KNDH 3PQFA 4Q1DA 1NHGA 2E4UA 4KB0A 2ZYRA 3OYMA 4NMLA 5HRCA 2OXCA 4S04A 1YSCA 3QX7A 2HCRA 3GRKA 2VYPA 4MK4A 1JEAA 4Q7LA 4PHTX 2IIPA 4GP9A 1XDGA 4XCXA 2CXTA 4PHGA 4Y6LA 2WAAA 5EJ9A 1UFKA 2DSTA 1AM4D 1FFSA 2GJSA 1SQFA 2GZHA 2K2QB 5LQDA 1WR8A 3NWEA 1U11A 3DEJA 2G77B 2QLLA 4EL0A 5AUPB 1WKVA 3W1WA 3JALA 1QH8A 2XNDA 3I9OA 4AKTA 1K3FA 4WJKB 4AJ1A 2DAPA 3OYAA 2AEEA 2R8EA 2VC2B 4MYSA 3RHFA 1KKMA 3CG0A 3UQZA 3TM5A 3PX0A 3OCWA 4BQZA 4LRXA 5B37A 3LC2O 4UTNA 1AN0A 1KORA 5E41A 2AL7A 2BFFA 4TTPA 5CBPA 2VDPB 1DIGA 1EDEA 1JG3A 2XMDA 5E8JA 3HRKA 3FDZA 5FULA 1H1LA 1SC4A 1QQTA 3U7FB 4IRXA 3SQ2A 2O3SA 1ZBIA 4UBKA 1CY2A 2O8FA 4BVAA 4QNRA 1QQ6A 1JKHA 1ZYUA 3E27A 3AR2A 3P9KA 1Z25A 1OV6A 1X3SA 4U7TB 2NX2A 1ZD5A 2EC5A 2D06A 2PGXA 2L19A 4CFSA 4TVSA 1UAAA 3ABOB 1S72N 4AJEA 1RZRA 4MHOA 3QYAA 1QHAA 1WDTA 5CVEA 2G8IA 2J30A 4KHWA 3IV9A 4CRWB 1E9EA 1HZZC 4R81A 1PVOA 4XH5A 4XB6B 4P81A 4LZJA 4RTOA 4ID3A 4REQB 2BFDB 5GV7A 3MRXA 4PEVA 4XPIA 3LC7O 1E6WA 2FSKA 1UP6A 3DAOA 5C8VA 3V1NA 1TAUA 3GEPA 3IJPA 3LUPA 4FOIA 3QPCA 1US8A 2I3AA 4IDCA 4K6CA 2QRMA 3ZEUA 3ZHZA 5CPFA 2SKDA 4BKOA 5CK5A 3X1KA 1V6AA 4W5HA 2KS6A 3C98A 3CBQA 3G6EN 1LLCA 4MDEA 5BW6B 1KEUA 2NO6A 5EQDA 1HE8B 3HO1A 1U4NA 5FXMA 5BPFA 2WFAA 4NYIQ 4FNGA 3ZX3A 1LDMA 1TTPB 2AHOA 2YR0A 3ZCMA 4JD2B 1VQ9N 1BMFD 2CY0A 2LRHA 2QX6A 3FUUA 1HSZA 1MX3A 5DEOA 3MN6A 4FOPA 1XD8A 3UK0A 3WY9A 3E3NA 1BMQA 2Y05A 3IP8A 4KXFB 5JVDF 3TNFA 3H7IA 3ZE2B 4HEA6 1MJGM 3H99A 4JV5B 2QTBA 2FZCA 2NQTA 4ARSA 2E5FA 4LDPA 1HYZA 1GILA 4R1LA 2HNDA 4RK5A 1NVFA 4ZKDA 3UMYA 1QRUA 4JIMA 1UZAA 4Y2SA 1M8GA 2B25A 1VLVA 1Z5VA 2NZWA 3G8DA 3KEGA 4L6CA 4NCHA 1ICIA 3MLEA 4UREA 4X44A 4ZYTA 4Z9FA 5J47A 1T6CA 1N5MA 3LBHA 3E3MA 2F1IA 3KCQA 3PYMA 1U2VB 3AVPA 1W5AA 3D7MA 3EG9A 5BSHA 5I7FA 2OY0A 2YX1A 4JWTA 6YASA 3O91A 5DZSA 5KQDA 2FLKA 1QH0A 3K58A 4B6QA 5JT1A 4DS4A 3QBJA 3R2JA 4CZHA 4AM6A 4N5SA 1J2JA 1RQPA 2B3TA 3SKYA 5L3SA 3K71B 4FKBA 1NW6A 3KJEA 2XMPA 3L4BA 2VRCA 2N46A 2C2WA 1N2ZA 3E2PA 1VKZA 3MTAA 3EIFA 3QPUA 3CF4A 1ZW1A 4MYHA 3PWKA 1WZUA 1A50B 1JCEA 2QMZA 2DX7A 1I94B 5FUBA 1R9GA 5JEEA 5K99A 2G0TA 2PQMA 4HADA 3PJRA 4WXPA 4OAOA 1O87A 3KUDA 1C50A 2VOEA 5D87A 1XZHA 3GCWA 1YNSA 2BGMA 3N2KA 1E6EA 2NO0A 3VKWA 2B7BA 1MIOA 3ASMA 1GDDA 2ZYDA 3QELB 2D1SA 4N4AA 2YYAA 3VPZA 1ISPA 3DW3X 1PWEA 1YH3A 3SQ0A 3QWHA 2ITMA 3B6PA 4UXJA 2V0GA 3EIOA 4QG3A 1F14A 4UHHA 2JEOA 2VHEA 3KZKA 4LYHA 4XDYA 2C7RA 3AQ4A 4WFAL 2CLCX 2IC5A 1OC2A 1ORWA 1AF4A 3VQDA 3HG7A 3QK7A 4KIWA 4DAEA 4C5CA 1OIVA 2JI4A 2ASOA 4PPYA 2ONYA