1YTZI

Crystal structure of skeletal muscle troponin in the ca2+-activated state
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
141
structure length
141
Chain Sequence
EEKKRRAATARRQHLKSAMLQLAVTEIEKEAAAKEVEKQNYLAEHSPPLSLPGSMQELQELSKKLHAKIDSVDEERYDTEVKLQKTNKELEDLSQKLFDLRGKFKRPPLRRVRMSADAMLRALLGSKHKVNMDLRANLKQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Troponin T
publication title Ca2+-regulated structural changes in troponin
pubmed doi rcsb
source organism Gallus gallus
molecule tags Contractile protein
total genus 45
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2005-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00992 Troponin Troponin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.350 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ytzI01
4Y99B 1YTZI 4Y99C 1J1EB 1J1EC 1J1DB 1J1DC 1YTZT
chains in the Genus database with same CATH superfamily
2QEXP 2W90A 1KQGB 1SQVD 1QEXA 3JCUE 1SLQA 1M56D 2KS1B 3JC22 1BDDA 3ITKA 2XZRA 3SFEC 1Q86Q 2FYZA 2KSJA 1RE4C 2P2UA 2H7HA 2K3RA 3Q5SA 1QX8A 4Y99B 1G1JA 3TGUJ 1UIXA 2P1JA 3H1HD 1N7SC 2R3CA 4IL6H 2Q9IA 1JMBA 2XKMA 1HGVA 1IFJA 5AVWB 2IYOA 1N86A 2ZAEB 5B66H 1NJIQ 1RQVA 2HPCB 1GL2B 3CC2P 1JUNA 1HUCA 2M3EA 3H1IE 3V5BA 1W2EA 3RGUA 2GUSA 1S72P 4XA4A 1JMMA 2FYUJ 1OX3A 3TGUD 2IX7C 3OJAB 1SQVE 1E79H 4DCKA 1QVFO 3KQGA 2WT7B 3B5NA 3L74G 2IZ0A 2W8ZA 2Y9ZA 1EC5A 4PD4H 4C7NA 2KSEA 2B88A 3L70J 1QGKB 1NTMJ 2KS1A 3WUVA 5K5GB 3H1HE 3VMAA 1NTZG 2FYUD 1SS1A 3KZIH 3ZDMA 3C8VA 2YO2A 1FZFA 5AVRB 1L0LK 1VF5D 1X22A 1KB9H 1VQ7P 5H2FE 1Q7YQ 1YQ4C 3M0AA 1NTKG 2QA4P 3G3ZA 3N7NA 3RL0C 5APUA 3IR9A 3L75J 1HJBA 3JSVC 5APSA 2WVRA 2HPCA 3RK2D 3L70D 2WMMA 5DJUB 1NTMD 3TGUE 2PGDA 3USSA 5KAIE 2D2CC 4HH2A 1W5CE 2IYPA 3CCVP 3N4XA 4GODA 1R5LA 4I7ZC 1NOHA 1KFNA 3V2PA 3AE9C 2XDJA 1JCDA 1PGQA 1NVOA 1L2PA 1L4AC 4EYYQ 1IK9A 2IBZG 1L0NE 3L75D 2M8RA 2LXCB 3UIAA 3TF5A 2R32A 2FYUE 4RJTA 3MTUE 3L73J 2W6AA 5CCGA 1ZXGA 1LWUC 2KOGA 1FZCC 5AVUB 5KAFE 3T97B 1RF1C 1PGOA 1VQ8P 2H43A 3VP9A 1KV4A 3FWNA 4CPGA 1S5LH 3HD7A 2WSEH 2R5BA 4H44C 1Q90D 5AW3B 2N1TD 2KI7B 3AE4C 1EQ7A 4N78D 3L70E 5GTHH 1NTME 3H32B 2OYIC 3P32A 2E76D 3CD6P 4PJ0E 1NU1G 4UB6E 2AEFA 4XFJA 1X9VA 3L73D 4W80A 2W27A 2JO1A 5AW0B 5AW6B 3D6YA 1LTJB 3L75E 2MJZA 3H1LG 3TNUA 1JO5A 2ITAA 1FDMA 1VF5B 1HWTC 1VQMP 3D70A 1Y8AA 1LTTC 1J1EC 2QE7H 2QJPB 2K1AA 1A02F 5KJ7C 1JEKA 4UB8E 3E1RA 4PV1D 2AEMA 1IO4A 4H0LD 5AW7B 2XNXA 5TISH 2RMZA 4N78E 2QM8A 2KYVA 5B5EH 1JCCA 1NTZK 3L73E 1GU4A 2QJKB 1FZAA 2E75D 1W2BO 3GMAA 1SFCD 4DT0A 3MHVA 3MZWB 4KHXA 2E74C 3H1JJ 1QL1A 1NTKK 2KP8A 3G4SP 4U7JA 3S9OA 3C9IA 1S4XA 3ABVC 3SFDC 3MGNA 3AE6C 1FC2C 3VP8A 1M90Q 4U3FJ 2BEQD 4C7RA 1CI6B 1YTZT 4NPDA 1M1KQ 2QG4A 3M0DC 5AVTB 1OVUA 2N1TB 2ZYGA 1VDFA 2YKQA 3CCLP 1NAYA 1SQPJ 3VYIA 3H1JD 2E76B 2GA1A 4WY4A 4YTPC 1RF0C 4PD4D 2OYHC 4L74A 3PHLA 3H25A 3HE4B 2I1JA 2JJLA 1FJKA 3O6QB 1IJDB 1HF9A 4U3FD 2KIKA 5KLVJ 3MUDA 1SQQJ 1PPJD 4XE5B 2KXPB 1CW5A 3H1KJ 3LW5H 2ZVNB 2OTJP 1GMJA 2WPRA 2AXTH 1LJ2A 1T6AA 1N73A 1X79B 5B66E 1GZLA 1SQVG 1KB9D 2C0WA 2ZJSE 2Z4EA 1SQPD 4C46A 2ZXXA 4IL6X 3V2NA 3TSIA 2A06G 1Y9BA 2WSCJ 1GL2D 1RHZB 1U57A 3AE8C 1NU1K 5AW9B 2FFDB 1BDCA 3CCEP 3V4WA 3VOPA 4PV1B 1EZVD 2I1KA 1JY2P 4OGQC 5KLVD 2G3AA 3RBXA 2N9BA 4H0LB 1SQQD 2RN0A 3KDPB 2FBWC 1FDIA 1YBKA 1N8RQ 3H1KD 3H1JE 3NXSA 1KZUB 2HLOA 4PD4E 2WSEJ 2YKOA 3CCJP 1DD3A 1BGYJ 1PFIA 1JY3O 1OW6A 4WBAA 3CCMP 3Q3DA 2Q6QA 1RQUA 4U3FE 1SQBG 4BRYB 3NMDA 1IFNA 1PPJE 3PJSK 3TGUG 2B9BA 1MV8A 3SWYA 3KZIE 3L4FA 4ASVA 1BSHA 4LLHA 1KB9E 3MP7B 1AJYA 3IFMA 1SQPE 4I1LA 5CMZA 2E43A 2I8DA 1M1JA 2ZVOB 4PD4I 1EXJA 2K9YA 3U59A 1SQXJ 5BU8B 3M91A 4ZNCA 3W68A 2OTLP 1RY3A 3EQ2A 1PP9G 2O01N 1BGYD 1L0NG 4K3AA 1EZVE 1HVVA 5KLVE 3D6ZA 2KB7P 4L73A 1SQQE 3WUUA 3B5NC 3I55P 2C9LY 2CPSA 1KB9I 3H1KE 5APXA 1KYOH 3WMM0 4EIJA 2RKLA 4GT1A 2A45G 3RL0D 1FS0E 2H89C 3PP5A 3CWBG 2J5UA 1FOSF 1VPCA 1HH0A 1H0TB 3U1CA 2K37A 3L37A 2NPSD 1L0LJ 1TU3F 1SQXD 2MKVA 4OWFA 4N6JA 2WSSH 3NFQA 1EZVI 3L70G 1LP1A 5CBNA 3FGAD 4NPEA 3EFGA 2RH0A 4BRYA 4MN4C 2E5TA 1FAVA 1SFCA 1SVFA 2B87A 2R5DA 1D7MA 1MFTA 3GLMA 5CCHD 1K04A 1N7SB 1BGYE 5CJ4A 5AVSB 4DZOA 3II6A 1L0LD 1KILA 5GTHE 2WITA 2KNCB 3GHGB 2M5AB 1S5LX 2XV5A 1ZR2A 4ASWA 2WTYA 3L71G 3HRNA 1KTMA 2ZT9C 1ZN5A 1SQVK 1ZW0A 4LGDE 1HJ0A 1KQLA 1SQXE 3GG2A 3PH0A 1RE3C 5CCGC 1IZNB 1CZQA 1YIJP 1QVGO 1T3UA 1H0TA 2HR3A 3L73G 1UIIA 2WZ7A 2Y0CA 3Q5PA 3HD7C 1LTGC 2KZIA 2YIUC 3LW5J 4GOFA 4RKUJ 4AQRD 3WU2E 3V2RA 5TISE 3L35A 1L0LE 4EDFA 1ZMEC 2AEJA 1T2KC 1BE3G 1PL5A 1GL2A 1SQBK 1OXZA 2QSIA 5B5EE 3AEDC 3CLQA 4ZKPA 3RL0B 2KNCA 3GHGA 2M5AA 2NPSB 4Z1MH 2H88C 1HBWA 2C9NY 1IFDA 4Y28J 5C39A 1AVYA 4A7PA 1NKNA 2IPPA 2LKMA 4HJGH 2WT7A 2FXPA 3S1KA 1L0NK 4I7ZB 3HE5B 3L74J 1GW4A 3CX5H 4D6TG 5TJHA 1ZRTD 2QRXA 1LT9B 1NTZJ 2W6BA 3IN6A 1EXIA 4AYCA 4HYTB 3KXDA 1YI2P 2BCCG 1PZQA 3NTNA 3I56P 3M9HA 1NTKJ 3SWKA 1Z56A 3CCUP 1NHLA 3L74D 5BU5A 3B71A 3EFFK 3QWOC 3AE3C 3EWKA 4HB1A 2Y0DA 1BCCG 1OVVA 1FU1A 2OYOA 2OYIB 1OW8A 1IFMA 3AEAC 5APYA 5APVA 2IFNA 1LGHB 3V6IA 2NPSA 1HTLC 1FZGA 5KLIC 2HODB 1AQTA 1VF5C 2J59M 3MIWA 2V4HA 1ZRTE 2QJPC 2O01H 1J1DC 1NTKD 1PPJG 1URQC 2PRRA 2JP3A 2POHA 4WY4C 5AW8B 3A0BH 2VRSA 1KQFB 1KYOD 3HTKB 3RK2C 4IFDK 2ZXEB 4DJGA 2NRGA 1J1EB 5CCHA 1LT9A 3T97A 5GTIH 4K35A 3MUDC 3A5TA 4RESB 1J2JB 2WWWA 1S1CX 2YXRB 5KKZB 1ZV8A 4LC1A 2PAJA 3TK1A 1N73C 4ZMDA 2QIWA 3H32A 2WPQA 3BCCG 3L72G 2Q7CA 3CMAP 1OFCX 2E42A 1NU1J 1NGMB 5AVXB 3KHUA 2W6JH 2LXBA 3OAKA 5KAIH 1IFPA 2KLUA 1OZHA 4EI2A 3CCQP 2HG5D 2UWJE 2E5YA 1NTKE 1LTJA 3D71A 2E74B 1P84H 1M8OB 2FY8A 4H13C 1GK4A 1KYOE 2P10A 3W67A 1NU1D 1VL2A 4M3LA 4WB4A 3H1IG 1FOSE 2A45H 3A3YB 3GF7A 1DIPA 1VQ5P 3CXHH 5AW5B 3GF3A 2JWDA 2L91A 1WMKA 1M1JC 1KYOI 1DEEG 4IL6E 1N2DC 1OWAA 1YJNP 1KMIZ 1JNMA 4PJ0H 2OYHB 3IAOA 3K5BA 5EFWB 3KYQA 2XU6A 3HUSB 1M57D 1SQXG 3M9BA 2W83C 5BVZA 3CC7P 1ZP0C 1GK6A 3SSUA 5M1BA 1N7SD 3H1HG 2IBZI 3FX0A 4H0LC 1JB0J 3VMXA 1LTAC 3E7KA 1CI6A 1NU1E 1DH3A 3BASA 2JKVA 1NKZB 3AE1C 1MUUA 2FYNC 2N1TA 4OGQB 2E75C 2NZ2A 2GM4A 1L0LG 2N9YB 4YPCA 1K8AQ 3PRJA 4UB8H 2CK3H 1SFCC 1T8ZA 3CX5D 1DD4A 4GKGA 3HE4A 4GIFA 1H89A 2ZT9D 3O6QA 2OQQA 1N7LA 2QJYC 1KILC 1EDKA 2Q3IA 5CCGD 1RF0A 1VQLP 1DX7A 4OVNF 2HYNA 2WPSA 1FZEA 3G71P 1OW7A 1FJPA 4JBZA 3HUSA 2Q3EA 1YITP 3A0HH 2FYUG 3RK3C 1GD2E 1G1IA 2YKPA 1U7JA 1IC2A 4TT3H 1K05A 3A2AA 2BEZF 2FFDA 3B4SA 1VQ9P 3AEEC 4GDOA 1DEBA 1BSNA 5AVQB 5AW1B 3CL3D 5CJ0A 1VQPP 2CPBA 4QMAA 4Y99C 1NTMG 3KPEA 4R4MA 3CX5E 2D2CD 4IOIH 1PIXA 4BXLA 3B8EB 1SP4A 3CC4P 1FBMA 5AW2B 1SQBJ 2A06D 4HKZH 2P7JA 1T3JA 1GL2C 1JY2O 1S5LE 1L4AD 2PFXA 4W7YA 1JY3N 5E79H 3SWFA 2KLVA 2WQYC 4BWNA 2JWAA 1OIPA 3L75G 3TYYA 4B86A 2ZYAA 1USDA 3CX5I 3GHGC 3R4YA 2O3JA 5APTA 1PP9J 3G6EP 1L0NJ 1LTIC 4L75A 5APWA 4TLFA 2Q1KA 1SQBD 4JYBA 1KQSO 4H44D 1EDLA 1SQXK 2WPVB 1RH5B 3C1LA 3P7KA 2B89A 2ZT9B 2M3BA 3CWBJ 1IFIA 2Y0EA 4DOJA 1S3JA 3BRVB 2A06E 1Q82Q 3VMYA 1P84D 3F89A 1PP9D 1K73Q 3A0BE 3AE5C 1L0ND 1PGPA 2K88A 3FXEA 5GTIE 1RE4A 2WSFH 1KORA 3HD7B 4O9BA 2YIUB 2JR8A 2YMYA 1AQ5A 1OMIA 3H6PA 1N7SA 1OVRA 1WRGA 1URQD 3S4RA 3CWBD 3CXHD 3TDKA 5AVYB 5KJ7D 1EDJA 4WY4D 4RO0A 1Q2NA 2NPSC 1SQBE 1JY2N 2XNDH 5KTBA 1FE6A 2FKWB 4I6MC 1AVOA 3MD0A 3F5HA 2D2CB 3L71J 1VQ4P 4GOEA 4IFFA 3AEGC 4JF7A 1U7MA 1GU5A 3TNUB 1AA0A 3U1AA 2FYUK 3JCUH 1NYHA 1P84E 1VQKP 2G8YA 3BRTB 1PP9E 3O8ZA 5CCHC 1LT9C 1L4AB 3FWLA 2E74D 2WSCH 4YXDC 4ZKUA 3OA7A 2V7QH 3GW6A 1ZR4A 2FXOA 1RE3A 2C0XA 1X0TA 1LWUB 1VQNP 1FZCB 3L71D 1LNQA 1NTMK 1RF1B 3CWBE 1P84I 3CXHE 4JQ0D 3M06A 4H13D 4H44B 1VQOP 1BE3J 2AXCA 3A7OA 4I2LC 4W7ZA 3V4QA 3AE2C 2AXTE 5CBOA 3BATA 3BVHA 3H1JG 1G2CB 1MFZA 1VQ6P 1LTJC 1QLED 1NTZD 3I5CA 4N3YB 4EOTA 2A45I 2QVAA 1WT6A 3CXHI 5DJTB 4U3FG 1QL2A 3QH9A 1KC8Q 3CMEP 1PGJA 3HE5A 1YQ3C 5KLIB 3P8CD 1PV3A 1BE3D 1R5SA 1LT1A 2R3SA 3LIEA 3CI9A 4D6TJ 1ZLLA 1SQPG 1L4AA 1J1DB 3L71E 1NH4A 1URQB 5H2FH 1XTGB 5KKZC 4WY4B 3FXDA 3L74E 2IDBA 1CSBA 1LTSC 1JOCA 2QJKC 4OGQD 2KK7A 1LWUA 1EZVG 3RK2B 3WU2H 1ZOYC 5KLVG 5CHXA 3AEFC 1FZCA 1SQQG 2BCCJ 3AECC 1RF1A 2Z5HA 3VTPC 1YTZI 2IBZD 3H1KG 1MKMA 2HFED 2OARA 1NTZE 3R2PA 1GW3A 4D6TD 1N73B 1BCCJ 2OYIA 1G2CA 1AFOA 2LR2A 1JY3P 2ZYDA 4KT0J 2SPZA 3A0HE 1HGZA 3RBZA 1YJWP 2HODA 1H88A 2QM7A 3L36A 1M7LA 3H1LJ 3P8CE 1BE3E 2BCCD 2N1TC 4OH8B 1KILD 1KFMA 2J58A 1H8AA 2E76C 1EDIA 2Z5IA 1JTHB 4H13B 2YO3A 2WSFJ 5KAFH 1BGYG 1BCCD 3HTKA 2P67A 1JM0A 4YXWH 1FDOA 3RK3D 2K9JB 3B5ND 2GUVA 1NO4A 1URQA 2DW3A 3E1IA 2IBZE 5KJ7A 3CCRP 3H1LD 3Q2YA 1KD1Q 4JYCA 4UB6H 1YHQP 5L8RJ 4D6TE 2FXMA 4NPFX 3HUSC 3P8MC 1YJ9P 3OW2O 5E79E 3BCCJ 2KZJA 1M1JB 3L72J 1K9MQ 5AVVB 2Y9YA 2IFMA 2FFDC 1FZBA 2IZ1A 4PV1C 2H8PD 3AEBC 2BCCE 4WVZA 1Y47A 2R44A 1KILE 3PTZA 5AVZB 1R8EA 2YMKA 1NWQA 1AV1A 1YYCA 2V7QJ 1NAFA 4R4LA 1S9KD 3M9QA 5AW4B 1KN7A 1BCCE 2JEEA 3RK3E 3BCCD 3WUTA 3L72D 2Q5UA 3CPWO 1JTHA 3IF4A 3M0DA 3LIDA 1LP1B 3H1LE 3AE7C 2KUBA 3H1IJ 2K9JA 1LTBC 2ZFCA 2O1KA 2FYNB 4JPZB 2E75B 3Q5RA 4KJMA 3G9RA 2M0BA 4AUWA 1SFCB 1SQPK 1GTWA 4WWIA 1X8YA 2B87B 2O1JA 1MZ9A 1S2EA 2OYHA 3PLNA 2P58A 1IK7A 3VN0A 4IFMA 3V2QA 1SQVJ 3VMZA 2OTKE 2O01J 2QJYB 1KILB 3HD7D 5KLVK 1USEA 2YNYA 2JDIH 1SQQK 3Q1MA 3H1ID 1S9KE 1XTCC 2L5GB 4L76A 1GDTA 3RL0g 3H1HJ 1E5WA 3RK3B 1Q81Q 5APQA 3CCSP 2OGUA 1T2KD 3B5NB 3BCCE 3L72E 2PP6A 2YXQB 2BASA 4C7NB 1A02J
chains in the Genus database with same CATH topology
5AVYB 4WY4C 5KJ7D 1N73A 1SLQA 1X79B 1GZLA 4WY4D 5AW8B 2C0WA 2VRSA 2Z4EA 2NPSC 1JY2N 2XZRA 5KTBA 3HTKB 4C46A 3RK2C 4IFDK 2ZXEB 2FYZA 2KSJA 1J1EB 5CCHA 1LT9A 1RE4C 2FKWB 4I6MC 3V2NA 3TSIA 3T97A 2P2UA 2H7HA 4Y99B 3A5TA 1G1JA 1GL2D 3MD0A 4RESB 1NU1K 1J2JB 5AW9B 2WWWA 2FFDB 2P1JA 1N7SC 2R3CA 1ZV8A 4IFFA 4LC1A 3V4WA 2Q9IA 2XKMA 3VOPA 2PAJA 2I1KA 4JF7A 1JY2P 1GU5A 2N9BA 3TK1A 3TNUB 1N73C 1HGVA 2FYUK 1IFJA 5AVWB 3KDPB 3U1AA 1N86A 3H32A 2WPQA 2HPCB 2Q7CA 3BRTB 1GL2B 3O8ZA 5CCHC 1LT9C 1L4AB 2E42A 1JUNA 1HUCA 3NXSA 2WSCH 3V5BA 4ZKUA 3OA7A 5AVXB 1KZUB 2HLOA 1W2EA 3OAKA 2GUSA 2YKOA 1ZR4A 1PFIA 1JY3O 4XA4A 4WBAA 1JMMA 1RE3A 2C0XA 2HG5D 3NMDA 1IFNA 1LWUB 2IX7C 1LTJA 1FZCB 3OJAB 1NTMK 1MV8A 1RF1B 3SWYA 3L4FA 3M06A 4LLHA 3KQGA 2WT7B 3B5NA 1GK4A 3IFMA 4I1LA 5CMZA 2E43A 1M1JA 3A7OA 4C7NA 4I2LC 3U59A 4W7ZA 3V4QA 5BU8B 3M91A 3BATA 3BVHA 1RY3A 4M3LA 4WB4A 1G2CB 3EQ2A 1MFZA 1LTJC 3I5CA 1FOSE 4N3YB 2A45H 4EOTA 3A3YB 2A45I 1HVVA 2KB7P 2YO2A 1FZFA 5AVRB 5AW5B 1L0LK 1WT6A 3B5NC 2C9LY 2CPSA 5APXA 3WMM0 1M1JC 1QL2A 4EIJA 3M0AA 4GT1A 1N2DC 2A45G 1OWAA 3HE5A 3G3ZA 3N7NA 3RL0C 1JNMA 3RL0D 5APUA 2OYHB 3PP5A 1FOSF 3IR9A 1VPCA 1HH0A 3P8CD 1HJBA 3U1CA 5APSA 3L37A 3KYQA 2NPSD 2HPCA 2XU6A 3LIEA 3CI9A 3HUSB 1ZLLA 3RK2D 1L4AA 3M9BA 1J1DB 4N6JA 3NFQA 5BVZA 1NH4A 1URQB 1GK6A 4HH2A 1XTGB 3EFGA 4WY4B 3N4XA 1N7SD 1NOHA 1CSBA 1LTSC 1FAVA 1JOCA 1SFCA 1KFNA 1LWUA 3RK2B 3VMXA 3V2PA 5CHXA 1LTAC 1FZCA 2XDJA 1SVFA 1JCDA 2R5DA 1RF1A 2Z5HA 1CI6A 1DH3A 3BASA 3VTPC 1YTZI 1L4AC 2HFED 5CCHD 1IK9A 2OARA 1NKZB 2M8RA 1N7SB 3R2PA 3UIAA 5CJ4A 2R32A 5AVSB 1GW3A 4DZOA 3II6A 1MUUA 2N1TA 1KILA 3MTUE 2GM4A 2WITA 1N73B 2W6AA 5CCGA 3GHGB 2OYIA 1G2CA 1SFCC 2XV5A 1AFOA 1LWUC 1T8ZA 2KOGA 1ZR2A 1FZCC 1JY3P 5AVUB 1RF1C 2WTYA 2H43A 1HGZA 3HRNA 3VP9A 4GKGA 2HODA 3HE4A 4GIFA 1H89A 1H88A 1ZN5A 2QM7A 3L36A 1M7LA 3HD7A 3P8CE 1SQVK 2WSEH 2R5BA 4LGDE 1KQLA 1N7LA 2N1TC 4OH8B 5AW3B 1KILC 2N1TD 1KILD 1KFMA 2J58A 1EQ7A 4N78D 1RE3C 5CCGC 2Q3IA 5CCGD 1RF0A 3H32B 2OYIC 1H8AA 3P32A 1CZQA 2Z5IA 1DX7A 2HYNA 2WPSA 1T3UA 1FZEA 1JTHB 1X9VA 4W80A 2YO3A 1FJPA 3HUSA 3HTKA 2W27A 2P67A 2WZ7A 3RK3C 1GD2E 5AW0B 1G1IA 3RK3D 3HD7C 1LTGC 2YKPA 1IC2A 3B5ND 2GUVA 1NO4A 1URQA 5AW6B 3A2AA 3E1IA 2FFDA 5KJ7A 1LTJB 4AQRD 2MJZA 3TNUA 3V2RA 3L35A 4JYCA 1JO5A 1FDMA 2FXMA 1T2KC 1HWTC 3HUSC 3P8MC 1DEBA 1GL2A 1SQBK 1LTTC 1J1EC 5AVQB 5AW1B 1OXZA 3CL3D 5CJ0A 1M1JB 2CPBA 4Y99C 3KPEA 1A02F 5AVVB 3CLQA 4ZKPA 3RL0B 2IFMA 2FFDC 5KJ7C 3B8EB 1SP4A 1FZBA 3GHGA 2NPSB 2H8PD 1IO4A 1HBWA 1FBMA 2C9NY 5AW7B 1IFDA 5AW2B 2XNXA 4N78E 5AVZB 2P7JA 2QM8A 1T3JA 1GL2C 1JY2O 2KYVA 1NWQA 1NKNA 2IPPA 2LKMA 1YYCA 4W7YA 1L4AD 1JY3N 1NAFA 1S9KD 3SWFA 2WT7A 2KLVA 3M9QA 5AW4B 1L0NK 1JCCA 1NTZK 3TYYA 3HE5B 1GU4A 4B86A 1GW4A 2JEEA 1FZAA 3GHGC 2Q5UA 1SFCD 1JTHA 1LT9B 3M0DA 4KHXA 1QL1A 5APTA 1NTKK 3LIDA 2KP8A 1LTIC 2W6BA 5APWA 3C9IA 1LTBC 2ZFCA 2O1KA 4JYBA 4AYCA 4HYTB 3MGNA 3VP8A 4AUWA 1SFCB 1SQPK 1SQXK 1GTWA 4C7RA 3NTNA 1X8YA 3M9HA 2O1JA 1MZ9A 1CI6B 2OYHA 3P7KA 1YTZT 1Z56A 1NHLA 3M0DC 5BU5A 2M3BA 3VN0A 5AVTB 1IFIA 4IFMA 3V2QA 4DOJA 3VMZA 2N1TB 3BRVB 1KILB 1VDFA 2YKQA 3HD7D 5KLVK 1FU1A 2YNYA 3VMYA 1SQQK 3VYIA 2OYIB 1IFMA 5APYA 5APVA 4WY4A 2IFNA 1LGHB 1S9KE 1RF0C 1XTCC 2L5GB 2NPSA 1HTLC 2OYHC 1GDTA 1FZGA 2HODB 3HE4B 2I1JA 1E5WA 2JJLA 1RE4A 1FJKA 2WSFH 3RK3B 3HD7B 4O9BA 2J59M 1IJDB 5APQA 3MIWA 1T2KD 3B5NB 3MUDA 2O01H 2YMYA 1J1DC 2PP6A 1AQ5A 3H6PA 4XE5B 2BASA 4C7NB 1N7SA 1CW5A 1WRGA 3LW5H 1URQC 2WPRA 1URQD 1A02J 2POHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y99 B;  1YTZ I;  4Y99 C;  1J1E B;  1J1E C;  1J1D B;  1J1D C;  1YTZ T; 
#chains in the Genus database with same CATH topology
 2QEX P;  2W90 A;  1KQG B;  1SQV D;  1QEX A;  3JCU E;  1SLQ A;  1M56 D;  2KS1 B;  3JC2 2;  1BDD A;  3ITK A;  2XZR A;  3SFE C;  1Q86 Q;  2FYZ A;  2KSJ A;  1RE4 C;  2P2U A;  2H7H A;  2K3R A;  3Q5S A;  1QX8 A;  4Y99 B;  1G1J A;  3TGU J;  1UIX A;  2P1J A;  3H1H D;  1N7S C;  2R3C A;  4IL6 H;  2Q9I A;  1JMB A;  2XKM A;  1HGV A;  1IFJ A;  5AVW B;  2IYO A;  1N86 A;  2ZAE B;  5B66 H;  1NJI Q;  1RQV A;  2HPC B;  1GL2 B;  3CC2 P;  1JUN A;  1HUC A;  2M3E A;  3H1I E;  3V5B A;  1W2E A;  3RGU A;  2GUS A;  1S72 P;  4XA4 A;  1JMM A;  2FYU J;  1OX3 A;  3TGU D;  2IX7 C;  3OJA B;  1SQV E;  1E79 H;  4DCK A;  1QVF O;  3KQG A;  2WT7 B;  3B5N A;  3L74 G;  2IZ0 A;  2W8Z A;  2Y9Z A;  1EC5 A;  4PD4 H;  4C7N A;  2KSE A;  2B88 A;  3L70 J;  1QGK B;  1NTM J;  2KS1 A;  3WUV A;  5K5G B;  3H1H E;  3VMA A;  1NTZ G;  2FYU D;  1SS1 A;  3KZI H;  3ZDM A;  3C8V A;  2YO2 A;  1FZF A;  5AVR B;  1L0L K;  1VF5 D;  1X22 A;  1KB9 H;  1VQ7 P;  5H2F E;  1Q7Y Q;  1YQ4 C;  3M0A A;  1NTK G;  2QA4 P;  3G3Z A;  3N7N A;  3RL0 C;  5APU A;  3IR9 A;  3L75 J;  1HJB A;  3JSV C;  5APS A;  2WVR A;  2HPC A;  3RK2 D;  3L70 D;  2WMM A;  5DJU B;  1NTM D;  3TGU E;  2PGD A;  3USS A;  5KAI E;  2D2C C;  4HH2 A;  1W5C E;  2IYP A;  3CCV P;  3N4X A;  4GOD A;  1R5L A;  4I7Z C;  1NOH A;  1KFN A;  3V2P A;  3AE9 C;  2XDJ A;  1JCD A;  1PGQ A;  1NVO A;  1L2P A;  1L4A C;  4EYY Q;  1IK9 A;  2IBZ G;  1L0N E;  3L75 D;  2M8R A;  2LXC B;  3UIA A;  3TF5 A;  2R32 A;  2FYU E;  4RJT A;  3MTU E;  3L73 J;  2W6A A;  5CCG A;  1ZXG A;  1LWU C;  2KOG A;  1FZC C;  5AVU B;  5KAF E;  3T97 B;  1RF1 C;  1PGO A;  1VQ8 P;  2H43 A;  3VP9 A;  1KV4 A;  3FWN A;  4CPG A;  1S5L H;  3HD7 A;  2WSE H;  2R5B A;  4H44 C;  1Q90 D;  5AW3 B;  2N1T D;  2KI7 B;  3AE4 C;  1EQ7 A;  4N78 D;  3L70 E;  5GTH H;  1NTM E;  3H32 B;  2OYI C;  3P32 A;  2E76 D;  3CD6 P;  4PJ0 E;  1NU1 G;  4UB6 E;  2AEF A;  4XFJ A;  1X9V A;  3L73 D;  4W80 A;  2W27 A;  2JO1 A;  5AW0 B;  5AW6 B;  3D6Y A;  1LTJ B;  3L75 E;  2MJZ A;  3H1L G;  3TNU A;  1JO5 A;  2ITA A;  1FDM A;  1VF5 B;  1HWT C;  1VQM P;  3D70 A;  1Y8A A;  1LTT C;  1J1E C;  2QE7 H;  2QJP B;  2K1A A;  1A02 F;  5KJ7 C;  1JEK A;  4UB8 E;  3E1R A;  4PV1 D;  2AEM A;  1IO4 A;  4H0L D;  5AW7 B;  2XNX A;  5TIS H;  2RMZ A;  4N78 E;  2QM8 A;  2KYV A;  5B5E H;  1JCC A;  1NTZ K;  3L73 E;  1GU4 A;  2QJK B;  1FZA A;  2E75 D;  1W2B O;  3GMA A;  1SFC D;  4DT0 A;  3MHV A;  3MZW B;  4KHX A;  2E74 C;  3H1J J;  1QL1 A;  1NTK K;  2KP8 A;  3G4S P;  4U7J A;  3S9O A;  3C9I A;  1S4X A;  3ABV C;  3SFD C;  3MGN A;  3AE6 C;  1FC2 C;  3VP8 A;  1M90 Q;  4U3F J;  2BEQ D;  4C7R A;  1CI6 B;  1YTZ T;  4NPD A;  1M1K Q;  2QG4 A;  3M0D C;  5AVT B;  1OVU A;  2N1T B;  2ZYG A;  1VDF A;  2YKQ A;  3CCL P;  1NAY A;  1SQP J;  3VYI A;  3H1J D;  2E76 B;  2GA1 A;  4WY4 A;  4YTP C;  1RF0 C;  4PD4 D;  2OYH C;  4L74 A;  3PHL A;  3H25 A;  3HE4 B;  2I1J A;  2JJL A;  1FJK A;  3O6Q B;  1IJD B;  1HF9 A;  4U3F D;  2KIK A;  5KLV J;  3MUD A;  1SQQ J;  1PPJ D;  4XE5 B;  2KXP B;  1CW5 A;  3H1K J;  3LW5 H;  2ZVN B;  2OTJ P;  1GMJ A;  2WPR A;  2AXT H;  1LJ2 A;  1T6A A;  1N73 A;  1X79 B;  5B66 E;  1GZL A;  1SQV G;  1KB9 D;  2C0W A;  2ZJS E;  2Z4E A;  1SQP D;  4C46 A;  2ZXX A;  4IL6 X;  3V2N A;  3TSI A;  2A06 G;  1Y9B A;  2WSC J;  1GL2 D;  1RHZ B;  1U57 A;  3AE8 C;  1NU1 K;  5AW9 B;  2FFD B;  1BDC A;  3CCE P;  3V4W A;  3VOP A;  4PV1 B;  1EZV D;  2I1K A;  1JY2 P;  4OGQ C;  5KLV D;  2G3A A;  3RBX A;  2N9B A;  4H0L B;  1SQQ D;  2RN0 A;  3KDP B;  2FBW C;  1FDI A;  1YBK A;  1N8R Q;  3H1K D;  3H1J E;  3NXS A;  1KZU B;  2HLO A;  4PD4 E;  2WSE J;  2YKO A;  3CCJ P;  1DD3 A;  1BGY J;  1PFI A;  1JY3 O;  1OW6 A;  4WBA A;  3CCM P;  3Q3D A;  2Q6Q A;  1RQU A;  4U3F E;  1SQB G;  4BRY B;  3NMD A;  1IFN A;  1PPJ E;  3PJS K;  3TGU G;  2B9B A;  1MV8 A;  3SWY A;  3KZI E;  3L4F A;  4ASV A;  1BSH A;  4LLH A;  1KB9 E;  3MP7 B;  1AJY A;  3IFM A;  1SQP E;  4I1L A;  5CMZ A;  2E43 A;  2I8D A;  1M1J A;  2ZVO B;  4PD4 I;  1EXJ A;  2K9Y A;  3U59 A;  1SQX J;  5BU8 B;  3M91 A;  4ZNC A;  3W68 A;  2OTL P;  1RY3 A;  3EQ2 A;  1PP9 G;  2O01 N;  1BGY D;  1L0N G;  4K3A A;  1EZV E;  1HVV A;  5KLV E;  3D6Z A;  2KB7 P;  4L73 A;  1SQQ E;  3WUU A;  3B5N C;  3I55 P;  2C9L Y;  2CPS A;  1KB9 I;  3H1K E;  5APX A;  1KYO H;  3WMM 0;  4EIJ A;  2RKL A;  4GT1 A;  2A45 G;  3RL0 D;  1FS0 E;  2H89 C;  3PP5 A;  3CWB G;  2J5U A;  1FOS F;  1VPC A;  1HH0 A;  1H0T B;  3U1C A;  2K37 A;  3L37 A;  2NPS D;  1L0L J;  1TU3 F;  1SQX D;  2MKV A;  4OWF A;  4N6J A;  2WSS H;  3NFQ A;  1EZV I;  3L70 G;  1LP1 A;  5CBN A;  3FGA D;  4NPE A;  3EFG A;  2RH0 A;  4BRY A;  4MN4 C;  2E5T A;  1FAV A;  1SFC A;  1SVF A;  2B87 A;  2R5D A;  1D7M A;  1MFT A;  3GLM A;  5CCH D;  1K04 A;  1N7S B;  1BGY E;  5CJ4 A;  5AVS B;  4DZO A;  3II6 A;  1L0L D;  1KIL A;  5GTH E;  2WIT A;  2KNC B;  3GHG B;  2M5A B;  1S5L X;  2XV5 A;  1ZR2 A;  4ASW A;  2WTY A;  3L71 G;  3HRN A;  1KTM A;  2ZT9 C;  1ZN5 A;  1SQV K;  1ZW0 A;  4LGD E;  1HJ0 A;  1KQL A;  1SQX E;  3GG2 A;  3PH0 A;  1RE3 C;  5CCG C;  1IZN B;  1CZQ A;  1YIJ P;  1QVG O;  1T3U A;  1H0T A;  2HR3 A;  3L73 G;  1UII A;  2WZ7 A;  2Y0C A;  3Q5P A;  3HD7 C;  1LTG C;  2KZI A;  2YIU C;  3LW5 J;  4GOF A;  4RKU J;  4AQR D;  3WU2 E;  3V2R A;  5TIS E;  3L35 A;  1L0L E;  4EDF A;  1ZME C;  2AEJ A;  1T2K C;  1BE3 G;  1PL5 A;  1GL2 A;  1SQB K;  1OXZ A;  2QSI A;  5B5E E;  3AED C;  3CLQ A;  4ZKP A;  3RL0 B;  2KNC A;  3GHG A;  2M5A A;  2NPS B;  4Z1M H;  2H88 C;  1HBW A;  2C9N Y;  1IFD A;  4Y28 J;  5C39 A;  1AVY A;  4A7P A;  1NKN A;  2IPP A;  2LKM A;  4HJG H;  2WT7 A;  2FXP A;  3S1K A;  1L0N K;  4I7Z B;  3HE5 B;  3L74 J;  1GW4 A;  3CX5 H;  4D6T G;  5TJH A;  1ZRT D;  2QRX A;  1LT9 B;  1NTZ J;  2W6B A;  3IN6 A;  1EXI A;  4AYC A;  4HYT B;  3KXD A;  1YI2 P;  2BCC G;  1PZQ A;  3NTN A;  3I56 P;  3M9H A;  1NTK J;  3SWK A;  1Z56 A;  3CCU P;  1NHL A;  3L74 D;  5BU5 A;  3B71 A;  3EFF K;  3QWO C;  3AE3 C;  3EWK A;  4HB1 A;  2Y0D A;  1BCC G;  1OVV A;  1FU1 A;  2OYO A;  2OYI B;  1OW8 A;  1IFM A;  3AEA C;  5APY A;  5APV A;  2IFN A;  1LGH B;  3V6I A;  2NPS A;  1HTL C;  1FZG A;  5KLI C;  2HOD B;  1AQT A;  1VF5 C;  2J59 M;  3MIW A;  2V4H A;  1ZRT E;  2QJP C;  2O01 H;  1J1D C;  1NTK D;  1PPJ G;  1URQ C;  2PRR A;  2JP3 A;  2POH A;  4WY4 C;  5AW8 B;  3A0B H;  2VRS A;  1KQF B;  1KYO D;  3HTK B;  3RK2 C;  4IFD K;  2ZXE B;  4DJG A;  2NRG A;  1J1E B;  5CCH A;  1LT9 A;  3T97 A;  5GTI H;  4K35 A;  3MUD C;  3A5T A;  4RES B;  1J2J B;  2WWW A;  1S1C X;  2YXR B;  5KKZ B;  1ZV8 A;  4LC1 A;  2PAJ A;  3TK1 A;  1N73 C;  4ZMD A;  2QIW A;  3H32 A;  2WPQ A;  3BCC G;  3L72 G;  2Q7C A;  3CMA P;  1OFC X;  2E42 A;  1NU1 J;  1NGM B;  5AVX B;  3KHU A;  2W6J H;  2LXB A;  3OAK A;  5KAI H;  1IFP A;  2KLU A;  1OZH A;  4EI2 A;  3CCQ P;  2HG5 D;  2UWJ E;  2E5Y A;  1NTK E;  1LTJ A;  3D71 A;  2E74 B;  1P84 H;  1M8O B;  2FY8 A;  4H13 C;  1GK4 A;  1KYO E;  2P10 A;  3W67 A;  1NU1 D;  1VL2 A;  4M3L A;  4WB4 A;  3H1I G;  1FOS E;  2A45 H;  3A3Y B;  3GF7 A;  1DIP A;  1VQ5 P;  3CXH H;  5AW5 B;  3GF3 A;  2JWD A;  2L91 A;  1WMK A;  1M1J C;  1KYO I;  1DEE G;  4IL6 E;  1N2D C;  1OWA A;  1YJN P;  1KMI Z;  1JNM A;  4PJ0 H;  2OYH B;  3IAO A;  3K5B A;  5EFW B;  3KYQ A;  2XU6 A;  3HUS B;  1M57 D;  1SQX G;  3M9B A;  2W83 C;  5BVZ A;  3CC7 P;  1ZP0 C;  1GK6 A;  3SSU A;  5M1B A;  1N7S D;  3H1H G;  2IBZ I;  3FX0 A;  4H0L C;  1JB0 J;  3VMX A;  1LTA C;  3E7K A;  1CI6 A;  1NU1 E;  1DH3 A;  3BAS A;  2JKV A;  1NKZ B;  3AE1 C;  1MUU A;  2FYN C;  2N1T A;  4OGQ B;  2E75 C;  2NZ2 A;  2GM4 A;  1L0L G;  2N9Y B;  4YPC A;  1K8A Q;  3PRJ A;  4UB8 H;  2CK3 H;  1SFC C;  1T8Z A;  3CX5 D;  1DD4 A;  4GKG A;  3HE4 A;  4GIF A;  1H89 A;  2ZT9 D;  3O6Q A;  2OQQ A;  1N7L A;  2QJY C;  1KIL C;  1EDK A;  2Q3I A;  5CCG D;  1RF0 A;  1VQL P;  1DX7 A;  4OVN F;  2HYN A;  2WPS A;  1FZE A;  3G71 P;  1OW7 A;  1FJP A;  4JBZ A;  3HUS A;  2Q3E A;  1YIT P;  3A0H H;  2FYU G;  3RK3 C;  1GD2 E;  1G1I A;  2YKP A;  1U7J A;  1IC2 A;  4TT3 H;  1K05 A;  3A2A A;  2BEZ F;  2FFD A;  3B4S A;  1VQ9 P;  3AEE C;  4GDO A;  1DEB A;  1BSN A;  5AVQ B;  5AW1 B;  3CL3 D;  5CJ0 A;  1VQP P;  2CPB A;  4QMA A;  4Y99 C;  1NTM G;  3KPE A;  4R4M A;  3CX5 E;  2D2C D;  4IOI H;  1PIX A;  4BXL A;  3B8E B;  1SP4 A;  3CC4 P;  1FBM A;  5AW2 B;  1SQB J;  2A06 D;  4HKZ H;  2P7J A;  1T3J A;  1GL2 C;  1JY2 O;  1S5L E;  1L4A D;  2PFX A;  4W7Y A;  1JY3 N;  5E79 H;  3SWF A;  2KLV A;  2WQY C;  4BWN A;  2JWA A;  1OIP A;  3L75 G;  3TYY A;  4B86 A;  2ZYA A;  1USD A;  3CX5 I;  3GHG C;  3R4Y A;  2O3J A;  5APT A;  1PP9 J;  3G6E P;  1L0N J;  1LTI C;  4L75 A;  5APW A;  4TLF A;  2Q1K A;  1SQB D;  4JYB A;  1KQS O;  4H44 D;  1EDL A;  1SQX K;  2WPV B;  1RH5 B;  3C1L A;  3P7K A;  2B89 A;  2ZT9 B;  2M3B A;  3CWB J;  1IFI A;  2Y0E A;  4DOJ A;  1S3J A;  3BRV B;  2A06 E;  1Q82 Q;  3VMY A;  1P84 D;  3F89 A;  1PP9 D;  1K73 Q;  3A0B E;  3AE5 C;  1L0N D;  1PGP A;  2K88 A;  3FXE A;  5GTI E;  1RE4 A;  2WSF H;  1KOR A;  3HD7 B;  4O9B A;  2YIU B;  2JR8 A;  2YMY A;  1AQ5 A;  1OMI A;  3H6P A;  1N7S A;  1OVR A;  1WRG A;  1URQ D;  3S4R A;  3CWB D;  3CXH D;  3TDK A;  5AVY B;  5KJ7 D;  1EDJ A;  4WY4 D;  4RO0 A;  1Q2N A;  2NPS C;  1SQB E;  1JY2 N;  2XND H;  5KTB A;  1FE6 A;  2FKW B;  4I6M C;  1AVO A;  3MD0 A;  3F5H A;  2D2C B;  3L71 J;  1VQ4 P;  4GOE A;  4IFF A;  3AEG C;  4JF7 A;  1U7M A;  1GU5 A;  3TNU B;  1AA0 A;  3U1A A;  2FYU K;  3JCU H;  1NYH A;  1P84 E;  1VQK P;  2G8Y A;  3BRT B;  1PP9 E;  3O8Z A;  5CCH C;  1LT9 C;  1L4A B;  3FWL A;  2E74 D;  2WSC H;  4YXD C;  4ZKU A;  3OA7 A;  2V7Q H;  3GW6 A;  1ZR4 A;  2FXO A;  1RE3 A;  2C0X A;  1X0T A;  1LWU B;  1VQN P;  1FZC B;  3L71 D;  1LNQ A;  1NTM K;  1RF1 B;  3CWB E;  1P84 I;  3CXH E;  4JQ0 D;  3M06 A;  4H13 D;  4H44 B;  1VQO P;  1BE3 J;  2AXC A;  3A7O A;  4I2L C;  4W7Z A;  3V4Q A;  3AE2 C;  2AXT E;  5CBO A;  3BAT A;  3BVH A;  3H1J G;  1G2C B;  1MFZ A;  1VQ6 P;  1LTJ C;  1QLE D;  1NTZ D;  3I5C A;  4N3Y B;  4EOT A;  2A45 I;  2QVA A;  1WT6 A;  3CXH I;  5DJT B;  4U3F G;  1QL2 A;  3QH9 A;  1KC8 Q;  3CME P;  1PGJ A;  3HE5 A;  1YQ3 C;  5KLI B;  3P8C D;  1PV3 A;  1BE3 D;  1R5S A;  1LT1 A;  2R3S A;  3LIE A;  3CI9 A;  4D6T J;  1ZLL A;  1SQP G;  1L4A A;  1J1D B;  3L71 E;  1NH4 A;  1URQ B;  5H2F H;  1XTG B;  5KKZ C;  4WY4 B;  3FXD A;  3L74 E;  2IDB A;  1CSB A;  1LTS C;  1JOC A;  2QJK C;  4OGQ D;  2KK7 A;  1LWU A;  1EZV G;  3RK2 B;  3WU2 H;  1ZOY C;  5KLV G;  5CHX A;  3AEF C;  1FZC A;  1SQQ G;  2BCC J;  3AEC C;  1RF1 A;  2Z5H A;  3VTP C;  1YTZ I;  2IBZ D;  3H1K G;  1MKM A;  2HFE D;  2OAR A;  1NTZ E;  3R2P A;  1GW3 A;  4D6T D;  1N73 B;  1BCC J;  2OYI A;  1G2C A;  1AFO A;  2LR2 A;  1JY3 P;  2ZYD A;  4KT0 J;  2SPZ A;  3A0H E;  1HGZ A;  3RBZ A;  1YJW P;  2HOD A;  1H88 A;  2QM7 A;  3L36 A;  1M7L A;  3H1L J;  3P8C E;  1BE3 E;  2BCC D;  2N1T C;  4OH8 B;  1KIL D;  1KFM A;  2J58 A;  1H8A A;  2E76 C;  1EDI A;  2Z5I A;  1JTH B;  4H13 B;  2YO3 A;  2WSF J;  5KAF H;  1BGY G;  1BCC D;  3HTK A;  2P67 A;  1JM0 A;  4YXW H;  1FDO A;  3RK3 D;  2K9J B;  3B5N D;  2GUV A;  1NO4 A;  1URQ A;  2DW3 A;  3E1I A;  2IBZ E;  5KJ7 A;  3CCR P;  3H1L D;  3Q2Y A;  1KD1 Q;  4JYC A;  4UB6 H;  1YHQ P;  5L8R J;  4D6T E;  2FXM A;  4NPF X;  3HUS C;  3P8M C;  1YJ9 P;  3OW2 O;  5E79 E;  3BCC J;  2KZJ A;  1M1J B;  3L72 J;  1K9M Q;  5AVV B;  2Y9Y A;  2IFM A;  2FFD C;  1FZB A;  2IZ1 A;  4PV1 C;  2H8P D;  3AEB C;  2BCC E;  4WVZ A;  1Y47 A;  2R44 A;  1KIL E;  3PTZ A;  5AVZ B;  1R8E A;  2YMK A;  1NWQ A;  1AV1 A;  1YYC A;  2V7Q J;  1NAF A;  4R4L A;  1S9K D;  3M9Q A;  5AW4 B;  1KN7 A;  1BCC E;  2JEE A;  3RK3 E;  3BCC D;  3WUT A;  3L72 D;  2Q5U A;  3CPW O;  1JTH A;  3IF4 A;  3M0D A;  3LID A;  1LP1 B;  3H1L E;  3AE7 C;  2KUB A;  3H1I J;  2K9J A;  1LTB C;  2ZFC A;  2O1K A;  2FYN B;  4JPZ B;  2E75 B;  3Q5R A;  4KJM A;  3G9R A;  2M0B A;  4AUW A;  1SFC B;  1SQP K;  1GTW A;  4WWI A;  1X8Y A;  2B87 B;  2O1J A;  1MZ9 A;  1S2E A;  2OYH A;  3PLN A;  2P58 A;  1IK7 A;  3VN0 A;  4IFM A;  3V2Q A;  1SQV J;  3VMZ A;  2OTK E;  2O01 J;  2QJY B;  1KIL B;  3HD7 D;  5KLV K;  1USE A;  2YNY A;  2JDI H;  1SQQ K;  3Q1M A;  3H1I D;  1S9K E;  1XTC C;  2L5G B;  4L76 A;  1GDT A;  3RL0 g;  3H1H J;  1E5W A;  3RK3 B;  1Q81 Q;  5APQ A;  3CCS P;  2OGU A;  1T2K D;  3B5N B;  3BCC E;  3L72 E;  2PP6 A;  2YXQ B;  2BAS A;  4C7N B;  1A02 J; 
#chains in the Genus database with same CATH homology
 5AVY B;  4WY4 C;  5KJ7 D;  1N73 A;  1SLQ A;  1X79 B;  1GZL A;  4WY4 D;  5AW8 B;  2C0W A;  2VRS A;  2Z4E A;  2NPS C;  1JY2 N;  2XZR A;  5KTB A;  3HTK B;  4C46 A;  3RK2 C;  4IFD K;  2ZXE B;  2FYZ A;  2KSJ A;  1J1E B;  5CCH A;  1LT9 A;  1RE4 C;  2FKW B;  4I6M C;  3V2N A;  3TSI A;  3T97 A;  2P2U A;  2H7H A;  4Y99 B;  3A5T A;  1G1J A;  1GL2 D;  3MD0 A;  4RES B;  1NU1 K;  1J2J B;  5AW9 B;  2WWW A;  2FFD B;  2P1J A;  1N7S C;  2R3C A;  1ZV8 A;  4IFF A;  4LC1 A;  3V4W A;  2Q9I A;  2XKM A;  3VOP A;  2PAJ A;  2I1K A;  4JF7 A;  1JY2 P;  1GU5 A;  2N9B A;  3TK1 A;  3TNU B;  1N73 C;  1HGV A;  2FYU K;  1IFJ A;  5AVW B;  3KDP B;  3U1A A;  1N86 A;  3H32 A;  2WPQ A;  2HPC B;  2Q7C A;  3BRT B;  1GL2 B;  3O8Z A;  5CCH C;  1LT9 C;  1L4A B;  2E42 A;  1JUN A;  1HUC A;  3NXS A;  2WSC H;  3V5B A;  4ZKU A;  3OA7 A;  5AVX B;  1KZU B;  2HLO A;  1W2E A;  3OAK A;  2GUS A;  2YKO A;  1ZR4 A;  1PFI A;  1JY3 O;  4XA4 A;  4WBA A;  1JMM A;  1RE3 A;  2C0X A;  2HG5 D;  3NMD A;  1IFN A;  1LWU B;  2IX7 C;  1LTJ A;  1FZC B;  3OJA B;  1NTM K;  1MV8 A;  1RF1 B;  3SWY A;  3L4F A;  3M06 A;  4LLH A;  3KQG A;  2WT7 B;  3B5N A;  1GK4 A;  3IFM A;  4I1L A;  5CMZ A;  2E43 A;  1M1J A;  3A7O A;  4C7N A;  4I2L C;  3U59 A;  4W7Z A;  3V4Q A;  5BU8 B;  3M91 A;  3BAT A;  3BVH A;  1RY3 A;  4M3L A;  4WB4 A;  1G2C B;  3EQ2 A;  1MFZ A;  1LTJ C;  3I5C A;  1FOS E;  4N3Y B;  2A45 H;  4EOT A;  3A3Y B;  2A45 I;  1HVV A;  2KB7 P;  2YO2 A;  1FZF A;  5AVR B;  5AW5 B;  1L0L K;  1WT6 A;  3B5N C;  2C9L Y;  2CPS A;  5APX A;  3WMM 0;  1M1J C;  1QL2 A;  4EIJ A;  3M0A A;  4GT1 A;  1N2D C;  2A45 G;  1OWA A;  3HE5 A;  3G3Z A;  3N7N A;  3RL0 C;  1JNM A;  3RL0 D;  5APU A;  2OYH B;  3PP5 A;  1FOS F;  3IR9 A;  1VPC A;  1HH0 A;  3P8C D;  1HJB A;  3U1C A;  5APS A;  3L37 A;  3KYQ A;  2NPS D;  2HPC A;  2XU6 A;  3LIE A;  3CI9 A;  3HUS B;  1ZLL A;  3RK2 D;  1L4A A;  3M9B A;  1J1D B;  4N6J A;  3NFQ A;  5BVZ A;  1NH4 A;  1URQ B;  1GK6 A;  4HH2 A;  1XTG B;  3EFG A;  4WY4 B;  3N4X A;  1N7S D;  1NOH A;  1CSB A;  1LTS C;  1FAV A;  1JOC A;  1SFC A;  1KFN A;  1LWU A;  3RK2 B;  3VMX A;  3V2P A;  5CHX A;  1LTA C;  1FZC A;  2XDJ A;  1SVF A;  1JCD A;  2R5D A;  1RF1 A;  2Z5H A;  1CI6 A;  1DH3 A;  3BAS A;  3VTP C;  1YTZ I;  1L4A C;  2HFE D;  5CCH D;  1IK9 A;  2OAR A;  1NKZ B;  2M8R A;  1N7S B;  3R2P A;  3UIA A;  5CJ4 A;  2R32 A;  5AVS B;  1GW3 A;  4DZO A;  3II6 A;  1MUU A;  2N1T A;  1KIL A;  3MTU E;  2GM4 A;  2WIT A;  1N73 B;  2W6A A;  5CCG A;  3GHG B;  2OYI A;  1G2C A;  1SFC C;  2XV5 A;  1AFO A;  1LWU C;  1T8Z A;  2KOG A;  1ZR2 A;  1FZC C;  1JY3 P;  5AVU B;  1RF1 C;  2WTY A;  2H43 A;  1HGZ A;  3HRN A;  3VP9 A;  4GKG A;  2HOD A;  3HE4 A;  4GIF A;  1H89 A;  1H88 A;  1ZN5 A;  2QM7 A;  3L36 A;  1M7L A;  3HD7 A;  3P8C E;  1SQV K;  2WSE H;  2R5B A;  4LGD E;  1KQL A;  1N7L A;  2N1T C;  4OH8 B;  5AW3 B;  1KIL C;  2N1T D;  1KIL D;  1KFM A;  2J58 A;  1EQ7 A;  4N78 D;  1RE3 C;  5CCG C;  2Q3I A;  5CCG D;  1RF0 A;  3H32 B;  2OYI C;  1H8A A;  3P32 A;  1CZQ A;  2Z5I A;  1DX7 A;  2HYN A;  2WPS A;  1T3U A;  1FZE A;  1JTH B;  1X9V A;  4W80 A;  2YO3 A;  1FJP A;  3HUS A;  3HTK A;  2W27 A;  2P67 A;  2WZ7 A;  3RK3 C;  1GD2 E;  5AW0 B;  1G1I A;  3RK3 D;  3HD7 C;  1LTG C;  2YKP A;  1IC2 A;  3B5N D;  2GUV A;  1NO4 A;  1URQ A;  5AW6 B;  3A2A A;  3E1I A;  2FFD A;  5KJ7 A;  1LTJ B;  4AQR D;  2MJZ A;  3TNU A;  3V2R A;  3L35 A;  4JYC A;  1JO5 A;  1FDM A;  2FXM A;  1T2K C;  1HWT C;  3HUS C;  3P8M C;  1DEB A;  1GL2 A;  1SQB K;  1LTT C;  1J1E C;  5AVQ B;  5AW1 B;  1OXZ A;  3CL3 D;  5CJ0 A;  1M1J B;  2CPB A;  4Y99 C;  3KPE A;  1A02 F;  5AVV B;  3CLQ A;  4ZKP A;  3RL0 B;  2IFM A;  2FFD C;  5KJ7 C;  3B8E B;  1SP4 A;  1FZB A;  3GHG A;  2NPS B;  2H8P D;  1IO4 A;  1HBW A;  1FBM A;  2C9N Y;  5AW7 B;  1IFD A;  5AW2 B;  2XNX A;  4N78 E;  5AVZ B;  2P7J A;  2QM8 A;  1T3J A;  1GL2 C;  1JY2 O;  2KYV A;  1NWQ A;  1NKN A;  2IPP A;  2LKM A;  1YYC A;  4W7Y A;  1L4A D;  1JY3 N;  1NAF A;  1S9K D;  3SWF A;  2WT7 A;  2KLV A;  3M9Q A;  5AW4 B;  1L0N K;  1JCC A;  1NTZ K;  3TYY A;  3HE5 B;  1GU4 A;  4B86 A;  1GW4 A;  2JEE A;  1FZA A;  3GHG C;  2Q5U A;  1SFC D;  1JTH A;  1LT9 B;  3M0D A;  4KHX A;  1QL1 A;  5APT A;  1NTK K;  3LID A;  2KP8 A;  1LTI C;  2W6B A;  5APW A;  3C9I A;  1LTB C;  2ZFC A;  2O1K A;  4JYB A;  4AYC A;  4HYT B;  3MGN A;  3VP8 A;  4AUW A;  1SFC B;  1SQP K;  1SQX K;  1GTW A;  4C7R A;  3NTN A;  1X8Y A;  3M9H A;  2O1J A;  1MZ9 A;  1CI6 B;  2OYH A;  3P7K A;  1YTZ T;  1Z56 A;  1NHL A;  3M0D C;  5BU5 A;  2M3B A;  3VN0 A;  5AVT B;  1IFI A;  4IFM A;  3V2Q A;  4DOJ A;  3VMZ A;  2N1T B;  3BRV B;  1KIL B;  1VDF A;  2YKQ A;  3HD7 D;  5KLV K;  1FU1 A;  2YNY A;  3VMY A;  1SQQ K;  3VYI A;  2OYI B;  1IFM A;  5APY A;  5APV A;  4WY4 A;  2IFN A;  1LGH B;  1S9K E;  1RF0 C;  1XTC C;  2L5G B;  2NPS A;  1HTL C;  2OYH C;  1GDT A;  1FZG A;  2HOD B;  3HE4 B;  2I1J A;  1E5W A;  2JJL A;  1RE4 A;  1FJK A;  2WSF H;  3RK3 B;  3HD7 B;  4O9B A;  2J59 M;  1IJD B;  5APQ A;  3MIW A;  1T2K D;  3B5N B;  3MUD A;  2O01 H;  2YMY A;  1J1D C;  2PP6 A;  1AQ5 A;  3H6P A;  4XE5 B;  2BAS A;  4C7N B;  1N7S A;  1CW5 A;  1WRG A;  3LW5 H;  1URQ C;  2WPR A;  1URQ D;  1A02 J;  2POH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...