1YU9A

Gppnhp-bound rab4a
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
175
structure length
175
Chain Sequence
GPLGSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGEDVEEAFVQCARKILNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of family-wide Rab GTPase recognition by rabenosyn-5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords GTP-binding protein
total genus 60
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2005-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1yu9A01
1GRRA 2ZJ5A 3PIRA 2WJIA 2HT6A 1R5NA 1CJUC 1XMVA 1YZLA 1XD9A 4PPGA 1JNYA 3THWA 3H4MA 3MG9A 4QFMA 4DSTA 5JJKA 2AK3A 1R4AA 2G3YA 1S9DA 2J1LA 3K0FB 3T5GA 3ZIAD 4CEIA 2BBSA 5HKKA 2WJYA 4AYTA 1R2QA 3OEEA 3IHLA 2RB4A 4M9QA 3VFDA 2RKOA 3MAAC 4FMCB 4ZDIA 3A1VA 1KDPA 1XWIA 4GOKA 4KLNA 1E9AA 5KSPA 4KI0A 3ZVLA 2IT1A 1LV7A 3A1TA 3X1WA 3QKRB 1IN4A 4B3XA 4XTRA 3FFBA 5HZHA 5JSZA 1XMSA 4DSNA 3FFAA 721PA 1NSTA 2JJ1D 1OIWA 4OQMA 3QPUA 3TVDA 1KSJA 4PQYA 1EFRD 2IF0A 4ITRC 2IA5A 3PEUA 1KSGA 2REBA 1FX0A 2DCUA 3K0SA 3EPKA 3RRYA 2A78A 2Q6TA 2QM8A 2QUZA 2WZQA 3MWYW 3A36A 4JLDA 1X1RA 1RE0A 2QI9C 4TMTA 5LD2B 1EESA 5JZVA 5D3MB 4DC9A 1E2MA 2DHRA 4BQSA 1W2HA 4BEJA 3VX3A 4LJ6A 2W6ID 4POAA 1VKJA 2W6JD 1CRPA 4OQFA 3GLHE 2ZM5A 3VR1A 5KPDA 4TT3D 1BMFD 1IJFA 3JZMA 1W4AA 1G21E 3HJNA 3N2EA 4P31A 2JIZD 3W90A 4IDNA 2XSZD 4WXRA 5F9FA 1F2TA 5HE9A 1HT1E 3IO5A 4JBWA 2QENA 4IOMA 4M2LA 3BRWD 4OHXA 1N6OA 3ICQB 3LO5A 1EG7A 3ADBA 1XZQA 3LVQE 1DOAA 1R6BX 2EFCB 3LAWA 2ZRIA 1NBMD 1GM5A 4TLEA 4PO8A 3OEHA 4CEHB 1KI7A 1ZD1A 1II0A 1NVVQ 4EKDA 4XVQA 4Q4AB 1NY6A 3HDTA 5JLJA 2G0TA 2ZRHA 4YXWA 5CK5A 4OJQA 4URXR 4KYIB 3NEYA 1N6IA 4QL3A 2ZU0C 3CH4B 1J2JA 3CPJB 1F3OA 4Q66C 2WWWA 2ZVQX 3S1AB 4AKHA 1OFUX 2PX3A 2F6RA 3KKOA 2QTFA 2G83A 3AVQA 3Q8XB 1AS0A 3ZLJA 1MABA 5SZHB 1QRAA 3DOFA 1BIFA 2REOA 2A5GA 4A0FA 5JMTA 1XF9A 2OILA 3T1OA 1F2UB 2CL6X 5KTYA 1TEVA 4BE7B 1ZD8A 4XWKA 4V0NA 4HDCA 1P72A 4LHVA 2J7PD 2F7SA 1Z08A 3K9GA 1OXVA 3BC1A 3CX8A 3F8TA 3GMTA 2ZRDA 1YR6A 3L43A 1E1QD 4B43A 3AP1A 3NDPA 2XB2A 4MRVA 2JLXA 1Q12A 1Q44A 4C7OA 2ZROA 3DO6A 3SHWA 3PEVA 4B2LA 4QJ5A 2QAJA 121PA 1GNPA 4JL5A 2P65A 4DT1A 3DDCA 3CM0A 3RNLA 4P32A 1VMAA 1NSFA 3BFXA 4ERNA 1V43A 3QBTA 4R98A 3W3ZB 2O8CB 2YZ2A 1SXJA 2CNWD 4LV8B 5EUQB 1OFIA 3VR2A 5KSYA 2P3SA 2WOOA 4QBHA 3SR0A 1W46A 5AJWA 5ELXA 4FMCF 1SXJC 4LDJA 3LQRA 3WYAA 3GLIE 2ZRLA 4JLMA 2Q9CA 1KY2A 3KKMA 1J8YF 2XNDA 1IM2A 2IYTA 3BIFA 3BOSA 1P6XA 1RW4A 1EWQA 3WYGA 4MKFA 4Q4JA 4GMDA 1S3SA 1KI9A 3JZAA 4XVUA 3W6NA 1IY0A 3E70C 1AGRA 3THWB 2YKGA 2GVDC 1G6OA 3VR6A 4QJ4A 2AL7A 1GRNA 4NZYA 4Q7JB 4G5SA 1T5LA 4NU0A 1WF3A 4Q7KA 1SXJB 621PA 1IHUA 3ZH9B 4ZI2A 3WP1B 2ZI7A 4KYUA 5KSZA 1CS4C 1WQ1R 4G5OA 3TH5A 2LWIA 5H70A 2VHCA 3GJ0A 1W7AA 2E87A 2V6JA 3OESA 1ZUHA 2JJ1A 1DAIA 2C98A 2W83A 1NBME 4Q47A 1PLJA 3A37A 4Z1MD 2IWHA 4B73A 1XCPA 3FKQA 1EFRA 4YXWD 2L0XA 1N5IA 1G8HA 3TMKA 4I81A 1NG9A 4IDQA 2CXXA 4CEHA 3GJ6A 3PXGA 1XEWY 1Z3IX 5JWRA 1YVDA 5TV2A 1G5TA 4JT2A 1W4BA 2PCLA 4RD6A 4DLRA 3A58B 4GP6A 1WCV1 3GLIA 1KTVA 1Z2CA 5GJVC 1E1RD 3V4RA 1EWRA 4HZUA 3RS0A 4CT5A 1XU4A 2WJHA 3NKVA 2GCOA 5JWHA 1ESMA 3RABA 1RRFA 1R0ZA 4TTRA 2ZUDA 1SULA 4LJ5A 1Q3HA 1LS1A 2CLDX 3U5ZB 3I4LA 2JATA 3I8SA 5SZIA 2J5XA 1XCMA 3GLGE 2ZJYA 1DG3A 1KSHA 5BN3A 5GJBA 2FA9A 5FPTA 2W0MA 3FYHA 3RANA 5FBWB 1S96A 3RS4A 2RHMA 5G41A 3ZVNA 2JJ2A 2CMKA 3JVUA 1ZD9A 4I4LA 3TJZA 1KAGA 4B2IA 5GVSA 2XXAA 5JHGB 4JLJA 5DISB 5CYPA 1GOTA 4W9MC 2DFTA 4EPTA 5CITA 2C99A 3MWKA 1XX6A 1OB2A 1NG1A 4KVGA 3C4JA 4FXPA 3NXSA 3ZS8A 5FOUA 3LXXA 3I92A 4KBFA 2Q9BA 3FOZA 2HT1A 2XNDD 2RGNA 4B3GA 3ZQ6A 1SVKA 3O8BA 2C8VA 4D26A 1VIYA 2JLSA 4JKYA 2VTKA 4LHYA 2BMFA 2ORWA 3CPHA 4ZI3A 4KFSA 5HZKA 3FHOA 3Q7PA 2GJ8A 3OEED 3L82B 2B8WA 4TQUS 4TYYA 5EE9A 3CKLA 5FPHA 1YZKA 1E2NA 2KE5A 4QHTA 1OXXK 1P62B 2ZS7A 4ZKEA 5HR5A 1KGDA 1Z47A 1X6VA 4MGKR 1M1YE 2V3CC 1FX0B 1KSFX 4AWXA 5AUNB 3T1TA 4QXAA 1G6HA 3LX8A 1QHNA 2GAOA 3C8UA 4ZCLA 4L15A 1O3YA 2QNRA 2FPLA 4PAMA 4V0LA 3QXSA 2MMGA 3MJRA 4BLTA 4LYHA 4LRWA 5FOSA 1AKEA 2GDJA 4ZO4A 4A0RA 3C7KA 4O25A 421PA 4TLCA 4JZKA 3SU8A 5DN6D 5FUXA 1W0KD 5H68A 2V4ZA 3X1DA 4JLVA 5DNYB 4JLOA 2CHGA 3CF6R 2DY1A 2J0VA 4II7A 4V02A 2IW3A 1US8A 1N6NA 3TR0A 3AKDA 4Q02A 2JAQA 1RFLA 2WAYA 1MT0A 1Q1BA 1SKYE 3L8YA 4HB3A 4Q4HA 3K70C 2H5EA 3RSLA 4P4TA 2OXCA 4DSUA 4P33A 4BEBA 2ZJZA 3FE2A 4TSFA 1T5IA 2QROA 2FWRA 1E4VA 1SKQA 2QY9A 2VF8A 3HR8A 4JMPA 1MH1A 1XZPA 2GK6A 4JLNA 1I4TD 2GXAA 1CLUA 2ODEA 1E0SA 2QQEA 4A6XA 1JI0A 1VHTA 3QG5A 4ESHA 4M8NE 4W5WA 1F2TB 2AHOA 1N5LA 1HE1C 2IC5A 4DDTA 3AF4A 3U3KA 3T35A 2C9CA 3TAHA 5BN5A 1H8EA 4GL2A 3N2IA 3G5UA 3PUWA 4IHQA 5KU1A 5KPJA 2RGXA 5BWMA 1N3BA 2FV8A 3GLGA 1B0UA 4C0BA 4E09A 1JEEA 1G17A 1UAAA 1AQYA 4C2UA 5JBQA 1TUIA 4B6FA 4KCGA 1PUJA 2GWHA 1GNQA 5AWFC 4B34A 3BFVA 1CJKC 3THXB 2Z83A 1N6RA 3IIKA 2OLKA 2ZQ5A 2WSSA 4XVRA 5LD2C 1K8RA 2FE4A 5A0FA 4N0DA 2D62A 4UNRA 4X8MA 1Z22A 2EVWX 4US0R 2QU8A 3TVTA 2UZ3A 3BFKA 4MRPA 4Q5IA 1GNRA 1KIMA 2A7QA 2D74A 4BLQA 4M9XA 1W0JA 3I5XA 3A1UA 1XPUA 3R9XA 4PC2A 4KITB 1SXJD 2CNWA 3WRXC 4NL4H 3A4LA 3PUYA 4A1FA 3ADDA 4QHSA 3SZRA 3GEEA 4G0NA 5J5CA 4DB4A 2J0QA 4FCVA 5FBRB 4KSBA 4GP7A 2XZPA 4DCUA 3U60B 2FSGA 2PEZA 2AKAB 4LUCA 4IVQA 4EPVA 4XJXA 2ZE5A 1E2HA 2OFWA 4MKHA 1L7VC 1XD2B 3AUYA 4Q48A 2Q9AA 2VSOA 4AKGA 2WMOB 1AS2A 5KNDA 1KO7A 3IQXA 3RRNA 4MGIR 2ZJBA 4B71A 4R7ZA 2WJGA 3UG6A 2QE7A 1COWD 1NIJA 1UBEA 1ZJ6A 3TUZC 5KSOA 4HLDA 2WJVA 2O8DB 4TYWA 1A2KC 4MYHA 4KLZA 1RYHA 1UKYA 1KZ7B 1QHSA 5DH9A 4OI1A 1OFHA 3SBEA 1YRBA 1M34E 2HYDA 3GD7A 2RGBA 2WICA 3KXIA 5DYGA 5CK4A 3FHTA 1TX4B 2BM0A 2F3RA 3L0OA 4BRWA 4LJ7A 3EWSA 4G01B 4UXJA 4OI0A 1OXTA 1XEFA 2NIPA 4Y0AA 3K9LA 3VTKA 4M1OA 2V7QA 1N6HA 2IUSA 2VHQA 4JSTA 2F3TA 1G7TA 1T9HA 4EFMA 1AZSC 2Q21A 2ZIAA 3F3YA 4LHZA 1GSIA 2CHQA 4RFSB 1M6NA 3DL0A 2XSZA 4HI0E 3NBXX 2XOKD 5JI2E 4LBWA 3CRVA 4RZ3A 1QHHB 1IXZA 4C0AC 2OV2A 4NH0A 1YRAA 3EZ7A 4TL7A 1CRQA 3WBJA 1G8GA 2BM1A 1XJQA 4DZZA 1AIPA 3H1TA 3THYA 1OYYA 2WIBA 4GT1A 4KAXA 5SZKB 3GLFA 2YV5A 2O8EA 3F0TA 1CP2A 4FMDB 2AXPA 3SJAA 1NIPA 2WWXA 3NVAA 1JPJA 1U98A 1YZTA 4F92B 4KFRA 1AKYA 1P9NA 1II8B 2WWFA 4EPXA 2IYZA 3K9HA 1G4AE 2FZLA 2GTPA 2Z5FA 1W5SA 4Q19A 4AKIA 2XJ9A 1Z0DA 4JS0A 1N2CE 3PVSA 3AVVA 1KZGB 4O3MA 4NKRA 3KKNA 1R0XA 2O0JA 3AKCA 5C4GB 2ZYVX 3LNCA 1IONA 3IDQA 4PSVA 4M9SA 4IVRA 3REGA 2XEXA 1YZGA 1E0KA 3U7HB 2IYUA 2F43A 3VHXA 4WZAE 3LW7A 1U81A 1SVSA 2PT5A 2G1KA 1CF4A 1XPOA 1KJYA 2GNOA 5J4KA 3AGQA 2OCAA 3NBYC 4C0LA 2IYXA 4UJ3A 1ZIOA 2YYZA 4BFZA 4DUGA 3E1SA 4IW3B 3LBHA 3T1VA 2JLZA 1NVUQ 1CEEA 1L8QA 1V5WA 4G1UC 2QAGA 1W49A 3LY5A 5BN4A 3U4QB 1GKUB 3TUJC 1W0JD 3KZ1E 1K5DA 1NJGA 1K5GA 2KWIA 5DIFA 1QHXA 3FVQA 1Q21A 3QBVA 4KBGA 4RD2A 3G0HA 3CF0A 4NYIQ 3CR8A 3ZDQA 1QG4A 1J90A 2IS2A 4GZLA 3LXRA 1BYUA 2ASEA 2ZSBA 1LF5A 4HAZA 1XPRA 5LBIA 2ZRMA 2H18A 3RS5A 3W8NA 5B57C 4LJAA 2R44A 1IN5A 2ZSDA 2GZHA 3I72A 2FSFA 3KUDA 2IYQA 2WKQA 1X8JA 1A1VA 2ERYA 4B35A 1S9HA 3SDZA 1WP9A 1LNZA 3AB3A 1YR7A 4QNMA 1YZNA 2WPDA 3TSOA 3OZXA 1PLLA 3HPQA 4B3BA 3DZ8A 4DDVA 1JR3A 1X86B 5JCZA 2R6GA 2CCJA 1LW7A 1RYFA 4LPKA 3NC1C 2V9PA 2DB3A 5L3QB 3VMFA 1E9FA 4DB2A 2XGJA 4TMZA 1OXSC 4BUJA 3V00A 3UMRA 1Z28A 3IKJA 5L3VA 4Q4HB 5CDFA 4AY2A 3QVUA 1F60A 2LKCA 3B1VA 4KODA 1D9XA 5GVRA 1XEWX 3C16C 3EIQA 2O8CA 5E7MA 4WIAA 1ZUIA 4URWR 1OPXA 4FN5A 4IFBA 5E95A 4AG5A 2HCBA 4AK9A 3RRMA 2MSCB 3SC3A 1WE2A 2YJTD 3K0AA 1CR4A 3LA6A 1BOFA 2HUPA 4DLUA 2DWQA 3LFUA 4ZIRA 3M6AA 3GP8A 4TYQA 2FDCA 3GPLA 2ZRCA 3U44B 3NH6A 1E9EA 4C4PA 2ZREA 2ZI6A 1Q1EA 3C15C 1QBKC 1SVMA 3WBKA 4OYHA 4ACBA 2V7QD 5IF9A 2VH5R 3KJGA 4LJ9A 1E9RA 1D2EA 1GL6A 1OHHA 2WV9A 3AKEA 5B58C 1FMLA 4Q9JA 4RFVA 5CJ2A 1JALA 3K0CA 5BYJA 4B32A 1KO4A 1TF7A 2P6NA 4R9UC 4DUGD 5KDOA 4TYNA 2FMXA 4JBXA 4A2QA 4PAQA 3CH5A 1XTSA 1R0YA 1RRGA 1EX7A 1HEIA 3OE7A 1UBGA 1GIAA 2QE7D 4M1MA 4EJSC 4Y0VA 1D8TA 1BS1A 5EUMA 3TQFA 5EP1A 2EWWA 4HUTA 2IF2A 3FHCB 4LBVA 1TQ6A 4JVSB 1SHZA 4KXFB 4IRUB 2OG2A 4OQLA 1G64A 3BH6A 1Z06A 5IRCD 4YMTA 1IQPA 2WWIA 3FGNA 2QORA 3I61A 2AN9A 2EU8A 1T8TA 2OBMA 3B8HA 3MRSA 1KI4A 2CBZA 1P2SA 1GP2A 2ZS8A 4UKDA 1TAGA 1OFTA 3CBQA 3WNCA 2OUKA 4PPFA 1W36B 3FKSD 1TUEA 3I3SR 5F9HA 2NO6A 1BMFA 2V54A 2ZUBA 2PBRA 1EXMA 4JVLA 4XTCS 2WMNB 2A30A 3CNLA 2GBLA 1P9WA 2WKPA 1UBFA 1Z83A 4A15A 2O0KA 4KFTA 5KYKA 2HV8A 2Z43A 4F93B 2PMKA 3LBNA 2BBWA 2K5UA 4U02A 2OZEA 2ZYWX 4TTPA 4NYJR 2KBEA 5TB5A 4CGZA 3QEOA 3SJBA 1OIVA 2WTUA 5JEDA 2GEVA 3AVTA 4PHTA 5JECA 2AR7A 2QTVB 3CX6A 4MGYR 1TL7C 3Q5EA 2IS1A 2QT0A 1P2VA 2XTMA 1ESNA 3P27A 1W4CA 2BWJA 2IK8A 1PUIA 4RZUA 1G20E 3GFPA 2YWHA 1FNMA 1P7CA 4B75A 1ZMXA 2YHSA 4LJ8A 2KB0A 5JFGA 4MUAA 3EA0A 2VP9A 3HYRA 5BW8A 2GZAA 4MITA 5H1YA 1KK0A 3UATA 3A1WA 1NY5A 2WKRA 1E4YA 4GMXA 4MRRA 4NCNA 5LB4A 2ZJOA 3LH5A 4DJTA 4UQOA 5DI3A 1X1SA 4BECA 2GRJA 5DI9A 1A4RA 1GL7A 4PXAA 4CIDA 521PA 3U7FB 1ETUA 3O8CA 2CVHA 2WWYA 1GAJA 5FTMA 2BJWA 2YOGA 2W0SA 1HUQA 3Q5DA 4HAWA 3CR7A 1NJFA 3ZIAA 4CF7A 2JASA 3RVBA 1Z0JA 1ZIPA 3LVRE 3WXMA 1MR3F 3RS2A 1ZM3A 1SQ5A 3EWAA 2GJKA 3LV8A 5FOWA 4MDEA 4DIEA 3G82C 3ZD6A 1N0UA 3M1IA 1XB2A 5AJZA 2A3RA 2ZI5A 5L8VA 1SVOA 2JLWA 1E9SA 1JJ7A 3L0SA 3S1AA 1RIFA 2VP4A 4PSKA 4IDHA 3W5IA 1G8FA 4BLOA 2YOFA 1E2LA 4EJSB 3U6BA 1S3GA 4LY6A 4PHHA 2V55B 3GFTA 1KI2A 2DBYA 4Q1CA 5TVKA 4DT1B 1CBUA 2IXGA 1FP7A 1R10A 4A6PA 4BLRA 1RRCA 4BFXA 2BMDA 4EUNA 3QPVA 2QL6A 3EX7C 4A36A 1W5TA 1KK3A 2CL0X 1G3RA 1TQ2A 4J0QA 2QBYA 3EZ6A 3TIFA 1U99A 1NN1A 2WIAA 3SOPA 1WRBA 4CEJB 1VYVA 4TZ6A 3X1ZA 1F6BA 4GBMA 2WWGA 1ZNYA 2IYLD 4RY2A 3SNHA 5AUPB 2QSYA 4M9ZA 1KNXA 4YMWA 4ZKDA 5G53C 1MOZA 2JGNA 3VR5A 2QP3A 4BFWA 2VF7A 4ASUD 2HLDA 2ZVPX 4M1SA 2A5JA 1L4UA 2HYIC 3DM5A 3UG7A 3TLXA 5SZJA 3EASA 2CL7X 3UK6A 4W7SA 2GZDA 4MKIA 1WXQA 2IYWA 2XITA 5JS7A 1GTVA 1IBRA 1KI3A 1BH2A 2R8RA 1CKEA 1PJRA 3O47A 4L8GA 4S35A 4RFSA 2H1LA 2ZE6A 1P9RA 1N5KA 2GETA 2H92A 4QRHA 3KTAA 2C96A 5KUTA 1E79D 2BMJA 4DXAA 1YU9A 3BERA 3QSYA 1EX6A 5CM8B 1CIPA 4TLDA 5JJLA 1MV5A 4DSOA 4W5HA 4EJSA 2H16A 5EP4A 5D3QA 5JRJA 4BLSA 4QBFA 2NPIA 3OAAD 4BFYA 4MYUA 1GZSA 1H8ED 1NMZA 3D3QA 2WM9B 3AEZA 4JJZA 5FBLB 3VU9B 3KJHA 5FOVA 3B7GA 4C0HA 1OH8A 1T8UA 4JLPA 3TK1A 4C0SA 3N5CA 2CLSA 4EPRA 2GA8A 2DR3A 1C1YA 1I2MA 3CF2A 4XSGA 2PLFA 2F9LA 4R2HA 5FUWA 4TMWA 2CK3A 3AVPA 4WZ6A 2VA8A 2FGKA 1GITA 2RGNC 2FNAA 4XD7D 5AK0A 1E9CA 3NIBA 5AJYA 4F4CA 1Z6TA 1DELA 2G0NA 2H57A 4QBIA 5FTKA 1ZCBA 4B33A 4EQ6A 1P61B 2B21A 4MKGA 5KDLA 4US1R 4AYXA 1UFQA 1Q1QA 1OT3A 1XXHB 2A5DA 4KU4A 5FOXA 2DPXA 1HT2E 4V0MA 3DMNA 5CJPA 1DO0A 1JQLB 1T3HA 2BEKA 2BOVA 4Z1MA 2J0SA 3VKHA 5FUYA 3B6EA 5E7JA 3OF5A 2J46A 2QMUA 2FFAA 2FG5A 4HZUB 1PZNA 3EPLA 4BFTA 5BXQC 3EW9A 4I1SA 2GK7A 1S1CA 3DKPA 1WBBA 4K8OA 1ZUNB 4LBZA 4D0GA 1OKKA 3W9YA 1R8QA 1IJEA 3SS8A 3PR1A 8OHMA 2EFEB 3A1SA 2QGZA 2WSSD 4IDOA 3B9PA 3L8ZA 3RC3A 2ONKA 2P5TB 3RC8A 1VECA 1VYUA 2FPKA 5AR1A 5IK2D 4OK5A 5AJVB 1KI6A 2ORVA 3THOA 2VL7A 4RCYA 3SFZA 4C7OB 4TT3A 1QZXA 5FI0B 1E32A 3QXXA 5KNCA 1ZNXA 4LV6A 3CNNA 1XTQA 4JJKA 1RJ9B 3GQBA 1FNNA 3AP3A 1RVDA 1WMSA 4GRAA 3KKQA 5EJEA 1P73A 4A4DA 1VTKA 2BIFA 3U3MA 4A8JB 1NNEA 1GWNA 1S0UA 4FMBB 3VR3A 1HTWA 2ZITA 3BK7A 3KFVA 4NCIA 4NYIR 1U8AA 3B5JA 4BRUA 2HJVA 1WBDA 1G3MA 1TQ4A 1X8LA 4Q03A 2AFHE 4P3YA 3UIEA 3AVUA 2PLRA 1BO6A 3LX5A 1JQJC 2XOKA 1F48A 3PJRA 2RGCA 4LBYA 3J81k 5JWOA 3OIWA 1DPFA 4V0KA 3UKDA 2ZR9A 3NEJA 1E96A 4D4LA 4M1TA 1ZBDA 1L2TA 1UJ2A 3QY0A 3B1XA 4BZPA 1DG1G 4I1OA 4NP6A 4DRZA 3AF1A 3IQWA 1KMHA 2EWVA 2ODBA 3K0AB 4H9GA 2IYSA 1YHNA 2FSIA 2H17A 2KI5A 3MWLA 3KDSE 2O8FA 3BB1A 3DPUA 1ELOA 1FQJA 3RSOA 2ZS9A 2BC9A 5F2EA 1B23P 3QQ5A 4EIWA 1M2OB 2N1BA 1XP8A 1NN5A 2GILA 3L0IB 1JBKA 4HUQA 4DCSA 1WDTA 1N25A 5DYIA 4AIIA 5TY0A 3CWZA 4TZ0A 1Q20A 1E2PA 3CUEF 2VP0A 3QUSA 2VIIA 2FEOA 2HEIA 1T3SA 5CB6A 2RMKA 1KDTA 3CW2A 3OIUA 1FFHA 3WP0A 1P5ZB 3K0EA 1SXJE 4TLAA 4WOPA 1NRJB 2EQBA 2F1HA 4G5RA 5E4FA 2PZFA 4C0KA 2R9VA 1IXRC 1US8B 1T6NA 2AKYA 2D06A 2OBLA 2VPPA 3AF3A 4Q9IA 3SQWA 3IHWA 3PFIA 1JR6A 1TTTA 4F91B 3QOFA 4P4SA 1QHIA 1OH5A 4V0OA 4FCTA 4PTLA 1XTKA 1W48A 3U3RA 3BE4A 2DWOA 3HPRA 2YOHA 1UKZA 2NO9A 1W36C 2JJ2D 1UEJA 4RCZA 4DVGA 2QQ0A 4B48A 1S8FA 2Z4SA 2KBFA 4LWZA 4Q1BA 4D2IA 1UKVY 2IXEA 4NPHA 2RHDA 2QG6A 2RCNA 3FB4A 3SJCA 3D7MA 2UZIR 3K1JA 4Q00A 4A82A 3MMPA 4M4SA 2HXSA 2B7CA 1HYQA 2FFQA 3BD9A 1FUUA 3AM1A 2X8AA 2FSHA 3KXLA 3CB4A 1MO6A 3W6OA 4OHYA 3CIOA 2GEDA 2ZEJA 2CEAA 1Z6AA 3SYKA 3WNDA 2F43B 5CDFE 4A8JC 3O8RA 4AC9A 4ZCMA 4C0JA 1G291 4Q4LA 1MO3A 2J41A 2J3EA 3MD0A 3NH9A 3VX4A 4TQAA 1QVRA 3AV0B 1DBSA 1DVRA 3HU2A 4GZMA 4NDZA 2BKUA 2CCGA 4O2LA 3LLUA 1G7SA 5HPYB 2PX0A 5FH9A 4MQBA 1W2GA 1O87A 4EAQA 4PQFA 3U7GA 4OHWA 2DFNA 4FCWA 4N3NA 2P0EA 1NN3A 1LB1B 2B8TA 2O0HA 3NWJA 1E2GA 3Q3JB 3I8XA 3AVYA 3AF2A 4CYMA 4PHGA 4PPQA 1X8KA 1CJTC 2O5VA 4HZIA 2CDNA 3LWNA 4WA7A 4ARZB 2GXSA 5FI1B 1OB5A 3GLHB 5EXPA 2GHIA 1DADA 1N6LA 4B76A 1BYIA 6Q21A 3EC2A 4BPBA 3QIAA 2ZPTX 1GRQA 3B9QA 1CR1A 3GEIA 3PENA 3UMSA 3FMIA 3OFND 5K8TA 3BJIC 1ZVQA 2CHVA 3IPXA 1AQUA 1QVAA 4LJYA 1KNQA 2OO7A 5AUOB 4AKEA 5F98A 4PR0A 4DCVA 1P3JA 4TLBA 4ARZA 4IKEA 5DHAA 1Q3TA 4GDFA 1Y3AA 4OBEA 2XTNA 4FIDA 4Q4JB 3QXJA 3R9IA 4PZZA 4PSAA 4HEJA 1G41A 3AP2A 5FPYA 3C5CA 3EAQA 3IIJA 5B30A 1AJEA 2O8FB 1EFUA 4U7DA 4FINA 2QT1A 2QMOA 1NN0A 1XRJA 3PUXA 2EFHB 1C4OA 1NVVR 2AX4A 1F5NA 4CT4B 1XJCA 4YDSA 4M21A 2RGAA 3KQHA 3R8CA 1SKYB 4NONA 1DEKA 3X1XA 3TW4A 1MRSA 4DLXA 1E0AA 3DMDA 2VQSA 4B3DA 1U90A 1KMQA 2C9OA 5M04A 3GLFB 3AQ4A 1TPZA 3IUYA 1FUKA 1Z6GA 3PQCA 3NTUA 1HH4A 4JVMA 3HU1A 3EARA 3TBKA 1OH7A 2D4HA 4Z54A 2RGGA 2GVZC 4TYPA 1UPTA 5C4MA 2OM2A 4RD0A 4B3FX 4TN1A 2NG1A 2ZJAA 5DE3A 1EFHA 1A2BA 3D8BA 1SZPA 3MLEA 2ODNA 1Z5ZA 2EW1A 3BXZA 4LC1A 4Q18A 1ZAKA 4I1UA 3VQTA 4DDUA 3NHAA 1AS3A 2PEYA 5K8IA 1L4YA 1QG2A 2VEDA 4HAUA 1Q22A 1E2JA 2OBNA 1XCGB 4JBYA 4B74A 2QSZA 221PA 1IN8A 2CJWA 3OHMA 2PT7A 3PUZA 4YMVA 2JLUA 4JLBA 5L3RA 2OT3B 1TF5A 3IILA 1M8PA 2ZAOA 5CLLA 3ZGXA 3B85A 4QGAA 3B13B 2D7DA 4YONB 1W1WA 3P26A 2ZYUX 2Y8EA 3LBIA 4MDFA 3R8FA 1J7KA 3B82A 4U5XA 4QM7A 3U4QA 4D4MA 5CB8A 2ZUCA 4GSYA 2BCJQ 1SVLA 4TMVA 1E2DA 3WRYC 2ZRBA 1G3UA 2XJ4A 3QF4A 4ON9A 4PX9A 4DLYA 4Z51A 4DLSA 3EPJA 3IEVA 2BMEA 2JDID 2IHYA 1T4GA 2GJAA 4QGGA 4ZCIA 1N0WA 2CK3D 2XAUA 1HV8A 1QHHA 4KFUA 1ANKA 4QHYA 2XZLA 1XTRA 2J7PA 4HDOB 5AUQA 4E5UA 4EFLA 4NCJA 4TMKA 3TUIC 4RD1A 1U2RA 4M1WA 2ZRFA 2ATVA 4NE2A 3D6TB 1NL3A 5G40A 2ZRGA 1DTSA 3CZQA 3QF4B 5IK2A 2O8BA 2GXUA 1XD8A 2I1VB 4U00A 2RGEA 1E98A 2IEYA 2YINC 1QDEA 3GLHA 1FOEB 2ORIA 4KO8A 4UXIA 2G6BA 4TL9A 2WSMA 4IEIA 1II8A 4JYBA 1U0HC 1ZM7A 2NQ2C 3QE0A 3TKLA 1ZW6A 4A92A 4GPTA 3AUXA 2FN4A 2V1XA 3QXHA 2O8DA 2A5YB 1KO5A 2C5LA 1G18A 4DHEA 3SHFA 3UWKA 2NTYC 4A2PA 3BGWA 4L9WA 3T12A 2BHRA 1M74A 3B1ZA 5EQTA 3B78A 3M4YA 3A6PC 2ZETA 1XDBA 4D25A 4JLKA 3TGPA 1UKEA 2OAP1 2VP5A 3CX7A 4LGMA 2ECKA 5JHHB 3ETLA 4FD2A 2EYUA 5EP3A 3HYTA 3VHLB 1OHHD 5D3MA 3JVVA 3X1YA 3ZZ0A 4Z8XA 5CM9C 1W44A 1UM8A 1XJ0A 5ANRB 3EIEA 4S2EA 3T1QA 5JI3E 2I3BA 5K8LA 1CJMA 1E2IA 1YJ5A 1VDZA 2OFOA 4P4UA 1UF9A 4QNRA 4LOAA 2GCPA 1GDDA 3MUFA 2JDIA 1TU3A 2PZEA 3FTQA 2P67A 1Z0FA 3GJ4A 4D4JA 3SYNA 1UDWA 3F5FA 2FFBA 5CIQA 5HTKA 2AD5A 1VHLA 5FPKA 5C18A 4URUR 1H8HD 3EZ9A 1KI1A 4ZDKA 2IBMA 4EDHA 3DHWC 3FMFA 4ASUA 4KV9A 1ZM2A 5FR1A 3FWYA 1UBCA 1JAHA 2IL1A 5JS8A 1IN7A 2B6HA 2JIZA 2X1VA 4RD3A 4BFUA 3MFYA 2OHFA 1X3SA 1Q57A 1G16A 3LD9A 2CVFA 3K0CC 1Z6XA 3ADKA 3I73A 4F7WA 1E2KA 1II9A 1OH6A 4NMMA 5JRZA 2I4IA 3ZZTA 2WBLC 2GBLC 3ZS9A 5CLQA 1OSNA 1XEXB 1Z2AA 2ZU6A 2IXFA 5A4JA 3ZD7A 1QHGA 1R5OA 3W6PA 5GADl 1A5TA 3NDBB 1E99A 3GFOA 1KHTA 1KDRA 4M0LA 4I99A 4LHXA 1OW3B 1LFDB 2ZRNA 1W36D 2QRNA 5FL7D 4A2WA 2BEJA 3LQQA 3Q9LA 4D80A 2ZE8A 3W5JA 3HP1A 3GEHA 1LTQA 2IS4A 4B3CA 3OEHD 1JXMA 1DAMA 3ZZUA 2RGDA 1D5CA 4HB0A 3C41J 4IOJA 3DM9B 2JLVA 4TQ9A 4UXHA 5AJXA 3EC1A 3H0KA 5EZ5A 5FBVB 1CR0A 1KI6B 2NO1A 3ND8A 3DKVA 3H86A 4HAYA 2B92A 4LX0A 2ZI4A 5GJWC 3V9PA 1DAEA 3SEAA 1NVXQ 1VCOA 4QC2A 1CR2A 1BKDR 2JJ8A 4FW9A 4OK6A 5IDVA 2D2EA 1AA9A 3WMEA 2W58A 1FW6A 2R6AA 2NZ8A 1W4RA 2ATXA 4FWTA 5P21A 4LYFA 3CZPA 2QPOA 2ZRKA 4DDWA 4QM6A 5FL3A 1S1MA 4F4JA 2QMHA 2R2AA 4LZZA 4QBGB 2FOLA 1HURA 1R7RA 2JEOA 1E1RA 2ZI3A 5A5GA 2R62A 4E07A 4DIDA 3I5YA 3SN6A 2GCOB 4Q9HA 1E1QA 2C95A 3R7WB 4E22A 5EE0A 2D2FA 1DO2A 2ONJA 3FPAA 1GILA 2VSXA 5FFMA 2G88A 4MGZR 3BAFA 2XNSA 4PFSA 4RVCA 2ZTSA 2J0UB 3IGFA 1DAHA 3K53A 2FEMA 4A9AA 4B44A 2IUTA 1CXZA 2HF8A 5CYOA 2W00A 3NBZC 4DLWA 1VG8A 3H84A 4OL0A 2UKDA 1ZNWA 2BBTA 2ODWA 3TSWA 1AZTA 4PC1A 3U3JA 3U61B 4DEYA 3B2EA 2YWEA 3KB1A 1YZQA 2N46A 3LDAA 1COWA 3QKSB 1FPMA 3A4NA 4B47A 4DLTA 3FMPB 3R9WA 2BKEA 3RYTC 1JEDA 4K46A 3TNFA 2NO0A 1D9ZA 2ZRAA 3RLFA 4DCNA 2C2HA 2IWRA 1HA3A 4DLVA 3RS3A 2QN6A 4I1VA 2GF0A 1GKYA 1T91A 3SJZA 3VAAA 5DI3B 4M53A 3KJIA 1Y63A 2F9MA 1ZCAA 4IVPA 2ZAMA 3T34A 3U7EB 1HQCA 2VYFA 4V03A 1GG2A 1NI3A 4NCKA 2W6JA 5DHFA 3CRW1 3ZVRA 3BH0A 1P2UA 1FMJA 1VG0B 2QRZA 4HYYA 4A0HA 3GLIB 1MO4A 2J0UA 1P2TA 3PCRB 1S2MA 2EFGA 4URZR 5EZ6B 1E2QA 2W2VA 1LY1A 2WVJA 3MSXA 3UWOA 3CRMA 1T0JB 4IJMA 1M7BA 1N6PA 2J9RA 3AVXA 3KTAB 4HATA 4BZQA 3TRFA 4XOIA 1XTJA 4IXMA 1U94A 3GJ8A 2R6FA 1KMHB 1KDOA 3I1FA 2IHBA 2TMKA 2ZRJA 2QP9X 3L0PA 1OXUA 2YC2C 4EQ6B 2AWNA 4RKFA 5H8WA 1Q1ZA 4ZDJA 4OHZA 2EFDB 2IX3A 3EZ2A 2ZYTX 5TXGA 1TADA 3ZYCA 4URVR 4UNNA 4CW7A 821PA 4HLUA 4LYAA 1G8PA 2A9KA 4HUQB 3MWJA 3ND9A 3O8DA 4ABYA 2QZ4A 1F2UA 2C03A 3NBFA 4X8LA 2R6CA 3SYLA 4IOLA 2NMVA 4G3XA 2J87A 2G1JA 2Z0MA 3RRZA 1G8YA 3OIYA 2HCJB 2CE7A 2VHUA 4C0QC 4JIMA 3SFVA 3VNUA 4AD8A 3VNVA 3TR5A 4OI4A 1VPLA 2J45A 3UANA 3B1WA 2ZANA 5TDHA 2IYRA 5J4YA 4PZYA 2QTHA 3X2SA 4R71A 1TF2A 3WHKA 1R8SA 1RJ9A 4MYTA 4UNSA 4JKIA 5KDDA 2AFIE 2VP2A 1Z63A 1OV4A 4P4SB 1WA5A 2CE2X 3GJ3A 3P4XA 1IAQA 1JXOA 1SHKA 1FTSA 4EPWA 2LKDA 4NYMQ 2PH1A 2QEQA 2X2FA 2LCFA 4QJ3A 4TL6A 2C77A 3E2IA 2WJJA 3QKUA 4NHOA 4K81B 4QGHA 3SI7A 2GCNA 4C3ZA 4LK2A 4A8JA 1E69A 3KUCA 1NLYA 5DGXA 4D0LB 1K6MA 1GKIA 2FH5B 5E7IA 1ZNZA 5FTLA 1NLZA 2QGNA 1VYTA 3CWQA 2FF7A 4YDHB 4CEIB 3EG5A 4WXPA 4PC7A 1NBMA 2YVUA 4P0TA 1T3LA 4X8OA 3W34A 3D31A 4B2PA 4H1VA 4C2TA 2IEZA 2RH5A 2VBCA 2CLCX 4HDQB 1I2DA 5J4VA 2BCGY 4N1AA 2IUUA 3KXKA 2HF9A 2W6IA 1OF1A 3UMFA 1J70A 4EPYA 1CU1A 2GJSA 2B7BA 4XWAA 3R20A 4Q9KA 1MKYA 2ZSAA 2F1RA 1D6JA 5DN6A 3L2OB 4LI0A 4JT4A 4RZ2A 2A5FA 3WMGA 5E3HA 3QENA 5KOYA 4CVNA 1RPZA 1I4DD 4PO9A 1FP6A 4V0ME 3AGPA 1YQTA 4QOSA 5GJCA 3QNUA 5F3WB 4WVFA 4M1KA 2OEPA 2CCKA 2NOAA 1KY3A 2BDTA 2GXQA 1PV4A 3QF7A 4HAXA 4F38A 3DVLA 3K09A 4XH9B 4E03A 1A82A 4Q7LA 3SE0A 1P4SA 1CJVC 4XWOA 1E79A 3HR7A 1Q0UA 4IOKA 3RDPA 3ZJYA 4BGDA 5HKKD 3U2QA 3T5DA 1VCMA 4MYCA 2YNMA 1NKSA 3P32A 1NMXA 1OIXA 2ZXUA 1Z29A 1SVIA 2GEUA 3IIMA 3OFNA 2MSEB 2P6UA 2BJVA 3FDIA 1U0LA 4MRNA 4OKSA 4LPSA 3DEFA 3QVVA 1Z8FA 5KNBA 4B6EA 5C1BA 2OCYC 2VSFA 1OYWA 4NCHA 1E3MA 1Z0IA 3HU3A 1E2FA 1KK1A 1MRNA 4OQXA 1EFTA 2OE2A 1VCNA 1NKTA 4AI6A 4Q1FA 1XNJA 4FMDF 1H8HA 2JCSA 1KJZA 4D82A 3IBGA 2BBOA 2UVQA 2ZR7A 5FOTA 3BWDD 4JLAA 5DLQC 4WAUA 2NPFA 4IXNA 1U8ZA 2Q3HA 2WAXA 4HB2A 2JLRA 4GFDA 2ZSEA 3ICEA 1QF9A 3KB2A 4YQFA 3GJ7A 3LW8A 4OQNA 3PEYA 1ZM9A 4IFEA 1W0KA 1GUAA 2ERXA 2R65A 2V1UA 3PUVA 3KKPA 2G77B 4LJ4A 1U9IC 5B64A 4C30A 3ZVMA 1ZU5A 3QJYA 1YR9A 5C46F 4BLPA 3K9NA 5LDDC 3VKGA 2AD1A 3AVOA 3OAAA 2O52A 2NO7A 5EP2A 3OE7D 2ZE7A 3RS7A 3BB4A 4BZXA 4TWZA 1GFIA 3U3OA 2Z6VA 1E9DA 1DAGA 2H8KA 2QMEA 2J59A 1UEIA 1PVOA 1GVNB 1XEXA 4PANA 4RD4A 1Z0AA 3ECCA 4EFNA 3BH7A 1ZM4A 2QA5A 4UNQA 3A4MA 4PC6A 1IXSB 1R5BA 3K09C 2Q3MA 3KX2A 4GOXA 4XIGS 5FR2A 5TMPA 3U44A 2PJRA 2HXYA 2FJUA 3U6KA 4YLGA 4PZLA 1G9XA 3IO3A 1SVWA 1C9KA 3RAPR 3THXA 1EK0A 5BYKA 4URYR 5EXSA 2VHJA 2Z4RA 5KO2A 2PZGA 1DAKA 4W5JA 3QPWA 2NZJA 4OJKA 2GKSA 1E2EA 3K70D 3P1JA 1AK2A 1KO8A 1IY1A 2VLIA 5K8UA 1M7GA 4TTQA 1XXHE 4BFSA 2PJZA 1XTIA 2H7VA 3QKRA 4MH0R 4PO1A 2JLYA 1UADA 1ZP6A 2BVNA 2A2ZA 4JL6A 3EXAA 4ACAA 2HLDD 3WYFA 1TMKA 3K0FA 2ANCA 4WW0A 5L3SA 3Q7QA 4MUBA 4LSGA 3ONWA 2WOJA 3UPUA 2XTZA 3LRPA 2QAGB 3Q72A 3W8RA 5KHOC 4DWJA 3TE6A 1VIAA 4KJZA 1KK2A 1TU4A 2G9NA 4IDPA 1KO1A 2N42A 5L3QA 1VG9B 4ZIRB 4Q21A 4LCBA 1JR3E 1QHYA 3TSZA 3OIVA 1TQDA 4LYJA 1G7RA 3W3AA 1RC8A 1U9IA 3UXMA 1DARA 2PCJA 5FUVA 4CEJA 3R7WA 2DYKA 3QI2A 2AK2A 2OSBA 4G5GA 2VRWA 4ZPXA 2MMCA 3WNBA 1G19A 1XBTA 4NYJQ 4WBSA 3BORA 4ZDWA 2O8BB 1J99A 2RAPA 1YE8A 2DFLA 4PAOA 4RSGA 3FKSA 5IT5A 3KQLA 3WHLA 1XD2A 4KHZA 3FMOB 2Q0HA 4TSFD 1DE0A 5UKDA 2V6IA 3K8YA 1G7CA 3K70B 2IS6A 4YMSA 3QEJA 3DOEA 3P4YA 1U0JA 1CTQA 4TMXA 3CNOA 3GJXC 1Z07A 1E94E 1MABB 4GI7A 2E9SA 2QPTA 2YWGA 3N70A 5JCPA 2WWHA 3AVWA 4Q7MB 4NTZA 3KL4A 3RHFA 4H1UA 4PPNA 3VR4A 3C14C 1KAOA 3KQKA 1J8MF 1FQKA 3EA5A 1JR3D 2FPMA 3EIHA 5BQ5A 4ESVA 1I4LD 1M7HA 4Z8YA 1OE0A 2XX3A 2ZJ8A 1MO5A 3CLVA 4L9SA 2ZR0A 1AGPA 3LLMA 3P20A 4LV5B 3BS4A 1G1MA 3IEUA 4NBSA 3T06B 2P2LA 3C5HA 2VO1A 4TL8A 3GCGA 5DO9A 3DZDA 2MSDB 1NVWQ 5FPSA 1KYIA 3CRQA 4CZ2A 1ZU4A 4HSEA 1Z0KA 2FU5C 3KQUA 1NLFA 2WPDD 5J47A 2IYYA 1KI8A 1FTNA 2SHKA 1EFCA 4HLUC 2I1QA 4JVNA 3IPYA 1N6KA 1N0VC 2D7CA 3A8TA 2C9YA 3KQNA 1HE8B 2X19A 1ZINA 3RWMB 3EZFA 3TAUA 2F55A 1KKLA 1D2NA 1Z6YA 4DEXA 4KVAA 1CULC 2FGJA 3T15A 1ZC4A 1EGAA 1ZC3A 2KSQA 3QKTA 1HY3A 5EXXA 3BB3A 2O8EB 4KSCA 4R2IA 4Q1DA 4UNPA 5J4LA 3CO5A 1IN6A 4FWIB 1FL9A 3M0EA 2F1JA 5FBQB 2GJ9A 1P60A 1XMIA 3B1YA 4D0NA 3GJ5A 4YC7A 3GLFE 1XFAA 1KOFA 5FTJA 1YZUA 4YMUA 3NG1A 1XXHA 1IOZA 1T0HB 2QAGC 3WMFA 4D6PA 1NMYA 2EYQA 2GF9A 3NHBA 1JPNA 2JA1A 2X77A 2ZJ2A 2C04A 1JECA 4L4UA 3QG1A 4XD7A 2W2TA 1N5JA 4Q1EA 2OESA 2JLQA 2C78A 2IYVA 3Q85A 5EE1A 5JEEA 1NP6A 1TEXA 4RZXA 2GESA 4LC0A 4Q1AA 4DBLC 1HQYE 3REFA 4FI3C 2BV3A 2YWFA 5LB2A 1G5PA 3THYB 5JSZB 1G3QA 1RRPA 1E9BA 2OXRA 4IEEA 4DCTA 4BASA 4MRSA 1VG1A 5JJIA 3PV0A 5DSZA 3H2YA 2VHTA 5FL7A 3AF0A 4GOJA 3VU9A 5L3SB 4O0MA 4PQRA 4G5QA 3MGCA 3KJEA 2FX3A 1VCIA 2OAQ1 3CONA 5J4HA 1PLKA 1SGWA 2OCPA 4N0EA 2XB4A 2DFKB 1H65A 1LVGA 2OCBA 3AH8A 5LPNA 5B2ZA 1E0JA 4M1YA 4JYCA 2XZOA 4D81A 1ONBA 4OHVA 5G3YA 2QM7A 2VP6A 4O2RA 3QKSA 1RZ3A 2V8OA 4QG7A 5IHPA 3CRRA 2HJGA 3MCAA 4MA4A 3T61A 2ZI9A 3PEWA 3ZQJA 4HB4A 1LF0A 2R6DA 4JSYA 2W2XA 3TW8B 3MJHA 4OK3A 3NC0C 1ODFA 1KJWA 3PG5A 5C2JB 5J40A 1YKSA 5EE3A 1DAFA 1D2MA 3I62A 1S4QA 4AURA 3SQXA 4PHFA 2FFHA 3V4FA 1ZYUA 4NYMR 2XXAB 1OKKD 2ANBA 3B60A 5HE8A 4CRWB 1P75A 1G5RA 2J7KA 5EXTA 3WY9A 1XMJA 2ZRPA 4RJLA 2CJWB 2FZ4A 4Q9LA 5FTNA 2PMDA 2X2EA 1KKMA 3I32A 1NF3A 4CDGA 2P6RA 2QBYB 4BWYA 4QGFA 4D4KA 1E6CA 3HWSA 1IY2A 1LS6A 2ZSFA 3AKYA 4DKXA 1TNDA 2HDNB 3GLGB 1WB9A 1JB1A 1R0WA 3KFXA 2REXB 4L16A 4WZBE 3QXCA 2QPAA 2Q3FA 4AG6A 5HCIA 1JJVA 1G4UR 2DWPA 2QP4A 2WHXA 1OJLA 5G3ZA 4F4IA 3CPEA 2P5SA 2E1RA 2PL3A 1OLOA 1UDXA 4M22A 3SBDA 4AYWA 4ILEA 4RKEA 1JAIA 4A0GA 4HLCA 3TQCA 4X8HA 3E5HA 3IBYA 2D3WA 2YC4C 4ZV4A 1G3IA 1GL9B 4Q01A 2OFXA 4QKQA 2OLJA 3RWOA 3VKWA 1DS6A 4HLQB 4XSHA 1YR8A 3ADCA 3ASYA 1FZQA 4UJ5A 3EPHA 4HAVA 1W47A 1AM4D 2AXNA 4US2R 3BBPA 1AN0A 4GNKA 4LHWA 4OI2A 5CIWA 2AWOA 2KJQA 1A7JA 3ASZA 4Q4AA 2GAAA 4C9BA 1ZRHA 5HCNA 4L5BA 1RKBA 5TARA 4PC3A 2F1IA 2NGRA 5EE5B 3PITA 4JL8A 4BFVA 4DLZA 1U8YA
chains in the Genus database with same CATH superfamily
2XVZA 4PICA 3E3OA 4D3FA 1LRLA 1R5NA 3BK2A 4QUKA 4OB8A 1C2YA 4Z2AA 1H93A 3RV3A 4BJ5A 3ZV7A 1XD9A 4YRZA 4DLBA 4N0MA 3R5HA 2IEBA 1RLMA 4HTFB 1JAYA 3EQ6A 5FWYB 4E5NA 1RAGA 2ACVA 1RXCA 1RCFA 4L6IA 4FFWA 1JQAA 1R4AA 5GM1A 4X64B 1SU4A 3K0FB 3NOQA 1PR1A 4IDEA 1O6ZA 2IUEA 5HFAA 4KP7A 4C06A 4B1FA 2WG2A 2GUWA 3OEEA 3IHLA 1IDOA 1Y9JA 4ARSA 2ET6A 3WBFA 2DHEA 1FFCA 2RKOA 3FGPA 2HLHA 3GEGA 1R9JA 4FMCB 3TB4A 4ZDIA 1KDPA 4F4HA 1XWIA 3JAKA 4QTZA 5HS6A 3L79A 1QH8A 1EIZA 4DM7A 1WZEA 1KPGA 1PSWA 2IT1A 1LV7A 1X7DA 4OHPA 4FS8A 3OLYA 3L4BC 1SR8A 4C04A 2WJ4A 1IN4A 1UK7A 2DZDA 4PZEA 3BXXA 1YU6A 4L02A 2IODA 2XR1A 4GKVA 2QZPA 3O2SB 4BX9A 4C78A 1WHSA 1QB8A 1O2DA 5G1OA 1OIWA 2P3QA 2XKAA 3GH3A 4D9FA 2I33A 3WLQA 4TUYB 4DL9A 1KSJA 4LE1A 2XT0A 1RQLA 2DFVA 2NXCA 4RPJA 2RHBA 4WA8A 4HN2A 4HH1A 4CV2A 3D3WA 4MUYA 4DC1A 1ZRNA 2IA5A 2X7XA 3TXYA 1ADYA 3RRYA 2A78A 2QUZA 3MWYW 3R3ZA 3A36A 2YWJA 1X1RA 2QI9C 1MJGM 3D2AA 1EESA 5D3MB 3DCJA 1GPAA 5MDHA 3QXGA 2DTEA 1E2MA 3SX2A 2DHRA 4AS3A 4LNUA 3AW9A 2R6ZA 4KB5A 4B4DA 4EF5A 2IEGA 4F6RA 1H6CA 4IYJA 5L9AA 4EUFA 2W6ID 3WFIA 4FCCA 4POAA 4F0JA 5CLHA 1FYVA 2BZSA 4P7KA 2ZM5A 3B9BA 5KPDA 4TT3D 1JLLB 1IJFA 4MW2A 2O2IA 3HJNA 2JIZD 2DT5A 1UT6A 3GF4A 4XVHA 4IDNA 4EB0A 4RK5A 3PSHA 1F2TA 4MP3A 2QENA 2WJAA 1XF1A 3B3JA 4MIOA 4X1KB 1TXGA 4DCOA 4YT4A 2QKYA 4CCYB 3G9XA 5DOVA 3LL7A 4ZVPA 3DZKA 1TIKA 4BP9A 2UZ4A 2EFCB 3FMGA 4MV9A 2ZK7A 1K7YA 5ICSA 1V16B 4PO8A 4TLEA 1VCHA 1K4KA 3JQAA 3S68A 1JBQA 3UVEA 2XCOA 2AC7A 4L0CA 5EWLA 4NAUA 1P7PA 2ZRHA 3RK1A 2YV3A 3RKSA 1C0EA 2ZU0C 3CH4B 3LQFA 1IM5A 1FFWA 4WL0A 7YASA 1DC5A 4Q66C 1JG3A 5ALWA 4F60A 4DV1B 5A02A 2GS9A 1I7LA 3AR5A 2R4QA 3O2JA 1VJGA 2F6RA 4UW9A 1PNVA 4ZO6A 3HGTA 4BMXA 2IV2X 1JH9A 3Q8XB 3S2IA 3QIVA 4WNAA 1MABA 1EYZA 1UT8A 3AXTA 3DFKA 4RIFA 3ZLJA 2E49A 2REOA 2A5GA 3ES9A 3UFXA 2OENG 1ADCA 5JMTA 1UBKS 1F2UB 1EDEA 1L4GA 2CL6X 3STWA 4K26A 1TEVA 1VGRA 1O89A 3MLAA 4PLWA 2RHCA 1GPMA 1KEWA 4JI4B 5G0SA 2EDCA 4B3TB 2FCRA 3IP5A 1K08A 2GFHA 2R86A 2NP7A 4G0ZA 4S1WA 2PKCA 3BC1A 1MG0A 2O1SA 3F8TA 2ZRDA 3L43A 4V0QA 1DEHA 3Q7RA 4M8SA 2PWPA 3AP1A 3M1LA 2W2LA 2PHZA 3PRJA 4I1RA 5E9JA 2HIHA 4YUXA 4MRVA 1XYYA 2ZJFA 2DJIA 3DO6A 3PEVA 4XX0A 5FKJA 1WD7A 1BXZA 1RLOA 2QMYA 3F5QA 4JL5A 2C5FA 1Z45A 1YF3A 3P2IA 2AGVA 3ET4A 5ADUS 4Y6SA 4ERNA 3N9IA 1V43A 2NTVA 3QBTA 3QTTA 1SXJA 2CNWD 3N2GA 4X6LA 1J1IA 1YONA 3VR2A 4HO1X 1HGXA 3SR0A 3WO1A 4A8TA 4B4KA 3DDHA 5AJWA 5KSYA 1SXJC 3IVGA 5JZMA 1VBKA 1YQEA 2C5EA 1ZRMA 3KKMA 3FDZB 5BV7A 1PZEA 4RU1A 2JFWA 3BOSA 5LMCA 5GINE 1YNSA 4HNUA 1RACA 2IX9A 2PAAA 4HGPA 1J24A 2WAOA 2ZG6A 5IUKC 4GMDA 4NFSA 2I66A 3JQFC 3W4IA 2R8BA 2J08A 3I39X 2UZ1A 4R9RA 1IY0A 2F8SA 2XYVA 1AGRA 3KEQA 1FMTA 3D0OA 1TIPA 4QJ4A 3RO7A 3V4LA 1V7PC 4CMKA 1BRTA 1BDIA 1JEJA 1T5LA 3K6KA 3HV2A 3P19A 4TN5A 1SXJB 2Q99A 4NEGA 1QORA 1IHUA 3ZE1B 4HKTA 5BR8B 4D5GA 3ZKWB 1HDIA 2DE0X 4B9AA 4G5OA 5CB0A 4IICA 3WKDA 1RIIA 4TTIA 2Y2UA 3DFFA 3GJ0A 4KUEA 3P9SA 3H1AA 4EZBA 1ZUHA 3VSCA 2F64A 4L73A 1YH3A 3DE1X 5AI8A 1NBME 3OETA 2C8KA 4Y9SA 5K0SA 2YZ7A 4Q3CA 4BNLA 3LFHA 4B3MB 4YXWD 2Z3VA 1R27A 2WVAA 5KQRA 3B5IA 4ZK2A 1N5IA 3S1SA 3STVA 4FFOA 1R15A 4UDOA 2CXXA 5ED0A 3KFLA 4WXHA 2Y1OA 3PKJA 5JXWA 1P0PA 5DDIP 2YY5A 1WCV1 1KTVA 1EVYA 5LQAA 3HYSA 3EJWA 2ON6A 4AX8A 2AW5A 4QUJA 4GPAA 3CZRA 4HZUA 5AYVA 1XU4A 3KAPA 5JV5A 2WJHA 4OGKA 5EGSA 1CY7A 4H7HA 4RMHA 4ETWA 2GCOA 2XF8A 4INJA 2RGYA 5BWBA 1ZJ5A 3PFNA 1XU7A 4IGEA 3DZJA 3FUTA 4TTRA 2ZUDA 3PGLA 4TV8F 1OLXB 3RIEA 1LS1A 2K2WA 4Y2XA 3I4LA 1B73A 1Y6RA 2E5WA 3D7LA 3WK9A 2GPNA 5JMPA 4P80A 2OB2A 4ZVNA 1ORWA 3L7NA 5IJAA 4EP1A 5BN3A 3IKMB 4BQOA 4EJ2A 2FA9A 1I3CA 2ZIWB 3V2IA 5KWJA 4C20A 5EMKA 4K3UA 2G5CA 3VUFA 4R83A 5AXCA 1W34A 2PRIA 4FJ2A 1DXHA 1CFJA 1KAGA 1HYBA 1A9PA 2GEBA 2GTHA 3ANMA 5CVDA 3MN1A 4BNDA 2XTJA 4JLJA 5DISB 3MTDA 1SELA 2XZTA 3Q5GA 1UJ5A 4DUZB 1U0NA 1VJ0A 4UAGA 3MS4A 3MJCA 4FGJA 1I10A 2TMDA 2V7UA 3D64A 4GEKA 3LBFA 1XX6A 2GM3A 3ZWQA 4KVGA 4KHPB 4F85A 4GVLA 4P82A 3LXXA 3F47A 3AFHA 4WVLA 3ZCPA 1KEZA 4LTMA 1PWZA 2Q9BA 1Y34E 2A0WA 4PRKA 1SVKA 1Z7GA 3ZQ6A 2R7LA 2C8VA 5E6UA 4W8OA 3VSEA 3CKYA 1C30B 2JLSA 1KEPA 1OI7A 4MVWA 3D81A 3EDOA 4PZCA 1PFKA 2SNIE 1V8DA 3CPHA 3RD5A 3AOEC 4ARBA 1H2RS 3Q2KA 2UV8A 4D1YA 2VJYA 4UPDA 3L82B 2G9RA 1RAHA 3I1IA 2VUUA 1COZA 2AFHA 1Z4LA 3BXPA 2G0AA 4ZCPA 4N6OA 1QP8A 4JI6B 2ZS7A 1FPQA 4WH0A 1M1YE 3RFVA 2OSVA 3CUYA 1KSFX 3U4IA 2XWBF 3F5SA 1MGOA 2IHVA 4LK3A 4IX9A 9MHTA 4PCAA 1SK9A 4EEKA 4CM3A 1LEHA 4NMHA 1Z74A 2VS1A 1QHNA 3C1TA 3C8UA 3MMNA 4LKOA 3TX2A 2VF4X 3U3XA 5LUAA 1O3YA 3ILYA 1PWHA 2QNRA 3F5DA 2JFYA 1NVBA 1XZJA 2ZYGA 1HO3A 3QXSA 2PMCA 1MX9A 4RQUA 4LFBB 3BT7A 4EHLA 2EEZA 1V1JA 3LYLA 1PZMA 4XWTA 5JU6A 5KQGA 2O19A 3WZMA 2GDJA 2WYHA 2P3LA 2VRCA 2W43A 2WSLA 4MVJG 4M46A 5DHQA 3AEUA 2M6KA 4O25A 4XZ3A 4FIZA 5JDCC 2ILTA 3I6BA 3HG7A 4HGYA 4IMRA 4KN5A 4WKCA 5IAEA 2KLHA 2RI6A 4H7FA 5FV7A 3ZHVA 3C7CB 3A6ZA 3PE6A 5C80A 2CHGA 3GXOA 3U4HA 4BMVA 2J0VA 4L0QA 4EY6A 3ABIA 1US8A 4GNRA 2BEUB 2PQ0A 3ETJA 1MOPA 2NVOA 3AKDA 3AX6A 4LOHA 5ESDA 1A0OA 2A9VA 1KQGA 4HS4A 1MT0A 2QRVB 2Z08A 4R1NA 1LPBB 4R1UA 4FN4A 4RHTA 1DQRA 3EBOA 4U2KA 2OXCA 1QG0A 4HNGA 4ZGGA 5CX1B 4I1PA 3FE2A 1FFYA 2FWRA 1VRCA 2QROA 4JMPA 1Y8QB 5AHWA 1XZPA 1AUQA 2GK6A 1TM3E 2J6IA 3ZPXA 1YOVB 2RFLA 4MP8A 3WADA 1LQ2A 4BBZA 1GSOA 2Q5CA 2ZTVA 1M2KA 2QLMA 1RWBA 4MDYA 2VKQA 3QG5A 3IELA 2DQ4A 3SQDA 1Y8ZA 3AJAA 1QHEA 3F4KA 1OUMA 3LCJA 3TAHA 1NOJA 4DG5A 4GL2A 4F6LA 2QXYA 2LGJA 3WDSA 2RGXA 4DS3A 3A11A 1WBJB 2XVAA 4B2YA 1B0UA 3GQBB 3ZGNA 4BV9A 4C0BA 4D44A 2JD1A 1UAAA 4IUDS 3RBVA 3CZCA 5JBQA 3EHDA 5BVGB 2ZSKA 4KCGA 5KI6A 2JGMA 1VLHA 2QMQA 2QAIA 2XY4A 3RCBA 2YBEA 5U1PA 1J0XO 2XMRA 3TIXB 2BI4A 3EH2A 3N8KA 1N6RA 2YMMA 2BGRA 2OLKA 3IIKA 3T5TA 2ZQ5A 3WWCA 6NULA 3TTWA 1DDOA 2WSSA 2P78A 5J5AA 2FE4A 4BGIA 4OYYA 2D62A 2NYRA 4I55B 5KNDD 2EVWX 1BJTA 3C74A 3H9UA 1EDZA 4EAAA 2QTMA 4UM5A 7ADHA 4MRPA 1BE6A 3K92A 1KIMA 2B4AA 3R7LA 2D74A 1FF9A 2J32A 3P0FA 3L46A 3O6VA 1Y6FA 4KR2A 3QMMA 3MK31 3CRNA 4XGIA 3A1UA 5DP1A 3WV5A 4A73A 2GLUA 4QYIA 2I5PO 2JRCA 4KITB 2C7PA 4QSMA 2Q5IA 1FMFA 3ICCA 1TKAA 5JJ5A 2O2XA 4RIHA 2EATA 3GEEA 4G0NA 5J5CA 4DB4A 4ALMA 1QMGA 2ZXEA 2IJGX 4CXMA 1UJBA 1WY7A 1X14A 3L8DA 4DRXB 4PZPA 2J3LA 3NYIA 5TMBA 4KH1A 2QTAA 2ZE5A 3IMKA 1E2HA 2OFWA 4XJXA 4NF2A 1L7VC 4Q48A 3RSHA 2ZYSA 4MVJD 3SC2A 1G9SA 1JJBA 2BH9A 1AS2A 2HWXA 2WMOB 4FBGA 4UBMA 4XWYA 1ZAYA 5LZ9A 4EELA 1CHDA 5E6RA 3F3KA 4B71A 3QWBA 3MS2A 2O20A 4JY7A 3ZEAA 1NUHA 3DEJA 1QOPB 1QC5A 1T4MA 3E6AA 2QE7A 4XPIA 4F2GA 5JQGF 3QVLA 3JZIA 3SS7X 1EWYA 4DUPA 1QFXA 2GB4A 3WYCA 4R31A 1LQUA 4B4WA 4EG4A 4E13A 4D4GA 3DAHA 2CNKA 1Y5MA 5HVNA 1CZHA 2QV7A 2O8DB 4FFRA 4TYWA 3F4BA 4MV6A 2Y1LA 1KZ7B 2LBPA 5CXQA 1D2HA 1M34E 4KNWA 1J9ZA 4AY6A 3GD7A 1QDUA 2G36A 3UNXA 2X1MA 3G2JA 4G24A 1DIAA 4OQZA 3WO0A 5CK4A 4EVSA 4XM2A 4NVRA 1MGPA 2F3RA 1QO0D 2CD9A 5ADVA 1ADBA 1TJ3A 3EWSA 2E7ZA 3IS3A 1FNSA 4JUDX 3AK4A 1H6AA 4H1TA 1XEFA 4X1OA 1DFIA 1MA0A 3QVKA 2Z98A 4C87A 4GIBA 1TJYA 3GUVA 4KUGA 2VHQA 2VTEA 4JSTA 4UHCA 4WJZA 4D5EA 2PR7A 3I9MA 1YNOA 2WU0A 1Z36A 1F17A 1VHQA 2ATIA 5COBA 4LHZA 3RG2A 1GSIA 1YIOA 4J4TA 2I3GA 4RFSB 4X60A 5LYJF 5DIZA 3MT0A 3FCUB 3S2UA 3NBXX 4RGVA 5F2KA 4L4ZA 2MYTA 3ASVA 5K0ZA 3UMCA 1K5PA 2LIPA 1CRZA 2DQZA 4XYMA 3ZHBA 3MC1A 4ZAVA 5C53B 4NH0A 5FFFA 3W8NA 1JZTA 1N5OX 4UAVA 2CWDA 3FCEA 4W5TA 2BM1A 2HWYA 3C3XA 2W2OA 1AIPA 3IIIA 3DDNA 3OUUA 2PZMA 3H1TA 2V7VA 3I4FA 3IDFA 2PR2A 3Q7IA 4GT1A 3ID6C 1IWOA 4QOGA 1PT8A 2AXPA 2PO7A 3SJAA 1NIPA 2WWXA 1U2GA 4DR6B 2JGAA 4KQ1A 1BAPA 4F92B 5AOAA 1IHOA 5FADA 2R6R1 1BVHA 4KX3A 3CIFA 5JRDS 1J2EA 1KU0A 5IDWA 3FZGA 3K9HA 1I32A 2ZBGA 3OQ1A 3M2TA 1ESDA 1M34A 2G8LA 3AZOA 1UR5A 3LCCA 4RPIA 2XJ9A 5JQWA 2F4VB 1CEYA 1Z0DA 3RM3A 3SQOA 3JD3A 3AUTA 2WEKA 5CFNA 3F1KA 3PVSA 3CSSA 2QN3A 3LJKA 4KI7A 2PYDA 3KKNA 2AS0A 1I3OA 1V47A 1IBCA 1L6RA 1G8JA 2QI9F 4FC7A 2O0JA 5I45A 4BXOB 2EW8A 1SG0A 2MSLA 2ZYVX 4JHXA 3A1DA 4QASA 1ILEA 2ZW9A 1Y33E 1RWOA 1P7ZA 2AYZA 2N75A 1TZMA 4R9SA 1Y7IA 4GLFA 3VHXA 4AJPA 3LW7A 1XCBA 1HI9A 1ZN7A 2FFJA 2G1KA 4ZCQA 5I9MA 3RK0A 3EEOA 3N2YA 1Z35A 1PGQA 1SHTX 2EARA 3C6YA 2OCAA 2J48A 2PSEA 2IYXA 4UJ3A 2V5UA 1X1TA 1N4AA 4DUGA 3NALA 3EDMA 5K01A 2QPLA 3FDXA 3TR6A 4IW3B 5K45A 4BMDA 2P7IA 2W2KA 3LBHA 3T1VA 1Q6YA 1UPBA 4KAJA 3K9FC 1NVUQ 1R00A 3DQQA 3EGOA 1L8QA 1V5WA 1VDMA 2PRJA 4ZYXA 1Z4OA 1Q6ZA 1GKUB 2OXEA 5MFPA 1GAQA 4ITVA 1EWVA 1K5GA 5IUNC 2Y9MB 2GPJA 5D5PA 5DIFA 1QHXA 1Z6PA 1L7NA 2IIQA 2OHOA 2WV7A 3AUSA 1OFGA 3LDFA 4IIUA 1WP4A 3F2VA 3CR8A 4NYIQ 1YASA 4H7DA 4EITA 1QG4A 3V2GA 2O5RA 4EF4A 2HA4A 3LXRA 5LQJA 3WSTA 1V1RB 1EUDB 3HXTA 1IRIA 2ECPA 3ODGA 4FNGA 4M0UA 3OZIA 1WW2A 3W2IA 2ZBQA 4LJAA 3OCUA 1NU8A 4H08A 3I72A 1BVUA 2WJZB 4EJ6A 1WX1A 2DH5A 4HQ0A 2ID8A 1X8JA 4IH4A 3ON5A 4PZ0A 1O6CA 1RWXA 4R6XA 3O8QA 4XCVA 1WP9A 1CSEE 5IAOA 1HNXB 4A26A 4RFLA 1YZNA 4G1FA 4MEAA 3RBZA 4B3BA 1L8XA 1JR3A 3D6JA 3DFZA 4A16A 1BC5A 1KMMA 2HRQA 3AEUB 3F67A 3O0TA 3Q0IA 1ZITA 3AOGA 4DDKA 2CCJA 3ROGA 3VOAA 3MMZA 4J91A 1V3UA 1QFJA 1T36A 3E18A 2DB3A 1ULBA 2GAFA 4LGYA 4HT3B 4MWOA 5IX8A 3SF8A 2JIMA 2XGJA 3E0QA 3ER8A 1N1MA 2E2WA 3V00A 1B93A 3UMRA 3IKJA 3VH2A 3HJAA 3ZWVA 2A9OA 4L4YA 1PN3A 1GTMA 3H2JA 3IUQA 4RS3A 3LUPA 4CGYA 1T2CA 3HYCA 3MHTA 5GVRA 3MWFA 3C16C 4Q15A 5D85A 5DRYA 1OMOA 1ECBA 3DNPA 1WTAA 2DBQA 1DBIA 5AOBA 5BWCA 3PWKA 2HCBA 1UXJA 1H0KA 5K8JB 4BQPA 2MSCB 1LGYA 2H1HA 1YO6A 2YJTD 3QVJA 4RHXA 5LC1A 4EHDA 1M5RA 5IBCA 3NTVA 3PEEA 2OG1A 4MO2A 1E8NA 1YHZA 1ABEA 4DLUA 5IMSA 3GEPA 2DWQA 3KWFA 3M6AA 3U44B 1C3OA 3MOSA 1KQNA 5BSHA 3NH6A 2H52A 4PIVA 4QTYA 1JA0A 2A9RA 1NI5A 4IWYA 4FR2A 1Q1EA 2WKSA 4NS1A 3KLPX 1EP2B 5LQSA 5CG2A 5FCDA 4BN4A 4MPPA 1L4KA 3KJGA 3MJEA 1E9RA 2E85A 3CVYA 4Y7DA 4EO7A 1GL6A 1OHHA 1CUEA 2YXEA 1EVJA 2AFHB 2C82A 2P6NA 3VPSA 4TYNA 1IB6A 3KIPA 4G97A 2SCUA 4PAQA 2WFZA 1EJ2A 1RRGA 5E4TA 1LVUA 3S8YA 1NKVA 5ARBA 3A9UA 1EVIA 1FFBA 1UBGA 4JP3A 4DEVA 2P2SA 3GPCA 4BE4A 1QV6A 1BS1A 3TQFA 1C9EA 4WZAA 1NF8A 2EWWA 4Y2TA 4Z3DA 1ADFA 2CFOA 2IF2A 4HUTA 3W4JA 4NK4A 2AUNA 1SHZA 1ENOA 2E37A 1YB4A 3BTUA 3OZEA 4OQLA 3BE8A 1G64A 10MHA 4PAWA 2PUFA 3W06A 4YMTA 5ISMA 1ST2A 5ALZA 1IQPA 4RM2A 2GSDA 3FGNA 4KQ6A 3I61A 1KJIA 1QYDA 4KN6A 1Q17A 4GI5A 1NW9B 1RQ2A 2EU8A 2OBMA 4TV8B 3URMA 2ZJ6A 5FA8A 3TGWA 1LJUA 2BFCB 5JH7B 5KQMA 1YBHA 3TOZA 3JASA 2XBUA 2VZ9A 1RLUA 3WIUA 1TQ8A 1G8AA 3HBFA 1WOYA 4HR7A 1WWKA 1KRWA 3GY0A 4IILA 3UB4A 4XYLA 3R7SA 2V54A 1E6MA 3X2FA 4BGUA 4DR7B 3S40A 1LV8A 3ER6A 2R8PA 4GOLD 2I9KA 4JVLA 4D3SA 3TYXA 1RYMA 4OV6B 1PEKE 3CNLA 1JA1A 9GPBA 4AICA 5MGBA 2GBLA 5SY6A 4ZARA 2WKPA 2C5BA 2Q4TA 2EL7A 4RWZA 2Z43A 4WCFB 4PFJA 2JKZA 1ZN2A 2BBWA 2NT4A 3LBNA 3LKBA 3UJBA 3PFCA 1DKQA 4KXUA 4HV4A 4OJTA 2YNMD 5D7BA 5DW0A 3SJBA 2VJQA 2VYQA 2CVZA 4LW8A 5JEDA 3KELA 3AVTA 5JECA 1RJEA 2QTVB 4Y2HA 4DXDA 4MGYR 3EODA 4N4AA 4CNBA 4DVJA 3TRDA 3KV1A 4KMRA 1KYWA 1JH8A 5LOVB 1V11A 3RK4A 2D1RA 3PQFA 3P9XA 2YWHA 3FY4A 3OSUA 4JEMA 2WY2D 4LJ8A 5JFGA 2GNPA 2VP9A 2B3DA 1TZBA 4F2DA 3HZRA 4OVKA 1KK0A 4Q39A 1SUWA 1W93A 3A1WA 3CLTD 1JHMA 2FMHA 2XI4A 4GZ3A 5LB4A 2NU9B 4YJDA 1O94D 3FCYA 5ADWA 1V4BA 1X1SA 2DCMA 4BECA 2W8BA 1QLJA 3IEPA 4WDRA 1BDMA 1GL7A 3ZKWA 4ENSA 4CIDA 3L05A 521PA 5A5VA 3U7FB 2WG1A 4OL9A 1CE8B 1NJ2A 1QO7A 1U3DA 4N5MA 1I1OA 4F3RA 4RTOA 4LXIA 2CVHA 4LNAA 2WWYA 4MI3A 1GDHA 4R1LA 2XMCA 5FX2A 3GL9A 1NNI1 4ZXFA 2W0SA 1HUQA 3EQ8A 3M5PA 5EJ6A 3LHKA 4HAWA 4CF7A 2Q41A 2GWRA 4C6HA 4QOJA 2HV9A 3W0LB 3OZGA 5KX5A 4IHJB 3LVRE 4IJ5A 3RS2A 1BX0A 1M6WA 3LSYA 3WLLA 1ZM3A 2E48A 5JAQA 2QRKA 5FOWA 4CIAA 3IVMA 2D2VA 3GA7A 1N0UA 3K1ZA 1RXWA 3NCTA 2JLWA 2ZYAA 1TT5A 1AZLA 4L8LA 3S1AA 3V8MA 1MJGA 3AL0C 3W5IA 3VOTA 3DXFA 3GK3A 3WI7A 5K03A 2H31A 2WT4A 5I4BA 4Q3NA 4LY6A 4AJJA 4OMUA 1GUFA 4S24A 5TVKA 3GFTA 1KI2A 5BSMA 3F71A 3G1UA 2VDQB 3H1BA 4JDPA 4EUNA 1I33A 1KK3A 3D8UA 1G3RA 1KJQA 4DR2B 1PV2A 2QBYA 1N0IA 3EZ6A 1J06A 1Z8HA 5EJ7A 3WQHA 2O54A 1NN1A 3SOPA 1MUUA 1SA0A 1WRBA 3NJ4A 1UBHS 2EIXA 4J75A 4ZQHA 4TZ6A 4CQJA 3PI6A 4OUKX 3AB7A 1SOVA 5CD1A 1FX1A 3SNHA 4I2VA 4K03A 2QSYA 4G0XA 4ZAYA 3ZG6A 2Z3ZA 1YOVA 5G53C 3GVIA 2JGNA 3KLMX 1Z62A 1MB0A 4Y3UA 4GP9A 1C4XA 3AIOA 3RTEA 4BBJA 1JYEA 5A3JA 2NQTA 2ZVPX 3Q11A 4RY9A 1JEOA 3DM5A 1E5VA 1XV5A 1BEUB 3ET5A 1XWWA 3IPLA 2TECE 5D1HA 5AM4A 3RVPA 1AU9A 1Q95A 4OX9B 3K73O 3EASA 4RJTA 1A7KA 2V0NA 4M88A 3DEKA 2XUGA 4N03A 4W7SA 2GZDA 3C1AA 4CM9A 4DQLA 1E6LA 1WXQA 3TINA 4KYTA 1BH2A 4ZANA 3O47A 3RFTA 5I7RA 4ZO8A 2YJ3A 3IDAA 1WVMA 3GAMA 3ABQB 5JHHB 5BMOA 1B4DA 3H05A 1WVGA 2LCQA 3RUAA 2X8WA 4FMPA 2OAEA 2RJ3A 3IR6A 3PXCX 4EYGA 3KTAA 3RVKA 3KQTA 4D9MA 4RW0A 2I03A 2BMJA 1ZL0A 1YU9A 4G1MB 1L0BA 4FBMA 1MQ8B 5JJLA 2FSVC 4DSOA 4W5HA 1M8FA 2H16A 2ZSIA 5D3QA 4BLSA 4X7PA 1O6GA 3OAAD 1T1IA 5T3UA 2XUOA 3Q3EA 1D2CA 4MYUA 1H8ED 1NMZA 4YRTA 3WWEA 2B69A 2G67A 3KJHA 3R5SA 2XCSB 1E6UA 1LBHA 1YUNA 3PSAA 3IPCA 4QDUA 4QPNA 1NXPA 4YJ3A 1JR2A 5FOVA 4NATA 3S6JA 3VISA 5HMMA 4CG2A 1HSOA 3N5CA 4J1NA 1Z2NX 2CZCA 5F73A 3COJA 4N3GA 3GU3A 4JBGA 5B1EA 5AK6A 1YBFA 4CN9A 4WZ6A 4J4BA 1MJ5A 1CUSA 1OD6A 1V8OA 1XA0A 2FNAA 2FGKA 3E7WA 3TW0A 1Y6ZA 3NM5A 1DELA 1TK2A 2H57A 3E7DA 5K05A 1ZCBA 1SBYA 1FYEA 3GRKA 3AR7A 2HQOA 3HUFA 2DTXA 2Z2ZA 4N5LA 2R1TB 3LY8A 4AYXA 1UFQA 2VJMA 3NB0A 4HK4A 1OT3A 1XXHB 2A88A 2NX2A 3A70A 3EOBI 3ODPA 3O9ZA 4HN4B 3WL5A 3UPTA 4H6VA 3DMNA 1VJ5A 4LDQA 1QGYA 2BEKA 3ILVA 4RTPA 4EGQA 2GYYA 1U6KA 3CLUD 3P9RA 4R01A 3L4BA 5K3SA 4XXHA 2OCIA 1IAVA 3NHFA 3OF5A 3EW7A 5DTIA 4OBXA 1PWYE 4HNTA 1OWMA 2VYND 3EW9A 5BXQC 2ZWIA 1WBBA 4EZIA 1SOMA 2P4UA 4K8OA 4Q9AA 2IHTA 1OZAA 1AQLA 1K8ZB 1R8QA 1IJEA 1I6LA 3SS8A 3AF5A 3KSBC 2OMEA 4PX3A 1JDBC 4IDOA 2QGZA 3FLEA 3H3FA 1PFYA 4Z0TA 1FJXA 3KOOA 4F1KA 1VECA 4X95A 2GCGA 2ZBUA 3F7TA 1YCDA 2ES4A 4KXWA 4L57A 4OPMA 1O03A 1KI6A 1X13A 2FPOA 4PBSA 2ORVA 4QFDA 5LQDA 1GPJA 1MBZA 2XBLA 4TT3A 4XSVA 3RSZA 5FI0B 1E4EB 2E89A 3QXXA 3IQGX 3LU1A 4LV6A 2AI1A 4AS2A 4GOMD 2VF5X 2ZATA 1ADGA 1A2OA 3GQBA 3L1UA 3I01A 1OTXA 2N3ZA 3AP3A 5BRAA 3ZTYA 1RVDA 4PLCA 3WIDA 4GRAA 3UC5A 3SYTA 1Y4SA 2MCFA 1NDHA 1RFGE 3CPSA 2E5LB 4CM4A 4ZRNA 4QO8A 3GHYA 4JMLA 2YWRA 1NHGA 3M5CA 3LUFA 3CFYA 1X9HA 3K1YA 4FZ5A 4GM0A 4LOLA 3FF1A 4RDHA 1KDVA 3KWJA 3RHTA 3S7TA 1XTTA 5CDTA 3MSCA 3T95A 1HTWA 1WBDA 2DBRA 1U8AA 3ENWA 3MPOA 2A0YA 2DU8A 2HJVA 3EGXB 4RY0A 4U6QA 1CERA 4DANA 4OXNA 5AVRA 2H9AA 2EHJA 3FAZA 3VZSA 1LDBA 1X8LA 3J7AC 2ZB8A 2AFHE 2XYHA 3H8VA 4P3YA 4IV0A 4ZVMA 5C8YF 4TS3A 5DM0A 3AVUA 1BO6A 2FF5A 1T2EA 1C50A 3H1PA 3LECA 2XOKA 3PGXA 1XCLA 4QDXA 1PJ3A 4LBYA 1QO0A 4DA8A 5IJ0A 1DJLA 3SYRA 1RBMA 5COQA 4EG3A 3HU5A 3TPZA 5FWXB 4EG0A 1UJ2A 3QY0A 4FE3A 3U81A 2EOAA 5AKXA 3JQ9A 5CVJA 4OX9Y 4I1OA 3A2KA 1P7YA 4FFMA 4K9NA 1VHDA 1GT91 2HEGA 1CUJA 2PSFA 3NP7A 2R47A 1M6HA 2D13A 3ELYA 1G2OA 1MMFB 2HGZA 1IPFA 1YHNA 3N7AA 3NZEA 2G82A 1ZGCA 1F0YA 4XX0B 5CA1F 1AUVA 4Z3OA 1JKJB 4AMZA 4DAOA 4LWOA 1EU1A 1SUAA 2JAUA 1DDGA 3HKCA 5F1YA 3WWDA 4K6HA 1E1LA 5F2EA 3TZKA 5T64A 4G25A 2WUEA 2QTLA 4FJ0A 4EIWA 4QD3A 1JGTA 4EVQA 1E64A 1E7MA 1QK5A 3IE1A 4AIIA 1DKPA 1WXGA 4ZYYA 2Q1TA 4B4UA 1Q20A 1E2PA 3CUEF 3FMVA 1PFGA 4NPAA 5EYPA 3QUSA 1UINA 2WHQA 4JJGA 2VUTA 5IVPA 2HX1A 4C6TB 1FYDA 1T3SA 3O31A 2V9ZA 3ORRA 5CB6A 3KNZA 1KDTA 4X85A 4AJ4A 3NTLA 3AY6A 1SURA 1Z4IA 4TLAA 4I66A 4J0JA 5AOCA 3A25A 1JSCA 1NRJB 1WIWA 3OICA 3EDQA 2R9VA 2HZBA 4DMMA 5A4FS 1T6NA 1DXOA 4Q9IA 2AJDA 4JOSA 3RIGA 2ZP1A 4ALLA 4E33A 4XGRA 4V0OA 3O8OA 3T3MB 2B4RO 3QP9A 3LXMA 4MA5A 5AVOA 5LM3A 2DWOA 3HPRA 4L0MA 2NO9A 2QTNA 3VDRA 5B1DA 1N77A 3UM9A 4IQFA 1RQRA 1UPCA 4RNDB 1HL7A 3WB2A 1TEHA 3AESB 3L8EA 2JNWA 4R81A 1S8FA 3C6MA 2KBFA 4LWZA 4S1OA 1Z7EA 1Z33A 2H06A 5B1HA 3UC9A 2BAGA 4H59A 2QG6A 4ZT3A 1NQOA 1DG9A 2EQAA 3N28A 3QMPA 2UZIR 3LFTA 1GR0A 2IXBA 1ZQ9A 2PLNA 4JIGA 3FETA 3ELWA 4IS2A 4X5OA 1R50A 3QU2A 2B7CA 4ZP1A 2FFQA 5E1BA 5EWMA 4E31A 1AKNA 4M8LA 3IODA 2F48A 5KIAA 1ZWLA 4MWGA 1NXTA 3LUDA 4LYGA 3AHCA 2XUFA 2IDKA 3L7LA 3K8OE 4DMKA 1XELA 4P4GA 3CIOA 1XNQB 4K9MA 3VYRB 1KXZA 2B4YA 1A7UA 3JYNA 3WNDA 5J2TA 3I9OA 4A8JC 2IOFA 4AC9A 1J0CA 1CY6A 4OIFA 5BV2P 4KQHA 5JD6A 1AHPA 1T8PA 4Q16A 1G291 3CW8X 4Q4LA 2VA9A 4TLMB 4ZCTA 3AF6A 3NH9A 5TX7A 3V4PB 4E5PA 3VX4A 4TQAA 2YCBA 4WMLA 1QVRA 4GZMA 1DBSA 1DVRA 4NDZA 3WMRA 2BKUA 2CCGA 3D6UA 4M89A 2O06A 1C9DB 1G7SA 1H5QA 3D4IA 4ID3A 1WKCA 3CNHA 4R84A 3RQSA 4BNKA 1R4MB 1LBEA 1VBFA 4JK3A 2QVXX 4IHKA 1L5WA 4N7JA 4PQFA 5DP2A 4G2TA 4IM7A 4N3NA 4FSHA 1T9GR 2PZBA 1LB1B 1P18A 2O0HA 3FYUB 3ZH2A 3IQHX 3I6MA 1E2GA 3NWJA 3Q3JB 5ALRA 2O1XA 3SMQA 4CMBA 3AF2A 1GZ5A 5B7GA 3DL4A 2O5VA 3A6LA 1XRQA 4WA7A 3ZD9A 2AJTA 3DWIA 4ZREA 3UOWA 4BN5A 3GLHB 4XDYA 2H2IA 2GHIA 3TLAA 3AUJB 5G4LA 5FPQA 4QT4A 2I6QA 5DSTA 2JI9A 6Q21A 3Q8LA 2BF4A 1C4KA 4BPBA 1U0GA 1MIOA 1J8FA 4FHFA 4EZEA 4NBRA 1GRQA 1UXKA 2QQGA 3T0GA 4Z7JA 1VL1A 3OZ7A 1QIMA 4OGGA 1LPOA 1CR1A 2X4IA 3IULA 2HJSA 3COZA 1BHSA 1KH1A 3NP9A 5DT2A 3HVKA 2I6SA 3OFND 1CHNA 4MARA 3O82A 3W8EA 2CHVA 1Y89A 1J0DA 3MXTA 1I1QB 1M73E 1UWCA 1Y4AE 1AQUA 4B3HA 2HTEA 4LJYA 4GPEA 5KWEA 1U31A 1CYEA 3G6WA 3FIUA 2YN0A 4AKEA 4DA0A 4UTPA 4DCVA 3SR3A 1P3JA 4TLBA 4XDZA 3M49A 1WSDA 4OQQA 4ARZA 3HKDA 4YTEA 1OC4A 4XDGA 3KSUA 5REQB 1Y3AA 4OBEA 1FQWA 4CKWA 4WZZA 1DEAA 2HLNA 4D42A 5K6AC 1NOIA 1G41A 2OV8A 4WZBA 2IHUA 4X66B 2H4JA 4GPD1 1Q0TA 2RHJA 1SC6A 3NHKA 3TLGA 4CKEA 2QG4A 3URKA 5B30A 4Y2GA 2FOXA 2Y0EA 4GWLA 1V1MA 3FG9A 1GPNA 4FINA 4U7DA 2QMOA 3N3BC 3TD9A 3NTQA 1J2YA 4GMHA 4H0FA 1C7JA 2FZEA 3QBJA 3GPDG 5AW1A 1F5NA 1A9SA 4WLFA 1N9KA 2VKTA 1P91A 3HJTA 4LQLA 3V80A 2AZ4A 1SKYB 4TTSA 1T2DA 2CXSA 4D9HA 2CNNA 4NOJA 1N3LA 3Q3VA 4U4AA 3KOXA 4GZ6A 2YIDA 4OQ4A 3RJ9A 3VVCA 5IVHA 4WNIA 2VDOB 3S0JA 1KMQA 3MBIA 3QVGB 4DYDA 5HHTA 3R7BA 1F6DA 2REQB 5M04A 2KM1A 1E1YA 3NU1A 3S5UA 2D2IA 3GLFB 1V1MB 5KKCA 1AKMA 2ZR8A 2FSSA 1Z6GA 3IUYA 2MINB 3RC9A 4ZJZA 2VDPB 4JVMA 3JYQA 2YXBA 2VRCD 4OHKA 1AKRA 4OHBA 2D4HA 2ZT5A 3WX0A 4Z54A 3BMOB 2GVZC 1CUFA 3IBCA 3ILHA 3QH4A 4RKWA 2C4VA 5C4MA 3B12A 4X84A 4TN1A 1WEHA 5DE3A