1YTZI

Crystal structure of skeletal muscle troponin in the ca2+-activated state
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
141
structure length
141
Chain Sequence
EEKKRRAATARRQHLKSAMLQLAVTEIEKEAAAKEVEKQNYLAEHSPPLSLPGSMQELQELSKKLHAKIDSVDEERYDTEVKLQKTNKELEDLSQKLFDLRGKFKRPPLRRVRMSADAMLRALLGSKHKVNMDLRANLKQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ca2+-regulated structural changes in troponin
pubmed doi rcsb
source organism Gallus gallus
molecule tags Contractile protein
molecule keywords Troponin T
total genus 45
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2005-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00992 Troponin Troponin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.350 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ytzI01
4Y99C 1YTZT 1J1EB 1J1EC 1YTZI 4Y99B 1J1DC 1J1DB
chains in the Genus database with same CATH superfamily
1WMKA 1NTMG 2O3JA 1EDKA 1KFNA 1SQBE 2XNXA 5B5EH 1JCDA 1RF0C 3SSUA 3TGUG 1KILC 1KQSO 4HH2A 5APWA 1OX3A 2XDJA 3V2QA 1K73Q 3MUDC 3FGAD 1H89A 2E76B 3AE7C 3P8MC 3A5TA 1Y47A 2QJPC 4KHXA 3TK1A 3CCJP 2GUSA 4NPEA 3CCUP 1NJIQ 1CW5A 1JY3N 3KDPB 3L4FA 2KB7P 1LTBC 1IFNA 2E75B 2ZAEB 3C8VA 3RL0D 1SFCB 3JCUE 1LWUB 1SFCA 3K5BA 1A02F 2M5AB 1Q86Q 5E79E 2OYHB 1EC5A 2YMKA 5M1BA 5KKZB 2M0BA 2D2CC 4YTPC 1RE4A 1YI2P 1FC2C 2H43A 3I5CA 4PJ0H 4U3FG 3CC4P 3A0BH 1VDFA 2KIKA 3HE4A 4DZOA 1KFMA 3CCLP 2FYNC 3M06A 2WSCH 4H44B 5KLVE 3CWBJ 4RESB 3L74J 1J1DB 1NU1E 1RF1C 1E5WA 2WPQA 2OTJP 1X22A 1YTZI 4RO0A 2LR2A 1VF5B 2K88A 1JY3O 2OTKE 1BGYE 5KAFE 3H1IE 1JTHB 1NTZG 1NWQA 1URQC 2R5DA 3L74D 3RK2D 3KHUA 4JYBA 2BASA 2C9LY 1AQTA 1GL2D 2YO3A 1SVFA 1SFCC 2ZVNB 3F5HA 3S1KA 5GTHE 2W27A 4GT1A 4B86A 1VF5D 1ZXGA 3JSVC 5CBOA 2J58A 2NRGA 1N7SC 2JO1A 3RK3B 1QX8A 1CSBA 3MUDA 1RE3A 5AVQB 2RN0A 5DJUB 3U1CA 1LTJC 3TSIA 1VQ6P 1S72P 1WRGA 2WSEJ 2E75D 3RL0B 1X9VA 1UIXA 2K37A 2Y9YA 1SQVE 4U3FJ 2XKMA 1NVOA 3G3ZA 4GDOA 1LWUA 1H8AA 3L72D 5KLIB 3R4YA 1JO5A 2HODB 3L70G 3WU2E 5AW3B 2GUVA 1DX7A 2E76C 1NGMB 1SQXJ 2MKVA 1GW3A 2K9JA 3HUSB 2FFDC 2K9JB 2JWDA 3H1LJ 3HE4B 4U3FD 5APUA 1GD2E 2N1TA 1PGJA 1PL5A 2Q3IA 3BRVB 1DD4A 3CXHI 2KUBA 1OMIA 3M0DC 2Q1KA 1M7LA 4WBAA 4IFDK 1NKZB 4KJMA 1DH3A 2ZT9B 1NTKG 2XU6A 1OWAA 3HE5B 1VQNP 3HE5A 4PD4H 1BCCJ 1QGKB 2OGUA 2W83C 3E1IA 3RK3E 1BSHA 1ZRTE 3PHLA 2KLUA 1GL2B 2FYZA 2WSFH 3H1KD 2FBWC 1SQQD 5CHXA 4W80A 1YJ9P 1H0TA 2QSIA 1SQQG 3RBZA 5KJ7A 1NTZE 1RQUA 1JY2O 4C7RA 2IDBA 1IZNB 1M56D 2KSJA 3ABVC 3TGUD 1HJBA 3P8CD 1FZCA 2KSEA 1S2EA 5DJTB 5AW9B 4PD4D 1KV4A 1QVGO 2BEQD 3H1HD 3P32A 2E5YA 2QVAA 4PV1B 1PPJG 3GF7A 1KQLA 2QIWA 1S9KE 3T97A 5B66H 1N8RQ 1NKNA 3L71J 2YIUB 4Y28J 2R3CA 4KT0J 1LTJA 4RKUJ 1NAFA 1T3UA 2LKMA 1JOCA 2Q3EA 1X79B 2LXCB 2E5TA 1SQXG 1LGHB 5KLVG 4H0LB 1NTZJ 2NPSC 4N78D 3GG2A 2B89A 1U7MA 2HODA 1FZBA 2FKWB 1YYCA 3M0AA 2PGDA 3CC7P 1EDIA 1YJWP 3AEDC 3CX5D 2WPRA 1SQBG 2V7QJ 3N4XA 1L4AB 5AVUB 3EFFK 3Q2YA 3JC22 3PH0A 1LTGC 5CCHD 5CCGD 2IBZE 3PP5A 2IYPA 1JEKA 3TDKA 2J5UA 3IAOA 3KYQA 4UB6E 3CCVP 2ITAA 1IK9A 1GU4A 2FXPA 1AVOA 2POHA 3E1RA 4L73A 1KQGB 1EXIA 4O9BA 4JF7A 2CPBA 3CL3D 2BEZF 3H1KJ 4OH8B 3A7OA 5APTA 3AE4C 5APYA 2OQQA 1X8YA 3NTNA 2CK3H 2E75C 1SQPJ 3WMM0 4H13C 2M5AA 1BCCD 3L35A 1SQVJ 4U3FE 5CCHA 2A45H 5KJ7C 3V2NA 1FZCC 1USDA 2JEEA 2KZJA 2ZVOB 3AE1C 4XE5B 1NAYA 1MZ9A 2W90A 5AW6B 4ZKPA 1M1KQ 3HUSA 1H0TB 1BDDA 4XFJA 1YITP 3I56P 1USEA 1W2EA 4HJGH 3RL0C 1FZCB 1S3JA 2AEJA 5AW1B 3H1LD 2BCCD 3TF5A 2AEMA 3OW2O 1LTJB 1R8EA 1SQXD 2E43A 5AW5B 4Y99B 4IL6E 1J1DC 3V2PA 2OTLP 2JDIH 2LXBA 2I1KA 2R44A 2Q7CA 1G2CA 1KB9E 1N7SB 2HLOA 3WUUA 2PFXA 3M9QA 2E74C 4QMAA 4YXWH 5BU8B 3Q5PA 2P7JA 1JTHA 2R32A 1H88A 3CMEP 4GKGA 3D70A 1GL2A 3EFGA 3FWNA 1K8AQ 2WT7A 3CCRP 2WT7B 2M3EA 1SP4A 2W6AA 2FXOA 3MIWA 1PV3A 3MGNA 3MHVA 5KAIE 5APQA 1VQOP 2WSSH 2ZYGA 2WSFJ 4PJ0E 3VP8A 1SQBK 4I2LC 1A02J 3VTPC 1LT9A 2PP6A 2A45G 3AE6C 3AEAC 1NTZK 5KJ7D 3S4RA 1JMMA 3GF3A 5AVRB 1M1JC 1P84D 1PP9E 3FX0A 2O01N 1RE3C 1D7MA 1ZV8A 3QWOC 2W8ZA 5APSA 3D6YA 4DOJA 1FZGA 1JB0J 1U57A 3CCEP 1J2JB 2YKOA 1M8OB 3H1JE 4PV1D 3EWKA 5TJHA 5KAFH 2QA4P 1N7LA 2QM7A 1G1JA 1HVVA 3N7NA 1FAVA 3L73E 4I7ZC 4IL6H 4NPFX 2VRSA 3HD7B 1Y9BA 5AW7B 3CWBD 1CZQA 1IC2A 1NU1D 2JWAA 3SFEC 3V2RA 3AE3C 2JP3A 1EQ7A 4Z1MH 1L4AA 1SQPK 1FDMA 1EDJA 3D6ZA 4C46A 1BE3D 3CD6P 4OGQC 3I55P 3AEBC 1MV8A 3CI9A 2YXQB 3AEFC 5GTHH 2Z5HA 3E7KA 1HWTC 1SQVK 1PGPA 4LGDE 1EDLA 3L71E 4HB1A 4W7ZA 1T2KD 1S5LH 1L0NE 1OW8A 1SQPG 3FXDA 4BRYA 1ZOYC 3M9BA 2JJLA 5AVVB 2WSCJ 1KN7A 3CLQA 3WUVA 5K5GB 1FJKA 4WWIA 2L91A 5CMZA 3A0HH 4R4LA 2B88A 1DEBA 3KXDA 5GTIE 3H32A 1FZFA 3D71A 1LT9B 2R3SA 3L72G 1AQ5A 1KILE 5B5EE 1NH4A 3VN0A 5BU5A 1L0LJ 1S5LX 2I8DA 2PAJA 2G3AA 3L72E 1Q81Q 2HR3A 3KZIH 5CBNA 1PP9G 3VP9A 1N73C 2HG5D 1EZVI 5APXA 1KB9I 1DEEG 2FYUE 3B5NB 2YKPA 3B5NA 1OVUA 3GMAA 3PLNA 1G2CB 1N7SA 1NTKJ 1YTZT 5C39A 2XV5A 3V4WA 3V6IA 4D6TD 3RK3C 1ZLLA 3GHGC 3W67A 4OVNF 1OW6A 1N2DC 3L73J 1QL2A 3G6EP 3HD7A 3IF4A 1FOSE 4A7PA 4GOFA 2A06G 1BE3J 2FXMA 3SWYA 1NTKE 2A06D 1GU5A 1GDTA 1QEXA 2WSEH 1AVYA 3RK2B 2E42A 1NTKK 2M8RA 2QRXA 2OYIC 1HGZA 1VQ7P 1NTMD 2XZRA 1S1CX 2ZYAA 3AEEC 2Q9IA 2YNYA 1HGVA 2A45I 3MZWB 1KYOH 3A0HE 1ZW0A 1SQVG 1VQ5P 1VQLP 1PZQA 5AVZB 1SQBD 2FYUK 1IFJA 2IFMA 4JPZB 3TGUE 3L71G 1KB9H 3II6A 1URQA 3L75G 3AE9C 1YBKA 2BCCG 3BCCJ 1N86A 2WVRA 3H1HE 3L75D 5AVWB 1S9KD 1VQKP 2CPSA 3HTKB 3S9OA 1VQPP 1Q90D 2IFNA 5KLVD 1X0TA 1IO4A 4ASVA 1RF1A 1SLQA 1RF1B 1R5LA 2NPSB 2GM4A 3L70D 3VMAA 1JMBA 2O1KA 3SWFA 2YIUC 2AEFA 2FYNB 2KZIA 2C0XA 1FS0E 4H44C 2WZ7A 3GLMA 5CCGA 1HH0A 2KNCA 1SQXK 2P2UA 3GW6A 3H1ID 3CMAP 1Q82Q 2J59M 4D6TG 3KZIE 2PRRA 1L0NK 1PGOA 1NO4A 3PJSK 1YJNP 4HKZH 4OWFA 1OZHA 1U7JA 1NU1G 1FJPA 1OVRA 2H89C 2KP8A 3GHGA 4C7NA 2K1AA 2K3RA 2RMZA 3CX5H 4DT0A 1NOHA 3B71A 4H0LD 4I7ZB 2IBZG 1PGQA 2P67A 4YXDC 3H1KG 1JNMA 1VQ4P 1SQPE 2N9YB 1BGYD 3TYYA 2D2CD 2WQYC 1JUNA 3C9IA 2E74B 1OFCX 4M3LA 1JY2N 1MUUA 1EZVD 4L74A 1N7SD 1T2KC 1BGYJ 1MFTA 1SQVD 2OYOA 3RL0g 2Z4EA 1M1JA 1KYOD 1CI6A 1PPJD 3L36A 3BCCD 4MN4C 1HBWA 1SFCD 3VOPA 1FE6A 2O01J 3RK2C 1URQD 1YIJP 3AE8C 3FWLA 3L73G 1W2BO 5TISE 2H88C 5KLIC 1GZLA 4TT3H 3NXSA 2ZXXA 3SWKA 3U1AA 1S4XA 2V4HA 2Y9ZA 1KC8Q 2KOGA 1KORA 2Y0DA 5BVZA 2O1JA 3C1LA 2K9YA 1KMIZ 3Q5SA 1BDCA 2WITA 3WUTA 3B5NC 1Q2NA 4IOIH 2KNCB 2JR8A 2KK7A 1OIPA 3F89A 4WB4A 1HTLC 5AW0B 1HUCA 4ZMDA 1QLED 1L0LE 5KAIH 3SFDC 3HD7D 1NTZD 3L75J 3CXHD 4BRYB 4IL6X 1OVVA 5AVXB 1VQ8P 3TNUA 1IJDB 3AEGC 3FXEA 2SPZA 3GHGB 1L4AD 1MKMA 3P8CE 4C7NB 4W7YA 3B5ND 4NPDA 3CCMP 1URQB 5TISH 1R5SA 2IZ1A 3AE5C 1BGYG 1Y8AA 5APVA 2IYOA 3BASA 2XNDH 4EOTA 1PP9D 2E74D 1ZRTD 3H32B 1EZVG 2D2CB 2IX7C 1NTMJ 3RGUA 2FY8A 4RJTA 1BCCG 2OYHC 1SQQE 3VMYA 3VMZA 2UWJE 1XTCC 2NPSA 3CXHH 2H8PD 3M9HA 5AVYB 3TGUJ 2QM8A 5EFWB 3UIAA 1ZR2A 1ZMEC 1M57D 1P84H 2O01H 3H1JD 1OW7A 1OXZA 1FZEA 1CI6B 4N78E 1ZN5A 3WU2H 4WVZA 5GTIH 2H7HA 2Q5UA 2AXTE 1SQQJ 3LW5H 2L5GB 2KS1A 3A0BE 3L73D 4BWNA 2NPSD 1BE3G 1LTSC 3CWBE 1L4AC 3CX5I 4TLFA 3AECC 2QE7H 4D6TJ 5KKZC 1KD1Q 1RF0A 1LWUC 1PFIA 3BATA 3O6QB 4WY4A 3JCUH 2C0WA 3HD7C 1BE3E 3L37A 1EXJA 1FOSF 5AW2B 2G8YA 1IFDA 4H13D 3A3YB 3H1IG 1LJ2A 2P58A 3H1JJ 4H0LC 1JM0A 2QJPB 3ZDMA 4IFFA 4OGQB 3Q1MA 3BVHA 2Y0CA 3L74E 1LTTC 1RY3A 2QJYB 3AE2C 4I1LA 1KILA 3CX5E 4ZKUA 1FU1A 1KILB 2QG4A 3G4SP 2ZT9D 1LT1A 1PP9J 1NYHA 1T6AA 3L72J 1M1JB 3L74G 3RBXA 3Q3DA 4EDFA 4UB8E 5AVSB 2N1TD 1T3JA 1VL2A 2IBZD 2N9BA 1L0LG 4GOEA 4K35A 1W5CE 2B87B 5CCGC 1LTAC 1YQ4C 2V7QH 5KTBA 4LC1A 2HYNA 3HTKA 2M3BA 5H2FE 4N6JA 1FZAA 1GW4A 3G9RA 2AXTH 4WY4C 1J1EB 2BCCE 2OYHA 1BSNA 1KZUB 1M90Q 1RQVA 3U59A 2HPCB 1AA0A 4U7JA 2RH0A 2HPCA 5L8RJ 3W68A 1WT6A 1Q7YQ 1NHLA 2HFED 1FDOA 2KXPB 2Y0EA 2GA1A 2YMYA 1FBMA 1NU1J 4D6TE 2OYIB 3KPEA 5CJ4A 2KS1B 4BXLA 2WTYA 2AXCA 2WWWA 1VQ9P 3IR9A 1AFOA 3H1LE 2FFDA 4CPGA 2FFDB 2QJYC 3O6QA 2Z5IA 4EIJA 3TNUB 3Q5RA 1VQMP 4PD4I 4JYCA 1NTME 1T8ZA 1P84I 2BCCJ 2WPVB 3BCCG 4GIFA 1ZP0C 3H6PA 4H13B 3RK3D 2RKLA 1Z56A 1SQQK 2I1JA 4H44D 1G1IA 1TU3F 2ZJSE 1VF5C 3H1KE 3R2PA 4DJGA 2YO2A 1HF9A 1KTMA 1JCCA 2OARA 2QJKB 3USSA 5B66E 1GL2C 2WMMA 4K3AA 4N3YB 1IFPA 3L75E 1GK6A 2FYUG 5H2FH 1AJYA 2KI7B 1SS1A 1K04A 1JY2P 1QL1A 2B87A 2N1TC 2ZFCA 3NMDA 3OJAB 4PD4E 3MP7B 4JQ0D 4L75A 2JKVA 1L0LK 1P84E 3L70E 1K9MQ 2ZT9C 1QVFO 4EI2A 1IFMA 2C9NY 1GMJA 4IFMA 2QEXP 2DW3A 2E76D 2Q6QA 3PTZA 3H1IJ 3H1JG 5AVTB 2KYVA 4JBZA 3HUSC 1DIPA 4EYYQ 1YQ3C 4AQRD 3A2AA 3G71P 2N1TB 1UIIA 2W6BA 3M91A 2OYIA 2IBZI 1LTIC 3L70J 2NZ2A 1L0ND 5CCHC 4YPCA 4GODA 1IK7A 2QJKC 1RHZB 1L0NG 3MD0A 2YXRB 3MTUE 3B8EB 4Y99C 5KLVJ 1N73A 1N73B 3BRTB 2P10A 1DD3A 1GK4A 3OAKA 1AV1A 1SQPD 4AUWA 4WY4D 3H1HG 4AYCA 4OGQD 3EQ2A 2WPSA 1LNQA 3CCSP 4XA4A 1SQBJ 1NU1K 3OA7A 2W6JH 1EZVE 1IFIA 3H1HJ 3LW5J 3B4SA 1KILD 2R5BA 3L71D 3O8ZA 1K05A 3QH9A 4UB6H 5KLVK 2ZYDA 5CJ0A 3LIDA 3CCQP 2FYUJ 1JY3P 1KYOE 1PPJE 1MFZA 1KQFB 3BCCE 1XTGB 3V4QA 1J1EC 2IZ0A 3H25A 2P1JA 4HYTB 5AW4B 5AW8B 1LP1A 2B9BA 2FYUD 1LP1B 3HRNA 4LLHA 1BCCE 4L76A 4PV1C 3PRJA 3T97B 4DCKA 1GTWA 3IN6A 3NFQA 4ZNCA 5E79H 2KLVA 3V5BA 1NTMK 1S5LE 1L2PA 1FDIA 2ZXEB 3M0DA 4I6MC 4ASWA 1ZR4A 1NTKD 2A06E 2IPPA 1LT9C 3IFMA 1HJ0A 3KQGA 4WY4B 1SQXE 1KYOI 3CPWO 3CWBG 1VPCA 3VYIA 1YHQP 1L0NJ 2YKQA 3CC2P 3H1LG 1RE4C 1KB9D 2MJZA 1E79H 3ITKA 3P7KA 1L0LD 4R4MA 4UB8H 3VMXA 1PIXA 3LIEA 3CXHE 1RH5B
chains in the Genus database with same CATH topology
1KFNA 2XNXA 1JCDA 1RF0C 1KILC 4HH2A 5APWA 2XDJA 3V2QA 1H89A 3A5TA 3P8MC 4KHXA 3TK1A 2GUSA 1JY3N 3KDPB 3L4FA 2KB7P 1LTBC 1IFNA 3RL0D 1A02F 1SFCB 1LWUB 1SFCA 2OYHB 2H43A 1RE4A 3I5CA 1VDFA 3HE4A 4DZOA 1KFMA 3M06A 2WSCH 4RESB 1J1DB 1RF1C 1E5WA 2WPQA 1YTZI 1JY3O 1JTHB 1NWQA 1URQC 2R5DA 3RK2D 4JYBA 2BASA 2C9LY 1GL2D 2YO3A 1SVFA 1SFCC 2W27A 4GT1A 4B86A 2J58A 1N7SC 3RK3B 1CSBA 3MUDA 1RE3A 5AVQB 3U1CA 1LTJC 3TSIA 1WRGA 3RL0B 1X9VA 2XKMA 3G3ZA 1LWUA 1JO5A 2HODB 5AW3B 2GUVA 1DX7A 1GW3A 3HUSB 2FFDC 3HE4B 5APUA 2N1TA 2Q3IA 3M0DC 3BRVB 4WBAA 4IFDK 1M7LA 1NKZB 2XU6A 1OWAA 3HE5B 3HE5A 3E1IA 1GL2B 2FYZA 2WSFH 5CHXA 4W80A 5KJ7A 4C7RA 1JY2O 2KSJA 1HJBA 3P8CD 1FZCA 5AW9B 3BVHA 3P32A 1S9KE 1KQLA 3T97A 1NKNA 2R3CA 1LTJA 1NAFA 1T3UA 2LKMA 1JOCA 1X79B 1LGHB 2NPSC 4N78D 2HODA 1FZBA 2FKWB 1YYCA 3M0AA 2WPRA 3N4XA 1L4AB 5AVUB 1LTGC 5CCHD 5CCGD 3PP5A 3KYQA 1GU4A 1IK9A 2POHA 4O9BA 4JF7A 2CPBA 3CL3D 4OH8B 5APYA 3A7OA 5APTA 1X8YA 3NTNA 3WMM0 5KJ7C 3L35A 5CCHA 2A45H 3V2NA 1FZCC 2JEEA 1FZCB 4XE5B 5AW6B 1MZ9A 4ZKPA 3HUSA 3RL0C 1W2EA 5AW1B 2E43A 1LTJB 5AW5B 4Y99B 1J1DC 3V2PA 2I1KA 2Q7CA 1G2CA 1N7SB 2HLOA 3M9QA 5BU8B 2P7JA 1JTHA 1H88A 4GKGA 1GL2A 3EFGA 2WT7A 2WT7B 1SP4A 2W6AA 3MIWA 3MGNA 5APQA 1A02J 3VP8A 1SQBK 4I2LC 1LT9A 2PP6A 2A45G 1NTZK 5KJ7D 1JMMA 5AVRB 1M1JC 1RE3C 1ZV8A 5APSA 4DOJA 1J2JB 2YKOA 1N7LA 2QM7A 1G1JA 1HVVA 3N7NA 1FAVA 5CCHC 2VRSA 3HD7B 5AW7B 3V2RA 1CZQA 1IC2A 1EQ7A 1L4AA 1SQPK 1FDMA 4C46A 1MV8A 3CI9A 1HWTC 2Z5HA 1SQVK 4LGDE 4W7ZA 1T2KD 3M9BA 2JJLA 5AVVB 3CLQA 1FJKA 5CMZA 1DEBA 3H32A 1FZFA 1LT9B 1AQ5A 1NH4A 3VN0A 5BU5A 2PAJA 3VP9A 1N73C 2HG5D 5APXA 3B5NB 2YKPA 3B5NA 3VTPC 1G2CB 1N7SA 3V4WA 1YTZT 2XV5A 3RK3C 1ZLLA 3GHGC 1N2DC 1QL2A 3HD7A 1FOSE 2FXMA 3SWYA 1GU5A 1GDTA 2WSEH 3RK2B 2E42A 1NTKK 2M8RA 2OYIC 1HGZA 2XZRA 2Q9IA 2YNYA 1HGVA 2A45I 5AVZB 2FYUK 1IFJA 2IFMA 3II6A 1URQA 1N86A 1S9KD 5AVWB 2CPSA 3HTKB 2IFNA 1IO4A 1RF1A 1SLQA 1RF1B 2NPSB 2GM4A 2O1KA 3SWFA 5CCGA 2C0XA 2WZ7A 1HH0A 1SQXK 2P2UA 2J59M 1L0NK 1NO4A 1FJPA 2KP8A 3GHGA 4C7NA 1NOHA 1JNMA 2P67A 3TYYA 1JUNA 3C9IA 4M3LA 1JY2N 1MUUA 1N7SD 1T2KC 2Z4EA 1M1JA 1CI6A 1HBWA 3L36A 1SFCD 3VOPA 3RK2C 1URQD 1GZLA 3NXSA 3U1AA 2KOGA 5BVZA 2O1JA 2WITA 3B5NC 4WB4A 1HTLC 5AW0B 1HUCA 3HD7D 5AVXB 3TNUA 1IJDB 3GHGB 4C7NB 1CW5A 1L4AD 3P8CE 4W7YA 3B5ND 1URQB 5APVA 3BASA 4EOTA 3H32B 2IX7C 2OYHC 3VMYA 3VMZA 1XTCC 2NPSA 3M9HA 2H8PD 5AVYB 3UIAA 1ZR2A 2QM8A 2O01H 1OXZA 1FZEA 1CI6B 4N78E 1ZN5A 2H7HA 2Q5UA 3LW5H 2L5GB 2NPSD 1LTSC 1L4AC 1RF0A 1LWUC 1PFIA 3BATA 4WY4A 2C0WA 3HD7C 3L37A 1FOSF 5AW2B 1IFDA 3A3YB 4IFFA 1LTTC 1RY3A 4I1LA 4ZKUA 1KILA 1FU1A 1KILB 1M1JB 5AVSB 2N1TD 1T3JA 2N9BA 5CCGC 1LTAC 5KTBA 4LC1A 2HYNA 3HTKA 2M3BA 4N6JA 1FZAA 1GW4A 4WY4C 1J1EB 2OYHA 1KZUB 3U59A 2HPCB 2HPCA 1WT6A 1NHLA 2HFED 2YMYA 1FBMA 2OYIB 3KPEA 5CJ4A 2WTYA 2WWWA 3IR9A 1AFOA 2FFDA 2FFDB 2Z5IA 4EIJA 3TNUB 4JYCA 1T8ZA 1FZGA 4GIFA 3H6PA 3RK3D 1Z56A 1SQQK 2I1JA 1G1IA 3R2PA 2YO2A 1JCCA 2OARA 1GL2C 4N3YB 1GK6A 1JY2P 1QL1A 2N1TC 2ZFCA 3OJAB 3NMDA 1GD2E 1H8AA 1L0LK 1IFMA 2C9NY 4IFMA 5AVTB 2KYVA 3HUSC 4AQRD 3A2AA 2N1TB 3M91A 2W6BA 2OYIA 1LTIC 3MTUE 3MD0A 1N73B 4Y99C 3B8EB 1N73A 3BRTB 1GK4A 3OAKA 4AUWA 4WY4D 4AYCA 3EQ2A 2WPSA 4XA4A 3OA7A 1NU1K 1IFIA 1DH3A 3O8ZA 1KILD 2R5BA 5KLVK 5CJ0A 3LIDA 1JY3P 1MFZA 3V4QA 1XTGB 1J1EC 2P1JA 4HYTB 5AW4B 5AW8B 3HRNA 4LLHA 1GTWA 3NFQA 2KLVA 3V5BA 1NTMK 2ZXEB 1ZR4A 3M0DA 4I6MC 2IPPA 3IFMA 1LT9C 3KQGA 4WY4B 1VPCA 3VYIA 2YKQA 1RE4C 2MJZA 3P7KA 3VMXA 2R32A 3LIEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y99 C;  1YTZ T;  1J1E B;  1J1E C;  1YTZ I;  4Y99 B;  1J1D C;  1J1D B; 
#chains in the Genus database with same CATH topology
 1WMK A;  1NTM G;  2O3J A;  1EDK A;  1KFN A;  1SQB E;  2XNX A;  5B5E H;  1JCD A;  1RF0 C;  3SSU A;  3TGU G;  1KIL C;  1KQS O;  4HH2 A;  5APW A;  1OX3 A;  2XDJ A;  3V2Q A;  1K73 Q;  3MUD C;  3FGA D;  1H89 A;  2E76 B;  3AE7 C;  3P8M C;  3A5T A;  1Y47 A;  2QJP C;  4KHX A;  3TK1 A;  3CCJ P;  2GUS A;  4NPE A;  3CCU P;  1NJI Q;  1CW5 A;  1JY3 N;  3KDP B;  3L4F A;  2KB7 P;  1LTB C;  1IFN A;  2E75 B;  2ZAE B;  3C8V A;  3RL0 D;  1SFC B;  3JCU E;  1LWU B;  1SFC A;  3K5B A;  1A02 F;  2M5A B;  1Q86 Q;  5E79 E;  2OYH B;  1EC5 A;  2YMK A;  5M1B A;  5KKZ B;  2M0B A;  2D2C C;  4YTP C;  1RE4 A;  1YI2 P;  1FC2 C;  2H43 A;  3I5C A;  4PJ0 H;  4U3F G;  3CC4 P;  3A0B H;  1VDF A;  2KIK A;  3HE4 A;  4DZO A;  1KFM A;  3CCL P;  2FYN C;  3M06 A;  2WSC H;  4H44 B;  5KLV E;  3CWB J;  4RES B;  3L74 J;  1J1D B;  1NU1 E;  1RF1 C;  1E5W A;  2WPQ A;  2OTJ P;  1X22 A;  1YTZ I;  4RO0 A;  2LR2 A;  1VF5 B;  2K88 A;  1JY3 O;  2OTK E;  1BGY E;  5KAF E;  3H1I E;  1JTH B;  1NTZ G;  1NWQ A;  1URQ C;  2R5D A;  3L74 D;  3RK2 D;  3KHU A;  4JYB A;  2BAS A;  2C9L Y;  1AQT A;  1GL2 D;  2YO3 A;  1SVF A;  1SFC C;  2ZVN B;  3F5H A;  3S1K A;  5GTH E;  2W27 A;  4GT1 A;  4B86 A;  1VF5 D;  1ZXG A;  3JSV C;  5CBO A;  2J58 A;  2NRG A;  1N7S C;  2JO1 A;  3RK3 B;  1QX8 A;  1CSB A;  3MUD A;  1RE3 A;  5AVQ B;  2RN0 A;  5DJU B;  3U1C A;  1LTJ C;  3TSI A;  1VQ6 P;  1S72 P;  1WRG A;  2WSE J;  2E75 D;  3RL0 B;  1X9V A;  1UIX A;  2K37 A;  2Y9Y A;  1SQV E;  4U3F J;  2XKM A;  1NVO A;  3G3Z A;  4GDO A;  1LWU A;  1H8A A;  3L72 D;  5KLI B;  3R4Y A;  1JO5 A;  2HOD B;  3L70 G;  3WU2 E;  5AW3 B;  2GUV A;  1DX7 A;  2E76 C;  1NGM B;  1SQX J;  2MKV A;  1GW3 A;  2K9J A;  3HUS B;  2FFD C;  2K9J B;  2JWD A;  3H1L J;  3HE4 B;  4U3F D;  5APU A;  1GD2 E;  2N1T A;  1PGJ A;  1PL5 A;  2Q3I A;  3BRV B;  1DD4 A;  3CXH I;  2KUB A;  1OMI A;  3M0D C;  2Q1K A;  1M7L A;  4WBA A;  4IFD K;  1NKZ B;  4KJM A;  1DH3 A;  2ZT9 B;  1NTK G;  2XU6 A;  1OWA A;  3HE5 B;  1VQN P;  3HE5 A;  4PD4 H;  1BCC J;  1QGK B;  2OGU A;  2W83 C;  3E1I A;  3RK3 E;  1BSH A;  1ZRT E;  3PHL A;  2KLU A;  1GL2 B;  2FYZ A;  2WSF H;  3H1K D;  2FBW C;  1SQQ D;  5CHX A;  4W80 A;  1YJ9 P;  1H0T A;  2QSI A;  1SQQ G;  3RBZ A;  5KJ7 A;  1NTZ E;  1RQU A;  1JY2 O;  4C7R A;  2IDB A;  1IZN B;  1M56 D;  2KSJ A;  3ABV C;  3TGU D;  1HJB A;  3P8C D;  1FZC A;  2KSE A;  1S2E A;  5DJT B;  5AW9 B;  4PD4 D;  1KV4 A;  1QVG O;  2BEQ D;  3H1H D;  3P32 A;  2E5Y A;  2QVA A;  4PV1 B;  1PPJ G;  3GF7 A;  1KQL A;  2QIW A;  1S9K E;  3T97 A;  5B66 H;  1N8R Q;  1NKN A;  3L71 J;  2YIU B;  4Y28 J;  2R3C A;  4KT0 J;  1LTJ A;  4RKU J;  1NAF A;  1T3U A;  2LKM A;  1JOC A;  2Q3E A;  1X79 B;  2LXC B;  2E5T A;  1SQX G;  1LGH B;  5KLV G;  4H0L B;  1NTZ J;  2NPS C;  4N78 D;  3GG2 A;  2B89 A;  1U7M A;  2HOD A;  1FZB A;  2FKW B;  1YYC A;  3M0A A;  2PGD A;  3CC7 P;  1EDI A;  1YJW P;  3AED C;  3CX5 D;  2WPR A;  1SQB G;  2V7Q J;  3N4X A;  1L4A B;  5AVU B;  3EFF K;  3Q2Y A;  3JC2 2;  3PH0 A;  1LTG C;  5CCH D;  5CCG D;  2IBZ E;  3PP5 A;  2IYP A;  1JEK A;  3TDK A;  2J5U A;  3IAO A;  3KYQ A;  4UB6 E;  3CCV P;  2ITA A;  1IK9 A;  1GU4 A;  2FXP A;  1AVO A;  2POH A;  3E1R A;  4L73 A;  1KQG B;  1EXI A;  4O9B A;  4JF7 A;  2CPB A;  3CL3 D;  2BEZ F;  3H1K J;  4OH8 B;  3A7O A;  5APT A;  3AE4 C;  5APY A;  2OQQ A;  1X8Y A;  3NTN A;  2CK3 H;  2E75 C;  1SQP J;  3WMM 0;  4H13 C;  2M5A A;  1BCC D;  3L35 A;  1SQV J;  4U3F E;  5CCH A;  2A45 H;  5KJ7 C;  3V2N A;  1FZC C;  1USD A;  2JEE A;  2KZJ A;  2ZVO B;  3AE1 C;  4XE5 B;  1NAY A;  1MZ9 A;  2W90 A;  5AW6 B;  4ZKP A;  1M1K Q;  3HUS A;  1H0T B;  1BDD A;  4XFJ A;  1YIT P;  3I56 P;  1USE A;  1W2E A;  4HJG H;  3RL0 C;  1FZC B;  1S3J A;  2AEJ A;  5AW1 B;  3H1L D;  2BCC D;  3TF5 A;  2AEM A;  3OW2 O;  1LTJ B;  1R8E A;  1SQX D;  2E43 A;  5AW5 B;  4Y99 B;  4IL6 E;  1J1D C;  3V2P A;  2OTL P;  2JDI H;  2LXB A;  2I1K A;  2R44 A;  2Q7C A;  1G2C A;  1KB9 E;  1N7S B;  2HLO A;  3WUU A;  2PFX A;  3M9Q A;  2E74 C;  4QMA A;  4YXW H;  5BU8 B;  3Q5P A;  2P7J A;  1JTH A;  2R32 A;  1H88 A;  3CME P;  4GKG A;  3D70 A;  1GL2 A;  3EFG A;  3FWN A;  1K8A Q;  2WT7 A;  3CCR P;  2WT7 B;  2M3E A;  1SP4 A;  2W6A A;  2FXO A;  3MIW A;  1PV3 A;  3MGN A;  3MHV A;  5KAI E;  5APQ A;  1VQO P;  2WSS H;  2ZYG A;  2WSF J;  4PJ0 E;  3VP8 A;  1SQB K;  4I2L C;  1A02 J;  3VTP C;  1LT9 A;  2PP6 A;  2A45 G;  3AE6 C;  3AEA C;  1NTZ K;  5KJ7 D;  3S4R A;  1JMM A;  3GF3 A;  5AVR B;  1M1J C;  1P84 D;  1PP9 E;  3FX0 A;  2O01 N;  1RE3 C;  1D7M A;  1ZV8 A;  3QWO C;  2W8Z A;  5APS A;  3D6Y A;  4DOJ A;  1FZG A;  1JB0 J;  1U57 A;  3CCE P;  1J2J B;  2YKO A;  1M8O B;  3H1J E;  4PV1 D;  3EWK A;  5TJH A;  5KAF H;  2QA4 P;  1N7L A;  2QM7 A;  1G1J A;  1HVV A;  3N7N A;  1FAV A;  3L73 E;  4I7Z C;  4IL6 H;  4NPF X;  2VRS A;  3HD7 B;  1Y9B A;  5AW7 B;  3CWB D;  1CZQ A;  1IC2 A;  1NU1 D;  2JWA A;  3SFE C;  3V2R A;  3AE3 C;  2JP3 A;  1EQ7 A;  4Z1M H;  1L4A A;  1SQP K;  1FDM A;  1EDJ A;  3D6Z A;  4C46 A;  1BE3 D;  3CD6 P;  4OGQ C;  3I55 P;  3AEB C;  1MV8 A;  3CI9 A;  2YXQ B;  3AEF C;  5GTH H;  2Z5H A;  3E7K A;  1HWT C;  1SQV K;  1PGP A;  4LGD E;  1EDL A;  3L71 E;  4HB1 A;  4W7Z A;  1T2K D;  1S5L H;  1L0N E;  1OW8 A;  1SQP G;  3FXD A;  4BRY A;  1ZOY C;  3M9B A;  2JJL A;  5AVV B;  2WSC J;  1KN7 A;  3CLQ A;  3WUV A;  5K5G B;  1FJK A;  4WWI A;  2L91 A;  5CMZ A;  3A0H H;  4R4L A;  2B88 A;  1DEB A;  3KXD A;  5GTI E;  3H32 A;  1FZF A;  3D71 A;  1LT9 B;  2R3S A;  3L72 G;  1AQ5 A;  1KIL E;  5B5E E;  1NH4 A;  3VN0 A;  5BU5 A;  1L0L J;  1S5L X;  2I8D A;  2PAJ A;  2G3A A;  3L72 E;  1Q81 Q;  2HR3 A;  3KZI H;  5CBN A;  1PP9 G;  3VP9 A;  1N73 C;  2HG5 D;  1EZV I;  5APX A;  1KB9 I;  1DEE G;  2FYU E;  3B5N B;  2YKP A;  3B5N A;  1OVU A;  3GMA A;  3PLN A;  1G2C B;  1N7S A;  1NTK J;  1YTZ T;  5C39 A;  2XV5 A;  3V4W A;  3V6I A;  4D6T D;  3RK3 C;  1ZLL A;  3GHG C;  3W67 A;  4OVN F;  1OW6 A;  1N2D C;  3L73 J;  1QL2 A;  3G6E P;  3HD7 A;  3IF4 A;  1FOS E;  4A7P A;  4GOF A;  2A06 G;  1BE3 J;  2FXM A;  3SWY A;  1NTK E;  2A06 D;  1GU5 A;  1GDT A;  1QEX A;  2WSE H;  1AVY A;  3RK2 B;  2E42 A;  1NTK K;  2M8R A;  2QRX A;  2OYI C;  1HGZ A;  1VQ7 P;  1NTM D;  2XZR A;  1S1C X;  2ZYA A;  3AEE C;  2Q9I A;  2YNY A;  1HGV A;  2A45 I;  3MZW B;  1KYO H;  3A0H E;  1ZW0 A;  1SQV G;  1VQ5 P;  1VQL P;  1PZQ A;  5AVZ B;  1SQB D;  2FYU K;  1IFJ A;  2IFM A;  4JPZ B;  3TGU E;  3L71 G;  1KB9 H;  3II6 A;  1URQ A;  3L75 G;  3AE9 C;  1YBK A;  2BCC G;  3BCC J;  1N86 A;  2WVR A;  3H1H E;  3L75 D;  5AVW B;  1S9K D;  1VQK P;  2CPS A;  3HTK B;  3S9O A;  1VQP P;  1Q90 D;  2IFN A;  5KLV D;  1X0T A;  1IO4 A;  4ASV A;  1RF1 A;  1SLQ A;  1RF1 B;  1R5L A;  2NPS B;  2GM4 A;  3L70 D;  3VMA A;  1JMB A;  2O1K A;  3SWF A;  2YIU C;  2AEF A;  2FYN B;  2KZI A;  2C0X A;  1FS0 E;  4H44 C;  2WZ7 A;  3GLM A;  5CCG A;  1HH0 A;  2KNC A;  1SQX K;  2P2U A;  3GW6 A;  3H1I D;  3CMA P;  1Q82 Q;  2J59 M;  4D6T G;  3KZI E;  2PRR A;  1L0N K;  1PGO A;  1NO4 A;  3PJS K;  1YJN P;  4HKZ H;  4OWF A;  1OZH A;  1U7J A;  1NU1 G;  1FJP A;  1OVR A;  2H89 C;  2KP8 A;  3GHG A;  4C7N A;  2K1A A;  2K3R A;  2RMZ A;  3CX5 H;  4DT0 A;  1NOH A;  3B71 A;  4H0L D;  4I7Z B;  2IBZ G;  1PGQ A;  2P67 A;  4YXD C;  3H1K G;  1JNM A;  1VQ4 P;  1SQP E;  2N9Y B;  1BGY D;  3TYY A;  2D2C D;  2WQY C;  1JUN A;  3C9I A;  2E74 B;  1OFC X;  4M3L A;  1JY2 N;  1MUU A;  1EZV D;  4L74 A;  1N7S D;  1T2K C;  1BGY J;  1MFT A;  1SQV D;  2OYO A;  3RL0 g;  2Z4E A;  1M1J A;  1KYO D;  1CI6 A;  1PPJ D;  3L36 A;  3BCC D;  4MN4 C;  1HBW A;  1SFC D;  3VOP A;  1FE6 A;  2O01 J;  3RK2 C;  1URQ D;  1YIJ P;  3AE8 C;  3FWL A;  3L73 G;  1W2B O;  5TIS E;  2H88 C;  5KLI C;  1GZL A;  4TT3 H;  3NXS A;  2ZXX A;  3SWK A;  3U1A A;  1S4X A;  2V4H A;  2Y9Z A;  1KC8 Q;  2KOG A;  1KOR A;  2Y0D A;  5BVZ A;  2O1J A;  3C1L A;  2K9Y A;  1KMI Z;  3Q5S A;  1BDC A;  2WIT A;  3WUT A;  3B5N C;  1Q2N A;  4IOI H;  2KNC B;  2JR8 A;  2KK7 A;  1OIP A;  3F89 A;  4WB4 A;  1HTL C;  5AW0 B;  1HUC A;  4ZMD A;  1QLE D;  1L0L E;  5KAI H;  3SFD C;  3HD7 D;  1NTZ D;  3L75 J;  3CXH D;  4BRY B;  4IL6 X;  1OVV A;  5AVX B;  1VQ8 P;  3TNU A;  1IJD B;  3AEG C;  3FXE A;  2SPZ A;  3GHG B;  1L4A D;  1MKM A;  3P8C E;  4C7N B;  4W7Y A;  3B5N D;  4NPD A;  3CCM P;  1URQ B;  5TIS H;  1R5S A;  2IZ1 A;  3AE5 C;  1BGY G;  1Y8A A;  5APV A;  2IYO A;  3BAS A;  2XND H;  4EOT A;  1PP9 D;  2E74 D;  1ZRT D;  3H32 B;  1EZV G;  2D2C B;  2IX7 C;  1NTM J;  3RGU A;  2FY8 A;  4RJT A;  1BCC G;  2OYH C;  1SQQ E;  3VMY A;  3VMZ A;  2UWJ E;  1XTC C;  2NPS A;  3CXH H;  2H8P D;  3M9H A;  5AVY B;  3TGU J;  2QM8 A;  5EFW B;  3UIA A;  1ZR2 A;  1ZME C;  1M57 D;  1P84 H;  2O01 H;  3H1J D;  1OW7 A;  1OXZ A;  1FZE A;  1CI6 B;  4N78 E;  1ZN5 A;  3WU2 H;  4WVZ A;  5GTI H;  2H7H A;  2Q5U A;  2AXT E;  1SQQ J;  3LW5 H;  2L5G B;  2KS1 A;  3A0B E;  3L73 D;  4BWN A;  2NPS D;  1BE3 G;  1LTS C;  3CWB E;  1L4A C;  3CX5 I;  4TLF A;  3AEC C;  2QE7 H;  4D6T J;  5KKZ C;  1KD1 Q;  1RF0 A;  1LWU C;  1PFI A;  3BAT A;  3O6Q B;  4WY4 A;  3JCU H;  2C0W A;  3HD7 C;  1BE3 E;  3L37 A;  1EXJ A;  1FOS F;  5AW2 B;  2G8Y A;  1IFD A;  4H13 D;  3A3Y B;  3H1I G;  1LJ2 A;  2P58 A;  3H1J J;  4H0L C;  1JM0 A;  2QJP B;  3ZDM A;  4IFF A;  4OGQ B;  3Q1M A;  3BVH A;  2Y0C A;  3L74 E;  1LTT C;  1RY3 A;  2QJY B;  3AE2 C;  4I1L A;  1KIL A;  3CX5 E;  4ZKU A;  1FU1 A;  1KIL B;  2QG4 A;  3G4S P;  2ZT9 D;  1LT1 A;  1PP9 J;  1NYH A;  1T6A A;  3L72 J;  1M1J B;  3L74 G;  3RBX A;  3Q3D A;  4EDF A;  4UB8 E;  5AVS B;  2N1T D;  1T3J A;  1VL2 A;  2IBZ D;  2N9B A;  1L0L G;  4GOE A;  4K35 A;  1W5C E;  2B87 B;  5CCG C;  1LTA C;  1YQ4 C;  2V7Q H;  5KTB A;  4LC1 A;  2HYN A;  3HTK A;  2M3B A;  5H2F E;  4N6J A;  1FZA A;  1GW4 A;  3G9R A;  2AXT H;  4WY4 C;  1J1E B;  2BCC E;  2OYH A;  1BSN A;  1KZU B;  1M90 Q;  1RQV A;  3U59 A;  2HPC B;  1AA0 A;  4U7J A;  2RH0 A;  2HPC A;  5L8R J;  3W68 A;  1WT6 A;  1Q7Y Q;  1NHL A;  2HFE D;  1FDO A;  2KXP B;  2Y0E A;  2GA1 A;  2YMY A;  1FBM A;  1NU1 J;  4D6T E;  2OYI B;  3KPE A;  5CJ4 A;  2KS1 B;  4BXL A;  2WTY A;  2AXC A;  2WWW A;  1VQ9 P;  3IR9 A;  1AFO A;  3H1L E;  2FFD A;  4CPG A;  2FFD B;  2QJY C;  3O6Q A;  2Z5I A;  4EIJ A;  3TNU B;  3Q5R A;  1VQM P;  4PD4 I;  4JYC A;  1NTM E;  1T8Z A;  1P84 I;  2BCC J;  2WPV B;  3BCC G;  4GIF A;  1ZP0 C;  3H6P A;  4H13 B;  3RK3 D;  2RKL A;  1Z56 A;  1SQQ K;  2I1J A;  4H44 D;  1G1I A;  1TU3 F;  2ZJS E;  1VF5 C;  3H1K E;  3R2P A;  4DJG A;  2YO2 A;  1HF9 A;  1KTM A;  1JCC A;  2OAR A;  2QJK B;  3USS A;  5B66 E;  1GL2 C;  2WMM A;  4K3A A;  4N3Y B;  1IFP A;  3L75 E;  1GK6 A;  2FYU G;  5H2F H;  1AJY A;  2KI7 B;  1SS1 A;  1K04 A;  1JY2 P;  1QL1 A;  2B87 A;  2N1T C;  2ZFC A;  3NMD A;  3OJA B;  4PD4 E;  3MP7 B;  4JQ0 D;  4L75 A;  2JKV A;  1L0L K;  1P84 E;  3L70 E;  1K9M Q;  2ZT9 C;  1QVF O;  4EI2 A;  1IFM A;  2C9N Y;  1GMJ A;  4IFM A;  2QEX P;  2DW3 A;  2E76 D;  2Q6Q A;  3PTZ A;  3H1I J;  3H1J G;  5AVT B;  2KYV A;  4JBZ A;  3HUS C;  1DIP A;  4EYY Q;  1YQ3 C;  4AQR D;  3A2A A;  3G71 P;  2N1T B;  1UII A;  2W6B A;  3M91 A;  2OYI A;  2IBZ I;  1LTI C;  3L70 J;  2NZ2 A;  1L0N D;  5CCH C;  4YPC A;  4GOD A;  1IK7 A;  2QJK C;  1RHZ B;  1L0N G;  3MD0 A;  2YXR B;  3MTU E;  3B8E B;  4Y99 C;  5KLV J;  1N73 A;  1N73 B;  3BRT B;  2P10 A;  1DD3 A;  1GK4 A;  3OAK A;  1AV1 A;  1SQP D;  4AUW A;  4WY4 D;  3H1H G;  4AYC A;  4OGQ D;  3EQ2 A;  2WPS A;  1LNQ A;  3CCS P;  4XA4 A;  1SQB J;  1NU1 K;  3OA7 A;  2W6J H;  1EZV E;  1IFI A;  3H1H J;  3LW5 J;  3B4S A;  1KIL D;  2R5B A;  3L71 D;  3O8Z A;  1K05 A;  3QH9 A;  4UB6 H;  5KLV K;  2ZYD A;  5CJ0 A;  3LID A;  3CCQ P;  2FYU J;  1JY3 P;  1KYO E;  1PPJ E;  1MFZ A;  1KQF B;  3BCC E;  1XTG B;  3V4Q A;  1J1E C;  2IZ0 A;  3H25 A;  2P1J A;  4HYT B;  5AW4 B;  5AW8 B;  1LP1 A;  2B9B A;  2FYU D;  1LP1 B;  3HRN A;  4LLH A;  1BCC E;  4L76 A;  4PV1 C;  3PRJ A;  3T97 B;  4DCK A;  1GTW A;  3IN6 A;  3NFQ A;  4ZNC A;  5E79 H;  2KLV A;  3V5B A;  1NTM K;  1S5L E;  1L2P A;  1FDI A;  2ZXE B;  3M0D A;  4I6M C;  4ASW A;  1ZR4 A;  1NTK D;  2A06 E;  2IPP A;  1LT9 C;  3IFM A;  1HJ0 A;  3KQG A;  4WY4 B;  1SQX E;  1KYO I;  3CPW O;  3CWB G;  1VPC A;  3VYI A;  1YHQ P;  1L0N J;  2YKQ A;  3CC2 P;  3H1L G;  1RE4 C;  1KB9 D;  2MJZ A;  1E79 H;  3ITK A;  3P7K A;  1L0L D;  4R4M A;  4UB8 H;  3VMX A;  1PIX A;  3LIE A;  3CXH E;  1RH5 B; 
#chains in the Genus database with same CATH homology
 1KFN A;  2XNX A;  1JCD A;  1RF0 C;  1KIL C;  4HH2 A;  5APW A;  2XDJ A;  3V2Q A;  1H89 A;  3A5T A;  3P8M C;  4KHX A;  3TK1 A;  2GUS A;  1JY3 N;  3KDP B;  3L4F A;  2KB7 P;  1LTB C;  1IFN A;  3RL0 D;  1A02 F;  1SFC B;  1LWU B;  1SFC A;  2OYH B;  2H43 A;  1RE4 A;  3I5C A;  1VDF A;  3HE4 A;  4DZO A;  1KFM A;  3M06 A;  2WSC H;  4RES B;  1J1D B;  1RF1 C;  1E5W A;  2WPQ A;  1YTZ I;  1JY3 O;  1JTH B;  1NWQ A;  1URQ C;  2R5D A;  3RK2 D;  4JYB A;  2BAS A;  2C9L Y;  1GL2 D;  2YO3 A;  1SVF A;  1SFC C;  2W27 A;  4GT1 A;  4B86 A;  2J58 A;  1N7S C;  3RK3 B;  1CSB A;  3MUD A;  1RE3 A;  5AVQ B;  3U1C A;  1LTJ C;  3TSI A;  1WRG A;  3RL0 B;  1X9V A;  2XKM A;  3G3Z A;  1LWU A;  1JO5 A;  2HOD B;  5AW3 B;  2GUV A;  1DX7 A;  1GW3 A;  3HUS B;  2FFD C;  3HE4 B;  5APU A;  2N1T A;  2Q3I A;  3M0D C;  3BRV B;  4WBA A;  4IFD K;  1M7L A;  1NKZ B;  2XU6 A;  1OWA A;  3HE5 B;  3HE5 A;  3E1I A;  1GL2 B;  2FYZ A;  2WSF H;  5CHX A;  4W80 A;  5KJ7 A;  4C7R A;  1JY2 O;  2KSJ A;  1HJB A;  3P8C D;  1FZC A;  5AW9 B;  3BVH A;  3P32 A;  1S9K E;  1KQL A;  3T97 A;  1NKN A;  2R3C A;  1LTJ A;  1NAF A;  1T3U A;  2LKM A;  1JOC A;  1X79 B;  1LGH B;  2NPS C;  4N78 D;  2HOD A;  1FZB A;  2FKW B;  1YYC A;  3M0A A;  2WPR A;  3N4X A;  1L4A B;  5AVU B;  1LTG C;  5CCH D;  5CCG D;  3PP5 A;  3KYQ A;  1GU4 A;  1IK9 A;  2POH A;  4O9B A;  4JF7 A;  2CPB A;  3CL3 D;  4OH8 B;  5APY A;  3A7O A;  5APT A;  1X8Y A;  3NTN A;  3WMM 0;  5KJ7 C;  3L35 A;  5CCH A;  2A45 H;  3V2N A;  1FZC C;  2JEE A;  1FZC B;  4XE5 B;  5AW6 B;  1MZ9 A;  4ZKP A;  3HUS A;  3RL0 C;  1W2E A;  5AW1 B;  2E43 A;  1LTJ B;  5AW5 B;  4Y99 B;  1J1D C;  3V2P A;  2I1K A;  2Q7C A;  1G2C A;  1N7S B;  2HLO A;  3M9Q A;  5BU8 B;  2P7J A;  1JTH A;  1H88 A;  4GKG A;  1GL2 A;  3EFG A;  2WT7 A;  2WT7 B;  1SP4 A;  2W6A A;  3MIW A;  3MGN A;  5APQ A;  1A02 J;  3VP8 A;  1SQB K;  4I2L C;  1LT9 A;  2PP6 A;  2A45 G;  1NTZ K;  5KJ7 D;  1JMM A;  5AVR B;  1M1J C;  1RE3 C;  1ZV8 A;  5APS A;  4DOJ A;  1J2J B;  2YKO A;  1N7L A;  2QM7 A;  1G1J A;  1HVV A;  3N7N A;  1FAV A;  5CCH C;  2VRS A;  3HD7 B;  5AW7 B;  3V2R A;  1CZQ A;  1IC2 A;  1EQ7 A;  1L4A A;  1SQP K;  1FDM A;  4C46 A;  1MV8 A;  3CI9 A;  1HWT C;  2Z5H A;  1SQV K;  4LGD E;  4W7Z A;  1T2K D;  3M9B A;  2JJL A;  5AVV B;  3CLQ A;  1FJK A;  5CMZ A;  1DEB A;  3H32 A;  1FZF A;  1LT9 B;  1AQ5 A;  1NH4 A;  3VN0 A;  5BU5 A;  2PAJ A;  3VP9 A;  1N73 C;  2HG5 D;  5APX A;  3B5N B;  2YKP A;  3B5N A;  3VTP C;  1G2C B;  1N7S A;  3V4W A;  1YTZ T;  2XV5 A;  3RK3 C;  1ZLL A;  3GHG C;  1N2D C;  1QL2 A;  3HD7 A;  1FOS E;  2FXM A;  3SWY A;  1GU5 A;  1GDT A;  2WSE H;  3RK2 B;  2E42 A;  1NTK K;  2M8R A;  2OYI C;  1HGZ A;  2XZR A;  2Q9I A;  2YNY A;  1HGV A;  2A45 I;  5AVZ B;  2FYU K;  1IFJ A;  2IFM A;  3II6 A;  1URQ A;  1N86 A;  1S9K D;  5AVW B;  2CPS A;  3HTK B;  2IFN A;  1IO4 A;  1RF1 A;  1SLQ A;  1RF1 B;  2NPS B;  2GM4 A;  2O1K A;  3SWF A;  5CCG A;  2C0X A;  2WZ7 A;  1HH0 A;  1SQX K;  2P2U A;  2J59 M;  1L0N K;  1NO4 A;  1FJP A;  2KP8 A;  3GHG A;  4C7N A;  1NOH A;  1JNM A;  2P67 A;  3TYY A;  1JUN A;  3C9I A;  4M3L A;  1JY2 N;  1MUU A;  1N7S D;  1T2K C;  2Z4E A;  1M1J A;  1CI6 A;  1HBW A;  3L36 A;  1SFC D;  3VOP A;  3RK2 C;  1URQ D;  1GZL A;  3NXS A;  3U1A A;  2KOG A;  5BVZ A;  2O1J A;  2WIT A;  3B5N C;  4WB4 A;  1HTL C;  5AW0 B;  1HUC A;  3HD7 D;  5AVX B;  3TNU A;  1IJD B;  3GHG B;  4C7N B;  1CW5 A;  1L4A D;  3P8C E;  4W7Y A;  3B5N D;  1URQ B;  5APV A;  3BAS A;  4EOT A;  3H32 B;  2IX7 C;  2OYH C;  3VMY A;  3VMZ A;  1XTC C;  2NPS A;  3M9H A;  2H8P D;  5AVY B;  3UIA A;  1ZR2 A;  2QM8 A;  2O01 H;  1OXZ A;  1FZE A;  1CI6 B;  4N78 E;  1ZN5 A;  2H7H A;  2Q5U A;  3LW5 H;  2L5G B;  2NPS D;  1LTS C;  1L4A C;  1RF0 A;  1LWU C;  1PFI A;  3BAT A;  4WY4 A;  2C0W A;  3HD7 C;  3L37 A;  1FOS F;  5AW2 B;  1IFD A;  3A3Y B;  4IFF A;  1LTT C;  1RY3 A;  4I1L A;  4ZKU A;  1KIL A;  1FU1 A;  1KIL B;  1M1J B;  5AVS B;  2N1T D;  1T3J A;  2N9B A;  5CCG C;  1LTA C;  5KTB A;  4LC1 A;  2HYN A;  3HTK A;  2M3B A;  4N6J A;  1FZA A;  1GW4 A;  4WY4 C;  1J1E B;  2OYH A;  1KZU B;  3U59 A;  2HPC B;  2HPC A;  1WT6 A;  1NHL A;  2HFE D;  2YMY A;  1FBM A;  2OYI B;  3KPE A;  5CJ4 A;  2WTY A;  2WWW A;  3IR9 A;  1AFO A;  2FFD A;  2FFD B;  2Z5I A;  4EIJ A;  3TNU B;  4JYC A;  1T8Z A;  1FZG A;  4GIF A;  3H6P A;  3RK3 D;  1Z56 A;  1SQQ K;  2I1J A;  1G1I A;  3R2P A;  2YO2 A;  1JCC A;  2OAR A;  1GL2 C;  4N3Y B;  1GK6 A;  1JY2 P;  1QL1 A;  2N1T C;  2ZFC A;  3OJA B;  3NMD A;  1GD2 E;  1H8A A;  1L0L K;  1IFM A;  2C9N Y;  4IFM A;  5AVT B;  2KYV A;  3HUS C;  4AQR D;  3A2A A;  2N1T B;  3M91 A;  2W6B A;  2OYI A;  1LTI C;  3MTU E;  3MD0 A;  1N73 B;  4Y99 C;  3B8E B;  1N73 A;  3BRT B;  1GK4 A;  3OAK A;  4AUW A;  4WY4 D;  4AYC A;  3EQ2 A;  2WPS A;  4XA4 A;  3OA7 A;  1NU1 K;  1IFI A;  1DH3 A;  3O8Z A;  1KIL D;  2R5B A;  5KLV K;  5CJ0 A;  3LID A;  1JY3 P;  1MFZ A;  3V4Q A;  1XTG B;  1J1E C;  2P1J A;  4HYT B;  5AW4 B;  5AW8 B;  3HRN A;  4LLH A;  1GTW A;  3NFQ A;  2KLV A;  3V5B A;  1NTM K;  2ZXE B;  1ZR4 A;  3M0D A;  4I6M C;  2IPP A;  3IFM A;  1LT9 C;  3KQG A;  4WY4 B;  1VPC A;  3VYI A;  2YKQ A;  1RE4 C;  2MJZ A;  3P7K A;  3VMX A;  2R32 A;  3LIE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...