1YU9A

Gppnhp-bound rab4a
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
175
structure length
175
Chain Sequence
GPLGSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGEDVEEAFVQCARKILNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding protein
publication title Structural basis of family-wide Rab GTPase recognition by rabenosyn-5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 60
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2005-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1yu9A01
2GDJA 1ZCBA 3RWMB 5JHHB 1S3GA 3FDIA 4GZLA 4AK9A 2ZVQX 2ZE7A 4DC9A 1P9RA 3P27A 2AWOA 3NHBA 3ASZA 1UEJA 4MGYR 1XMJA 4C7OB 1WXQA 3QVUA 4DZZA 4EPVA 4TMZA 1G21E 3FTQA 1MABA 3G5UA 1W5SA 1OXTA 3LY5A 4PHGA 2JLQA 5CJPA 3TUIC 3I1FA 1UBGA 3OEHA 3RNLA 3K0AB 2VP2A 2ZSDA 2IUUA 4Q9IA 4Q1BA 3WBKA 1G7CA 1OXVA 5HE8A 4ILEA 5EP1A 1HUQA 3PJRA 3OE7A 3CO5A 2ZRIA 1HT2E 1OHHA 2XOKD 5CYOA 5FPHA 4XWKA 3Q5DA 4I1UA 1KDTA 4V03A 1CS4C 3F5FA 3KKPA 3RRMA 3RAPR 1G19A 1W2GA 2O52A 4Q9KA 3BFVA 4TMTA 5TV2A 1XEFA 3THWB 2OM2A 4DB2A 4W5WA 5DN6D 1EX7A 2R6FA 4DSOA 4K46A 1S3SA 2PLFA 5FL7D 3I32A 1IY0A 2QP9X 1AS3A 1CU1A 1ZM2A 4XVRA 2N1BA 3AEZA 1ELOA 4QHYA 3CUEF 2EWWA 1R5NA 2D06A 5JHGB 2QL6A 4YXWD 3ADDA 4IVQA 2EYUA 2C77A 2YKGA 3B9PA 3QG5A 2OLKA 2JLYA 4B47A 2YV5A 1KI6B 2A5YB 1P6XA 2GRJA 4D4MA 3ETLA 3HP1A 4DEYA 5K8LA 1N6IA 1R8QA 1NJFA 3U3RA 2J0UB 2GETA 1KO5A 1JALA 4Q1DA 1RE0A 3RHFA 4B3DA 1CJMA 2QTFA 4A92A 4AYXA 4XSGA 3U3MA 5JMTA 4HB4A 1D6JA 1H8EA 3DZ8A 4JLDA 2Z83A 1CEEA 4FWTA 3PEWA 4IOMA 1Y63A 5P21A 5FR2A 2ODNA 3B7GA 4O2RA 4CEIA 3KFXA 1ZC3A 3B9QA 2GCOA 4OL0A 4OK5A 2BC9A 4X8HA 3WP0A 3THOA 1X8JA 4QNRA 2KB0A 4A15A 1K6MA 1GRRA 2BJWA 2ZEJA 1FMJA 2QTVB 1BMFA 3KXKA 1CRQA 1G3IA 1OIWA 2IYQA 3CX8A 3WYFA 4WA7A 4AD8A 4B3GA 3W6NA 4QNMA 2DPXA 1U0LA 1ZM3A 1II8B 2LKCA 2OXCA 4B33A 1T6NA 4XOIA 2QBYB 1JI0A 3CPHA 1Z29A 4KSCA 1ETUA 4OJQA 1E2GA 2F1IA 2OLJA 3FOZA 3C15C 4PR0A 3D7MA 1PV4A 1ZD1A 2AD5A 2NTYC 3LO5A 4DRZA 4F7WA 4OBEA 2GAOA 2YOHA 2RKOA 4BEJA 4BFSA 4DT1A 4O3MA 3C16C 1KYIA 4US0R 3QF7A 3HU2A 3MMPA 5EE9A 3K0SA 1YZNA 3RS5A 4XWOA 2E1RA 4NU0A 2G83A 1Z22A 5DHAA 3K9NA 3U4QB 1E2EA 4PTLA 3AVUA 5TARA 3ZD6A 4TTPA 3WHKA 2RHMA 5H70A 3EPJA 3EIQA 2FSHA 4OKSA 2F43A 5SZKB 2V6JA 5L3QA 1BIFA 1A5TA 2OXRA 5FTKA 6Q21A 1DAHA 2H16A 4EFLA 1G3MA 4CT5A 4LHXA 1FQKA 1G4UR 1Q1BA 2OCBA 3K0FA 1HV8A 2EFDB 4QKQA 3UATA 1MO3A 4E5UA 1IQPA 2OSBA 3TGPA 4LBYA 4XD7A 1BOFA 1RJ9B 4JKIA 1DEKA 2AN9A 5CDFE 1FL9A 1U9IC 2QN6A 3EIEA 4CVNA 5ELXA 2V4ZA 1Z83A 1UPTA 1G6HA 4HAUA 4PZLA 1P60A 2WJHA 5FPTA 1HE1C 2GWHA 1WDTA 4BRWA 4PO1A 5JJKA 2J0SA 2F3RA 1RRCA 1W36B 2J9RA 2GVZC 2XXAA 1ZBDA 4M1MA 4NYIQ 1T5LA 3B1YA 3NH9A 2FG5A 2RHDA 2BM1A 4B34A 4Q7KA 3LBNA 4C7OA 3BC1A 1N0WA 5AUQA 5DO9A 3VR3A 2CVFA 4S35A 4HAVA 2QORA 1VECA 2RAPA 3K0AA 2YOGA 1LF0A 4UXJA 2FX3A 3DVLA 1JQJC 4PXAA 3B1WA 3X1DA 5FR1A 4DCNA 1Z47A 2YINC 2ZJ2A 1Z6XA 4DWJA 2VEDA 4NCIA 4PX9A 1W36C 2QI9C 3GEIA 1FUUA 4F91B 1L2TA 3TLXA 4DLVA 2YNMA 1YKSA 1MO4A 2WKPA 4MKHA 4BECA 5SZIA 2Q9CA 1EFTA 4K8OA 2ZJYA 1KSJA 2BBOA 4GI7A 4D80A 1KZ7B 1LS1A 3GCGA 2X19A 1WBDA 2ZRLA 3CB4A 4X8LA 2BCJQ 4RKEA 1KI1A 1GM5A 4V0LA 3BK7A 2XZLA 1CJKC 1FNNA 2IHBA 4HATA 4JBWA 4L8GA 4CZ2A 1U2RA 1E9RA 3TSWA 4URXR 5BN4A 3DM5A 4ZV4A 1LW7A 1N6HA 3GLFE 1WRBA 4IOKA 4GPTA 2WMNB 3RSLA 4LCBA 4QBIA 1T3SA 3CR7A 5DIFA 1VG1A 2J0UA 1Q0UA 3W8NA 3NTUA 2VF8A 1DELA 3WYAA 3KXLA 5LD2B 4FD2A 3D6TB 1E32A 1S4QA 2HUPA 2MMGA 621PA 1F6BA 3MFYA 2W0SA 3K0CC 4YMSA 3TAHA 4DXAA 4FMDF 5E7IA 3EZ7A 4Q47A 4Q9JA 4V0MA 3RS0A 4D0GA 4DEXA 5J5CA 2D7CA 3EZFA 3PUXA 4LYAA 1T3HA 1OIVA 2IA5A 4LHZA 3REGA 2PCJA 1W0JA 1XTKA 3DHWC 3QXHA 1S9DA 4B32A 5KNBA 4M2LA 4TLAA 2W6JD 1G1MA 2QMHA 1KDOA 2WM9B 4QFMA 4RD1A 2HV8A 4WIAA 3KL4A 4LBVA 4HLDA 2GEVA 2FN4A 5LD2C 2GEDA 1OHHD 3OIVA 4Z1MA 3AVWA 1G3QA 1I4DD 2AD1A 1XX6A 2GVDC 3GFOA 1AGPA 5IF9A 1II8A 3U3JA 2CLDX 3MRSA 3QPVA 1IJEA 2Q0HA 3B85A 1NSTA 2VA8A 3KFVA 3SEAA 4NZYA 1OE0A 2QNRA 3T12A 4A0FA 5JS7A 3O47A 4EPWA 3ADCA 3TSOA 1N2CE 3B2EA 1CR1A 4R2IA 2HF9A 1KI9A 2WZQA 2O8FB 3EPHA 3ZVRA 4CYMA 3A58B 3VX4A 2WPDA 2VP4A 4NYJR 3TK1A 2JCSA 5K8UA 1WB9A 3AVTA 1VG0B 5DH9A 2ONJA 2QAGB 1N5LA 3LFUA 2HXYA 3SBEA 3IEUA 3A1UA 1U9IA 4YDSA 3RC3A 3VKGA 2PJZA 1SVMA 3QXJA 1M1YE 2D62A 4OI1A 4C30A 3U4QA 1RIFA 3FPAA 4NCNA 5IRCD 1TF2A 1XXHE 4QG7A 3RDPA 4FMCF 3CH4B 2ZSEA 4TMWA 2O5VA 4Y0VA 1BKDR 2F6RA 3VTKA 2ZROA 3NBFA 2WWGA 1LY1A 4M0LA 5ANRB 1UKYA 2ZJ8A 3H84A 2XAUA 2JJ2D 1W5TA 1T8TA 4WW0A 4FWIB 1ZD9A 2JLSA 3TNFA 4M9SA 3LWNA 4M1OA 4MA4A 4OI4A 2VHUA 1DOAA 2B6HA 1GRQA 2FH5B 4DIDA 2QAGC 1RJ9A 1NIJA 1AGRA 4RY2A 4QXAA 1VYUA 4LHWA 2BVNA 4LJ9A 1KKMA 2ZE8A 2V1UA 3LNCA 1M2OB 4HB3A 3R9WA 1A2KC 3ND8A 2ZQ5A 4BFYA 4LK2A 1UAAA 1D2EA 4Q4AB 1XWIA 2ZJAA 4BZXA 3K8YA 1BMFD 1NMYA 3IIMA 4LZZA 4EPTA 1P2VA 2FA9A 4OQFA 3GLFB 4GSYA 4LRWA 1KHTA 2ZSFA 2G0NA 5EQTA 3CPJB 1W44A 2RGBA 3BE4A 4BLOA 3VQTA 1II9A 1E9AA 1KIMA 2EYQA 5G53C 2JLUA 2XNSA 1T4GA 3KQHA 2RGNA 1QF9A 3CX6A 3VHXA 5TXGA 4Q21A 3TW8B 3V4FA 5HZKA 1Z28A 5A5GA 1NLZA 4PPQA 4FCTA 4LHVA 1SGWA 5EXSA 3SQXA 1E79D 2ZR0A 1KKLA 3UWKA 1G9XA 2F1JA 3A8TA 4M9ZA 2NG1A 3M6AA 1KJYA 2BM0A 3KX2A 3RLFA 1ZU4A 3D8BA 1UM8A 1U98A 4GOJA 1FZQA 1G8PA 1E99A 2BMDA 4IDPA 4MGKR 4XTCS 1T5IA 4NTZA 3N5CA 2XX3A 4IVRA 4U00A 1JBKA 3RS4A 1RC8A 2G88A 4JBYA 2REOA 2OE2A 4A4DA 2EFCB 3DOEA 3I73A 4F93B 3I8SA 3ZVMA 1L4YA 1XZQA 3GJ0A 4HDOB 5AUPB 1U0JA 1BS1A 1GRNA 1LF5A 2DWPA 5F9HA 3PUWA 2P65A 2J59A 2QMEA 2ZJZA 5JRJA 1NVVQ 1JJ7A 1XPOA 4LPSA 4D4LA 4AYTA 1DAGA 1XZPA 2ZU6A 1F2UB 4QHTA 2ODBA 1M7BA 2IUSA 3CW2A 4B44A 1FX0B 2BMFA 2J0QA 2ZE5A 4M1KA 2XOKA 2ZRDA 3LW8A 2PT5A 2XITA 4BEBA 4C0HA 3IBGA 1KZGB 1M8PA 2IW3A 3WRYC 1CJVC 2FPLA 3RRZA 3C5CA 3AF3A 3TQFA 2YZ2A 5DN6A 2OEPA 1KI4A 1YZUA 3PG5A 5AJVB 1DS6A 1R7RA 3K9LA 5FL7A 3AVXA 3M1IA 1VYTA 2PEYA 1XXHB 2J5XA 3WRXC 4ZI3A 5J4LA 3I72A 2CE7A 4YXWA 4TYPA 721PA 2FFBA 1QVRA 1YR9A 4D4KA 2IXEA 2O8EB 4TQAA 2HJVA 2V9PA 4GL2A 1E2QA 4LSGA 5GJBA 1NG1A 1E2PA 4ON9A 2ZYTX 2O8DB 3F0TA 2XGJA 2IK8A 1MR3F 1QHGA 4QBFA 5JSZB 1BO6A 1FW6A 3QKSA 4Q01A 3RS7A 5JWOA 4ZIRB 3X1YA 2IS1A 1P7CA 2OAQ1 4BFTA 4CEJB 2JDIA 5C1BA 3MAAC 3LV8A 4US2R 1E2KA 1I4LD 2NGRA 4AKEA 421PA 2VIIA 4WOPA 1W0KD 2O8FA 2JLRA 3BB1A 5DNYB 4C0LA 1Z0FA 3OFND 1OSNA 2NOAA 3AM1A 4LYJA 2C9YA 4ARZA 4QHSA 1P5ZB 3AVYA 4KVAA 2D4HA 1QHNA 3BB4A 2QAGA 2XXAB 4LBZA 3AUXA 2VP0A 4S2EA 1Q1EA 4TL9A 3WP1B 2IS2A 2HEIA 5CM8B 5L3SB 2H92A 4ESVA 1DG3A 1DTSA 4JT4A 2YC4C 4Q48A 3W5JA 4L16A 2E9SA 1AKYA 1UBFA 2VYFA 4NHOA 3JZAA 1W7AA 2GJ9A 5KYKA 4BZPA 3AKYA 4B6EA 3AF4A 2C03A 5FTNA 4DKXA 2BBTA 1QDEA 3PUYA 4JLKA 3SBDA 2PLRA 2BKUA 5CLLA 3EWSA 1KI3A 5KSYA 1G20E 4P4UA 1XD2A 4I81A 1ESMA 3H4MA 3CRQA 2GNOA 3WMGA 1KDRA 5A4JA 4PC3A 4W7SA 2A9KA 3BFXA 3TIFA 1G18A 2A5JA 4M1TA 1Q21A 3VR4A 4MRVA 4CGZA 4A0GA 1VG9B 1F2TB 4TWZA 2F3TA 3IHWA 1T91A 3SOPA 2ZRMA 2O8CB 3GLFA 2R9VA 4PHTA 5EXPA 3DMDA 3VR6A 3ECCA 2KWIA 4Q1AA 4ZKEA 2WJYA 4GT1A 5JJIA 5BQ5A 4LDJA 2W0MA 2AR7A 4PHHA 1YRBA 4KAXA 1SHZA 3EASA 1U8AA 2I3BA 2UZIR 5CYPA 5E95A 5GVSA 1SVOA 1ZNZA 4R2HA 4CEIB 3HPRA 2IXFA 1DAMA 1FTSA 2GCOB 3EA0A 5JI2E 4PZYA 4RSGA 3BD9A 5B2ZA 1E0SA 1M34E 5HTKA 2Z5FA 4Q02A 3CKLA 1CULC 4LWZA 2C8VA 1N3BA 1SHKA 4W9MC 3T35A 1Z0DA 3MJHA 3IGFA 2IYRA 4BFWA 2PX0A 4HZUB 1I2DA 4FINA 5JI3E 3UK6A 4AI6A 3IDQA 3NKVA 1C9KA 4L15A 4KBFA 3KB1A 4OK6A 5TMPA 1D5CA 4B3CA 1GTVA 4MGZR 3BH6A 4JBXA 3IQWA 5KUTA 4I99A 1QZXA 2BIFA 2CLCX 1LFDB 5EZ5A 3MSXA 2ZRAA 1QVAA 1F2UA 4EUNA 1R2QA 1NKSA 1XDBA 3TH5A 1KY3A 4QL3A 2FOLA 1NF3A 1FX0A 1R5BA 3QIAA 2ZUCA 3RABA 3DEFA 3NBYC 5DSZA 5FUWA 1OF1A 2PZFA 1SVKA 3AH8A 2GJSA 4BLPA 5J47A 4M53A 3PCRB 2R6CA 2IYUA 1FP7A 3VKHA 3RRYA 3LX5A 4H9GA 2QRZA 4LJ6A 2R8RA 2G0TA 2MMCA 4AY2A 4AG5A 1XBTA 3PQCA 3A4LA 1XTIA 1VCMA 3I8XA 1XXHA 5L3RA 5L3VA 5DI9A 1ZJ6A 2G77B 2BEKA 4PO9A 4HYYA 2D7DA 3JVVA 1GIAA 4FW9A 4IJMA 5DISB 2JLVA 1ZCAA 1XMIA 4JVSB 2ZS7A 2ZI5A 2B21A 2AWNA 4EQ6B 2O8EA 1G8FA 3K1JA 4Q1FA 2FPMA 1LS6A 1TPZA 1TX4B 1RRGA 2O8DA 1E4YA 1ZRHA 3WMEA 5JSZA 2MSCB 4ZIRA 2J45A 2W58A 4DDWA 5KSZA 2OHFA 4IDOA 4HB0A 3T61A 1AJEA 5KPJA 3X1WA 5CB8A 3QXXA 2ONKA 4Q9LA 1M74A 3D3QA 4Y0AA 1LNZA 1P62B 2CE2X 3I92A 4NCJA 1U90A 1HA3A 4ESHA 1DO2A 1XRJA 3FWYA 2NZ8A 3V9PA 4IOLA 3CZQA 1P2UA 3ZLJA 2LKDA 3TMKA 4PC1A 2GK6A 1WF3A 1P9NA 5LBIA 3B13B 1T9HA 4F4CA 2W6JA 1WE2A 2FFAA 2HF8A 3AF1A 5KDOA 1P61B 3SFZA 2C98A 4PSKA 1FTNA 1JPJA 3TR5A 4PQFA 4LX0A 1JAIA 1XD8A 5L3SA 1RZ3A 2FNAA 2OBNA 1COWA 3UANA 2A7QA 4Z8YA 3WNCA 2JLZA 1OIXA 1UBCA 2GAAA 2PJRA 4L4UA 4D0LB 4DLWA 1NVXQ 1OV4A 2Z43A 3T34A 3ZDQA 2FV8A 2WSSA 3PEUA 4TZ0A 1VMAA 4G5SA 3EARA 2W2XA 4P3YA 1Z0AA 3THXA 2XNDA 4C2UA 3C8UA 2KBFA 3QKRB 5C46F 1G7TA 1SVWA 4JKYA 4M21A 2CJWB 4KHZA 5FTLA 3LBHA 1MRNA 5TDHA 4ABYA 3T5GA 1NVUQ 1F2TA 2VL7A 4L9WA 3I61A 4DLRA 1JNYA 2BMEA 1OYWA 5F2EA 2O8CA 2JAQA 3AKCA 4H1VA 1YR6A 4JJKA 4NP6A 2P6RA 1TQ6A 5LDDC 2WWIA 2JDID 1E2JA 2XZPA 1G7SA 1G8GA 3RS3A 4Q9HA 1XB2A 1DAKA 1NY5A 3MG9A 2JJ2A 4P0TA 1NSFA 5C2JB 1XPUA 2FGKA 4MQBA 1H8HA 2AKYA 3L2OB 4MKGA 3FB4A 2X77A 2IWHA 4KO8A 2P6NA 5H68A 1OKKA 4D2IA 5JEEA 1Z6YA 3X1ZA 2FU5C 4TLEA 3SHFA 2JA1A 2QSYA 1F3OA 1KSGA 3ZZTA 5KU1A 1TQ4A 2ZYVX 1AQYA 1NKTA 1UDXA 5LPNA 4LJ8A 4NE2A 3P1JA 2QAJA 5DGXA 4TYYA 1M7HA 3EXAA 1EFCA 1NN3A 2Q3HA 4HZUA 1E9FA 3GJ3A 3W8RA 1XF9A 4OQXA 4TMXA 4TYQA 2FF7A 3CZPA 3BRWD 3PXGA 4DDTA 2JJ8A 2ZAMA 4D26A 4GZMA 5GJCA 1Q22A 1NMXA 1ZM7A 2HT6A 4I1SA 3O8DA 2DWOA 3ZVLA 2FZLA 4Z8XA 5HCIA 3U3OA 2FJUA 3WNDA 1JR6A 2CVHA 2GCNA 1RYHA 2GF0A 3Q8XB 3BIFA 1N6OA 2BJVA 1TF7A 1E79A 1Z63A 3PENA 2RCNA 2AFIE 2ATXA 1E2HA 1X6VA 2JATA 1KGDA 2IYYA 1W1WA 4C2TA 2ANCA 2DFKB 2KE5A 4RD2A 2GZDA 1UF9A 5E3HA 4Z51A 1N25A 1XCGB 1IXSB 2G1KA 1IOZA 3B6EA 4PPGA 5BWMA 1J2JA 2O0JA 4C9BA 5FBLB 4ACBA 5JCZA 1KSFX 4BLSA 5K8IA 2P0EA 4Q00A 3L0SA 4DDUA 3HJNA 4HAWA 1IM2A 3BB3A 2IYWA 3ZIAD 3LLMA 3F3YA 2QM7A 3GP8A 4UNPA 4EPYA 1Q20A 3LAWA 3SN6A 2H7VA 2GEUA 4EQ6A 3NEYA 1WQ1R 1GKUB 3Q85A 3W6OA 5D3QA 1GL6A 2YYZA 1G64A 2REXB 4G3XA 3VNUA 4TL8A 3BAFA 2FSGA 4DIEA 2GXQA 3LBIA 3VX3A 3DPUA 2P6UA 1GL9B 2VP6A 3KJGA 4RCZA 4FCVA 1E2IA 1J8MF 2NZJA 2BEJA 3WHLA 1GILA 1II0A 2BV3A 4LV6A 4URYR 2WOJA 3UG6A 3J81k 2VTKA 3O8RA 1CF4A 4AC9A 3CRRA 1E2MA 4RFVA 4CEHA 2ZUBA 4HUQA 1IN5A 1KJWA 2GF9A 4II7A 4V02A 4X8OA 1IY1A 5G3ZA 1GNRA 3GLIB 1YQTA 2VHJA 4P4SB 3R9IA 1R6BX 1TTTA 1QG2A 1TMKA 2R6DA 4HB2A 4XWAA 3RWOA 3S1AB 1Z2CA 3ICEA 1G291 1WP9A 3IILA 4NMMA 4HLUC 3SE0A 4DBLC 2BDTA 3RVBA 5C18A 2GCPA 5HR5A 4O25A 2ZAOA 3QBTA 1ZNYA 2NO1A 4A8JB 1E4VA 3N70A 1HY3A 2F55A 3CNLA 4IEIA 4WAUA 3L8ZA 3W3ZB 3FMIA 1YU9A 1U8YA 1AM4D 4U5XA 4HEJA 3SJCA 3ADBA 3P4XA 1D8TA 4B48A 4QGHA 3SDZA 4WZAE 3TUZC 2Z4RA 2ZXUA 4JLVA 1W0KA 5AWFC 4TL6A 2PH1A 1VYVA 3VHLB 3OFNA 3KZ1E 3I5YA 3KDSE 1Q3HA 4RVCA 2QGZA 1HQCA 2R2AA 3C7KA 5KDDA 2P3SA 2IHYA 5KHOC 3QKRA 4QGAA 2D2FA 2Q3FA 4YMVA 1DE0A 2ZUDA 3SJBA 1ZAKA 1BYIA 2CJWA 2HCBA 2ORIA 2RGNC 2CBZA 2GXSA 3AP2A 1ZUNB 4WXPA 3PUVA 2O8BB 1QHYA 3Q9LA 5A0FA 1GITA 1Q1ZA 1IXRC 3A1TA 4DHEA 1F48A 4A8JC 2ZITA 1DO0A 2IYXA 3ZVNA 2E87A 3NG1A 2DY1A 5EXXA 4CRWB 2W83A 3UMRA 5KNCA 2AFHE 4M22A 3ZS8A 3U3KA 1U0HC 2ERYA 4MYTA 4Q1EA 1K5DA 3QXCA 3EC2A 1J8YF 2WVJA 3HU1A 4IXNA 3SYNA 1MH1A 5IK2D 2V55B 3AVPA 2IS6A 3CF0A 1X3SA 4JSYA 3NBZC 4FI3C 2ZSBA 3T06B 1NLFA 4D82A 4BLRA 3KQNA 4PZZA 2ORWA 1E0JA 1NBMA 1OXUA 3L0OA 3QG1A 5FUYA 4NDZA 3KJIA 3QXSA 1AA9A 1SULA 2WIBA 1A7JA 1VKJA 3KKNA 5GADl 1COWD 1NY6A 3GJ8A 4DCSA 5DI3B 1SKYB 1AKEA 1PLJA 1YJ5A 2EFEB 3QKSB 4JLBA 2ZTSA 3FVQA 2Q6TA 2WSSD 3V4RA 5KPDA 2H5EA 1KI7A 3U7FB 4PANA 3VR5A 4PC6A 2ASEA 3B78A 2ZM5A 1F5NA 1YR7A 3MD0A 2IX3A 3UMSA 4JT2A 1G3UA 4KFUA 2X2FA 2F9MA 4V0KA 5SZHB 5AK0A 3AF2A 4QC2A 4CIDA 2XNDD 2ZE6A 3MWLA 4ZDWA 5FPKA 1FP6A 4ARZB 3IO3A 3NWJA 2QPOA 4G0NA 3PR1A 4DUGA 4JLJA 3CONA 4IW3B 4LC0A 2RGCA 1OB2A 1NP6A 4JMPA 4B2IA 2CCKA 1GP2A 2QE7A 4Q7MB 2WHXA 4BASA 1JB1A 1JEDA 3Q72A 1ZU5A 4B2LA 1KDPA 3N2EA 4G5RA 4V0OA 3H86A 1G5RA 4US1R 1H65A 4B76A 2WBLC 2DHRA 1XMVA 2ATVA 4G5GA 4HAZA 5IT5A 1LVGA 4L5BA 3JVUA 2OBMA 3D31A 5J4KA 1KJZA 1H8HD 2QY9A 1CXZA 1XD2B 4B2PA 3NEJA 4IOJA 4LYHA 1E9DA 1OKKD 2PMDA 2ZJOA 3ND9A 2B7BA 2OV2A 3ZJYA 4YMUA 4HLUA 4IDNA 3AVVA 3QI2A 1PVOA 1L7VC 2OCAA 2QZ4A 4LI0A 5DYGA 2IEYA 2A3RA 2NPFA 4C0JA 5CM9C 4LJYA 1BH2A 5FUXA 4ZDJA 2GXUA 3H2YA 1E9EA 3UMFA 2EFHB 3X1XA 3EAQA 3SC3A 2VHQA 3GLGA 1EFUA 4XVQA 1A2BA 1P9WA 3TR0A 1WMSA 4W5JA 4OQNA 3IKJA 3W5IA 3QE0A 1Z0KA 1JQLB 2ZJ5A 3X2SA 2QT0A 5J4HA 1SKQA 2ZS8A 3KQUA 3GLIA 4NH0A 2P5SA 2LCFA 4P4SA 1S96A 2VH5R 2IYSA 4TLCA 1GDDA 1KK0A 2MSEB 4Q4JB 3S1AA 2F7SA 2Q9AA 3QENA 3FYHA 5CIWA 1W2HA 4AYWA 3TUJC 1AIPA 1D9ZA 5EJEA 4TZ6A 2OFOA 3U7HB 4A8JA 2IC5A 4MRPA 4IFBA 5J4YA 2NO6A 2R44A 3MUFA 1OLOA 4MGIR 1EGAA 2WSMA 2BBSA 2ZI4A 1JAHA 4RD3A 5FI1B 5JBQA 2NPIA 3IPYA 3IBYA 1E96A 2NO0A 2FE4A 2OZEA 2PX3A 3W9YA 3VFDA 4BFXA 3KUDA 2IWRA 1GKIA 4EFNA 2ZRPA 1OT3A 2EFGA 2N42A 4A2WA 4XIGS 3EG5A 2OCPA 1OH8A 3LLUA 5JS8A 1DAFA 1SQ5A 4ITRC 2FGJA 4CW7A 5B30A 4DLYA 2O8BA 4P33A 1KAGA 1AK2A 4C0BA 2NQ2C 3KJHA 3P20A 2VF7A 1DG1G 4N0EA 3EPKA 2CDNA 4LV8B 4RD4A 1E98A 1GSIA 1TUIA 1US8A 3DM9B 3SS8A 3CRMA 2JLXA 3AGPA 4JSTA 1IN8A 1FMLA 4H1UA 4YC7A 1O3YA 4JVMA 4M1WA 3CBQA 4LJ5A 2ZR7A 4FN5A 5CB6A 2A78A 4E03A 2VSXA 5H8WA 4PAQA 4XJXA 1KO7A 5FL3A 3G0HA 4BQSA 3GFPA 1S9HA 1XD9A 3KKMA 3E5HA 1XEWX 1ANKA 1M6NA 4J0QA 1NLYA 1NNEA 3MJRA 1CBUA 1E2DA 4DCVA 4GBMA 1B0UA 5JWRA 2XB2A 2PL3A 3W34A 3G82C 4DLTA 1T0JB 4FCWA 4NYIR 2ZANA 5DI3A 3DKVA 3PEYA 4JJZA 4WZBE 3A1VA 4BPBA 2CNWD 2HT1A 1JXOA 1OXXK 3EA5A 4URUR 3TBKA 1U99A 1XJCA 4TT3D 2QP4A 2HDNB 4KFSA 4UXHA 4ZDKA 3UXMA 5IHPA 5FOXA 4YLGA 1D2NA 1KNXA 4MUBA 1KSHA 3MWYW 1P73A 5FOTA 4Q4HB 1TADA 3EC1A 5CLQA 1X86B 4IVPA 4PAMA 1VCOA 5HZHA 3MCAA 1OYYA 3K70D 1U94A 4JZKA 5DHFA 3MWKA 1Z6AA 3SR0A 3VMFA 4UQOA 4KODA 3K09C 2VO1A 3B60A 3U2QA 3NH6A 2QM8A 1BYUA 4RZ3A 3HR8A 3AKDA 3QF4B 3U5ZB 1CTQA 4KITB 2REBA 2C2HA 3GD7A 1EK0A 4A82A 4XVUA 1TU4A 1Q1QA 5KDLA 1SZPA 4MYUA 1R5OA 2BKEA 3LA6A 4POAA 1W4AA 1KO1A 3B1ZA 1V43A 2AXNA 1OFIA 2AXPA 2GBLC 3EZ6A 1Z06A 3SJZA 5JZVA 3THXB 4MDFA 1G8HA 1XMSA 1WCV1 2RGDA 2CK3D 3GJ6A 4NCHA 4ZCLA 3SI7A 3OAAD 1NBMD 4KYIB 2XZOA 1ZW6A 4G01B 1JJVA 3DKPA 2ZRHA 2CHVA 4R98A 3U7EB 2DB3A 1MV5A 2CHQA 2WIAA 5BN5A 1GL7A 4JYCA 1EFRA 4JIMA 3TSZA 1KOFA 4OQMA 3CWZA 3GJ4A 5JJLA 1CJTC 1YZGA 1ZUHA 5KSOA 1V5WA 1N6NA 1CR4A 3W3AA 4C0KA 3LVQE 1YZKA 4TMKA 2NO9A 1ESNA 2WAXA 2HYDA 5DYIA 2WWYA 3ZIAA 3KQLA 1E69A 3GLHB 2KJQA 3NBXX 1P4SA 5DLQC 2ZSAA 2DFTA 3HYTA 1QHSA 3SZRA 4Q4JA 1P75A 2XJ9A 3Q7QA 1PZNA 2V8OA 1SXJD 3NXSA 1KO4A 3FKSD 3OZXA 1LB1B 1EWRA 2J7PD 5EP3A 4IKEA 1SVSA 4DUGD 1EESA 4R7ZA 2DBYA 3U6KA 5AJYA 1XJQA 3HU3A 3NC1C 1HQYE 4AG6A 5M04A 1O87A 2QE7D 1G4AE 1W49A 4UJ3A 2ZRGA 2JJ1D 2VSFA 4UKDA 5FOUA 5JECA 2CEAA 2FEOA 2RH5A 2MSDB 1VDZA 5FI0B 3VU9A 4AIIA 1WBBA 3SJAA 4OYHA 1CLUA 3B1XA 1G3RA 2FFHA 2FDCA 1UDWA 4MUAA 3QSYA 2IYVA 2YWHA 3I3SR 4EDHA 3ZQ6A 1G7RA 4EIWA 4DSNA 2WJGA 4F4IA 1L4UA 2HCJB 1ZNWA 2WJIA 2ZRNA 4TLDA 1AZTA 1UEIA 4KJZA 2OUKA 1DAIA 4NYMR 5EZ6B 4EKDA 3CRVA 3IEVA 1QRAA 3RANA 4RD6A 2YWGA 4TYNA 3LX8A 3IUYA 3UKDA 4CDGA 5TB5A 1W4BA 3THYA 2FMXA 2YC2C 3R20A 3KTAB 1FQJA 2RGEA 4E09A 4WBSA 4LY6A 4DCTA 4PHFA 4MH0R 2GILA 3SU8A 1CR0A 221PA 4ZCMA 3PIRA 4UJ5A 2A5FA 1N5KA 1NBME 5G40A 5EE1A 3V00A 4BGDA 1NN5A 4RD0A 2A5GA 2OFXA 5JWHA 3C4JA 4RKFA 4RZ2A 2CHGA 4HUTA 2A30A 3TVTA 4YMTA 2QGNA 1CIPA 3AB3A 4C3ZA 3BFKA 4ACAA 4Q7JB 2VP9A 2J3EA 4CF7A 4BFVA 4PPNA 5HE9A 3ZZ0A 4CT4B 1P3JA 1XFAA 4TMVA 4JLPA 1DVRA 3FHTA 1GVNB 3K09A 3WMFA 3NIBA 2NO7A 3U6BA 4JS0A 3ZS9A 4R9UC 3WXMA 1JR3A 3R8FA 3EW9A 3M4YA 3TRFA 3GMTA 5HKKD 1SXJE 4C4PA 2IS4A 4D6PA 2Z0MA 4Q19A 1G5PA 4R71A 1J70A 5IK2A 2DFLA 4GRAA 3KKQA 1G8YA 1E9SA 3K9GA 4M9XA 4K81B 2GBLA 4CEHB 4HUQB 3WBJA 2WOOA 4Q4HA 2YHSA 4GNKA 1OB5A 2V7QA 1ZD8A 1C4OA 4N3NA 1NIPA 4WZ6A 3GJXC 2JGNA 2QPTA 1EWQA 4JLMA 2ZU0C 2ECKA 2JASA 1MO6A 3CH5A 2ZRCA 3QF4A 1YVDA 1OFHA 1NN0A 4DLXA 3WYGA 1YHNA 5FUVA 2XSZD 1GZSA 4C0AC 5FPSA 4EJSB 2CLSA 2D2EA 1VCIA 2WJJA 2DR3A 2IYZA 3EWAA 4HI0E 1NVVR 2ZIAA 4KV9A 3NVAA 1KY2A 3EZ9A 1T8UA 1G5TA 3A37A 1F60A 2WWWA 4WVFA 2VSOA 3KXIA 3BBPA 4FMBB 4LJ4A 2QUZA 4JL5A 4NYJQ 2W6ID 1J90A 4QRHA 5AUNB 3GLGE 3A4MA 2WICA 4KFTA 4IRUB 2C9CA 3AKEA 1HTWA 3K70B 2V54A 4YQFA 1UKZA 1SVIA 5EUQB 2YJTD 4QJ3A 3ZZUA 4A36A 2GZHA 1CRPA 2KBEA 3CWQA 4EJSC 3GLIE 3WY9A 2B8TA 1IN7A 2CMKA 5CIQA 4YMWA 1Z2AA 5FPYA 1DARA 2QMUA 2GHIA 3AGQA 2CL0X 3B8HA 3TAUA 4A2QA 2V3CC 2VHTA 3GLHA 5KOYA 5F9FA 3A1SA 3L43A 4UXIA 1E1RD 1MT0A 3I5XA 2C9OA 2WKQA 4QBHA 2TMKA 4MKFA 3T1QA 5JFGA 1XPRA 4AWXA 3FMFA 3R7WB 3OESA 2X1VA 1ODFA 2C96A 2RGXA 3K53A 3O8BA 4PQYA 1AZSC 2AK3A 2X2EA 3O8CA 3A1WA 2QA5A 1OFUX 4IDHA 4TN1A 1OH6A 3SHWA 3SYLA 1XEWY 2QT1A 5FFMA 3K70C 4OK3A 1OJLA 4KYUA 2P2LA 3T1TA 4OQLA 4URWR 1CJUC 3HPQA 5B58C 1IJFA 1G17A 2QG6A 1N6PA 2CXXA 3BXZA 1XNJA 4PSAA 2ANBA 3NC0C 3T1OA 5BYKA 3CX7A 4B6FA 3FKQA 4IDQA 3OEED 4QBGB 5B57C 2DFNA 4DVGA 5JEDA 1FOEB 521PA 1ZINA 3Q5EA 1KK3A 5FOWA 2F1RA 2YWEA 5J4VA 2I1QA 2JIZD 4RZXA 1UBEA 3AUYA 3QQ5A 4MITA 4M1YA 1J7KA 4GP6A 1SXJB 3QEJA 2ODWA 3W6PA 2WWHA 1R0YA 4HAXA 3KTAA 3UWOA 4FIDA 4E07A 1YRAA 1OW3B 3QEOA 1M7GA 3RRNA 1N5IA 1EFRD 4KFRA 1AQUA 3UIEA 1KK2A 1E1QA 3AF0A 1UJ2A 2ZI3A 4U02A 4YDHB 4UNSA 2JEOA 5EP2A 1FPMA 4QM7A 1MKYA 3CIOA 4A9AA 1PJRA 4JLOA 4QJ4A 2OFWA 3IIJA 1EX6A 2FPKA 3ZD7A 1K5GA 1YZTA 4OI0A 1SKYE 2B92A 5UKDA 1PUIA 1SXJC 1Z0IA 2QQ0A 4JLNA 2QP3A 3QPUA 3ZYCA 3P26A 4C0SA 4ZKDA 4Q4LA 3QVVA 1YZQA 1PUJA 3ICQB 4RCYA 2Z6VA 2O0HA 4I4LA 3U44B 3CR8A 2QSZA 1P72A 4MYHA 4ASUD 3FMOB 1OH5A 4AKHA 1UADA 3GLGB 3DZDA 5FBWB 4HAYA 4IFEA 1GNQA 2I4IA 4BUJA 4HDQB 1ZM9A 1NMZA 1XTQA 4NBSA 4KBGA 1G41A 2HLDD 1E2NA 1R0ZA 2VRWA 5FBVB 1NN1A 2BOVA 1ZP6A 1DBSA 3LH5A 1B23P 4DLZA 4A6PA 2A2ZA 3P32A 1YZLA 2OBLA 1U81A 2QENA 4LV5B 5AUOB 3UPUA 4TLBA 2RGAA 3LW7A 4DLUA 2DWQA 2AX4A 4A2PA 4BFZA 5E7JA 3KJEA 4OHWA 1IAQA 2J41A 2CNWA 4EJSA 1W48A 4PC7A 1TEXA 1KNQA 5EP4A 4LPKA 4GMXA 1QBKC 2FEMA 4JL6A 4TT3A 1U8ZA 1HE8B 1QHXA 4C0QC 3W90A 4Q1CA 4GMDA 1FNMA 1NVWQ 2G3YA 3A4NA 2BMJA 5EE3A 2H57A 4QM6A 3LXXA 1KTVA 2C99A 4F4JA 2EQBA 3FE2A 1AS0A 5FTMA 1N6RA 2QQEA 4PC2A 4TTRA 5BN3A 2ZYUX 4MRNA 3BH0A 5AR1A 5LB2A 2ORVA 4GP7A 3THWA 4OJKA 2N46A 3P4YA 1QHHB 3AVQA 1N6LA 2G1JA 4KVGA 3ZGXA 2QEQA 4B43A 1E0KA 3CF2A 3BORA 5TY0A 3E70C 1TF5A 2RB4A 1JR3D 2IXGA 5D3MB 1LV7A 3WNBA 4O0MA 5JLJA 1EXMA 1US8B 5EE5B 1VHTA 2J7KA 3AQ4A 4FMDB 3VKWA 1E0AA 1HEIA 2GK7A 1XTSA 2ZRBA 2ERXA 4KXFB 4UNNA 1WA5A 3R7WA 1KI6A 3QY0A 4Q03A 2ZPTX 3NDBB 1TNDA 2CK3A 2AL7A 3FHOA 1OFTA 4LUCA 1JEEA 3OAAA 2W2TA 3CNOA 3RS2A 2R62A 2V7QD 5FOVA 2J87A 3R8CA 5AJZA 3VAAA 4RFSB 3TE6A 1X8LA 1TU3A 2F1HA 4D25A 1XCMA 4A0RA 3TKLA 2SHKA 3EPLA 1FUKA 2PZGA 1DPFA 3DOFA 4BWYA 3REFA 3BOSA 2OCYC 1E94E 3QKUA 2BWJA 4PPFA 4MYCA 3SNHA 4ZO4A 4JL8A 1JPNA 1KMQA 2GJ8A 2GESA 4N1AA 3DO6A 3PVSA 4M9QA 1T0HB 1UFQA 2QPAA 4GFDA 1KMHB 2VPPA 3OEHD 4DDVA 1ZMXA 2ZI9A 2IL1A 3IO5A 1RYFA 2CCGA 2LWIA 1SXJA 3OE7D 3FKSA 4TL7A 4BRUA 2J7PA 3PUZA 1JECA 1Z6GA 3U61B 2Z4SA 1ONBA 2CCJA 3AP1A 3TW4A 5F3WB 2XTMA 4G1UC 3QNUA 4O2LA 1E3MA 1ZNXA 4WXRA 4Z54A 4BZQA 4Q5IA 2EWVA 1R0WA 4D4JA 2BCGY 1T3LA 2JJ1A 3DMNA 3DDCA 5BXQC 4BFUA 1GOTA 2C5LA 5CK4A 3H0KA 3B5JA 3B82A 1G6OA 4FMCB 4XSHA 3C41J 4LJ7A 1HH4A 5EUMA 2IYLD 3FMPB 2YVUA 3N2IA 3FGNA 3NDPA 4DSUA 3IQXA 2UKDA 2GKSA 4MRSA 1X8KA 4HZIA 3MWJA 5HCNA 5KTYA 1X1SA 2OESA 2HYIC 4LHYA 1Z07A 2L0XA 2EW1A 2GTPA 1KI2A 4NYMQ 1S0UA 3MLEA 4DB4A 2UVQA 2PEZA 1TAGA 1JR3E 1ZC4A 1I2MA 3U44A 1D2MA 4F38A 4EPXA 5BYJA 4B35A 3A6PC 3OHMA 5LB4A 1Z6TA 3QJYA 4MKIA 1E9BA 1H8ED 3RSOA 1Z0JA 1E6CA 4PSVA 4OHXA 5CJ2A 4RZUA 2FWRA 3L82B 4KLNA 1NRJB 3GQBA 1P2SA 1KAOA 2PMKA 4P4TA 5CITA 3K9HA 3U7GA 3FFBA 1R4AA 4NPHA 2WWXA 3LD9A 2CL6X 1OH7A 4G5OA 1W4CA 3SQWA 3EZ2A 1GWNA 4LGMA 1N6KA 4LOAA 4B3FX 1RVDA 3GJ7A 4I1VA 4A0HA 1QG4A 1A82A 1LTQA 1AN0A 4NCKA 4OI2A 1D9XA 3Q3JB 5G41A 3LDAA 5FH9A 1RRPA 5FBRB 2IUTA 4KSBA 2ODEA 4TQ9A 2C78A 5E4FA 2FFQA 2WWFA 3PEVA 5BW8A 2ZYWX 5HKKA 3NHAA 5CK5A 2OO7A 2RMKA 1E1QD 3PITA 3ONWA 4TSFA 2Y8EA 1FFHA 3VU9B 2ZRKA 3QUSA 3RYTC 1C1YA 4HLCA 3VR1A 5C4MA 1HYQA 2FSFA 4PO8A 3LVRE 1ZIPA 2W2VA 2WKRA 4FXPA 3IPXA 4N0DA 4DSTA 1RKBA 4I1OA 1ZVQA 1X1RA 5J40A 1S1CA 4P31A 3SYKA 1VHLA 2BHRA 1R10A 1P2TA 1QHHA 1TL7C 4EPRA 2ZVPX 2WMOB 5EXTA 4F92B 2V6IA 3T1VA 3K0CA 3GLHE 3THYB 4Q18A 2YWFA 2CL7X 1W47A 2XSZA 3E2IA 5D3MA 4RJLA 3CNNA 4UNRA 3AV0B 2X8AA 2ZRJA 1CKEA 2VQSA 2Q21A 4ZPXA 4L9SA 1RFLA 3BJIC 2QMOA 4XD7D 2ZJBA 1MRSA 2W6IA 1W4RA 5GJVC 4YONB 2PCLA 1EG7A 3CRW1 5G3YA 4RFSA 2VLIA 2KI5A 1GG2A 4B74A 1PLLA 1Y3AA 2EVWX 1S1MA 1XJ0A 3C5HA 3A36A 1IN4A 1IY2A 2R6AA 2GZAA 4M1SA 4DCUA 4AKIA 2AHOA 1GAJA 1VPLA 4IHQA 1CR2A 3B1VA 1N0VC 8OHMA 1UKEA 2R65A 3H1TA 4W5HA 3QOFA 4PQRA 2QBYA 1XP8A 2Q3MA 121PA 2B7CA 3TVDA 1AS2A 4B3XA 1KMHA 1E1RA 1Q3TA 4V0NA 1XEXB 3CLVA 2VBCA 2DCUA 1MO5A 2VP5A 1DADA 5TVKA 1J99A 4PFSA 1GNPA 2IF2A 5GVRA 1NL3A 1XU4A 2QU8A 1GUAA 2ZS9A 4HLQB 4ZDIA 2J46A 2VHCA 2B8WA 2WTUA 5AJWA 1N0UA 1TEVA 5CDFA 2XTNA 4GOKA 3EIHA 1KK1A 1I4TD 1N5JA 4NONA 1JXMA 5SZJA 2GJKA 3BWDD 3C14C 4DLSA 4TYWA 1K8RA 5KNDA 2J0VA 3TQCA 3OEEA 5L8VA 1ZUIA 4JYBA 2I1VB 1GFIA 5KSPA 4BLTA 2P5TB 1Q12A 2KSQA 2UZ3A 3L0IB 1SVLA 2H18A 1MABB 3RC8A 1Z8FA 4XTRA 4TQUS 4B73A 5HPYB 1UKVY 3QPWA 2JIZA 2P67A 3IIKA 3KQKA 3T5DA 2GXAA 4MDEA 1A1VA 4KLZA 1L8QA 1YE8A 2BBWA 3E1SA 1YR8A 2PBRA 3KB2A 1XTRA 4G5QA 2C04A 4QGGA 3FFAA 4KU4A 4OHYA 2ZI6A 4JLAA 1IHUA 3GPLA 4ZI2A 5C4GB 3IHLA 2PZEA 3BGWA 2HJGA 1RPZA 3OIYA 2ZI7A 4NL4H 3L0PA 1S8FA 3K0EA 3EX7C 3MGCA 3L8YA 1MOZA 4LJAA 4B75A 2GA8A 2IT1A 3QKTA 4MRRA 2PT7A 1G16A 1VIYA 1W0JD 5KO2A 2V1XA 2QTHA 4GOXA 5IDVA 1ZIOA 4Q4AA 1HURA 3OF5A 4ZCIA 4HDCA 3SFVA 3LRPA 3HDTA 4LYFA 3LQRA 5FTJA 4E22A 2IYTA 3AVOA 5FBQB 1VG8A 4IEEA 4Z1MD 3HWSA 1NJGA 3KKOA 2O0KA 2EU8A 3I4LA 2GJAA 2OT3B 2XB4A 2F9LA 1ZM4A 2D74A 4ASUA 2IEZA 3CPEA 2HXSA 4BE7B 1E9CA 1W46A 1Z3IX 3R9XA 2H8KA 2H17A 1ZYUA 3ZH9B 3VR2A 3CM0A 2FZ4A 4NKRA 2OAP1 2G9NA 4LC1A 5K8TA 1XCPA 4M4SA 2WPDD 5JRZA 2WV9A 2XTZA 1XTJA 2HLDA 1KI8A 2ZR9A 1Z5ZA 4M8NE 5EE0A 5F98A 1S2MA 5DE3A 4DJTA 2NMVA 4QOSA 2D3WA 4P32A 2G6BA 3GEHA 1TQDA 3AP3A 4D81A 4OHZA 2H1LA 2Q9BA 1E2LA 2JLWA 4KCGA 1RW4A 1OPXA 1GKYA 3ASYA 3GEEA 2QROA 1IXZA 2W00A 5FOSA 1IBRA 4PAOA 1OXSC 3BH7A 3QBVA 2K5UA 3DL0A 4TTQA 3FHCB 1VIAA 3CF6R 2XEXA 1VTKA 3I62A 2IF0A 2A5DA 2IBMA 2RGGA 2WJVA 2ZRFA 4A1FA 2FSIA 4EAQA 3HYRA 1Z08A 2DYKA 3PFIA 1Q44A 1RRFA 4DT1B 4B71A 1IONA 3ADKA 4KI0A 4X8MA 4JVLA 3LQQA 3T15A 4XH9B 1VCNA 3GFTA 4EFMA 2YOFA 4GDFA 4V0ME 4UNQA 1W36D 4AKGA 4QGFA 3GJ5A 1TQ2A 5H1YA 3Q7PA 4U7DA 4OHVA 3VNVA 1KO8A 4HSEA 2QRNA 5JCPA 4IXMA 1IN6A 2WAYA 1A4RA 4A6XA 1HT1E 5B64A 2J1LA 4Q66C 821PA 2ZETA 3OIWA 1EFHA 1CP2A 2F43B 4JVNA 3TJZA 5L3QB 4ERNA 3JZMA 2C95A 1QHIA 4Q7LA 4BLQA 3U60B 4TSFD 1PLKA 3PV0A 1R8SA 1NI3A 3LXRA 5GJWC 3K0FB 1XEXA 4AURA 2XJ4A 3KUCA 3F8TA 4URZR 3BS4A 4QJ5A 1DAEA 2OG2A 2R6GA 5AJXA 3ZQJA 4URVR 1TUEA 1Q57A 2OILA 4D0NA 4CEJA 4B3BA 3M0EA 2ZREA 3OIUA 1NG9A 3BERA 2NIPA 5E7MA 3HR7A 3UG7A 1R0XA 2AKAB 2AK2A 4LBWA 1E2FA
chains in the Genus database with same CATH superfamily
2FW8A 3Q15C 1MMFB 1FNSA 2GDJA 2ZIXB 1T1EA 2AZ4A 2GQ0A 3IJPA 4AK9A 4ZOCA 1R0SA 1L7RA 3P27A 4K2AA 2AWOA 3PYLA 3RVJA 3PHBE 1QXSA 4KMOA 5CXXA 4ZZIA 1W2WB 1XMJA 1RM5A 4XYLA 4Z4CA 4NE7A 4UC0A 2YXNA 4TMZA 1IPHA 1A9YA 3E3AA 3FTQA 1W5SA 4PHGA 2IH2A 3I1FA 3OBIA 1UBGA 4ENPA 4HVTA 2DU8A 4YAGA 2VP2A 1JHZA 2ZSDA 2IUUA 3WBKA 2GAFA 1CB0A 3GBVA 3C3JA 3ZY5A 1HUQA 4PYLA 3UH0A 4ARUA 2VDNB 5JU6A 4RU1A 3TXAA 3IUSA 5CYOA 5BV2P 3AG5A 1LNQA 3OPXA 1KDTA 4V03A 1K6JA 1U0TA 4LXIA 3RRMA 4ALJA 1G19A 2O52A 4Q9KA 3FOFC 1WWKA 4B9AA 1M2FA 1YA6A 4E5PA 5C7YA 4HD8A 1V11B 2GCIA 5AHRA 5CBPA 5DN6D 1EX7A 3COZA 1M34B 1EUDB 2R6FA 5ENZA 3T94A 4DSOA 1EXVA 1V41E 5CB4A 3I32A 4XVRA 2PXAA 3GLUA 3WGVA 1FNDA 1UKAA 2N1BA 3AEZA 1L1EA 3FIUA 4J1NA 4C6RA 2A94A 2D06A 3R5JA 3AFIA 4HF7A 2X4LA 3GVCA 4FGZA 5IX8A 1V1RA 2UUPA 1WVGA 3JQ9A 4W1QA 3RUFA 2I6GA 1FYEA 1B3RA 4MV3A 1OXMA 1B26A 5BN4B 2QQGA 4B87A 2DKOA 1M5TA 1JDBB 2ZJ7A 2OLKA 3QG5A 4U39A 3WLPA 2W11A 2O07A 1YACA 1EVZA 3JYHA 4D4MA 1N6IA 1E3SA 1R8QA 2VDKB 1FC0A 5CB4B 4K3VA 4M0UA 1DC4A 1KO5A 4GI3A 4AJPA 2GD0A 1RE0A 1DGQA 3GJRA 5FWYA 4XR9A 3CN9A 1X8XA 2ES4A 1BGVA 1S01A 3OFKA 3UOGA 2Z83A 1T9GS 3QTLA 5D6OA 2CUZA 3H9GA 1YB4A 2ZIZA 3PEWA 4CG2A 3TXYA 4U7HA 5AESA 1N8NA 3WGGA 3WIBA 4RZQA 2Z30A 4CEIA 2RGYA 4JEIA 1XVVA 4LXTA 3MUEA 5DRYA 1PL6A 2GCOA 3PR3A 4AAYA 4DCJA 1M66A 3QVSA 3OQ6A 2YMLA 1JDBC 3IQFA 1OGYA 2GYVA 3I0ZA 4QLAA 4UM9D 1X8JA 4X7BA 4XW2A 5D1HA 3WP0A 3GLSA 3PHIA 2HLPA 2E3JA 3KAJA 1FDIA 2KB0A 3FJ1A 3H3XA 4TV8F 4A15A 1JFTA 1BH6A 4DR4B 4P5PA 3GK3A 5DCWA 2RK6A 4MQFA 2GH1A 1ZRNA 2O1WA 1T1SA 3VO9A 4ZCPA 1OIWA 1VE6A 2V0NA 4BS9A 4RTLA 2X0IA 2LPMA 1UH5A 2C7GA 1W6RA 2RK3A 2NUBA 3AFMA 1II8B 2OXCA 4KMRA 4B33A 1QQ5A 1DXYA 4ZYWA 3CPHA 3L5OA 1KEEB 1M2VB 1Z29A 4QUAA 4BC0A 4BU0A 5HWSA 5ICGA 3D4OA 1BWQA 3ZX5A 4UUMA 3OWOA 2PQ2A 3C15C 5FNVB 2HMUA 1PV4A 1ZD1A 1ZGBA 3JWPA 3EZYA 3BPSA 3VM6A 3RFUA 2YHIA 2RKOA 2YOHA 3DD1A 3MIZA 4TSRA 3V1MA 4BEJA 4GXTA 1UL1X 2CKMA 3ZDRA 3DC7A 3QF7A 3VR4D 4EA7A 5LDHA 4PCVA 4XX1A 2E1RA 2JAOA 3F71A 1QAOA 1Z22A 2PKQP 2R48A 1RRVA 2YVAA 4D4IA 1KP3A 1EDEA 1TE2A 3F1KA 2H51A 3AVUA 4H08A 1MTZA 2B61A 3RM3A 4N47A 3GYGA 1A27A 2GZSA 3ZD6A 3O74A 4IICA 3WHKA 2RHMA 2JIDA 2Z98A 1GRCA 3GN1A 4RTNA 5JD4A 3PD0A 5I48A 5AKLA 4QTTB 1JSXA 7ADHA 5JAZA 2V6JA 3U4IA 4FEGA 2XCQA 3JWHA 5HX7A 4EFLA 1WTCA 1MU0A 4MAMA 3IB6A 4YMIA 5ABPA 1BMTA 4QKQA 1XYGA 4L4XA 1MO3A 3F7MA 3W5VA 2JVKA 3EQ6A 1BOFA 1RJ9B 1WSBA 2A59A 1DEKA 2W9XA 3TLMA 1FL9A 1U9IC 2LBPA 2QN6A 2SKEA 3A6ZA 5TMBA 4J16C 3UV3A 2P6OA 2RHTA 1P60A 2WJHA 2ACWA 4OHCA 1HE1C 5DEIA 5FPTA 1XROA 1WDTA 3TX2A 3NPAA 3EXFA 4BMXA 2UYYA 4LXXA 3WV4A 3RK4A 2GVZC 2YW9A 2XXAA 4IXDA 3R7BA 3H9QA 3K1TA 1R8JA 1ECPA 2YBEA 2GPBA 4PFQA 1Y1KE 3LL7A 3NH9A 1TZBA 1UXHA 2RHDA 5B55A 4WLUA 4DIFA 2CD7A 1QOQB 3N3BC 4KGZA 1XRNA 5DBGA 4DA0A 1P5HA 2GD1O 1GUBA 5AI0A 4JUAA 5G4LA 1BDBA 3O4HA 4Q93A 3V7NA 3VR3A 4S35A 1L8OA 1KOGA 4AFNA 2RAPA 3TQSA 3HA2A 2YOGA 3L7JA 1YD7A 3GCWA 4OGLA 2I4TA 2ZTMA 2XE6A 3T5CA 1USKA 3B1WA 1MW9X 3ZCUA 3EEOA 2HH9A 3AUTA 4N6OA 1V2HE 4MIEA 4DCNA 1LTHR 4BX8A 2C3YA 4XLLA 1Z5UA 2GYWA 1GKKA 3N8NA 2VEDA 3QWFA 4KSYA 3UWMA 5C4IA 1WUKS 2BGIA 3QEAZ 1QOZA 5C34B 4PX9A 1GTL1 2IU4A 2QI9C 5JZBA 3SYTA 2V0CA 4N18A 3TLXA 3M3HA 3OM8A 4MVJH 3H7IA 3ADPA 1FUYB 3C87A 3GP3A 3QJ5A 4PW0A 5LQSA 1F9AA 4AU1A 1V11A 1TK3A 3Q2KA 5SZIA 1M34A 1EUDA 3TLAA 2PVCA 1EFTA 2JL1A 3VXKA 2OL4A 2XBUA 3GCGA 4D80A 2ZRLA 5CHYA 1AMNA 1GM5A 4WXMA 4DE5A 5JZSA 2IHBA 3ORRA 1JZQA 1N3LA 3GJYA 2PQ0A 1NU6A 5FYDA 2CFSA 3JVDA 4CZ2A 1U2RA 4EBFA 2G1UA 3PBKA 3TSWA 1G5FA 2VZEA 3CZAA 3FUVA 1N8TA 3AW8A 2IIQA 3H99A 3PP8A 1SUWA 5ALUA 2JBAB 5BN4A 2GHQA 4CMGA 2PYDA 3GLFE 1WRBA 1HNZB 4N9QA 2HTEA 1QDUA 4XARA 3F46A 4GPTA 4NV3A 3LVBA 1ONOA 4X6YA 4O4HF 3JX9A 1YQDA 3CR7A 5DIFA 3RC2A 1Q0UA 2NLOA 3NTUA 5GPBA 3WYAA 4LSMA 4TT8A 1KPGA 5U4QA 1NW5A 3OPNA 1EUZA 3NHYA 1E32A 1S4QA 4RXMA 2HUPA 4TM8A 1JWBB 5EZYF 4EL5A 3IELA 1F6BA 621PA 3A2KA 2NTJA 3DE6X 4DXAA 5LIPA 1ZSNA 4FDMA 2UUCB 1Z7EA 4QTXA 5E7QA 5LCXA 5ADUS 2JKVA 1IUNA 3ACBA 1CQPA 3L07A 4JEMA 3GJSA 5BY2A 1HKUA 1Y3CE 3KM0A 1OWNA 4L50A 2JCBA 1T3HA 1OIVA 1MAWA 2C57A 3A9CA 4MR7B 3DHWC 3EH2A 1TJYA 3CLRD 3I6BA 1CZHA 4DQ0A 5KNBA 3TD9A 3G7UA 2W6JD 3DBVO 4P38A 1NXWA 2FHSA 4EJFA 2B4AA 1H4TA 2LZ0A 1FMFA 3I3OA 5E1OA 4CU2A 4QFMA 4RD1A 2HV8A 4FQ8A 1Y1LA 3C1OA 3V7FA 3G88A 4LBVA 3S5JA 4DDHA 3HCFA 3X2FA 1LGYA 2ZUWA 2D2VA 2VKTA 4ZO8A 4Z1MA 3KIPA 3WHPA 3A25A 1BDIA 3HGQA 1DMSA 1G3QA 4J49A 5ALPA 3D1LA 3GUZA 2GVDC 3EIOA 2XNJA 4ETIA 3IBSA 1II8A 3U3JA 3E5NA 5K0EA 1XQ9A 3OOHA 5FLEX 3N8HA 3T12A 4C43A 2G1PA 4NZYA 3HXLA 1QM5A 1M2VA 4MV0A 4Q9AA 2O2IA 1KEEA 2IUYA 4CG0A 3B2EA 4Y98A 1KI9A 5FNVA 2O8FB 1SCKA 3ZVRA 2H29A 1K4KA 4CYMA 4EY3A 3G17A 4AZ3A 1K7CA 3HB9A 3VX4A 1GNVA 2W8ZA 3PX7A 5K8UA 4G0PA 4BVJA 1VG0B 2KLHA 4XDHA 3VRHA 2QAGB 3LFUA 5FFFA 2Q29A 3QFSA 1WUHS 1U9IA 3ROKA 1GNSA 3HJGA 4J1TC 4UM9B 3FOAA 4J16A 4KQEA 3R7DA 3W05A 4IV0A 4ESOA 2YYSA 3M9WA 4LRUA 3WGLA 1RIFA 2I80A 3PHHA 2XUDA 1FU8A 3Q6IA 2P2GA 3LDHA 4QYIB 3NBAA 2PH5A 2Y1OA 3FPHA 3PQ7A 4C3VA 3CH4B 3R6TA 2HZ7A 2DKNA 1NR5A 1Z5VA 2PRZA 2GHTA 1UKYA 1QIGA 2IY9A 4GMFA 9LDTA 3X1ZA 1DP4A 5KPDA 2XAUA 1C3VA 4FWIB 4RIEA 2JLSA 4M9SA 3EF0A 1Y1RA 1K7XB 4MA4A 2VHUA 4GYKA 5AHKA 3WL3A 2W4QA 2GD6A 1CUWA 2QAGC 1RJ9A 2R47A 4UTOA 1QX4A 2IKSA 3KQTA 4RY2A 1ZL2A 1Y0BA 3IB3A 4LJ9A 2H1WA 1U9CA 3L4SO 3C3EA 3ND8A 2ZQ5A 4RDCA 4LK2A 1ZZEA 3VDRA 3PRKE 4ZFNA 3DR3A 4YMVA 4N5MA 2HWUA 3Q8KA 4A0QA 1A5SB 1NMYA 5EIOA 5AW0A 4TLLB 4TTSA 4D0SA 1G55A 3L0ZA 3R77A 3GLFB 1BMDA 4LRWA 1KHTA 1JG1A 1HL3A 4NV1A 4O2BF 2GR9A 1W76A 5EQTA 2CUTA 2X0RA 1SOAA 2EKDA 2XUJA 3BE4A 1KC1A 5BQPA 1M5RA 4Z49A 4HDRB 3CXRA 1LX6A 3ND5A 3HKDB 3O7WA 2XNSA 2PDAA 1MBZA 2OXTA 3UHFA 3VGJA 3HJHA 1M2NA 4Q21A 3V4FA 2ST1A 2GPSA 5A5GA 1NLZA 4LHVA 2W6OA 1SGWA 3IUMA 2D5IA 4PCLA 1MDBA 3UOWA 4Z4FA 2RH4A 3AJ9A 4JP1A 4MQLA 2NG1A 4JWKA 4PCUA 4OX9Y 1KZ9A 3JR7A 2QRMA 1NW6A 4CM5A 3IOYA 1F6WA 2EF0A 2GPWA 2PVPA 3KSUA 4MVJP 6PFKA 1GYPA 4COOA 1DFHA 2XA2A 4EW3A 3JU3A 3K20A 4U00A 2ILTA 2OGZA 3E9CA 2XCLA 5IXJA 2E49A 2REOA 2Y1CA 3JSXA 2QLBA 3N7AA 2EFCB 2E6UX 2X8JB 3F78A 4E1AA 5IDWA 1L4YA 4I2NA 3GJ0A 3E81A 4YCLA 5AXDA 1GRNA 2JJQA 4K5QA 2BFWA 2FDRA 3PUWA 4YJ3B 2P65A 5TEWA 3RBXA 5ICSA 5F9HA 2QMEA 5JWOA 1JU4A 3LKZA 5JRJA 2FN3A 2JBAA 3ABOB 1O77A 3LCUA 3N6XA 4HQFA 3RU3A 1XPOA 1QKKA 1VP3A 4HVAA 5FUBA 4ZZ3A 1XZPA 1GT6A 3ENVA 1QQTA 2Y0DA 2ZB3A 4HNHA 3T7JA 2IHUA 4AKSA 3RYCB 1YO6A 4DV3B 1JRLA 2B1JA 2BMFA 2V03A 2NZVG 3LW8A 4IDCA 2C59A 5ADWA 1CQIA 3WIEA 4BEBA 2HBZA 3IBGA 1FFSA 5HQJA 4XM2A 2M32A 3PIIA 4IYRA 3VYUB 4EKYA 1CJVC 2I66A 4J75A 4BJ5A 3C3YA 3H9CA 3AF3A 3TQFA 2YZ2A 5K05A 5DN6A 2WA2A 2OEPA 1KI4A 3I8OA 5EUBA 1EWKA 1OXKB 4MUNA 3EMDA 4S1VA 4WCDA 4N8SA 5AJVB 5CIYA 3K9LA 3KU4A 2JF0A 1KGSA 4IIXA 4MR7A 3AVXA 1ZICA 3M1IA 3BIOA 1UXKA 2PEYA 3HP4A 2AHRA 2NAFA 3G9QA 1SWWA 2PLNA 3RR2A 3WRXC 4H0FA 3M4XA 5AD1A 2PQ6A 2ZYSA 2A4KA 2D0DA 3GRUA 5AVKA 721PA 2FFBA 1QE3A 2OZLB 3AETB 2HIMA 2WU1A 3GRRA 3N75A 4HWKA 4RIHA 1VL5A 4J1TA 2V9PA 4CMKA 1XRMA 4GVPA 1R6VA 3RUAA 1NG1A 4ON9A 3R3VA 1JA0A 2QK4A 3F0TA 5NULA 5JROA 3HYLA 4KH1A 1FW6A 3DW3X 4F5WA 3PL5A 2VRBA 2FN9A 4UBOA 4Y9UA 4CLXA 3DLCA 2JBWA 1HFJA 3KZKA 1GTRA 3QU5A 2Q3JA 1DHTA 1I4LD 2NGRA 2FWJA 5EJGA 4DV2B 421PA 4CMIB 1BNCA 1SOMA 2O8FA 1GZUA 2JLRA 2NSLA 5DNYB 2HRBA 2Q5OA 2XWPA 2NOAA 3OFND 4C0LA 1MTOA 3E61A 5KMGA 2IELA 4G8CA 4CTOA 1RAGA 4CKYA 3D6HA 4MHOA 1MFPA 1QHNA 2QAGA 3A2MA 3BB4A 3BHNA 3JD4A 2QTMA 3PR2B 3OOYA 4LBZA 3LLSA 3AUXA 1RU3A 2CV2A 2IIVA 3RBZA 3UUWA 1ULSA 3MIIA 1TRKA 1Z5WA 2IS2A 2H92A 2C2MA 1V6AA 1DTSA 5CCEA 5DNAA 4JLUA 2VDWB 1C7FA 1HK7A 4QYIA 1CHNA 4FILA 3EXIB 4Q05A 2VYFA 1UBFA 2J48A 4H18A 3GEMA 3LHIA 2GJ9A 3WK4A 1W7AA 1OZGA 3E9RA 2P3QA 3OZIA 4WH0A 5HBGA 3AF4A 4C5AA 4OOFA 4P80A 1QDEA 2F2TA 4JLKA 5TQ0B 4KR3A 1QQ6A 3DHNA 4X91A 3K9QO 4MQ4A 1VSQA 1RWBA 4NG5A 1ODKA 5AJUA 3E35A 2NZWA 1L8LA 3OOWA 5F1OA 5B7NA 4I81A 3CLRC 4NCBA 3WO1A 1MNAA 3H4MA 2GNOA 4JUIA 5EJAA 2PUHA 3I6QA 4PC3A 5F78A 1PG5A 2QTTA 2A9KA 4KXVA 5SYMA 2X23A 1BN6A 5AQEA 4AWAA 3VV2A 4R40A 5F2KA 2EQ5A 2PUCA 1Q21A 4U9UA 3VR4A 5HS4A 5LUAA 4CGZA 4IIFA 1LPPA 3FTPA 1NVGA 1VG9B 1F2TB 4WA8A 4Z9BA 4F2GA 2CL5A 2F3TA 1JXQA 3GHHA 1ZGCA 3PIDA 2ZBFA 3N6VA 4G36A 3GLFA 3OSZA 5KJCA 4JH0A 1D03A 3H1EA 2KWIA 3NNSA 1G8KA 4JIGA 1N0IA 4LDJA 3O92A 3NNDA 4QEDA 1FSPA 5BR8B 5BMVF 5JXWA 1YRBA 2GNPA 1I51A 4HDRA 1SHZA 3O4VA 4KAXA 3HKDA 3N86A 4W8OA 4XZ3A 1KBZA 1U8AA 2DFPA 2Y0BA 5E95A 4EHFA 1ZNZA 3CVVA 4IS3A 4R2HA 4ZOLF 1E66A 1DTEA 3K6JA 2HDHA 4GXRA 1DAMA 5JI2E 2JFZA 1NVDA 3JTEA 3GR6A 5IUJC 4PZYA 2Q2WA 1ZUWA 2YZMA 4KJXA 2P77A 2DHDA 5F4BA 2IEIA 3BTUA 1YDWA 4X63A 4R7GA 1BDJA 2WSIA 3PDCA 2C8VA 1EUQA 4MUFA 3OTIA 3QYJA 4JX9A 1B8NA 2CB0A 3MJHA 4I4TF 2IYRA 2DTDA 4RK7A 4A27A 4FINA 3OTWA 2IEDA 4AI6A 3NKVA 2L18A 4TTVA 2ZYGA 2X8JA 4CMAA 3SQMA 3R5SA 1MAHA 3O7MA 4IRXA 1D5CA 1QCCA 1GTVA 4MGZR 4JBXA 5IANA 4FR5A 2WVGA 1BFDA 1H4QA 5L4SA 3AI3A 3KKLA 3KWLA 1AN9A 3WRXA 4Q9NA 3KHUA 2PFSA 3GT4A 5IBCA 5EZ5A 4B4WA 1EBBA 3MSXA 2D8MA 4ZQHA 4NARA 4RK6A 4UNIA 3RYCA 2AZXA 1NKSA 2VAMA 2ZT8A 3LX6A 4QL3A 3CUYA 2IVFA 3ER6A 3RTBA 5ITZB 1XZDA 1EP1B 5CVVA 3W8EA 5IVPA 3QIAA 2I9KA 1H22A 5I47A 2QX6A 1RQNA 5DSZA 1GFZA 5C7IO 1TRHA 3AH8A 4RAOA 1PS9A 3OKCA 4M53A 3TGWA 4KHPB 3WV5A 2IFTA 1RYYA 5M34A 1FP7A 5JD3A 4CR8A 2HO5A 5I51A 4J91A 2EL7A 1IEVA 1TPYA 2QRZA 2R8RA 4QPJC 3WGJA 9LDBA 5ALZA 2MMCA 3PQCA 1MVOA 5IXSA 1PSWA 3W6ZA 4ZJZA 3WYDA 3QJGA 4A73A 1JWLA 4J43A 4DWVA 1LBTA 3D5TA 4GDMA 2G77B 4ARVA 2Z1MA 1DCFA 3BIJA 4C4SA 3JVVA 4Q82A 5DISB 2HA3A 4AF7A 3AETA 2OZLA 4PZPA 1ULZA 9MHTA 1KH2A 1XMIA 4JVSB 4ZV7A 2ZI5A 2HA4A 2HK6A 3HKEB 5EIAA 4BO3A 1G8FA 4ZO7A 4Q1FA 5AXAA 4OF4A 1LS6A 1TPZA 1RRGA 2ZIVB 1ZJZA 4JJ8A 3G2LA 3B3JA 2Q4DA 2J45A 4DDWA 3T61A 3QBJA 2XUGA 2F8SA 2PL5A 1PG2A 2G09A 2OC4A 5TMDA 3LBYA 2P9CA 1P62B 2AJTA 2CE2X 1U90A 3LG2A 3TZLA 4CMIA 3LWBA 3VBEA 1YONA 4EO7A 1CRLA 3B8EA 2Q7DA 4L4RA 1RRMA 3CZQA 3KLBA 1MFZA 4Z86A 3TBFA 3T99A 2LKDA 2ZATA 4W82A 3TMKA 5K6RA 3EZNA 5K8CA 5BOVA 3MLAA 1P9NA 2X40A 2W6JA 4MV9A 1GAQA 1W87A 2BMWA 2GEKA 1MAUA 1VBKA 2I7CA 3IAAA 3CVXA 3FZNA 1YDGA 2FPSA 4ZT2A 3LUPA 2L19A 3BTVA 3L05A 2CYCA 3RBAA 1PG0A 4ZQEA 3CUUA 3E9YA 2IBSA 4BIIA 1CQWA 1COWA 2VDWA 1C30B 1CSEE 3GZJA 4BVEA 1GYQA 1UBCA 3EXIA 4C2BA 2EC5A 3HBMA 3SYRA 2O5EA 4D0LB 3MJVA 2D13A 1SCAA 2IPOA 3ZU3A 1N92A 1SIWA 4PYIA 4C88A 1OWPA 4TZ0A 1Y7IA 3AF5A 2GJ4A 1VMAA 3HBLA 2BGWA 3KBBA 5TQ0A 3KRTA 5AI5A 3HP7A 4AP5A 4MRAA 1Q3KA 2J31A 3H5LA 1NA5A 4G5SA 1Q7CA 2X0KA 3DDUA 3EARA 3U81A 3VH3A 4FHEA 3L1IA 3FWKA 4NCXA 4QELA 4CQNA 4P3YA 1WKBA 5HIAA 1FUIA 1Z0AA 1O08A 3A9WA 2XNDA 4UE2A 5K0FA 4C2UA 2EL9A 3BG5A 4HXYA 2FY8A 1ONNA 5C46F 5G0VA 4MMXB 2QMZA 2YMMA 2Y9MB 4H35A 4X45A 2HRQA 4IIVA 5BSTA 1MRNA 3QHAA 3U1VA 1EDZA 1NXTA 4IGKA 3T5GA 1NVUQ 1F2TA 2GAJA 4L9WA 3I61A 3AUUA 2B5VA 3A3YA 4GVXA 4KK3A 2VJOA 4FR0A 4OP3A 5F2EA 5LMCA 1S2NA 2JAQA 5K7SA 4RDXA 1GZDA 1W75A 2XRYA 4JJKA 4ZICA 4NP6A 4PYJA 3NTVA 3AY0A 1U63A 4QUEA 1TQ6A 1BJRE 1P44A 2RHJA 1EFVB 2XZPA 1G7SA 4FX2A 4BWFB 1B15A 4ICIA 3VV3A 1UQTA 4Q9HA 1L8AA 3DQQA 1NY5A 2H5LA 4ZVUA 1L1FA 1KEZA 1IB6A 4OAQA 5IDYA 5C2JB 5L4NA 1GTSA 2NP7A 3I9JA 5I5GA 3EISA 3KSAC 5TC4A 1C3JA 1N5DA 1IVSA 1LK5A 1R6TA 3VSEA 5AJHA 8ADHA 1NXXA 1WUIS 4KO8A 2I8CA 3PEFA 3CJTA 4L9RA 2BZ0A 3RFCA 3SKVA 4D2IA 5CG2A 5KOJB 2JCXA 1QRTA 3WGIA 3SHFA 4BY9E 2G9QA 1RJDA 2C1ZA 4J4HA 4UUAA 1CW2B 5T64A 4CM3A 4D43A 2QTRA 3A9RA 4BE4A 4HO1X 3JQGB 5DX0A 1NKTA 3WDLA 4F3YA 5LPNA 5ECGC 3P1JA 2QAJA 5DGXA 1EFCA 4ZYXA 1E9FA 1HDCA 1MQ9A 3W8RA 4IZ6A 3N9IA 1XF9A 2LUOA 4UBMA 2XT9A 4TMXA 5F3RA 4FDLA 4LE0A 4PG7A 4N40A 2VG8A 2JJ8A 3WLOA 3NAMA 4NJEB 2HAEA 3LOPA 4UULA 3I58A 3Q3HA 4ZK2A 1TM1E 2DWOA 3SSNA 4KKXB 3U3OA 2CW5A 4C03A 5AVVA 3L77A 3FLBA 3WNDA 5ARBA 1JR6A 3Q8XB 5FHQA 3OZTA 2Z08A 2HMVA 4B79A 1I7NA 1N6OA 4OLBA 2GBFA 3LI2A 4J07A 5ITZA 4BKOA 3FHLA 4PAWA 3PENA 3T3EA 1DC6A 2IYYA 4IV8A 4UZEA 5E9JA 2VQFB 1MG0A 4UUPA 1NR1A 4LHSA 1A4UA 3NHFA 4MKZA 3FPLA 2O0JA 4C9BA 1YIAA 4AMYA 4HP8A 3R75A 2P35A 3F96A 3O4JA 5K8IA 1MF7A 2AJBA 2AE2A 1GCGA 4QOJA 4EY4A 2YRWA 1OX5A 1IM2A 1ZN7A 1A1SA 4M7RA 4C29A 3IAXA 3F3YA 2QM7A 1LDNA 1H1LB 3HMKA 3O21A 2Q3LA 4QOEA 4KPFC 4EAAA 4ZAVA 5FWXA 4YHHB 2FZWA 2YDXA 4AB1A 3NEPX 1YQGA 2DQKA 1FCJA 3HKEA 1L3BA 4FJ1A 4IHAA 3K5WA 4K28A 2HADA 4UTNA 2IYAA 1OWMA 2GCEA 1G64A 3VDQA 1WMFA 2EZ9A 5CRIA 1W8IA 4AMUA 3ZHTA 1ZN8A 4F9TA 4ENWA 3AJRA 2VK4A 2H1HA 5LLSA 1G6Q1 2QNIA 2R4TA 3DPUA 2MR6A 2P6UA 2QQFA 3VPAA 5A7HA 4CI0B 2H2GA 3CCBA 3GPDG 1QP0A 5JTTA 1I7DA 5DNWA 1UDBA 5A3RA 3GGSA 4M87A 2BEJA 1A5BB 1GILA 4G8BA 1II0A 1SBYA 4L5AA 1G8JA 1VFNA 4LV6A 1CF9A 4URYR 2XYHA 2ZBVA 4JROA 3UG6A 3O8RA 4QOHA 1T35A 3HHPA 1CF4A 1JTVA 5ICFA 1E2MA 4PO3X 2ZUBA 1WUJS 2JFYA 3F6EX 1R88A 4HUQA 4P4NA 4II7A 4S1TA 1PDWA 4YP5A 3DE0X 1IY1A 3R7SA 1GNRA 1YQTA 4GGOA 5F1KA 1R6BX 1QLHA 1VA5A 1Y6QA 4LYYA 4J1QA 4XWAA 5KHLB 1RI2A 1E7MA 1F14A 1G291 4NMHA 1T8PA 2CZQA 1C30A 2BDTA 3V32A 5HHTA 4IQGA 1P5JA 1PHPA 3DPSA 2W6NA 1QPGA 3V5NA 2ZAOA 3PC2A 3VR6H 2NO1A 3ZY4A 1HY3A 3IPRA 2D2XA 2QW8A 2IP4A 3DZJA 1ZOOA 1B0PA 3L8ZA 1OBVA 2AG1A 5L4LA 3HCWA 3ADBA 1EXWA 1LLDA 3F67A 3LJKA 1N5MA 3V8VA 1P0CA 1FTGA 1JG6A 3CTPA 3TUZC 1V37A 2Z4RA 1Y9EA 4GL4A 3QKWA 2QN2A 5AWFC 1JDJA 1NDHA 4XIIA 3R2JA 2PH1A 5HF6A 4EELA 3VHLB 5K6TA 3OFNA 5I8ZA 4XWGA 3DA8A 2QGZA 4DQLA 5JNWA 3C7KA 5JXJA 2PM8A 5KDDA 5F3DA 5KHOC 1PGQA 2NO4A 4ND1A 1ZBQA 2IZ0A 3EGOA 4M6WB 2Q3FA 2VF5X 3HBNA 1DE0A 2CUKA 3SJBA 4DLPA 3N07A 3ZCTA 1DUVG 2GXSA 4OKNA 4WXPA 4BN5A 3ENWA 3CJRA 4IXWA 5A5VA 4DM4A 1UMCB 1TXGA 4O2AF 5KSWB 3FTFA 5CVUA 1F48A 3SI7A 4YJFB 2PBZA 5EYPB 2I3DA 3ZVNA 3H19A 2E87A 2FQ1A 4WINA 5TPZD 4BNKA 3NG1A 1CUYA 2DY1A 5KNCA 3L7OA 1EFVA 5LNK1 2RBEA 4YV1A 3U3KA 5B4UA 1A76A 4XGQA 4HYTA 3RD5A 1KAEA 3ND7A 1QNLA 2POQX 3B9RA 3HU1A 4IKOA 4CXMA 3A9SA 1QIKA 2V55B 1SC4A 2AUMA 2I9PA 3NKFA 4FI3C 1X1QA 3U0VA 1LH0A 4PX2A 2VVTA 3T06B 1KRWA 1LJLA 3KQNA 5EFOA 3H2ZA 2P8JA 2ORWA 3FYCA 2WNSA 4FDVA 4UD2A 4E6PA 4Z0TA 5KOJA 2DP4E 2FPWA 3L0OA 1WOYA 1T36B 2AVDA 3M49A 4G1FA 4LX8A 4YAFA 3QXSA 4S1WA 5DHTA 4ERXA 3W06A 4FFPA 1QO9A 1O95D 2WIBA 1AUXA 1RYNA 1VKJA 3ODGA 1QGUB 4NVRA 4PVDA 1GARA 4LE2A 2EX4A 4FONA 3CJQA 1NW4A 5DI3B 5K3FB 5IKEA 1YJ5A 1XMPA 3TSCA 1KMNA 2WSSD 1QIEA 5L95A 4INPA 2ZUFA 4NJEA 4KPYA 3B78A 1NZJA 1VRVA 2IX3A 3SP1A 2Q2QA 3UMSA 1TLFA 2WABA 1G3UA 3TL6A 1THMA 3CE9A 2F9MA 2VK8A 4UUOA 1IHXA 1AXGA 2CNNA 5AK0A 1RAAA 4JYMA 2JGAA 2JH8A 4QC2A 1SUBA 2ZE6A 4ZDWA 2YDYA 4ARZB 1OA1A 2F67A 3NWJA 3FPSA 4Z7JA 5BYAA 4AQ7A 4JNKA 4YWHA 4F4FA 1LBSA 3HB0A 4MIKA 3CZ5A 2G1AA 1WS6A 2FW7A 4UCQA 5DRTA 2J3LA 1Y98A 2ECQA 3IEIA 4E14A 4GC5A 4Q7MB 1UEXC 5FB3A 2WHXA 1A0OA 1FFGA 4XJTA 2G0AA 1XZNA 3VTZA 4V0OA 3H86A 3VYRB 1U2EA 1OI7A 4ZOQI 4P86A 1H65A 2X13A 1ZVVA 3BGIA 3K5HA 4H1WA 3HFRA 1XMVA 2BFDB 2VBFA 3UJNA 1H1LA 3O26A 2ATEA 1KIFA 3B5EA 1DJOA 1LVGA 4IIYA 4K0RA 4L5BA 5J4KA 3DDOA 1KJZA 3W9UA 3WX0A 1CXZA 4QXQA 1XD2B 4B2PA 3NEJA 1C4KA 2HQOA 4M8SA 1NQXA 3NTLA 5A06A 2C2KA 4CV1A 3RK1A 2J5RA 2NXNA 4RCVA 1E9DA 1RWVA 1ZJYA 1OKKD 2PMDA 2PRJA 3ND9A 1JYFA 2CDBA 4BNUA 1RWOA 1TM3E 4IDNA 2FLWA 2OCAA 3CN7A 3TLEA 3H6GA 2XRZA 5SICE 3AK4A 2X0NA 2NPFA 4U2CA 4LJYA 2JVIA 4C0JA 2XCRB 5BN5B 3H2YA 3RJMA 3GLGA 5GP1A 3FIJA 2VHQA 2AJLI 1EQ2A 1XNRB 4BQIA 4FYHA 3P2IA 4OL9A 4J0FA 5CA0F 3C6BA 1YS7A 4Q37A 1I3MA 1V1JA 3L06A 1JQLB 1U5CA 2VJAA 1ARZA 1ISSA 3DZCA 3ZJVA 4HJXA 1GDDA 4HVCA 2JGDB 3BWCA 5CIWA 2QYTA 5E9AA 4AYWA 1X1BA 1L7MA 3QOXA 3EGEA 3HJTA 3R41A 1D9ZA 3HRHA 3JYQA 1EHIA 3C1UA 5EJEA 2VJQA 4DTIA 4PNHA 1FSGA 2HMYB 2DHEA 5B1SA 3TTTA 4IFBA 4GSKA 1Z4IA 4IS2A 1OLOA 3IVAA 1O0SA 1O9GA 2A9FA 4WFKA 5EHGA 4RULA 3KDAA 3ONDA 3FA2A 2WSMA 4MS1B 2BBSA 2CXOA 3G8CA 3PHGA 4CR6A 5CDSA 2C9BA 4H6VA 4J94A 3EDMA 2WEKA 3IPYA 3IBYA 1VXOA 3KWMA 2PX3A 4QGBA 3GUHA 3VFDA 4K05A 3MHTA 1NUSA 3KUDA 1BS2A 2R7KA 1LV8A 1J33A 4RKWA 4A2WA 2V96A 4M6WA 4XIGS 4KYVA 3AF6A 1JILA 5HMMA 1MQ8B 2OCPA 5FX2A 1NP7A 2VTBB 2GBCA 1E77A 4L4YA 5TS2A 3C5VA 4E5VA 3SKXA 4ITRC 5B30A 2FGJA 4CW7A 3EGCA 4TX1A 4DLYA 4AS1A 4KAJA 1RYZA 1UMCA 4M9UA 4H7DA 1AK2A 1LTKA 5ES3A 4FBMA 3WB2A 1SBZA 2ZZNA 1VE9A 3LRTA 5EYPA 3E05A 4BQFA 5BR4A 5BUSA 5JAHA 1B6RA 2P11A 3RE1A 1E1LA 3O4RA 3EPKA 4X24A 2A1IA 4RD4A 4OYRA 4A7PA 1TEZA 2JAPA 2QTZA 5LYJF 2NYRA 3DM9B 3SS8A 2NNWB 2UZ4A 2HU5A 2WWRA 3KKKA 5BNZA 1Z0ZA 4JSTA 5L7YA 1T2CA 4ES6A 1O3YA 1Y8QB 3Q98A 4LJ5A 5CB6A 1GPLA 3ET5A 4OREX 1VE7A 1NMQA 4QT0A 5CW2A 4EMTA 3ZDBA 3M1LA 1PJLA 4J2OA 1RIIA 3LKVA 4PAQA 4UM7A 1WXFA 3IIEA 3PI7A 4XJXA 5U1PA 2I4LA 3ZHSA 1AGYA 2GM4A 1ENZA 1XD9A 1T36A 4TYMA 1LBQA 4GQBA 1R4NA 4ENRA 1YQQA 1E2DA 4NI5A 2FJPA 3G0BA 4HRAA 1QGUA 1T29A 2CKDA 2PL3A 5JWRA 2XB2A 1P4AA 1VCHA 3G82C 4DLTA 1ND5A 1UK7A 1HPLA 4OHMA 1ODLA 4FCWA 3FKJA 4BNWA 5DI3A 1FJHA 1V3UA 2JIMA 2Q8NA 3DKVA 3R09A 4JJZA 5K3FA 1NBAA 4D8YA 5J2UA 1JNXX 4WZBE 3UK2A 1OXXK 2ETVA 3DL7A 5CCDA 1AKRA 1CD5A 1I24A 5K01A 1D4OA 1Z2NX 3I9NA 3PUJA 3OZBA 2J3MA 1JHYA 1P2BA 3FD8A 2Y05A 3F1LA 5SYNA 5LOVF 4KFSA 1H6CA 2IOQA 3QUAA 1OFVA 2C3MA 4MUBA 2PS0A 1XFDA 1JIIA 1HSZA 3G0DA 4AP9A 4I4CA 1NC1A 4QX6A 4FKBA 1H2RS 3DOIA 1TADA 5FOTA 3SLKA 5C53B 1GPKA 4JEUA 4XAQA 5IAOA 1X86B 4B45A 2PZLA 1ZCFA 2XHEA 1KPIA 4XCVA 3VZCA 1XA3A 1U94A 3FSRA 1I8TA 2D0PB 3MUNA 3SDBA 4UQOA 4KODA 3K09C 3TEJA 2HMWA 3OMXA 3U2QA 2A58A 1BYUA 1NUHA 2LP4Y 3U5ZB 4XIJA 2GN8A 2LIPA 1CK4A 1JJAA 3BXFA 3NHKA 5GM2A 2B4TO 3MGGA 2Q49A 2BFDA 3FFXA 5KI6A 5C1PA 5SY9A 1GCAA 4YT2A 4XVUA 1TU4A 2I4RA 1M8GA 1SZPA 3BBLA 3IMGA 3ONVA 4GM4A 4R3UC 3ENKA 1K98A 1W4AA 3IT1A 1KO1A 2IPMA 3JQDA 4OBBA 4D56A 3EZ6A 4REQB 3ZKAA 4K87A 2QX8A 3EPPA 1XMSA 5BSEA 4MQ6A 4NCHA 2J33A 2NACA 3KEFA 4KKVA 2Z1NA 4BX0A 2R97A 2VAVA 5ECYA 1KJJA 2R60A 1O95C 1Y3BE 2ZRHA 4QU8A 2CHVA 1IIBA 2G9UA 2QTNA 4OXXA 1TVKB 4EGFA 3T3HA 4EB8A 5ILOA 5BN5A 1PR0A 3BXPA 1R0LA 3E5RA 3TSZA 4CV2A 4E5DA 1CY6A 3CWZA 3GJ4A 1UJCA 4D9NA 1ZUHA 3FJYA 2V5VA 2IDZA 5CB4F 2Q5QA 3IKLA