1YU9A

Gppnhp-bound rab4a
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
175
structure length
175
Chain Sequence
GPLGSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGEDVEEAFVQCARKILNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of family-wide Rab GTPase recognition by rabenosyn-5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords GTP-binding protein
total genus 60
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2005-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1yu9A01
5E7MA 3C5CA 1SXJB 2CCJA 4LJ6A 5AUPB 1PLLA 2W0MA 1G64A 2AWOA 3JVUA 1DAEA 3P32A 4JKIA 3GLIA 1I2MA 4JSYA 1EWQA 4URZR 2YINC 1TQ4A 4JBYA 1LS6A 3U60B 4JZKA 3WP0A 3ND8A 5J4KA 3U3JA 4A0RA 2IF0A 1OIVA 2ZRJA 3B85A 3CR7A 4NYMQ 1G8PA 4E22A 1JPNA 1VPLA 2PX0A 3BGWA 4HDCA 2WWFA 3V00A 4A82A 1IAQA 3ADDA 2PZFA 2IBMA 3K0SA 4OQLA 2V1UA 2IYSA 3RS4A 3TSZA 4WBSA 2CL0X 2HT1A 3LRPA 2EWVA 2QMEA 1U0LA 3CPHA 4LPKA 2OEPA 3EZ7A 3OFNA 5B58C 4HB4A 4IOLA 1EFTA 3THWB 2ZYVX 1IXSB 2VP9A 4BUJA 1DAGA 2XB2A 1KO1A 1M7HA 2DPXA 2FEMA 1US8A 2AFIE 3CNOA 4Q4JA 2O8EA 5FR1A 4QJ5A 1XJCA 5L3RA 1X8JA 2C77A 3U4QB 4M9ZA 3AGQA 4TLAA 1TUIA 1ZM4A 2P2LA 1TF5A 4A6XA 4Y0AA 5FUVA 4O25A 3GJ0A 1NLYA 4JT4A 1E9EA 3AF0A 1XTRA 2GRJA 3TVTA 5ANRB 2O8DB 1E9AA 3QKSB 4Q19A 1PLKA 1XWIA 2QAJA 2OUKA 3BFXA 3P20A 2BMDA 4M9SA 3QE0A 1IN8A 2AK2A 4N0EA 4ACBA 5C46F 4UNQA 821PA 1GDDA 5JJKA 1BKDR 1XTKA 5DI3A 1CP2A 2GJ8A 3GFOA 2C9YA 2RGBA 5LBIA 5LD2B 5JI3E 2WOJA 4IOMA 3L0PA 3LWNA 4Q4AB 1S9DA 4GRAA 2JLVA 2CK3D 1A2KC 1UM8A 2EW1A 2ZU0C 3MRSA 3KFVA 2C9CA 2Q9BA 1E0AA 2QN6A 4W5HA 2XZOA 2XXAA 1UJ2A 1BOFA 3QOFA 3SHFA 4YDHB 2ZREA 1UF9A 1KO5A 4GSYA 4GOJA 2IYVA 4LCBA 2W6JA 4EKDA 1OKKA 4PZLA 2IS6A 1ODFA 2VLIA 4HLDA 5KUTA 2FSHA 5LPNA 4DBLC 1XB2A 2P6RA 4NTZA 1TL7C 4HZUA 1JR3D 1AZSC 4AKEA 2YOHA 4ARZB 2G77B 2ZITA 4JLKA 4JL8A 1Z6YA 2AFHE 1SVSA 1E2FA 1UBFA 2XSZA 2XGJA 2SHKA 1VECA 1YZLA 1ZM9A 2WKPA 2QP9X 4FI3C 2WWHA 4G5OA 4URYR 5DGXA 5HKKD 5JWRA 1YZGA 3H0KA 2R9VA 1FPMA 5C18A 4M9QA 4Z1MA 3EPLA 4LYJA 3BH0A 3QI2A 4PQYA 3AKEA 2AD5A 2ONJA 4JMPA 1SZPA 3BE4A 2GXQA 2CNWA 1E2DA 4NONA 2CHGA 4QNMA 5BW8A 3NHAA 5AUQA 3IEUA 1ELOA 2DY1A 4QGAA 1E9RA 1I2DA 1NKSA 1UDWA 2J1LA 3TH5A 1TF7A 4RD4A 2Z5FA 2Q3FA 1KJWA 1KSFX 4DSUA 3RRYA 4KLNA 4XH9B 3HPRA 3SJBA 4B43A 3GP8A 1OE0A 1GNPA 2REXB 3O8BA 4HUQA 5LDDC 3MFYA 5DI3B 1W2GA 1WA5A 2ZI3A 3JVVA 3CNNA 1DTSA 1S4QA 4DEYA 2CL6X 3UATA 2JJ1A 4JVNA 3JZMA 1KDTA 1E9FA 2OZEA 1DG3A 3T1TA 1WRBA 4TMVA 4AD8A 2JJ2D 4ZDIA 5DYGA 1KYIA 2F1HA 4ZI3A 4C2TA 4LC0A 3NDBB 3B78A 2KJQA 3MWYW 4Q21A 5FH9A 3G0HA 3RABA 1RC8A 4MYTA 5CYOA 1Z6AA 4JLVA 1IN5A 4KV9A 3BWDD 3AVWA 5TDHA 3IBGA 1N6HA 1K6MA 2YWHA 1X6VA 2J0VA 2B7BA 1UBCA 3SU8A 2CLDX 2AX4A 1PZNA 1N0WA 4KSCA 4EPVA 2MMCA 4JJKA 2ZRBA 5LD2C 3M0EA 2F1JA 4L5BA 1TMKA 4JSTA 2FZ4A 4Q01A 4BFZA 4DCSA 3U6KA 2DB3A 5CM9C 4DZZA 4QHSA 5HCIA 1GSIA 2KBFA 2PCJA 4DDUA 3IGFA 4DLUA 1GNQA 2NZJA 3QPWA 4P4UA 3V9PA 1E0JA 4NHOA 4TSFD 5H70A 1I4DD 1VCNA 1SXJE 2PL3A 1Q3HA 3LFUA 4HUTA 3KXKA 4B35A 4GP6A 4X8LA 2RHMA 3GJ3A 3RSLA 3D6TB 4C0BA 1CIPA 3AKYA 3KQLA 2AWNA 4UKDA 121PA 3DMDA 1K5GA 3LAWA 3FWYA 4C0SA 2ZJBA 4MRRA 1PUIA 4ARZA 2VSXA 4KXFB 4XWAA 1YE8A 4QRHA 4IDHA 1T9HA 1G1MA 3I5YA 3BXZA 2WIBA 3AF1A 2HYIC 5BWMA 1ESMA 3THXB 4F7WA 3QXHA 1ZC3A 4AY2A 1EFUA 1XXHA 2FV8A 3PR1A 4MYCA 2A30A 2R6FA 4LI0A 3K8YA 4D25A 3UK6A 3K9LA 5FOXA 3VHXA 3X1WA 4CT4B 1GRRA 4LUCA 2CEAA 3D3QA 1ZUHA 4JLPA 5F3WB 3WXMA 4ZIRB 2Z4RA 1U99A 1IBRA 1Z47A 2YKGA 1J8YF 5BXQC 4IOKA 5F2EA 3UMSA 2G0NA 1VHTA 2V7QD 3RSOA 4AYWA 1LF5A 1Z06A 1R5NA 5FPYA 3EPJA 2ZRCA 1NBMD 3THYA 4KFRA 3CONA 2HDNB 3PIRA 4Q7KA 1M2OB 4CEJA 2ORWA 3KXLA 4TL8A 4CF7A 3QKUA 3EARA 3NEYA 4ESVA 4MUBA 2P0EA 3TKLA 2DCUA 1KO4A 3BK7A 4D0LB 3DOFA 1UBGA 1N25A 2ZS9A 3OEEA 1IJFA 1GL9B 1W4AA 4Q03A 2KE5A 1NKTA 1XCMA 3EZ9A 1PLJA 1W0JA 3IO5A 1E3MA 1RRFA 3QJYA 4W9MC 2OCPA 2E1RA 2QE7D 1F2TB 2F7SA 1S3GA 2J87A 4DKXA 4DLXA 1N0UA 1GKYA 1HYQA 2QTFA 2YHSA 5EE5B 4LHXA 2IS1A 3PEUA 4LWZA 2YNMA 5JBQA 1SKYB 3NBYC 1GL7A 4HATA 1QF9A 1AKEA 2OFOA 1OFUX 1ETUA 1AKYA 5BYKA 3EPKA 4ON9A 4M1TA 1GUAA 1UKZA 3WMEA 4JLDA 5IHPA 1T0JB 2JDIA 1WDTA 4W5WA 2OCYC 4LBVA 3BB3A 3QKRA 4QJ3A 1OH6A 1H65A 1QHGA 1XCPA 4V02A 2O8BB 3FGNA 4AYXA 2ZJZA 2G88A 4F4JA 1W4RA 5GJVC 5L3QA 3T34A 2FEOA 3EWAA 3NTUA 4LJAA 1XZPA 3PXGA 1XFAA 3MWLA 4YQFA 3IPYA 4GZLA 1TADA 3WMGA 1DOAA 4DLRA 1P75A 2PCLA 1XEXA 2EQBA 1GFIA 2ZU6A 3WHKA 3SHWA 1BYIA 1XPUA 1Z6XA 4RCZA 1XCGB 4V0MA 1XEWX 5EJEA 4QL3A 4B44A 3DKVA 3I4LA 4WVFA 3KQNA 4C2UA 2EFHB 4RFSA 3T5DA 4MRNA 1G3QA 2CE7A 1HQYE 4FIDA 5DO9A 4EJSC 5HR5A 3IQWA 4ZDKA 4TYQA 1NSTA 2ASEA 3TMKA 3ADKA 3ZS8A 3AUYA 3U2QA 3BH6A 3T1QA 4PAOA 1S9HA 3KX2A 1E2GA 3GEHA 5H1YA 3EZ2A 3VKWA 2BVNA 2WWYA 4TLEA 4DCVA 4C7OA 2WTUA 2GEDA 1E1QD 1IY2A 2C95A 1RRPA 4PO1A 4Q9IA 3R20A 3T35A 2PEZA 4D81A 1ZIPA 1XXHB 4EFNA 3WHLA 1U2RA 1SHKA 3ETLA 4A2PA 1BIFA 4I81A 1X1RA 5FL7A 5FUWA 2Y8EA 4AKIA 1ESNA 5FTJA 1G5RA 2ANCA 2BEJA 4PHFA 1RIFA 1L7VC 2HCBA 3FKSD 4G5QA 4DLYA 2O8CA 2IXGA 3CPEA 2GWHA 4GOXA 4EQ6B 1ANKA 1II0A 2PZEA 1RVDA 4QOSA 4Q1AA 4FWIB 3WYFA 1I4LD 1TAGA 2NTYC 1E1RA 3ZVMA 4B71A 2J0SA 1KI3A 5FBQB 4DDTA 2GDJA 2ZRIA 4I1UA 2HLDA 4TN1A 2FFBA 1U81A 4G1UC 4YXWD 4UJ3A 3ECCA 1FX0B 5CK5A 4B34A 3VR3A 2D06A 2LKCA 4NDZA 4XOIA 2AHOA 5KU1A 1OFIA 1ONBA 2O8DA 3THOA 5J4HA 2Z83A 4MYHA 1UPTA 5B30A 3RNLA 4YMVA 1OV4A 1KSJA 4TQAA 4JBXA 4N1AA 1U94A 1VG9B 5P21A 2FMXA 4NYIR 4AG6A 3ZYCA 1G20E 4TYNA 1IXZA 3ZVNA 1HUQA 3B7GA 4G3XA 3I32A 1ZCAA 1G4UR 3I3SR 2GXUA 1J7KA 2OG2A 3PUZA 4FINA 4HAXA 2IS2A 4DIDA 2VPPA 1E0KA 2XZLA 4XJXA 1Z0DA 2W2VA 2ZROA 3W8NA 2ZI4A 1F60A 2VEDA 2HXYA 3KB2A 3Q85A 3DMNA 4OQFA 3QEOA 4P33A 2IUUA 1NVXQ 2N42A 1E2MA 3RVBA 1QBKC 1XP8A 1G3MA 1IY1A 1TNDA 3CLVA 2WM9B 3FMPB 4PPFA 2F43A 5KPDA 2IYQA 2RGEA 2O8CB 2R6CA 2ZXUA 4QC2A 1GTVA 2F9MA 2P3SA 2X2FA 1D6JA 4LHZA 4ZI2A 2B92A 4JLAA 4B74A 5B64A 5HZHA 3GQBA 3KKPA 3ZH9B 5JSZB 1J8MF 4A8JC 1YVDA 4HYYA 4LJ4A 3QSYA 3MJHA 3GLIE 1MRNA 2BJVA 4UXHA 2G83A 1IXRC 2ZTSA 4PHTA 1M34E 1T8TA 2YWGA 4LRWA 4MGIR 2CLSA 1CLUA 1ZM7A 4NMMA 2NMVA 5G3ZA 3CM0A 3GEIA 2QT1A 2EFGA 3DPUA 4KBGA 3ZVLA 1DADA 1KAOA 3TE6A 3SFZA 4G0NA 4DLZA 1UFQA 1KKLA 5E95A 3H86A 5DHAA 2EYQA 2ZE8A 1GRNA 1E2HA 1JI0A 2BBOA 2NO7A 3MGCA 4TLDA 4B76A 1NMYA 721PA 3NHBA 2FFHA 1QHHB 3G5UA 4RD1A 2BHRA 1GITA 2ERXA 3KJEA 2D7CA 5CB8A 2J9RA 3BFVA 4NCNA 1NJFA 1NSFA 1UEJA 1DARA 2IT1A 1LF0A 4R7ZA 1XTIA 4DC9A 3SJAA 1P2SA 3H2YA 4DHEA 3QKSA 3DOEA 2NIPA 2ONKA 3K9HA 2J0UA 3EIEA 3MUFA 1JEDA 1Q20A 2QPAA 1LVGA 1W0KA 2XSZD 1A1VA 2BBTA 3KTAB 4LJ5A 3IIJA 2HJVA 2QMUA 2ZI9A 3QUSA 1Q21A 5FOSA 2QPTA 4K81B 2F6RA 3J81k 1E96A 5JRJA 2CBZA 3AP3A 2O0HA 1CXZA 1EGAA 1T8UA 2QT0A 2BOVA 2VHQA 1Q22A 5JSZA 5L3VA 1WMSA 3BRWD 3SC3A 1COWD 4LZZA 5AJYA 1JR3E 4F93B 2VP4A 3L0OA 4FCTA 5KSYA 1LB1B 3L0SA 4BFYA 5TV2A 4OI0A 3F0TA 4MGKR 4WXRA 4EFLA 5EE0A 1FNNA 3A36A 5FR2A 5IF9A 2RMKA 4DLSA 3RRMA 2JJ1D 1V43A 3LVRE 3RS3A 2FGJA 3NH6A 3BH7A 1KJYA 3ZVRA 3AP2A 1T6NA 4OHWA 1EWRA 3TAUA 1M1YE 3D31A 3IEVA 1Z0FA 2XZPA 5FOVA 1VG1A 4IDNA 2NOAA 2ZRPA 4YDSA 2VP5A 2QUZA 5FBVB 3L82B 3RWMB 3AH8A 3Q3JB 4V0KA 5TARA 2EVWX 4LJYA 1P60A 1YR9A 1E9DA 5DLQC 3HYRA 3R8FA 2V54A 3GLHA 2OCBA 1BO6A 4CEHA 5JEEA 3L43A 2XTNA 4UXJA 2H8KA 4A8JA 1SVOA 3KFXA 4NYIQ 3W90A 4PZZA 4DJTA 2ZE5A 3THYB 4B2LA 4WIAA 3AVUA 2Q3HA 2HYDA 3VR6A 5AK0A 1CJMA 1R0YA 1UKVY 3RYTC 4F38A 5KSOA 2IC5A 4EUNA 4EAQA 5A4JA 3SQWA 4PC3A 2GILA 1KDPA 1TPZA 4NL4H 4DDVA 1R8SA 1Z07A 2WSMA 1R6BX 4KCGA 1N6RA 4B3FX 4M9XA 1N2CE 4OK6A 4IXNA 1IOZA 3KKMA 4PPGA 2JLZA 3MG9A 2J7PA 1I4TD 2V7QA 3K0CA 1WE2A 4LV5B 4PPQA 2VSOA 5FPKA 1S1MA 2A5YB 2QA5A 1JR6A 3ADBA 1ZRHA 3CH5A 4BE7B 1OIXA 3PUWA 3VR5A 1AK2A 3AF4A 3CNLA 1NJGA 4A0FA 1ZBDA 2H92A 1P61B 3OAAA 4O0MA 3VFDA 4XWOA 2ZR0A 1NIPA 5L3QB 4R2HA 5GJWC 1OYWA 4IFBA 4RFVA 3LY5A 1ZUNB 4JT2A 1Q0UA 4XWKA 2WAYA 4ZO4A 4Q9HA 4EFMA 3CZQA 3U4QA 3CIOA 1YKSA 3K0AB 4US1R 5TMPA 2WAXA 4Q4JB 3TLXA 3B2EA 4TMKA 1NMZA 4TLCA 1EX6A 1GKIA 4X8OA 1C4OA 1J90A 1KK0A 1JBKA 1E9SA 2ZANA 2ZVQX 2HF9A 1QHXA 4BPBA 2F43B 2YOGA 2IF2A 1P6XA 2ODEA 3HYTA 5AR1A 4WAUA 3E70C 2P6UA 3OZXA 1FMJA 2J41A 3ZD7A 1R7RA 2O0KA 5J4LA 3W8RA 1VKJA 2C8VA 3ZD6A 2WVJA 5K8UA 1SKYE 3SJCA 1G8HA 4CYMA 1AM4D 1OXTA 2PMKA 3EA5A 4M1YA 2PX3A 3H84A 4PHHA 1Z5ZA 3U3KA 1T3LA 4OYHA 5G40A 2ERYA 3SJZA 2VP6A 4ILEA 3NBZC 1R5BA 1MABA 2QSYA 3IUYA 4Q1EA 2UZ3A 1N5KA 3AVOA 2V4ZA 1JXOA 3TW8B 2GAOA 1QHIA 3L8ZA 4LYAA 2ANBA 2GZDA 5CIQA 2HV8A 4UNSA 5KOYA 4Q00A 4MYUA 1XU4A 1QHHA 3TUIC 1KO8A 3K9NA 4QBGB 2K5UA 2QBYA 5CM8B 4BLQA 4AKHA 2PZGA 1E2EA 1R2QA 2FE4A 2N46A 5CJ2A 5KTYA 4BZXA 4B32A 1G6HA 1OXVA 4IXMA 3AUXA 3KJHA 4F4CA 3LNCA 3TVDA 4PTLA 1GAJA 2D3WA 5JRZA 1E2LA 3N2IA 2ZE6A 3VX4A 2FX3A 4ESHA 3KTAA 4MITA 3AM1A 3SYLA 5FI0B 4RZ2A 2QGNA 3AQ4A 4RJLA 4Z8YA 4PANA 4AYTA 4KVAA 2Q9CA 1OXSC 1XPOA 4KBFA 1KJZA 3LBHA 4LV8B 1NY5A 2DWPA 4Q7JB 1IHUA 4NZYA 3RANA 4QFMA 3TGPA 3K0FB 1SVKA 4G5GA 5EXTA 3LDAA 3K70C 1VYVA 2BCJQ 5UKDA 3LXXA 5JMTA 1N0VC 2GKSA 1AGRA 1TU4A 2W6JD 5EP1A 3X1ZA 5EE1A 3U3MA 1WXQA 3B1WA 3W6PA 1E2JA 1SVWA 1R5OA 2QQ0A 4KFTA 3U7FB 3EZ6A 3DO6A 4OJKA 3P4YA 1ZCBA 3CPJB 2D2EA 4JVMA 1FTSA 4KYUA 4BFUA 2XJ4A 2EU8A 4DIEA 1XRJA 5HKKA 3WRYC 3CX6A 1CJVC 4C0HA 4M22A 4BLSA 1KGDA 2IK8A 2VA8A 1DAMA 1FTNA 2JJ2A 3CBQA 1KIMA 1Z22A 5EP4A 3GLFA 1W36C 4P4SA 2IXFA 3K0EA 4FMCF 3ZLJA 2P67A 4QBIA 2OLKA 4NCJA 1LS1A 3WY9A 3U5ZB 1PVOA 4ZDJA 4YMSA 2O8BA 3ASZA 4D0NA 2DFLA 2JIZA 3EZFA 4W7SA 1W44A 1XF9A 1KO7A 5KSZA 2FPLA 1IY0A 1G5PA 3U7GA 1R0WA 3I92A 3I8SA 2J3EA 5B57C 4LBYA 5BN3A 3PEYA 5JWOA 4US2R 4LSGA 4KU4A 4C0KA 3AVQA 4RD3A 2R6DA 3UG7A 3EC2A 3KZ1E 1KNQA 5EZ6B 4QM6A 1NP6A 3ONWA 5FPTA 4B48A 5JJIA 1WBBA 1P3JA 2A78A 4A92A 3FFBA 4DSOA 3ICEA 2IYYA 3M4YA 2PLRA 2OFWA 3FMIA 1ZD9A 1E79A 4OBEA 2C5LA 3U3OA 1G21E 1T4GA 4TL7A 2JAQA 2KWIA 2RGXA 4CEJB 1OHHA 1ZD8A 2WJJA 4KFSA 1T3HA 1D9ZA 4I99A 1GVNB 4Q9LA 5CLLA 3VNUA 4CEIB 2E9SA 1OF1A 2G3YA 4JVSB 4AKGA 1CF4A 1W36B 1PJRA 4LOAA 2OAQ1 4X8HA 4PQFA 4BZPA 3VQTA 4GL2A 1NBMA 2ZQ5A 2YVUA 1D2MA 4FN5A 3LBNA 5SZJA 4DWJA 4RCYA 5FI1B 1CU1A 3PQCA 1FMLA 4WXPA 2RGCA 2IL1A 2EFCB 1WP9A 3AB3A 1OH8A 3IKJA 1FZQA 2GBLC 3BC1A 4ITRC 3ZIAD 2GF9A 3I72A 5IRCD 1Z2CA 2GK6A 5EXXA 5KPJA 1F2UA 4M1KA 2P5SA 1E2NA 2RAPA 2WZQA 1NL3A 1WQ1R 4D4KA 4ZCMA 4M1OA 4G01B 1ZU5A 5JS7A 3UMFA 4HZIA 4C7OB 4IJMA 2ECKA 4TYYA 4B2IA 1ZNWA 2ZUBA 3SN6A 4DSTA 2H7VA 1G19A 4E07A 2ZE7A 3RWOA 1NNEA 2V6IA 3UXMA 2H5EA 2AXNA 2L0XA 4GBMA 4DB4A 4Z8XA 3TIFA 3ZJYA 1C1YA 4TQUS 1Z8FA 3GJ6A 5HE9A 5DSZA 2UVQA 5KNCA 4C4PA 1N6IA 4QKQA 3ZZTA 4D6PA 4Q48A 3ZGXA 4HEJA 1VIYA 2H17A 5AUNB 1PV4A 3R7WA 1Q3TA 2ORVA 2PJRA 1MO3A 1AN0A 2OCAA 1XMIA 3A4NA 1KAGA 1XTSA 3EG5A 5SZHB 2CJWB 1P5ZB 4FW9A 4D0GA 2OILA 4I1SA 1NN3A 3FE2A 4YMTA 1XD2A 3T61A 1FW6A 3GCGA 3LLUA 1M8PA 3WNDA 4JKYA 2O8FA 1W47A 2XJ9A 3NEJA 4ZKDA 1CR1A 4CZ2A 1EK0A 1DG1G 3BIFA 1QHYA 5J5CA 2ORIA 5JJLA 1EFHA 4MDEA 4US0R 4Z51A 5E4FA 1XD2B 1Z2AA 2ZS8A 4DSNA 3KUCA 1J70A 4S2EA 2BCGY 1W4CA 1II9A 3A1WA 2IYUA 1ZNZA 4PR0A 4P32A 4URUR 1G17A 3MMPA 5E7JA 2DFTA 1F2TA 4PC2A 1RZ3A 1KMHB 4LBWA 4LHWA 4F4IA 2HUPA 2BM1A 5FPHA 5BN5A 4F91B 2FSFA 2GF0A 2Q6TA 4C0AC 1II8A 5SZKB 4UJ5A 3RLFA 1JPJA 5FL7D 1N6LA 1YZTA 2PLFA 4A2QA 4Z1MD 1K8RA 3QF7A 1BMFA 1GOTA 4CIDA 1GL6A 4MKIA 3VNVA 4GMDA 4O2RA 4JLNA 4OL0A 1KI9A 4D82A 5DN6D 621PA 1G4AE 1XMSA 4XSGA 1E99A 1M74A 1AS2A 1T0HB 2FA9A 3OHMA 2XNDD 1E69A 3Q5EA 2ZSFA 3DZDA 4A0GA 4AG5A 2WWGA 4DCUA 2J0UB 1NVVQ 2NO9A 1AJEA 2X77A 1F3OA 3GLGE 2C9OA 4GT1A 1N6KA 2GBLA 3WP1B 3IIKA 4OK5A 1KZGB 4E09A 1CBUA 1JJVA 4YXWA 3ZZUA 5CK4A 5FTLA 4CGZA 1OFTA 4HB2A 4YMWA 2IS4A 2IW3A 1QG4A 2PEYA 3X1XA 1KOFA 1R4AA 3QF4B 2AKYA 3QF4A 4I1VA 1OIWA 3PG5A 5TB5A 3V4RA 3SZRA 3PUVA 1G8GA 1Z29A 4JYCA 1OH5A 3K09A 2D2FA 3QKTA 4QGHA 3NIBA 4K46A 2GCNA 1CRPA 1Y3AA 3U3RA 4R71A 1ZU4A 1E6CA 1Y63A 3IDQA 4ASUA 2QP4A 3KQKA 5GJCA 2QMOA 2KI5A 5J4VA 5ELXA 4O3MA 2MSEB 3N2EA 3QXSA 3QKRB 2GK7A 1D8TA 1TUEA 3GEEA 4OI4A 3S1AB 3QG5A 3VTKA 1Q44A 2YWFA 3B8HA 1W46A 4XTCS 1II8B 1TTTA 1GIAA 3SBEA 4LJ8A 3CRRA 4Q1BA 2DR3A 1RKBA 4TSFA 1P7CA 2MMGA 3LLMA 3QPVA 1NRJB 3IHWA 5HE8A 5FPSA 2O52A 3B6EA 3UANA 4C0LA 5HZKA 2AN9A 4N3NA 3I62A 1Q1ZA 2FG5A 3C4JA 3RDPA 1CJKC 1JB1A 1VG0B 4MGYR 3B1ZA 1X8LA 4WZBE 3TR5A 1NMXA 2VO1A 4JYBA 1KI8A 1N5JA 3QEJA 3FVQA 2OXRA 3FYHA 4M21A 4MUAA 1KI6A 2J5XA 5JZVA 4P4TA 5CITA 2IWRA 1G3RA 2NO0A 3MD0A 3R9XA 1KI7A 1YZQA 4ZPXA 4MKGA 2BBWA 4MRSA 3LA6A 1LV7A 4BLPA 1EFRD 3TSOA 2WV9A 3PVSA 3Q72A 4U5XA 1RYHA 4IVPA 1P9NA 4HSEA 4RKEA 4KSBA 1KK2A 5DH9A 2IHBA 1DE0A 3A1TA 2H16A 3K70B 2FFQA 2WMOB 4A15A 4URWR 4QJ4A 1ZM2A 4LYHA 3FMFA 3GJ4A 4M4SA 2KB0A 1IN4A 1JNYA 3F3YA 4NU0A 1CS4C 2C03A 4XIGS 5D3QA 1HT2E 4PFSA 1VIAA 3AVYA 4L16A 1H8HA 4IDOA 4Q5IA 2OV2A 4Q9JA 4Q47A 2FH5B 1AZTA 3SQXA 3AKDA 4BGDA 2QRNA 4C3ZA 2VSFA 3PFIA 3WMFA 2ZJAA 1L2TA 4MRPA 4UNPA 2YWEA 2DFKB 2GHIA 1MT0A 3WNCA 2ZRAA 4HLUC 4M0LA 4DVGA 5SZIA 2B8TA 1HH4A 2CXXA 3K70D 4B3GA 4BWYA 1OJLA 3HJNA 3A58B 2V9PA 3B60A 4IDQA 4L15A 5C1BA 4TZ6A 3CRMA 4B3CA 3LW7A 2BMJA 3HWSA 5LB4A 3TR0A 4TYWA 1F2UB 4Q7LA 2GA8A 1OPXA 1UKEA 2CHQA 1XXHE 1SVLA 2PJZA 3QG1A 2RCNA 4IEIA 5IDVA 1LFDB 1KMHA 4KVGA 4B2PA 4NH0A 2F3RA 2XOKD 1KK1A 1SHZA 1A2BA 4CDGA 2QBYB 4EPYA 3N5CA 4CEIA 2YOFA 1DS6A 3FDIA 5DI9A 5FOUA 1H8ED 1RFLA 1TEVA 2NG1A 2WJGA 2C04A 2O0JA 4A8JB 2JASA 4MH0R 5EQTA 3BJIC 1XEWY 2VF7A 4L8GA 5JCZA 3CF2A 3BFKA 4ZCLA 2IYRA 2LCFA 2ZS7A 4M53A 2IWHA 5JFGA 4A4DA 2BWJA 2GZAA 421PA 1U9IA 1YZUA 4A2WA 1G18A 4IDPA 1HA3A 1QG2A 2CJWA 4XSHA 5L3SA 2OO7A 1L4UA 2ZEJA 1W5SA 4PC1A 1NVUQ 1OXUA 2ZYUX 3SOPA 4TWZA 1HE8B 1QHSA 4QHYA 3UIEA 2ZI5A 1GWNA 2OM2A 2WOOA 3HU3A 4LBZA 4M1MA 2IA5A 1Z08A 5JCPA 2WSSD 1P62B 2F3TA 4OI1A 2QP3A 4TMWA 1CULC 2J7PD 3I61A 1GILA 3VR1A 4DT1B 4XVUA 3O8RA 2QG6A 4QM7A 1N6OA 3DZ8A 1TU3A 3MCAA 2R2AA 4I4LA 3FHTA 4QXAA 3NC0C 4D4JA 5FTKA 3RS2A 2EYUA 4DUGD 1O87A 2O5VA 4QG7A 4FCWA 1S0UA 5D3MB 5M04A 3B1YA 1Z6GA 3LD9A 3W6OA 3GLGB 1NVWQ 2WKQA 1G291 4TT3D 4M2LA 3FFAA 4GOKA 2ZRGA 2ZRKA 4E03A 5KHOC 2ZJYA 3RHFA 2VYFA 3KKOA 2R44A 1VYUA 1L8QA 2F1IA 3CF6R 4D4LA 2BBSA 3K0CC 2ODBA 1NG9A 3AEZA 4IVQA 3U7EB 4TMXA 4D4MA 3GLGA 4OHYA 1WBDA 1A5TA 3TK1A 1OW3B 2YC2C 1G7TA 4XTRA 1L4YA 2QL6A 4EIWA 5BYJA 2FPMA 4HDOB 1W4BA 1ZW6A 2R8RA 3C15C 4RZXA 5FTNA 4PO8A 1KY3A 2GXAA 2QENA 2DWQA 1W2HA 2AL7A 4X8MA 4C0JA 5IK2D 2ZYWX 4HB3A 4JL6A 3O8CA 2QPOA 4MKFA 1OHHD 2IX3A 1OT3A 4NKRA 2QY9A 1EESA 1M7GA 3NKVA 4TTRA 3HU1A 2XXAB 1LW7A 2HEIA 3MAAC 4MGZR 3SFVA 3TRFA 1HEIA 2FJUA 2A2ZA 4IHQA 4ERNA 4LJ7A 2BC9A 1G7SA 2QORA 1G41A 5JEDA 1NN5A 5EE9A 3UKDA 5C4MA 1HTWA 1OLOA 4PC7A 2ZJOA 3B1XA 4MRVA 4H1VA 5AJWA 5CDFE 3LXRA 5JI2E 4FMDF 2DBYA 1ZAKA 5K8TA 5GJBA 3GJXC 4V0OA 3FOZA 4OHVA 5FL3A 5G53C 3ZIAA 1HV8A 1R10A 1US8B 1W1WA 2I1QA 4LX0A 1Z0IA 3ND9A 2A7QA 2ZJ2A 1JAHA 2IXEA 2RGGA 5G3YA 5DIFA 1QDEA 1YR8A 2W00A 1JECA 1MH1A 2P5TB 1FX0A 3QQ5A 3PV0A 2YYZA 1PUJA 2ZRHA 3CW2A 5CLQA 3U61B 2EWWA 3UWKA 1KTVA 3H4MA 3T5GA 3WBKA 2RGNA 4XD7A 1OB2A 1UKYA 4HUQB 1W48A 5KNBA 1TQ6A 4MA4A 2QRZA 1Z0KA 5J47A 4GFDA 2QEQA 5EZ5A 4IRUB 2XTMA 4GP7A 3B9QA 1SGWA 1TQ2A 2NGRA 1G5TA 2G0TA 1Q57A 4LC1A 3ASYA 5BQ5A 3RRZA 2QI9C 2WMNB 3W6NA 3VX3A 3N70A 5JHHB 1F48A 4HB0A 1NLFA 1NG1A 5FOTA 3VR4A 2RGAA 3RS7A 4AIIA 4HAZA 2C98A 1RPZA 4JLOA 3RS5A 3TJZA 1G7RA 2FU5C 3LQRA 2ODNA 5DN6A 2ZAMA 2W2XA 5E7IA 2GJKA 3EAQA 3KXIA 5H68A 2ZIAA 3EIQA 1QHNA 4BQSA 4IEEA 1JJ7A 2XB4A 3FKQA 2PH1A 3WNBA 4IOJA 1XJ0A 4HZUB 1VCMA 3WYAA 5J4YA 1D5CA 4POAA 2GJ9A 2OXCA 2I1VB 2YJTD 3E1SA 2IYZA 3AVPA 1SXJA 4K8OA 3EX7C 2ZPTX 3SEAA 4TTPA 1AGPA 1ZUIA 2OAP1 3HP1A 3W3AA 4NBSA 4MDFA 1RRCA 4R2IA 1HURA 3P26A 4EDHA 3OIUA 1N6NA 2FGKA 1Z3IX 1TQDA 2WWIA 2OBNA 2XITA 1LTQA 1N3BA 2QSZA 3IHLA 4U00A 5AJZA 3Q8XB 4RY2A 2FFAA 1QZXA 3EIHA 1G8FA 2IYTA 4D2IA 1R8QA 1CRQA 1EFCA 1RJ9B 1UEIA 3B13B 4QGFA 2DYKA 5C4GB 2ZRFA 5FBRB 2VIIA 2P6NA 2XNDA 4RVCA 5AWFC 2NQ2C 5KO2A 4Q1CA 3KJGA 4GI7A 1XJQA 4E5UA 1KY2A 1RJ9A 1D2NA 1VCOA 3QXJA 4TTQA 3EASA 2GCPA 2GTPA 4BECA 1RRGA 1YRBA 3VU9B 1Z63A 2ZR7A 1RYFA 2Q3MA 5A0FA 1XTJA 3REFA 3NVAA 5FTMA 2V55B 1XZQA 3TSWA 5CIWA 4LV6A 3UPUA 2OHFA 4EPXA 3MJRA 3KKQA 3KQHA 1YHNA 3PCRB 4Q4AA 4BLRA 1K5DA 4UNRA 1X3SA 3QENA 4HDQB 4IVRA 1E4YA 1R0XA 3BB1A 4V03A 4WZAE 3X2SA 3A4MA 1O3YA 1GM5A 1ZC4A 3GPLA 2Q0HA 1YZNA 3EWSA 5DISB 2ZSAA 1DEKA 1AS0A 2CMKA 1R0ZA 1XX6A 2R62A 1P2UA 1U90A 5EE3A 2WIAA 4CEHB 3A6PC 3P27A 4I1OA 1XMJA 2Z43A 1DAIA 5EUQB 5TXGA 4UNNA 2C99A 4QBHA 1AIPA 5IK2A 3OIVA 4JLJA 1ZMXA 1S8FA 3K53A 5CYPA 2ZM5A 2A5DA 3P4XA 221PA 2VP2A 2W0SA 4NCIA 4HLCA 2NPFA 1EFRA 1P2VA 3GLFB 3X1DA 3U44A 4RSGA 1U9IC 3FHOA 1SVIA 3ZS9A 2JLQA 2IEZA 3E5HA 4N0DA 3P1JA 3SDZA 1JQJC 3V4FA 3C5HA 1E79D 1KI2A 3DEFA 1E4VA 1AS3A 2JIZD 4EPWA 2JEOA 1YZKA 5EUMA 2ZSDA 4Q02A 2QTHA 4KITB 4AURA 4A36A 3CR8A 2BMFA 4PAQA 4DB2A 1ZD1A 4FMDB 2UKDA 3KJIA 3B1VA 1XNJA 4YMUA 1MKYA 1XTQA 3OEED 1MO5A 4NCKA 4CRWB 3HR7A 3VU9A 4AK9A 2LKDA 3OIWA 2D74A 1FUKA 1YU9A 2QNRA 2JGNA 3OAAD 2QMHA 1G3UA 1ZM3A 4WZ6A 2J7KA 4QGGA 4BLTA 1JEEA 4CVNA 4Q18A 2X1VA 4GNKA 5CJPA 2FPKA 5TY0A 4CW7A 3SR0A 1T5IA 2JATA 4PZYA 5F9HA 1XDBA 1X1SA 1Q12A 4TMTA 1F6BA 2WBLC 1P9RA 2NO6A 2CDNA 1NIJA 4OK3A 4AWXA 2JDID 3GLIB 4DLVA 1P72A 4H9GA 2NZ8A 4L9SA 3Q9LA 4DLWA 3QIAA 1SQ5A 3O8DA 1C9KA 2PBRA 4GMXA 1KSHA 2DWOA 2OBMA 3A1UA 2V3CC 2CK3A 3R9IA 2QM8A 3PENA 3QXXA 4HLUA 3T1VA 3VMFA 2GETA 3NC1C 4RFSB 4A1FA 1DAHA 2G1KA 2YZ2A 4DEXA 1U0JA 2VP0A 1P9WA 1DO2A 5L8VA 2BKUA 5JS8A 2TMKA 4Y0VA 3F5FA 4IKEA 5FFMA 1XEXB 3DM5A 3KDSE 4OHZA 3Q5DA 1MO4A 1MR3F 3NG1A 1H8HD 2ZSBA 1ZP6A 5HCNA 2ZJ8A 1QVRA 3SYKA 2BM0A 5EP2A 1GKUB 4GDFA 4KO8A 5CDFA 2OT3B 2C78A 1FNMA 1CR4A 3A1SA 4JLBA 4PC6A 1W49A 1YR7A 1CR2A 2A5JA 1GNRA 4ZDWA 3VHLB 1LY1A 1MOZA 1E2IA 3PITA 4Q66C 4YLGA 2UZIR 1WF3A 3LBIA 4B33A 4BRUA 3TAHA 4HAVA 1IJEA 1BYUA 2O8EB 2CNWD 2W6ID 1E9CA 3W5IA 4NYMR 1Z28A 1FL9A 3IBYA 3GJ7A 3WBJA 2DFNA 3QVUA 4NCHA 4OQNA 2Q9AA 1SULA 5IT5A 3C7KA 2PMDA 4ABYA 6Q21A 5KDOA 1BMFD 1DELA 1DO0A 1KZ7B 1H8EA 1IN7A 4Q1DA 1XD8A 3LX8A 4JLMA 2NPIA 3BOSA 3CRW1 2ZETA 1IN6A 1BS1A 2A3RA 2GEUA 3IIMA 4IW3B 5G41A 1ZIOA 2ZSEA 1NBME 1Q1BA 4M1WA 1BH2A 3ZQJA 2F9LA 4FMCB 1ZNXA 3RC8A 1JXMA 2XOKA 4LPSA 4MQBA 2MSDB 4O2LA 4ZCIA 4B6FA 4PPNA 2WPDA 1N5LA 3W9YA 1JAIA 3L2OB 1E94E 4BEBA 3R8CA 3KB1A 3VAAA 3OE7A 5DE3A 3CWQA 4U02A 4D26A 1IQPA 3B9PA 2OE2A 1P4SA 2IYLD 2JLWA 2PT7A 5F9FA 2V1XA 4ZV4A 2H18A 5KYKA 3IILA 3HPQA 4BFWA 3A37A 3ADCA 4ZIRA 1U98A 1NN0A 4KHZA 3IPXA 4DLTA 4JL5A 4HAUA 3LV8A 1DVRA 1Z0AA 5JECA 2PT5A 3QY0A 1B23P 3AVVA 1DPFA 2WJVA 5C2JB 3GD7A 1UADA 2WHXA 2GEVA 4ASUD 3MWJA 1A82A 3KQUA 2F1RA 3K0AA 4PX9A 2ZAOA 4RD2A 2BJWA 4D80A 1CJTC 2JLSA 2J59A 4HAYA 4RD6A 1N6PA 5DNYB 3GJ5A 1FQJA 1MO6A 3WRXC 3SI7A 1DBSA 2FDCA 3NWJA 5EXPA 8OHMA 2FNAA 1RW4A 4EJSB 4RKFA 2BV3A 1FFHA 2HXSA 2R6GA 3EC1A 4MKHA 2ZI6A 2GJAA 3C41J 3RAPR 4BEJA 3CZPA 1U0HC 1OYYA 4PSVA 1SXJC 2NO1A 2V6JA 3GLFE 2GVDC 2WJIA 4RD0A 3SBDA 1KDRA 1YR6A 3I1FA 4Q4HA 1GZSA 4B47A 2D62A 5FBLB 4TZ0A 3M1IA 4HLQB 3B82A 4UXIA 3DL0A 4BFTA 1UAAA 3FHCB 2OBLA 2IUSA 3T06B 3CRVA 1NVVR 2AK3A 2HT6A 3LX5A 2QTVB 2ZUCA 1KI6B 1VYTA 3PEVA 3UWOA 3CRQA 1CJUC 4NP6A 2B7CA 2Z0MA 1S96A 4PSAA 2B6HA 3CKLA 2C96A 2J45A 1EG7A 3OIYA 2J46A 1EX7A 5EXSA 2CE2X 4BFVA 5LB2A 3KKNA 4DCNA 3CX7A 4U7DA 5JLJA 2E87A 2AR7A 1W36D 1IM2A 1G6OA 1OH7A 1X86B 1E0SA 2LWIA 3FPAA 2X2EA 1YQTA 1F5NA 2N1BA 2CL7X 2EFDB 4NYJR 4LHYA 4PAMA 1E2KA 4IFEA 1HE1C 3S1AA 4GZMA 2RGNC 3A8TA 3MLEA 3X1YA 3I73A 3TQCA 3E2IA 3NBXX 3CF0A 4KAXA 2YV5A 3QNUA 3C14C 3BORA 3CWZA 4JJZA 3TUZC 3SE0A 5L3SB 1JALA 4LDJA 2VH5R 1E2QA 3AF3A 3CO5A 3QXCA 5A5GA 1GG2A 3AKCA 3C16C 1E32A 2QE7A 3Q7QA 2ZR9A 3OFND 2FWRA 2VRWA 3TBKA 3I5XA 4JVLA 5AJVB 4B3DA 1M7BA 4NPHA 3CH4B 1YJ5A 2B8WA 2WWXA 4XD7D 4B3BA 3LQQA 2IEYA 5KNDA 2FF7A 2C2HA 3LVQE 2EFEB 4URXR 3H1TA 4YONB 1W0JD 1QVAA 1GP2A 2CCGA 4DXAA 1YRAA 2JA1A 4QBFA 2J0QA 2W83A 1Z0JA 4FCVA 3OEHA 2GAAA 1OKKD 3K9GA 2RKOA 1S1CA 3GFPA 3MWKA 2JLYA 1V5WA 3AP1A 2QAGA 2WWWA 3PJRA 2V8OA 4C9BA 2VHCA 5FUXA 4PXAA 1KDOA 4QNRA 5B2ZA 3W5JA 3CX8A 4KJZA 3QVVA 2IYXA 3W34A 1P73A 3T15A 2GCOB 1W7AA 2RHDA 3U6BA 3F8TA 2G6BA 2QAGB 4B73A 2ZRLA 1HQCA 3TNFA 1S2MA 4KODA 3ICQB 2BEKA 4LHVA 3WYGA 4A6PA 4PQRA 3PUXA 4FMBB 3EPHA 3EXAA 2FSGA 4FWTA 2REBA 1UDXA 4C30A 1XBTA 2QM7A 2ZI7A 1FP6A 4LK2A 3ZDQA 2FOLA 4GPTA 2DHRA 3EW9A 3PEWA 4CT5A 1WB9A 1LNZA 2AXPA 2W58A 3G82C 4LYFA 5HTKA 5K8LA 1XMVA 3CUEF 2KSQA 4HI0E 2B21A 4TL6A 1GRQA 3L8YA 3UMRA 4WA7A 1CTQA 3NXSA 2ZVPX 4P31A 1EXMA 1AQUA 1ZNYA 4BFSA 2I3BA 1MRSA 2QU8A 3T1OA 5KDLA 1D2EA 3GFTA 4BFXA 4WW0A 3ZQ6A 2JJ8A 2O8FB 5D3MA 1A4RA 3FKSA 2VHTA 4OQMA 3Q7PA 2IYWA 2G9NA 1T91A 2ZJ5A 2GVZC 1VDZA 2R6AA 2D4HA 1FP7A 1N5IA 4Q7MB 5TVKA 3VKHA 3RS0A 2XEXA 1KI4A 3VKGA 3QPUA 5F98A 2RGDA 3R7WB 4RZUA 2GZHA 4L4UA 2H1LA 4TMZA 5K8IA 4C0QC 1AQYA 2WSSA 3DDCA 3M6AA 1S3SA 3HR8A 4B6EA 4OI2A 2ZYTX 4BLOA 2WKRA 3D8BA 3W3ZB 5AJXA 1T5LA 1B0UA 2A9KA 2FSIA 1U8AA 1NY6A 2GESA 4A0HA 1HY3A 4KFUA 4OJQA 4TQ9A 3C8UA 2G1JA 1W5TA 4M8NE 4KLZA 2OFXA 2WJYA 3U44B 2QQEA 4S35A 4FD2A 1Q1QA 2HCJB 2VL7A 3NBFA 2HLDD 1T3SA 3NH9A 4BZQA 4DCTA 4EPRA 3GLHE 3AV0B 4OKSA 1RE0A 1U8ZA 1X8KA 2OSBA 4TT3A 4PSKA 1SVMA 2XTZA 4DDWA 1AA9A 3FB4A 3FTQA 4ZKEA 4B3XA 4DRZA 1G16A 2GJSA 4V0LA 4BRWA 1KI1A 2XNSA 1KHTA 1P2TA 5FOWA 3SS8A 4P0TA 3EA0A 4LGMA 1DAFA 5AUOB 2WJHA 4H1UA 1FQKA 1CKEA 1OSNA 3I8XA 4P3YA 4XVRA 5KSPA 3REGA 1VG8A 2X8AA 5FUYA 2REOA 2OLJA 3K0FA 1TF2A 2ZRMA 4RZ3A 4ACAA 3RRNA 1J2JA 4AC9A 2MSCB 5E3HA 5HPYB 4R9UC 3RC3A 4EQ6A 2GNOA 4B75A 3GMTA 4DUGA 2A5GA 1E98A 3T12A 3AVXA 1ZVQA 4Q4LA 2GCOA 2AD1A 1A7JA 3LH5A 4UQOA 2ZRDA 3DHWC 3R9WA 2GXSA 2H57A 4KYIB 3CB4A 5GVRA 2JLRA 1SKQA 5J40A 1W0KD 1CEEA 3GLHB 4YC7A 2BKEA 1ZJ6A 4JS0A 2QZ4A 4EJSA 2AKAB 3A1VA 1XEFA 3AF2A 2JLUA 3HDTA 1TX4B 5DYIA 3OEHD 2OESA 4R98A 4LJ9A 2HJGA 3DM9B 1E9BA 4TYPA 2D7DA 1E2PA 1TEXA 2BDTA 3QBTA 3GJ8A 5GADl 3U7HB 3DKPA 4OQXA 2R65A 1FOEB 1G3IA 1DAKA 3HU2A 1XPRA 4F92B 1Z83A 2VHUA 2XAUA 3KL4A 3DVLA 2W2TA 2FZLA 5BN4A 4XVQA 2Z6VA 3FMOB 1ZINA 4HAWA 2Q21A 5DHFA 3UG6A 2VQSA 4M1SA 1G8YA 2X19A 3O47A 3THWA 1FUUA 4II7A 2Z4SA 4DT1A 2P65A 1UBEA 2RH5A 2ATVA 4TL9A 1CR0A 2JLXA 2KBEA 1KSGA 1NF3A 2CHVA 4QHTA 3IQXA 2QGZA 2IUTA 1MABB 3PUYA 1D9XA 3IO3A 1Z6TA 4URVR 4LY6A 2A5FA 3LO5A 4G5SA 4P4SB 2QAGC 4PHGA 2ODWA 1M6NA 1COWA 2VHJA 3BD9A 2VBCA 3OE7D 1OFHA 2HF8A 4TLBA 2VF8A 5EP3A 1VHLA 1J99A 4WOPA 2CCKA 4V0NA 2RB4A 1XD9A 3K1JA 3SYNA 1Q1EA 5JHGB 1JQLB 4JBWA 3BAFA 2ZUDA 3KUDA 1JR3A 2F55A 1E1QA 2CVHA 1KKMA 2W6IA 3BBPA 4G5RA 1ZYUA 4L9WA 2YC4C 3LW8A 1NLZA 4FXPA 4BASA 4AI6A 1U8YA 3OESA 4PO9A 1VMAA 4V0ME 2WICA 4J0QA 2XX3A 3SNHA 2FN4A 2CLCX 5KDDA 2ATXA 3K09C 5GVSA 4JIMA 1OXXK 1QRAA 3THXA 3JZAA 4Q9KA 1KNXA 3D7MA 3BS4A 3NDPA 3B5JA 3QBVA 5JWHA 1KMQA 2VTKA 4EPTA 4NE2A 3AVTA 4W5JA 4Q4HB 2JCSA 4Z54A 1E1RD 3ZZ0A 2IHYA 4OHXA 1NN1A 1MV5A 1HT1E 2ZRNA 2I4IA 2WPDD 1KK3A 3MSXA 1VCIA 3L0IB 1SXJD 5CB6A 521PA 5H8WA 3TW4A 3AGPA 2BIFA 4KI0A 4A9AA 2QROA 3OF5A 1G9XA 3A4LA 1OB5A 3BB4A 1G7CA 1IONA 2BMEA 1VTKA 1NI3A 1WCV1 4Q1FA 3TUJC 3TQFA 3BERA 5FBWB 3VR2A 2CVFA 4NYJQ
chains in the Genus database with same CATH superfamily
1M34A 5E7MA 3LT1A 2P5UA 3GYGA 3GBVA 3GV0A 3UXEA 4JKOA 2W0MA 2NTJA 1WXHA 2P1RA 3JVUA 2I54A 2EQ5A 1LGYA 4CR6A 1I2MA 4EFKA 2B35A 5CA1F 2GPNA 3MRTA 1RXIA 3OMWA 4URZR 1DBQA 4RF2A 4JBYA 4JNCA 1PNRA 4X94A 4EG0A 1T13A 4QPCA 1XRSB 1QH8A 2IF0A 5B6JA 4M0DA 2PX2A 1JPNA 2HW8A 2PX0A 1RLOA 1ZK0A 2FLWA 2IYEA 1HZZA 3QVLA 4NZMA 3ZLUA 4R0VA 3ADDA 2PH3A 4QRIA 2OORA 1GFSA 1MZVA 5L53A 4MI1A 1GD1O 4JUAA 1OBCA 2VDPB 2YIDA 2V1UA 3RS4A 1CYEA 4EARA 2IZ0A 3OQNA 3H5WA 3TSZA 5CJJA 5MN5A 3EW7A 2JAUA 4TXLA 3ZJ4A 2EWVA 3CPHA 1GYQA 1UOEA 2XE8A 3KSZO 1Y82A 3IKMB 4LNUB 4XIIA 5B58C 2CY0A 4V0QA 4N7JA 2ZQZA 4OLJA 4IOLA 1EFTA 1A27A 3HA5A 2IW1A 2ZYVX 1XZ8A 5IW8A 3PLAE 4CIBA 1EDEA 1V9CA 3ONFA 1KO1A 1TJ3A 2C88A 3L05A 4D9KA 1M7HA 3FCUB 5AW6A 4FDAA 1BWRA 2JH9A 2A9JA 3B5IA 5L7YA 4M0PA 3GRYA 4IHJF 4QTTB 4I9NA 1DV1A 1XVTA 3EBLA 3JZIA 3NB0A 2C77A 3R77A 1BGWA 5AH0A 4M9ZA 1WNTA 4TLAA 3FKJA 1JQEA 2NTVA 1ZOIA 1NFFA 3O9MA 5FWDA 3DFMA 3ICPA 4TV9A 1Q7BA 1AG9A 2G09A 3I8OA 5K3SA 1J8FA 3UW3A 5I7FA 1FVXA 1VJ5A 3AEUA 4F84A 4Q19A 5DDIP 5B3LA 1G5HA 2OUKA 3BFXA 2BMDA 4KIWA 3GHHA 1IN8A 1YWGO 2CLIB 3C45A 3M5WA 2RHGB 1P5JA 1GDDA 4NBNA 5P8WA 4WBXC 2CVPA 1PTJC 4MXDA 5DI3A 4Q3NA 5AVOA 4EH1A 4EKNB 2GJ8A 2QJRA 3GFOA 3F6PA 2RGBA 5CAEB 3U26A 4OAPA 2WOJA 3RS8A 4N03A 4I8IA 5CH8A 5HEKA 4X97A 3E35A 4Q4AB 4GGMX 4GRAA 4L75A 3STVA 3D54D 2JLVA 1OAAA 2CK3D 1UM8A 2DQZA 3M3HA 3KYBA 4MVJD 4YT5A 3KFVA 1PJ4A 4N7MA 2QN6A 4PAWA 4NJMB 4W5HA 3ZGLA 5M2QA 2WY2D 1OAKA 5ALMA 2IZ5A 1H2XA 4JEHA 1ZJYA 1KO5A 2AQ8A 4GSYA 4O4LB 2IYVA 2XV1A 4LCBA 5I7OA 3RROA 4PZLA 3GT0A 3P96A 2IS6A 2VLIA 1FNDA 3HWWA 1UPUA 2FSHA 3DXYA 4J2HA 4RF4A 2G4VA 2VT7A 3F5DA 1W52X 4TKUB 4NTZA 3T9BA 3H5AA 4HZUA 3DDNA 4BE9A 5TEWA 2YOHA 5ARDA 3WV5A 5CA0B 3JASB 4JL8A 4KQEA 1SVSA 1E2FA 2XQFA 1UBFA 2PJUA 2YL2A 3N59A 4I0WB 4J16A 4MWGA 5T67A 3ZEIA 1N32B 5DGXA 1T2EA 3SSOA 2ZYIA 2Y0DA 3JALA 3UY4A 1FPMA 2AJDA 4LKOA 1E1KA 2JCVA 1O5TA 4LYJA 7ADHA 3ITKA 2QZZA 1XAIA 1KMMA 3H2HA 1ZITA 3LC7O 5JADA 2UU9B 2GN2A 3DG9A 1EQAA 1QV7A 1P39A 1NNUA 2AD5A 4JMPA 1WUTA 1OX6A 4H6XA 4NONA 4QNMA 4AUNA 2ZYRA 5DGTA 1KFEB 3WLTA 3QHQA 2DY1A 2I6QA 1I2DA 5EHZA 4WLNA 4MI3A 3HY4A 3Q6IA 5AQ1A 2CUTA 2XMGA 3LFHA 4L2IB 1ULAA 2WA2A 1UOPA 1DC7A 1KJWA 3FPBA 1C9MA 3F9RA 2DJIA 3UH1A 1M1ZA 3RRYA 2CVOA 2VK2A 5H16A 2FPGB 2X40A 4NMLA 3O8BA 2REXB 4HUQA 2EKLA 4EJFA 2YJ5A 3TIXB 2VJMB 2BEVA 2OA0A 3P2JA 3CNNA 1DTSA 1S4QA 3EMVA 2CL6X 1Q1AA 2JJ1A 4JVNA 3UATA 4DV4B 1CSEE 1VL8A 3JZMA 4TZKA 1KDTA 2GKGA 3W9UA 1C30A 5BSMA 1DG3A 4RQBA 5KOIA 4PCLA 3ME5A 2JJ2D 4EYEA 1UMBA 4HDKA 5I7RA 5DYGA 1KYIA 1ZMTA 2Q7DA 4C2TA 3NDBB 3C70A 4ENUA 5FH9A 4JEUA 5BOSB 5CYOA 4L0CA 1W35A 4EHDA 2AMVA 1XIVA 1BWPA 1GUYA 1L4EA 5A04A 4JLVA 3H1GA 3O8LA 1B00A 1DHRA 5HF6A 5A06A 2A1IA 4EG1A 2W7TA 3LUDA 2VPXA 4X90A 6CHYA 3EXHA 3MUOA 4H3VA 4YAOA 2YWHA 3NW9A 5CB0A 1X6VA 4BN0A 4JCCA 4MSUA 3SU8A 2OZPA 2AX4A 1IB0A 1ZNQO 4CHTA 1YZFA 2OXTA 2MMCA 3E3NA 4JJKA 5INTA 5EQFA 2EGHA 4L5BA 1TMKA 2JFGA 4E88A 1WTCA 1CUCA 3BL8A 4R54A 1B3BA 4ZVNA 5CM9C 1U7DA 1XJWA 1WZ2A 1GSIA 1S4MA 2FMKA 2PVPA 3A6HA 3U7QB 4MRMB 3ED5A 1DRWA 4NU5A 1FU8A 3QPWA 4P4UA 3UAOA 4W5TA 2NO5A 3GEGA 1VCNA 1SXJE 2IDJA 1J6UA 1Q3HA 1J21A 1DMRA 3IMCA 3P0RA 4HX5A 5HQJA 1QYWA 3RSLA 1WEKA 5TJ9A 3AXSA 1I2BA 1IHXA 3OPNA 1U9CA 1RI2A 3WGGA 1MLDA 5DTMA 4JOSA 1ECGA 4WX2B 4F2HA 4C0SA 1DBWA 3L4JA 4X6LA 1AXEA 2D5CA 1N2HA 4KXFB 4QRHA 3UGKA 4IDHA 1NVAA 4NZZA 3FGOA 1IZ9A 3VR5D 3MEQA 3D5QA 4NG4A 1UEXC 3AF1A 1THMA 2HYIC 3NAGA 1BCSB 1Z5GA 3IR7A 3RHSA 4LEIA 4K3UA 4EF4A 5CG2A 1EFUA 1LC3A 1N2CB 2FV8A 1PEYA 2DFDA 4K1LA 3HQ4O 1RT9A 4GXNA 5SYAA 2NZWA 2XCLA 4M8SA 1EBBA 3DBHA 5JDIC 2XB8A 4M7WA 1FFDA 4P84A 1GV0A 3WLKX 4CU2A 3AEKB 5B1DA 1BRMA 2XUZA 4YJ3B 3D3QA 1B8OA 4XJTA 1YRQA 1Q74A 2WF9A 5H80A 4ALLA 1Z8HA 2VHZA 4QAJA 1NU6A 3PDHA 1Z47A 3FRIA 1RWMA 3TW8A 2P91A 1NYTA 1V5FA 3EEQA 3O4GA 5BXQC 4G67A 1KOLA 2YKGA 3D8RA 2C3UA 4WDQA 2G0NA 4BVGA 4M0KA 2BTOA 4QODA 1WIWA 3WL7A 2NP7A 3WWCA 2N47A 2ZB2A 1IZZA 1VJGA 3G7NA 2VXYA 4AULA 3EG9A 1XKTA 4RJKA 4QT0A 1I4OA 4RTSA 2O3RA 4KE9A 3COSA 3NJ4A 3UYKA 1U8TA 3LCMA 3QH4A 4W82A 1FTWA 5FWYA 3NAZA 3VTAA 1M2OB 4B40A 1MDBA 4IUDS 5A03A 3J81A 4CF7A 3QKUA 3EARA 1VFPA 3TO5A 4ALIA 3S5UA 2P0EA 1RKUA 3BHMA 2DCUA 2BI7A 3BK7A 4CLXA 1YONA 2ZS9A 1T8YA 5F2NA 1Z6PA 1HX7A 2JPDA 1IJFA 1ULBA 1W4AA 4Q03A 1EP2B 1NKTA 1SUIA 2XT0A 3EZ9A 1ZQ1A 1LNSA 1WXFA 3IO5A 1V8BA 1IMJA 1D2CA 2IH5A 1MTOA 4K9QA 2Y6VA 3OCZA 5GONB 1OX4A 2F7SA 1XCLA 3LUCA 1AQ6A 4LVOA 4FFRA 3W4KA 1N0UA 1GKYA 1HYQA 1BTOA 1RHJA 2DUMA 2QTFA 2YHSA 3IT0A 1L7NA 4NNPA 4UC0A 4ITUA 1YQGA 4J7XA 4LWZA 2YNMA 3KS9A 5DWDA 1LLUA 2DE0X 3LP5A 4J9VA 5ER6A 3BKXA 3SX0A 2EAUA 3C7DB 4XB2A 1AKEA 2Y0BA 2OHOA 4Z4FA 2DGDA 1CZOA 3AY0A 4BO1A 4HCJA 2R79A 4I3HA 3BE5A 3WMEA 1VLZA 3G5MA 1PR3A 5IHPA 1T0JB 3DC7A 3EEYA 4HFRA 4M36A 1MEOA 2D54A 2JZNA 4RMJA 4LBVA 4XYEA 4IX9A 3PC3A 2D0IA 4QJ3A 5IX8A 4JXXA 3E23A 4V02A 2EG9A 3Q2OA 2C5GA 3B2NA 5ALUA 2EZUA 1W4RA 1A7AA 3FFXA 2IHVA 2PWPA 4OVKA 3EWAA 3NTUA 4LJAA 3ZLBA 5K0EA 2VF4X 5TQJA 1XFAA 1ZWKA 5ENVA 1K9VF 3Q10A 3WMGA 5C5IA 5E1MA 2Y1OA 3TNYA 1DOAA 5HP4A 3Q12A 1JRLA 3QWBA 1X7ZB 4WKNA 3WHKA 2P2GA 3N7AA 4NC9A 3EQ7A 1EGMB 4ZHSA 2CJXA 4GMGA 3OICA 3FF1A 1R9GA 1YS4A 4B44A 1K06A 5BR1A 2PD4A 3I4LA 3D3JA 2O2SA 4MV1A 1ZK2A 2EFHB 4P0PB 1C0KA 1G3QA 4EJSC 3C98A 3N8DA 4BNKA 4ISCA 1NSTA 2ASEA 3GC6A 1IEVA 4TYQA 3ZS8A 4B0OA 3AUYA 4IJVA 1TUBB 4UQPA 4C04A 1VJ1A 5B1EA 5T4FA 3BH6A 4OHPA 3T1QA 5A4KA 2O7RA 4S0XA 3OZGA 3HM2A 3I9NA 3VPBA 2GBIA 1ZKDA 3HP4A 1F1JA 2V45A 2YV4A 4TLMB 3ZWAA 4C7OA 1EFLA 3TFWA 2YS7A 1IY2A 2DPGA 2WTUA 2C95A 3ZH2A 1RRPA 3ROQA 1XTVA 5CFMA 3R20A 2HBZA 1XXHB 2R7NA 2CMHA 2J3QA 3NS7A 3PKIA 1U2RA 1X92A 1EHYA 2YJZA 3A04A 5CFNA 2VBFA 3S81A 1EDZA 1FMCA 3GWZA 4A2PA 1NMEA 2HSEA 3SIWA 1P6UA 4RX1A 4B2YA 5FIUA 4MVYA 4L3OA 9MHTA 3IALA 3FOCA 3NV9A 1RJFA 4GI2A 5FTJA 3S99A 2G36A 1FJHA 5TF4A 1RIFA 4IINA 5EJ6A 4I6EA 1HDEA 3CPEA 3T0IA 1YJBA 5CBPA 5DMHA 3UWSA 1II0A 2GVNA 4PAGA 3G89A 5GMOA 4QOSA 2PSHA 3WYFA 1EFPB 3S29A 2EX4A 1FTQA 4JXJA 3JQAA 1FNSA 3IQEA 2AC2A 2NUPB 4M99A 5FBQB 4DDTA 1E1MA 2HLDA 1N7GA 2KQUA 2YDXA 2FFBA 4V38A 1D2GA 4G1UC 1X94A 1XQ1A 4MPDA 4RDIA 3SC2B 3U80A 3IELA 3C3MA 3ECCA 3NIDB 1E5QA 3JU3A 4FDUA 1M6VA 1QAMA 2EP7A 2QT9A 3DYVA 1T4BA 3BGIA 3LOUA 2D06A 5E2BA 2PX6A 1IMOA 4JLWA 4XOIA 1A8HA 2Z83A 1JHUA 1UPTA 2D2VA 5B30A 2GUGA 1Y3BE 1E59A 3WB1A 1JQDA 3E9CA 4IZ6A 1OV4A 4ECEA 3H87A 4YDRA 5B7QA 3V1LA 3WYNA 1O9BA 1IQ0A 1VG9B 3DMGA 5P21A 4CMCA 3V2GA 2PMBA 1IXZA 1HUQA 1MB4A 3I32A 1ZCAA 1G4UR 3I3SR 4FINA 1J7KA 4KQHA 1JR2A 3DBVO 4IIBA 1MB0A 3DKRA 3EGXB 1OVGA 5DLEA 4DIDA 1CB7A 3AILA 3RUAA 3VPCA 3VZBA 1Z0DA 1ZGZA 4AX4A 2W2VA 2ZROA 2ZWIA 3NDIA 3TLGB 2ZI4A 5EGSA 4AROA 2VEDA 5KOHA 2J4CA 1RYZA 2HXYA 2VDUE 3Q85A 2AZ4A 3QEOA 1DBPA 4HWPA 1EGQA 2IUUA 3WLIA 2N42A 4BMYA 1Z35A 1MW9X 2BUBA 2EBWA 1G3MA 1IY1A 2R5FA 3CLUC 3L6RA 4PLWA 3CLVA 2REQA 2PFKA 2IYFA 2XVMA 1KJJA 4J90A 4L8FA 4PX2A 4ZODA 4PPFA 2ARKA 1K2WA 1P31A 4G25A 5FNVA 4M9RA 2ZXUA 4QC2A 1UH5A 3GG2A 5IDXA 2ZWPA 1M5UA 3MT7A 1UK7A 2F9MA 3PD7A 1D6JA 3PPIA 4LHZA 4CM9D 2B92A 4JLAA 4B74A 2FK8A 3KKPA 4KQIA 1J8MF 4W1RA 3E9NA 3MCTA 2G83A 5EVJA 1O8BA 1YRYE 3IEMA 4DMLA 3VZRA 5DGHA 2CLSA 3ABRB 1CLUA 1ZM7A 3GX1A 3ROFA 1I1HA 3VU8A 5B5SA 4ZJUA 6NULA 2YDYA 2Z04A 2HMYB 4FYVA 4CQLB 3U1TA 3ZVLA 3G02A 3TE6A 1IXYA 3EOZA 3P9PA 4G0NA 1TK9A 3L8HA 4JQOA 1BXGB 4LZPA 4UPEA 5E95A 5K6RA 2NZYA 1Y8QA 3H86A 3LSYA 2ZE8A 4ZD6A 1GRNA 4DA0A 1GJRA 3DXFA 5JH7F 2BBOA 2QUIA 1EXDA 4ZYYA 2XE4A 2GFQA 4D6XA 3NOXA 1OFGA 5KZMB 1SB9A 3UQZA 4WCFA 2FETA 1YS2X 1QF7A 5KWEA 2ERXA 1TYBE 1XZIA 2RH8A 5DN9A 5FO1A 3HFJA 1DQNA 4KIFA 5LP6A 5IT0A 1TM1E 4MCHA 2Z6AA 5J2TB 3DMTC 4LDPA 2J9RA 5CB8A 2RHHA 2C7OA 1U0GA 3UCEA 1DARA 1UEJA 2IOHA 2IT1A 4FEEA 3RTAA 1XTIA 3HN2A 2ENWA 4Z5XA 3NFYA 1FY2A 2EQAA 5EZYB 8AT1A 1JEYB 1KBZA 2FR0A 3FNHA 4FUQA 5FT9A 3A9WA 3HBFA 1HFWA 4YVFA 1ZA2A 4B6OA 2PUDA 2AGVA 2DCMA 4FYMA 1W0KA 2EKQA 3GNSA 4CGYA 2QN9A 3GVIA 5LQRA 1TLTA 4TTVA 2GK4A 3SXJA 3IIJA 4L07A 2NN3C 3I2FA 3AUAA 2JA2A 3PGXA 3K05A 4K05A 2C8LA 2I78A 3KXDA 3J81k 5JRJA 1G8KA 4EG7A 1N34B 1U0FA 3BMCB 4COOA 2FR1A 1WMSA 1L5OA 2O7VA 1LI5A 2WIDA 3BRWD 4LZZA 1JR3E 5CX1B 1ORIA 2O48X 2B36A 2WHPA 1LB1B 1Y8RA 2HJSA 1U2DC 1UODA 4BFYA 1IVSA 1KMNA 2WYWA 5DK4A 3DAHA 3M4XA 3OZTA 2YN2A 4EFLA 2WLTA 4UFPA 4Q12A 3A36A 2WM8A 4E4YA 4BVKA 2Z98A 3HR4A 3D3WA 3HXKA 1I3MA 3E7DA 5HJ5A 5HK8A 2QD2A 3ANSA 2CWDA 1BN6A 2IKQA 2W8BB 3I1JA 5CPFA 1V43A 1P3DA 2JJ1D 3NH6A 1NTOA 1BJTA 4WKOA 5DKFA 3BH7A 1M6YA 2H4YA 4X7RA 4GXRA 4PVDA 4TOIA 2CWWA 2EJTA 1T2CA 4QTUB 5AKYA 1XALA 4TV8F 5CM2Z 3L5OA 1Q84A 1I32A 3MHPA 4RMNA 4C7MA 4EABA 3L6UA 3PC2A 4X7BA 3TL6A 4CFZA 4EFDA 2G1PA 3OKCA 3ABSB 3IESA 4OM7A 4OXIA 4HF7A 4YDSA 5C31A 3SQMA 3TDNA 3ZV7A 5JXJA 5JNRA 5LNK6 2UZ4A 3KEQA 2QLMA 2HU2A 3L82B 3PTLA 1PSDA 1XNHA 3H3XA 2IEDA 3NBQA 4V0KA 2EVWX 2G67A 1VM6A 4FGSA 4I9GA 2NZXA 2X4GA 5DLQC 2V54A 5AKIA 3VVMA 4I4CA 3WLSA 1Y4SA 4M9UA 1DJNA 3L43A 2XTNA 4RHFA 3LY7A 4A8JA 4L5JA 3KFXA 2DHQA 4M1EA 5C7IO 4WKGA 2Z8YM 3DZHA 4WIAA 1EG2A 3K35A 2Q3HA 3VR6A 4HWTA 4XWTA 4ZZIA 2QUKA 1G63A 2HADA 2NUPA 2RC6A 1HLPA 2NSJA 4WE3A 2IYOA 4X1KB 3WSTA 1WU8A 4A5OA 4CKWA 5HTOA 3SQWA 2VOEA 2I80A 1KDPA 4U9UA 5KS2A 2ZBUA 1XU9A 3PFHA 4PM4A 3W2EA 2AUTA 4DDVA 1Z07A 1PWXA 4YJFA 1T2VA 3NOQA 4X1YA 5ALIA 3R5TA 4TXHA 2VFAA 2HCTA 3EZGA 3KKMA 2F4NA 3NM6B 3ND5A 1TZJA 4KN5A 3RIEA 1DHTA 5IVPA 4EDFA 2CBGA 1WE2A 4L1KA 2BF4A 3PDIA 3FMVA 2VSOA 3VGJA 5FPKA 4N7BA 3CH5A 1SC3A 2B20A 3HMKA 2C2BA 1N2JA 3VR5A 5LOVA 4W4TA 3CNLA 3EFOA 3IP8A 5JAIA 1WUJS 1ZBDA 2H92A 2PAAA 1IOLA 2QUBA 3BMNA 3KSDO 4MIEA 2HQBA 1NIPA 5DHTA 5A2GA 2GN9A 2GSWA 7GPBA 1UJNA 2Z5GA 1GDTA 3KSBC 4ZA2A 3JXEA 3BF8A 3LHIA 1I7NA 3LY5A 1ONNA 2PUJA 3GP5A 4Y2UA 4XWKA 2IRWA 1FXWF 2PS3A 2W2QA 2QTLA 1V7ZA 5EIOA 5KIAA 3U4QA 1YKSA 4BYMA 2ZAIA 4Z4EA 4OXYA 3INNA 4US1R 1RHRA 5TMPA 5CTAA 4E7OA 2WAXA 1URPA 2CSXA 2N75A 4D02A 2FK7A 2P9CA 2B0JA 1NMZA 4TLCA 4YCSA 1GKIA 2O3QA 3ENKA 1J90A 1JBKA 1E9SA 4GSLA 2HF9A 1WVGA 2F43B 4M89A 2Y2VA 1Y9JA 2PRSA 4G8DA 4J76A 4X60A 4KR9A 2ODEA 4GU5A 4P53A 1SXGA 1PVDA 2WT4A 4UZSA 1K4YA 2G1UA 5K2MA 3E70C 2P6UA 4LZJA 5A7GA 1N9GB 1FMJA 2J41A 5MN4A 4LN1A 1Q2UA 3B3AA 5HQ3A 4QXOA 3UHAA 4R2JA 5JS6A 2V4UA 2B1RA 2C8VA 2GF2A 5EGNA 1SQ6A 4RK7A 5K8UA 3SJCA 1LUAA 1N9KA 1WKBA 3PQ3A 1TJPB 3OCJA 5CDHA 4CYMA 1AM4D 1OXTA 4MKRA 4BWVA 1Y6RA 2PGXA 4KGXA 1MJGM 1Z5ZA 3BIJA 4ZOQI 4FGKA 4F46A 2SECE 3OZEA 4RW0A 2G28A 4KWEA 1APBA 2A33A 1BXRA 4MW9A 4EGQA 3VKVA 3R0XA 4ZC1A 4DLPA 3NBZC 3FNEA 2GPTA 5GGXA 7MDHA 1EX1A 3IJPA 4MI6A 4Q1EA 3AVOA 2V4ZA 4ZV9A 5EZYA 3A31A 4MUEA 2GAOA 2ZT7A 3USES 5BNWA 4QUKA 1LPSA 3JTEA 3TNLA 1KMIY 1LLFA 4EG8A 3TG8A 3VZQA 1QNLA 2AH5A 4IZOA 3V1YA 3SKXA 3VBEA 3ZWMA 4YYZA 4P3NA 3FJOA 1XU4A 1R6XA 4CDRA 4PICA 1KO8A 3K9NA 3QW2A 4QBGB 1USIA 3INRA 2HMVA 1CS0A 3MNFA 2PZGA 1DEXA 4OBXA 4F1KA 5AKKA 1T0IA 4WK0B 4DV1B 1PCXA 3Q1KA 2AEFA 4WHMA 2IPMA 4LXGA 1CERA 1VIMA 2YXNA 3NUZA 2D3WA 1U6KA 1Z88A 3NBMA 1NXSA 2FVXA 4ETMA 1HF3A 2I3DA 2ZDGA 1G21A 1IHDA 4G1VA 4IMJB 4DPMA 5ALTA 5I5EA 2NU6A 3MM4A 1V47A 3AEQB 3AQ4A 4DR2B 4F97A 4PANA 2ZWAA 1GLNA 1SCUB 1Z26A 4ZHQF 3ZU4A 4KVAA 3SKYA 1UP6A 1OXSC 2JBWA 2Q9CA 3ODPA 1RAFA 1KJZA 2QL5A 4KO3S 1KMCA 4V1CB 3RT7A 1TO1E 2QNIA 3TZ6A 2ZVJA 2F90A 3HV0A 5FV4A 1G6KA 2XCIA 4KJXA 3THRA 3LDAA 4DIUA 2QB5A 4OL9A 3HJBA 2BCJQ 3DLCA 5JZSA 3K70C 2BSQA 3OU2A 3EH2A 2X4LA 4LYGA 2WTMA 4NOMA 1AGRA 2PKYX 3V7UA 3FCEA 1EE2A 1R8XA 3X1ZA 1WDMA 1WXQA 3EVBA 1E2JA 1NA5A 2DM6A 5KVQA 1SVWA 1K5PA 2QQ0A 4LFCB 2FWNA 7AT1A 2NO4A 1NASA 4M86A 3RJZA 3V8BA 3K6SB 4DJ5X 1YJ8A 3CPJB 3FRJA 1YOVA 2D2EA 4K03A 3E8SA 1WVMA 4JYPA 4URFA 4G0UA 2XJ4A 2GZ3A 1D4OA 4JN6B 4G5YA 1M3SA 4OGLA 3EXFB 3WTCA 4CL0A 3E2MA 3LFTA 1BX1A 3OIGA 3WIOA 4HWKA 1CY6A 2VAXA 1H6CA 4C0HA 3E3LA 1F4PA 2HK8A 1FLDA 1SBCA 3GGJA 4M22A 1I3LA 1GKKA 4ROTA 4Y2PA 5LP6C 5JSFA 4ZZ3A 4IM7A 3OP4A 1KIMA 5EP4A 1YT5A 3PHJA 3NT4A 4HGZA 5FFNA 3ZWPA 4B8WA 4YAGA 4P4SA 4JJ8A 1Y8CA 3OTWA 2IXFA 4W7HA 4EW1A 4NY1A 3TSAA 5KKAA 1RI1A 3O7MA 4HOYA 3TJMA 4INZA 1HFEL 3BXOA 4OIMA 4BKUA 1EINA 4EEZA 4ZDJA 2PUGA 4Q93A 4YMSA 1EWKA 1HYGA 1AGXA 1OAOC 1ZL2A 2CXQA 2I3GA 3ASZA 1U0BB 1OU4A 2Y1FA 4W7SA 3U7JA 1E18A 1ZICA 4TXJA 2Q6OA 1W44A 1T34A 2OQ2A 1JHAA 2RJOA 4X64B 2BCEA 4QU0A 5BSGA 4YGXB 1ZR2A 1R0WA 2SCUB 3E48A 5JMOA 5LOVF 2NVWA 4FFVA 4C01A 1QORA 3DFIA 1PD1A 5TMEA 1N3YA 4N5NA 1RMTA 3T41A 3UOWA 4C7BA 4KU4A 1C1HA 3AVQA 2IEGA 1KTIA 4Q3EA 4RD3A 5KJFA 3AEXA 1LRKA 2C83A 2P75A 3PPVA 3UJ8A 2J5KA 3R6GA 4X20A 3IUMA 2JEYA 5KYWA 1A9TA 1NVEA 1TA4A 3FFBA 2JH3A 4L4ZA 4DSOA 5CEEA 1OZHA 1LBEA 3AC0A 5A3JA 3QE4A 3F74A 4LWPA 5JZMA 3I9V1 2PQMA 2CJYA 2RHBA 1T4GA 1P4AA 2CFTA 3AIMA 3K0BA 4K9DA 1T9GS 2RGXA 2HD4A 1NX6A 1JKFA 4DJAA 4F8JA 3PE3A 4B4DA 1ZD8A 3AO0B 4KFSA 1UJ4A 4NBRA 2P8JA 4I99A 2FRXA 2QSJA 1A04A 3FZEA 5LDGA 4EY4A 1ILEA 3KVRA 5DSTA 4RVFA 5IMBA 1RTKA 3GCWA 4AKGA 1CY0A 5B3JC 4PQFA 3VQTA 1FRZA 4TRJA 3UHFA 4DQKA 1M2EA 1VC2A 3BTUA 4LISA 2YVUA 1RAIA 4UAVA 4XVHA 1S2OA 2OBXA 2GM3A 4IDDA 5SZJA 4RCYA 5FI1B 1JT9A 2FMTA 3QXGA 4Z1OA 1OI7A 4BC1A 1E3DA 1C7ZA 2RGCA 2DH5A 1WP9A 2FUG6 1Z16A 4KQWA 4UUBA 2ACKA 3BC1A 2YN0A 3ED1A 2EZTA 4M60A 4C76A 1Z2CA 3HCWA 3JQEA 2NQTA 2WHEA 3IT3A 4OP2A 2OMKA 3GPCA 1F2UA 5EXXA 3F5QA 2FPXA 4ZQCB 3O3OB 4K3VA 2YRWA 1E2NA 2WZQA 1R4NB 1NL3A 1WQ1R 4N18A 5GM1A 2XDWA 1B6GA 2AI1A 4NZNA 1FA9A 2YIJA 4ZI5A 3OU7A 2AXQA 4KK3A 1FS5A 5ITWA 2JFVA 2QXUA 4MQFB 2ZUBA 1Q5PA 1I36A 3BICA 3UV6A 2Z9DA 1K8ZB 1H6DA 3CNQS 4DUPA 2ZJ6A 1W6RA 3IIIA 2BM8A 1OBHA 2AXNA 2L0XA 4G1MB 4GBMA 1ZMBA 4DB4A 3ZJYA 2R25B 3OUZA 4IVNA 4NEGA 4F0JA 3ESRA 4YCLA 2PGOA 4FKBA 4DR1B 5DSZA 1MDFA 2W6QA 4GX5A 4N65A 4PHCA 3A05A 5EJIA 5JD6A 1JKJA 4I6JA 1L7XA 2IU0A 4F7DA 1Z7BA 4HEJA 4IJKA 3QLEA 1ULHA 2AF4C 5CFOA 2H17A 4AY2A 3T3PB 4BMVA 2IDMA 2C9MA 2B37A 2Z56A 3IBSA 2PJRA 1AN0A 2OCAA 1QKJA 3STHA 2VAWA 3EG5A 3V4PB 3ER9A 5SZHB 1P44A 1K2VN 4I1SA 4J75A 1Q95A 5CGZA 3MWGA 3BMCA 3B8EA 3C3EA 5EZSA 5AVWA 2VRBA 4CM8A 4U4AA 5EWMA 3WNDA 5AM5A 2DG2A 3OX2A 4HMOA 3HYLA 4E13A 1JU4A 2BKVA 3NEJA 2XWPA 4X7MA 1EK0A 1DG1G 4MWEA 1EDBA 2JGMA 2ZCUA 4RAQA 3SF0A 3ZNQA 4MDEA 4QYMA 3BILA 5AOBA 3AM4A 3R3VA 4CM9A 3D4LA 4G4GA 3MUNA 3WFJA 5L51A 3KUCA 2Z08A 1IQRA 4RL6A 2E48A 3ZJUA 1XU7A 3SVZA 2ECQA 3SZOA 3ZDYB 3PLNA 1BQEA 2ADFA 3C85A 3GFRA 1AQLA 1PR2A 1A7KA 3BZWA 1I24A 1G17A 1MNAA 1HL7A 1P29A 1KMHB 2R47A 2ZYDA 4LBWA 4LHWA 3REQA 2ZIXA 5FPHA 2R0QC 5K0LA 1WQ3A 5SZKB 4F11A 3RLFA 1PFQA 1JPJA 3HZHA 5FL7D 4XR4A 1YZTA 1CF9A 2RI0A 1QP0A 2HHCA 3RPEA 2R1ZA 1BMFA 4RH3A 1QQBA 2EBHX 4CIDA 3AUTA 1U3FA 3KZKA 4MKIA 3ROTA 2GRUA 3S2SA 4YPOA 4YHHB 3LZ6A 5CVEA 621PA 4JHXA 1G4AE 2XB9A 5B12A 1Q6ZA 2UYQA 3RSFA 2ZUFA 1AS2A 4ZCSA 5B4VA 2IOYA 1E69A 3AHFA 3DZDA 4A0GA 1RYDA 3N0VA 4GXQA 4YAKA 1G6Q1 1NJ6A 1OASA 4Y9RA 1H0RA 5EERA 2HA5A 2VZ8A 1F3OA 3GLGE 1AJEA 4GT1A 3OVMA 1C2TA 4JASB 5LQKA 4B1FA 3K2BA 3OOWA 3VR6D 1K7YA 2PH5A 5CXXA 2BUCA 4PYNA 2X4IA 3MCVA 3K16A 1JAXA 2X9NA 3KELA 3CF4G 2BMWA 2IS4A 3H4IA 3VR3D 2IW3A 1ID8A 1A0OA 2CZGA 4MIKA 2OWDA 3DEHA 1SPBS 3IAEA 1OPRA 5DIFA 3PUVA 4MQMA 3V4RA 1TKRA 2WU8A 3SG0A 2XUAA 1AO3A 2H48A 1SBQA 4KDEA 3MQ4A 3OTIA 4JYCA 4KLAA 4MV5A 2IPOA 4UU8A 1OH5A 1RM4A 3QLTA 2R5NA 4UEKA 1UDBA 2V4MA 4RPLA 3UHJA 3SQDA 3FGZA 3GK3A 3RAGA 2GS9A 2RHCA 4BO3A 3EXHB 4R71A 2C42A 4LTDA 2FRVA 3IDQA 3QUTA 1KEWA 1T0BA 3OPQA 4FB4A 2H1SA 4R9RA 3RREA 4AZSA 2QN2A 3D5TA 5LFAA 4NAHA 3V8NA 4B4VA 2YW2A 4KMMA 4OKNA 5IT4A 4YUXA 1D8TA 3BCRA 1CEQA 1UMCA 1KF0A 4CMKA 4GPIB 1CT9A 4DR3B 1Q44A 3NI2A 3V2IA 3FROA 4WECA 3AETA 1R0LA 4CQJA 5I7UA 2R85A 4N6GA 3RAJA 1QUEA 5IXJA 1TTTA 4O8ZA 2P62A 1UKBA 2B94A 5J1TB 1C9JA 2MMGA 2JHFA 1N2XA 4CFSA 4GE3A 1NRJB 5FCDA 5HE8A 3UANA 1G9TA 4PZ9A 2UXCB 4N3NA 3I62A 2ZTUA 3G9ZA 4L4YA 4CM4A 4FYYA 2FG5A 3A6JA 4BQPA 3HJCA 1CJKC 4M76B 3NHSA 2BHLA 1XXLA 4DY6A 1JB1A 2C7RA 3IQGX 3T7IA 1LK7A 3RRXA 1JUDA 1ABBA 3DONA 5EINA 2OXRA 3FYHA 2ZPAA 4MUAA 3U4MA 1HE4A 2ZKIA 3BJRA 4P4TA 3UUFA 1Y5MA 4YCNA 2NO0A 3WGIA 3KSMA 4GI1A 1O95A 4ZPXA 2JLAA 3EWNA 2BBWA 1GLVA 4LJKA 1E5VA 5TPZD 5K3FB 2WV9A 4GLJA 3PQ4A 1JG1A 1RYHA 1P74A 1P9NA 2HRDA 4MMXB 4PX3A 3O03A 3KEMA 3ZWBA 5DH9A 5CEJA 1DE0A 5LOVB 4RL4A 3ROGA 2VPIA 4JR1A 3KLPX 1FFSA 1JTVA 1C1DA 2PGDA 4KW7A 1W1IA 5KNDH 3K70B 2WMOB 1ZM2A 1PR9A 4QO7A 1FS4A 4RA6B 2ALJA 2KB0A 2CB9A 4NU0A 2O1SA 4YNBA 5CT8A 5CX4A 4CF3A 2XBMA 3VXKA 2OV1A 3P0JA 2OV2A 2B4RO 4Q47A 2FH5B 1AZTA 4ZEOA 1EFAA 3M81A 1T1SA 4GM1A 4F6CA 1E8MA 3O4FA 1J5PA 3IKLA 1RKVA 2QRNA 3KR9A 3KR1A 4F60A 3WMFA 3J80A 1L2TA 5FBZA 1ZJWA 3DE5X 1ISIA 3R7FA 4H2DA 4MCJA 4EYQA 5I51A 5CA1A 2GHIA 1RQNA 1MT0A 3EUAA 1FFXB 4QASA 1O03A 3G8CA 4XQ9A 4EB8A 3KL2A 1GXSA 4KQ2A 1NOIA 2G1AA 3W5UA 5AIBA 1CNFA 1J42A 2WSBA 3TEJA 4RJTA 1YQ9A 2CXTA 1Y7PA 4CNBA 2CVQA 1JHVA 1OJLA 2GARA 2ZBRA 3ASVA 2PMFA 1F20A 3A58B 3OJLA 2W98A 5BR4A 4L15A 5C1BA 2I4MA 1S01A 2VUSA 4RYDA 3F7NA 3SSNA 3LW7A 1TA9A 1R0KA 3G5AA 3TR0A 4DCGA 1VKRA 4ZQIA 2JNWA 5J5VA 5L6MB 3BPSA 4A1OA 2Z58A 3EUFA 5J9FA 4CLRA 1UKEA 5JJBA 2E6KA 3HNPA 4L5CA 4L28A 2FY8A 5BV7A 1WB6A 2V7VA 1XDGA 1BHO1 2I7VA 2RCNA 2OQIA 3IFSA 4IEIA 1MJNA 1XG5A 2XT6A 1LFDB 1N2IA 1KMHA 4OQEA 1FSFA 3DF7A 3ITDA 1VE5A 2XOKD 3ZGNA 2D00A 4PFJA 1L7OA 3CMCO 1SC6A 3R75A 3VDXA 4DMKA 3KCQA 1GGNA 3A3NA 1P91A 2QBYB 4EPYA 2AR0A 2C1XA 3K1AB 3M3DA 3N5CA 4DRXB 2HA0A 1UC9A 3M6FA 1DINA 3ZHCA 5C53B 1DS6A 2Q4BA 3OJWA 3WQHA 1TEVA 5G02A 3V2UA 3AG5A 5FJJA 3OUTA 3LOQA 2VYCA 5JJ5A 2IY8A 4QX6A 1DKNA 1IULA 1UFRA 1SG0A 4MH0R 4BVEA 5EQTA 2R68A 3UXYA 2IOQA 5IANA 5HIJA 3OLQA 4ZCLA 3HUEA 2IYRA 3Q3CA 2ZS7A 3IP9A 1EXWA 5JFGA 3JYOA 4A4DA 4UW9A 421PA 3G7UA 1RKXA 2FZ5A 5I9SA 3VR2D 1QG2A 2CJWA 4XI9A 5L3SA 2CNKA 1ORWA 3LUJA 3EUEA 6REQB 3AU9A 3NBAA 4MVJH 4ZMRA 1CQZA 2ZYUX 4UBMA 2I5PO 3KU1A 4TWZA 3BWVA 3SOPA 4C6RA 4V1CI 5BV8A 4AMUA 2K7ZA 4EVQA 2R5WA 1MO2A 2Y9PB 4LBZA 4WCVA 2C0CA 5ITVA 1TKCA 1ZAYA 5EQJB 3WIUA 5KTKA 3B6JA 3WGKA 2Y77A 4HNQA 1W30A 2P0AA 4I50B 1NJSA