1YU9A

Gppnhp-bound rab4a
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
175
structure length
175
Chain Sequence
b'GPLGSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGEDVEEAFVQCARKILNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding protein
publication title Structural basis of family-wide Rab GTPase recognition by rabenosyn-5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 60
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2005-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1yu9A01
4LC0A 5JCPA 5D3MA 5DYIA 1XEWY 2JDID 5EP2A 1ZAKA 1J90A 3PG5A 4AYTA 1OXUA 2VHUA 1E0KA 1SZPA 3CRVA 4Y0VA 5J4HA 4LYJA 5BN3A 2VP5A 5J47A 4QBHA 2Q9AA 1FUUA 3H1TA 3OIWA 4GP6A 3SS8A 1OIVA 1GRQA 2FGJA 3JZMA 2VSOA 1NL3A 4IDQA 4HZUB 2YINC 4CVNA 2D74A 4LJ6A 4PC6A 3BRWD 3WXMA 1TMKA 5IK2A 3THYA 3P4YA 4FMDB 1W0KA 3N70A 5JMTA 4RFSA 1U9IC 1KZ7B 1HE8B 1Q21A 4JLOA 2RGBA 2MMCA 3HYTA 4HLUA 4OQFA 4GMXA 4C0SA 3NXSA 5IRCD 3N2EA 3RRNA 1IN5A 2OFWA 5IF9A 5DE3A 4JMPA 1KJYA 1NI3A 3M0EA 4UNNA 1KI4A 3CH4B 1NVVR 4YLGA 1E96A 4WW0A 5KSPA 4NU0A 2JLUA 4HLUC 3U44B 2H57A 5CM8B 2GETA 2NPIA 2RGCA 5J4VA 4QC2A 3NHAA 1ZC3A 1OFIA 1W2GA 1TF2A 2YOGA 3KQHA 3CM0A 4DCUA 2JJ1A 1JXMA 1L4YA 1N0UA 2RAPA 2PCLA 2QPAA 1KO4A 1NVVQ 1RJ9B 1XPOA 2BKUA 4IVPA 2VQSA 4X8HA 5C46F 6Q21A 2SHKA 4DSUA 2ZSAA 1PLLA 2IHYA 1O87A 1E2PA 2P65A 3SBDA 2D4HA 2DPXA 1H8HD 4Q03A 3LAWA 1COWA 3GLFA 1WA5A 3QKTA 4YDSA 2AHOA 2ODBA 3KJEA 5EXXA 3E1SA 3SYNA 3GJ4A 1NIPA 1UKEA 2WKPA 4OYHA 1E2HA 3B9PA 3H4MA 1E2MA 2REBA 3WP1B 4JVSB 2IBMA 2CE2X 4E09A 1VPLA 3T61A 2QA5A 3T5DA 2ZU0C 1XEXA 5DN6D 1L8QA 4CW7A 1NSTA 1UBEA 3TSOA 3W6OA 1QF9A 4QNRA 3AEZA 4DLUA 2ERXA 4P4SA 3WBKA 2VH5R 3BK7A 3PV0A 3GQBA 5KDOA 1C1YA 1XCGB 4KSCA 3PUYA 1KMHA 2PZFA 3WRYC 1DBSA 2YV5A 4CT4B 1IXSB 2AWNA 1W2HA 3CONA 2AKAB 1ESNA 1W4BA 3THYB 3LBIA 2ORVA 3BE4A 4JLBA 1CXZA 3EARA 4RFSB 1SVLA 5TDHA 2VHTA 5H8WA 3K70B 1FMLA 4NBSA 1NY6A 1Z0JA 1Z3IX 1HUQA 1G3RA 2FZ4A 2B7CA 4F4CA 1AQUA 3LV8A 1FL9A 2J0QA 4W5JA 3AM1A 1M6NA 4G5GA 4DUGA 1US8B 2C8VA 4II7A 2G3YA 1OXVA 2CNWA 3AQ4A 4A0GA 1D8TA 3K9LA 4JBYA 3MUFA 1G19A 5CJPA 2ZS7A 2QTHA 2FPMA 3LXXA 4C4PA 5A4JA 3B7GA 4TWZA 1NVUQ 4R2IA 3P32A 5A0FA 2FH5B 4ZKEA 4ZIRA 2HJVA 4LPSA 3GLGE 4AIIA 2R8RA 1XJ0A 2CCGA 1NVXQ 3CX8A 1P2VA 1KK1A 3C5HA 5CB6A 2GJ8A 3NTUA 5AJYA 3SOPA 4GBMA 2BJVA 3C8UA 1E2EA 4RD0A 3GLGB 1Q3HA 2R6FA 1JECA 1CIPA 1G8FA 4HAXA 2F43A 1YZUA 2BCJQ 3QKRA 4KFUA 5FOSA 3U3OA 1SXJD 4P4UA 3Q85A 3GP8A 2OUKA 2PJZA 1XCMA 2N46A 2ZYWX 4HDOB 4LY6A 1XJCA 4RD2A 2JJ2A 3U7EB 1EGAA 4DLVA 3NEYA 2D2EA 4A2WA 3K0FA 3K9GA 2PEYA 2CK3A 1NN3A 2O8FA 1OH5A 1XD2B 2W6ID 3LW7A 4C0AC 2FG5A 4D0LB 5TB5A 3ICQB 1JR3A 3JVUA 3QIAA 1IXRC 3W90A 3EIEA 3QG1A 1SVSA 2JAQA 1VYTA 2WOOA 2P6RA 2FSGA 1E94E 1P4SA 3NBYC 3U3RA 3DMNA 3LX8A 1K8RA 4ZDWA 5AJWA 3EC1A 2FNAA 2B7BA 2VIIA 1IN8A 2JDIA 3RRMA 4DKXA 3BERA 2J87A 4QJ5A 4KITB 2G83A 1KMHB 3EW9A 3ZQ6A 1P9NA 3MMPA 4ARZB 2ZR0A 3T12A 4NYIQ 2PJRA 1N5JA 5L3QB 2FZLA 2F1JA 1CR4A 1KO5A 4Q1CA 2VP0A 4L9SA 2PZEA 3CF2A 3IDQA 1IM2A 4JBXA 1QVAA 3B6EA 2AN9A 2BMFA 4LGMA 5TV2A 4D4MA 3K0CA 4WOPA 3LQQA 2I1QA 3I72A 4ZO4A 1AGPA 3U3KA 3BORA 1W4RA 4D25A 4NH0A 2QP3A 3UATA 3T06B 1G5PA 3K0CC 3FFAA 3GD7A 3VR3A 1Q0UA 3QOFA 1OFUX 1AZTA 4WVFA 5LPNA 4PPFA 2XNSA 1D2NA 5DGXA 2QMEA 5JWRA 1EFCA 4PC3A 2NO0A 3OIUA 1X3SA 3A1SA 4RKEA 4TTPA 4UXJA 4DLTA 4Z51A 4A0HA 4W5HA 1G3IA 3K9HA 1ETUA 2V9PA 2C78A 2JATA 4JLDA 2BMEA 3FFBA 3DO6A 5K8TA 3B1WA 2ZI4A 5JS8A 4WA7A 2PX3A 4J0QA 4ESHA 2ZITA 2Z5FA 1E98A 5FTNA 4MYHA 4TMVA 5FUXA 3U6BA 4NL4H 3RS2A 2OBNA 1XU4A 2EW1A 2O8CA 3IKJA 2PLFA 2F7SA 3K0FB 5LBIA 2KWIA 1H8HA 1UBGA 2UKDA 3F5FA 3TW4A 2O8FB 4IFBA 1OIXA 4D4LA 2GKSA 4Q4HA 5CM9C 1P6XA 2CCKA 1TF7A 2YYZA 1RE0A 3GJ3A 2A30A 2V7QD 3ASZA 5DI9A 3AF4A 2ANCA 3OE7D 2JLQA 1Z2AA 1GP2A 4LHWA 2EFGA 5DN6A 1PJRA 3HU1A 4MDFA 3K09A 4OI0A 1Q22A 1GKIA 4D6PA 1EK0A 3IUYA 1CRQA 3AKDA 4MYUA 4DDWA 3WHKA 2IF2A 1A1VA 3LVQE 1EFHA 1T91A 5HTKA 4Z54A 1OB2A 5HKKD 3WNBA 3CNNA 5TMPA 2ZR7A 2W58A 4PZZA 2A5GA 1W36D 3D7MA 3K09C 4HB4A 4OJQA 4POAA 5JWOA 2KJQA 4NCIA 3K0SA 1TUEA 1CLUA 1Z6AA 2GILA 1UADA 2J46A 3QPWA 5C4GB 5KUTA 4ESVA 1IY2A 1MO6A 1A2KC 2VO1A 4GL2A 2QMUA 5EE9A 1D2MA 2C9YA 5FI1B 2Q3FA 2GEUA 3AH8A 1KI8A 4ZPXA 1ZCAA 4Q47A 2GCNA 2OCYC 2YC2C 5TVKA 2QTFA 1MO4A 3BC1A 1ZINA 1XTIA 2ASEA 4DZZA 2A3RA 2QT1A 4IEIA 4Q7JB 3NHBA 4W9MC 4GRAA 2VPPA 2WIAA 4NCKA 3U2QA 2RGNA 2WV9A 1AK2A 4DLZA 3VKHA 1ZD1A 3ZS9A 4D4KA 3B78A 3TUJC 4TZ6A 3ONWA 1RIFA 1FQKA 1EXMA 4JT2A 2JLWA 3KUDA 4LBVA 3RAPR 1TQ2A 2RGNC 1KDRA 4DLYA 4XSGA 2C77A 4PPQA 4UKDA 1GFIA 4Q01A 1GRRA 2CVFA 1EWRA 3T1VA 1C4OA 1SVOA 3QQ5A 4Q9IA 3TAUA 3I73A 1CULC 2J1LA 2O8CB 2JJ8A 1P9WA 2W83A 4IOMA 4MRVA 1IY0A 4Q4AB 3EG5A 4AWXA 1SXJA 4HAZA 1YRAA 4TZ0A 4A2PA 2QAJA 3KFXA 2Z0MA 1CKEA 1GWNA 1M74A 4PSAA 4O2RA 5AJVB 4Q9HA 2EWWA 4MKFA 4ZDJA 3CNLA 4FCVA 4TT3D 1BYUA 3AP2A 2YKGA 3ZD7A 3QPUA 4US2R 4ITRC 3TUIC 4Q4HB 2V1XA 2W6IA 1SXJC 2CEAA 1P61B 5GJCA 4B47A 2YOFA 1Y63A 4OHXA 3PCRB 4L9WA 2QP4A 5HCIA 4B3DA 2I1VB 2QAGA 3QVVA 3EZ6A 4IXMA 4G5QA 1G16A 1N6OA 1XNJA 3LFUA 1ZC4A 1RVDA 2N42A 2W2XA 4H9GA 3A1TA 4DIEA 1V5WA 2FFQA 3AKEA 3IEUA 1Y3AA 3ZZUA 4PO8A 4EJSC 1SVWA 3R7WA 5L3SA 1NBMD 2IXFA 5KNCA 3KUCA 3W5JA 5AUOB 1KK0A 1W5SA 2FOLA 1U0JA 1KNQA 3P20A 4X8LA 3W8RA 3J81k 4KJZA 1I4DD 2PCJA 1LVGA 5B30A 4URYR 1NMYA 1G8GA 1TPZA 1XTSA 1KGDA 4V0NA 5FL3A 1G8HA 2ZYVX 3Q72A 4TMXA 2IYTA 3MGCA 3G5UA 1Z0DA 2KI5A 4C2TA 1NLYA 4TQ9A 1LW7A 3AGPA 2XZOA 5GVSA 3B13B 1CS4C 1UAAA 4I81A 5EZ6B 2FMXA 5FBQB 3FMOB 1N6RA 2HCBA 3NKVA 2J5XA 421PA 2IS6A 1G7SA 4TL6A 3CLVA 3TUZC 3K0AA 1G8PA 1XMSA 3AVOA 3NDPA 5AK0A 4JJKA 4G3XA 4HB0A 4FCWA 3DZDA 4BGDA 1MRSA 2WJGA 1NRJB 3EIHA 4URVR 3G82C 1ODFA 3T34A 1OLOA 3EX7C 1CP2A 3U4QB 2R9VA 4UNSA 2G0NA 1S8FA 3A8TA 4JS0A 5J5CA 3K70D 5FL7D 3NC0C 1OT3A 5FFMA 4Q9LA 4QM7A 4QRHA 1Z06A 2A2ZA 2E9SA 4TTRA 4NDZA 4EAQA 4YQFA 3KKPA 2H5EA 4DC9A 4YMTA 5BN5A 3W6NA 2YVUA 5DISB 1R6BX 1GNPA 1RW4A 2ZRDA 4H1VA 4P33A 2H1LA 2WM9B 1DAKA 3BAFA 4DSTA 1TAGA 5KOYA 1XTKA 3U7HB 3BH7A 1UBCA 2P67A 3QEOA 2QAGB 3VNVA 4M1SA 1F3OA 3LA6A 1T8UA 1SULA 2V7QA 3A1WA 3B2EA 4JYCA 3OE7A 4L5BA 3R7WB 2A9KA 1GTVA 4KU4A 1FX0A 3RC3A 3SN6A 1YR8A 4HDCA 4QGHA 2ZSDA 2P3SA 3KFVA 4P0TA 4X8OA 5JEEA 3SU8A 2Q0HA 2YWFA 3Q9LA 3SJBA 1HEIA 2J0VA 1YRBA 2OG2A 5HKKA 4WXPA 1XEFA 3I5XA 1Z6YA 5FPKA 1RRPA 4KBGA 1CBUA 5GJWC 4ZDIA 1DTSA 1W48A 1YZLA 5FTMA 4HEJA 3R9IA 2YOHA 2WJHA 3PFIA 1I2MA 1NY5A 4B34A 4ASUD 1F6BA 1G7RA 3IHLA 4B74A 1P2SA 4DJTA 1W36C 4MRNA 2D62A 4Q1FA 4I1SA 1VMAA 4AYWA 5B58C 2XJ4A 2EFHB 5BW8A 5ANRB 4DT1A 1G21E 4UNRA 3CR7A 5IHPA 1OB5A 5CYPA 4MKGA 2RKOA 1FPMA 4Z8YA 2R2AA 1R0WA 2GAAA 3VNUA 1TU3A 5JSZB 4GOJA 4YXWD 5A5GA 2F9MA 2GXAA 2X19A 2A5FA 3UK6A 5BQ5A 1Z83A 5DIFA 3TRFA 3CUEF 3UPUA 2OBLA 4RZUA 3TSWA 4E5UA 1XMJA 2HF8A 1MV5A 1DS6A 1Q1ZA 3KDSE 3H2YA 1NMZA 2JCSA 1TEVA 2ZRHA 1IAQA 3ND9A 1M7GA 3Q7QA 4RD4A 4HZUA 4KHZA 3RVBA 1PLJA 3M4YA 1M2OB 4WXRA 1E9CA 4KXFB 1ANKA 4NYMR 2CCJA 1P2UA 1KI6B 3C5CA 2PL3A 4DB4A 2VA8A 1GM5A 5BYJA 3DPUA 3FVQA 3RS0A 2WOJA 1NKTA 2A5JA 2WMOB 1IHUA 5F3WB 4N0EA 2YJTD 1DAMA 3BS4A 4XWKA 4RY2A 4PXAA 2IYZA 3Q8XB 4YMWA 1JQLB 3KQUA 4NYMQ 3AVWA 4N1AA 4LSGA 2G88A 2RH5A 1MOZA 4MITA 4G5RA 2XXAB 1FZQA 4IDOA 2B6HA 4FI3C 2EYQA 3KXIA 2WKRA 4A0RA 5JFGA 2REOA 2QMHA 3U44A 1OXXK 3GMTA 3I3SR 1BS1A 1EWQA 2WZQA 5E95A 4EPWA 2F6RA 1E4YA 3B1ZA 3CRW1 5FH9A 4B76A 1T5IA 5CIWA 1X8KA 4HLCA 3RHFA 4G5SA 1G18A 4PFSA 4ZV4A 2CVHA 2XNDD 4PQYA 2JGNA 3AV0B 3VR4A 1NBMA 1UPTA 2G0TA 1KHTA 4GOXA 2NIPA 4HAYA 4A15A 1FW6A 3SE0A 1KTVA 3M6AA 1WP9A 3NIBA 2HJGA 4Q7LA 1R0ZA 4BE7B 2OSBA 1KO1A 1OFTA 3QF4A 3UMSA 1N6PA 2RB4A 3KL4A 5IT5A 4RZXA 4OI1A 1YKSA 4M9XA 4OK3A 1T5LA 2C98A 2G1JA 3V00A 2ZQ5A 4PAMA 1YR6A 4DT1B 4BWYA 1E2DA 1W44A 4P32A 3A4NA 1II8A 1XMIA 2CXXA 2IYVA 2GJKA 4LJ5A 1G6OA 4RZ2A 1ZM4A 1AKYA 1VDZA 5FBLB 2NTYC 3NBZC 3T1OA 3OHMA 1Z0FA 5FOXA 2OAQ1 3RS3A 2IK8A 3EZFA 5G53C 1N6NA 1YVDA 4QM6A 4URZR 1LTQA 3HDTA 1E69A 2ZJYA 3LY5A 2ONKA 2C5LA 4LX0A 4BEJA 3UWKA 5BXQC 4RCYA 1IONA 3VQTA 1E6CA 2ZRKA 3RDPA 1Z6TA 5FBVB 4MYCA 3BB4A 4LHXA 1OKKD 5FL7A 2GCOA 1M7BA 2ZRJA 1W0JD 3IBYA 2J7PD 4UJ5A 3X1YA 4OI4A 2ATXA 2IHBA 2IYQA 4Q4JB 1U81A 4BZQA 5L3VA 1VHTA 3OFND 1US8A 3K70C 2JLRA 1E2KA 4DRZA 4WZ6A 2X2FA 2Z4SA 1LFDB 3IO5A 1OJLA 4KAXA 3CX6A 4KBFA 2IWHA 4MQBA 2BDTA 3TW8B 1Q1EA 3W34A 5C18A 1IY1A 2Q6TA 1NBME 4CIDA 1VG1A 4HAWA 5HZHA 4M9QA 3SDZA 3QXSA 3ZH9B 5B57C 4TYPA 2REXB 4QGGA 3H86A 3CRRA 4Q00A 2NG1A 3NBXX 4F7WA 3O8RA 3VU9A 1NJFA 4JVMA 2LKDA 2QQEA 4GI7A 4LJ4A 1R10A 2I3BA 3GLGA 2XX3A 4BFTA 2DWQA 4MUAA 1KOFA 2ZSEA 4OQNA 1QHXA 2QPTA 5FTKA 1A7JA 3CWZA 4QHSA 4ERNA 1T8TA 2P5SA 2PH1A 3N2IA 3QF4B 3ZZTA 5KTYA 4G1UC 4NCJA 2ZE5A 4DEYA 2WAXA 1AM4D 1JBKA 4O2LA 2Q9BA 1F2TB 1K5GA 1XD2A 4U7DA 5EE5B 3MRSA 4OQXA 4XJXA 2B92A 4ASUA 4DLXA 3VKGA 4G0NA 3IQWA 2FV8A 4QFMA 4A2QA 3OESA 1II8B 4JBWA 1E32A 2QL6A 5E4FA 2MSCB 4CEHA 4KLNA 4B71A 4JJZA 4JLKA 4R98A 4OHYA 1E2NA 1W47A 1MT0A 3A4MA 2A7QA 2ZXUA 5G41A 1ESMA 1Q1QA 5JHGB 4A6PA 2RGAA 3I32A 3PENA 1CR1A 2DFKB 3CX7A 1O3YA 4LV6A 1Q57A 4NP6A 3FHTA 1DEKA 1KIMA 3KJIA 3AVUA 4YXWA 3BIFA 4XOIA 1WXQA 4ARZA 5C1BA 1XXHE 3QSYA 2FU5C 5CLLA 2J0SA 1OH6A 4H1UA 2JA1A 4QNMA 5C2JB 5L3QA 1SKQA 3RNLA 1D9XA 3L0SA 4UXHA 5UKDA 5GJBA 1GNRA 2PMDA 2NOAA 3BH0A 1FFHA 3ZJYA 1JJVA 2RHMA 2WBLC 2ZRNA 4LV5B 3KQNA 1XXHB 2W6JD 2HT1A 2GCOB 3RABA 2DCUA 3THXB 3SYKA 4PC2A 2WIBA 2ZM5A 4F4IA 2PEZA 1RZ3A 2GA8A 2PX0A 1NN5A 4TLEA 2OILA 4LJAA 1XJQA 3HR7A 2VYFA 3MLEA 4I99A 3U7FB 4PO9A 2HXYA 1UEIA 3W3ZB 221PA 2BC9A 2FA9A 2C9CA 2IA5A 4DCVA 4EQ6A 2O52A 2QORA 2GVDC 3A6PC 3REGA 2ZREA 1HT1E 5FI0B 4ZCLA 1T3SA 1BH2A 4HLQB 1ZIOA 4HLDA 1PUIA 4F92B 4IEEA 2VP9A 5FTJA 1VKJA 1N5IA 4M1TA 3KXLA 1T3LA 1QHGA 2QM8A 4URWR 3VU9B 2RGDA 2IEYA 3R9XA 3N5CA 2R6CA 4V03A 2ZRFA 2QGNA 1N3BA 2ZU6A 1KKMA 3LDAA 4KYIB 4BUJA 1CR2A 2XNDA 5JJKA 1S1MA 1XZQA 1ZM2A 1S9DA 2RGXA 2NQ2C 1HE1C 1S3GA 2ZVQX 2C03A 3QBVA 2BWJA 2G6BA 2ZTSA 4RZ3A 4O3MA 4ZI3A 4RCZA 1IXZA 1G20E 3T1TA 2ATVA 2RCNA 2OHFA 1OF1A 4RFVA 2ZYTX 4LHVA 4U00A 2NMVA 4PANA 3KQLA 4UNQA 1FP6A 3AF1A 4FMBB 1J8YF 4XH9B 1EFUA 2IYYA 3NDBB 4R7ZA 4R71A 1E9AA 5G3YA 3VHLB 4D82A 3KQKA 4CEHB 3BFKA 3DM5A 3REFA 3O47A 4DLSA 4NYIR 3R20A 5KPJA 1R8SA 1DARA 1U2RA 2ZRGA 1AZSC 4KODA 4PAOA 1W4AA 2VP6A 1P73A 3ASYA 4C7OA 4P31A 2ZE7A 4L4UA 1N25A 2B21A 3WNCA 2D3WA 5HCNA 2GF9A 2PBRA 4M1MA 3B9QA 3RYTC 2ZSFA 4IOLA 1Z08A 1XX6A 2HXSA 1CU1A 3K1JA 4QG7A 3EPKA 3CRMA 3WBJA 2FPKA 1NMXA 1JI0A 3ZQJA 3LLMA 4A82A 3SQXA 3TK1A 2ZVPX 2ZJ8A 4RSGA 3MWJA 3FMFA 3MWKA 4I1VA 2O8DA 4NHOA 1OKKA 3LBNA 1W0JA 3GCGA 1IN7A 4KCGA 5FBWB 1WDTA 2J7PA 4DLRA 4JL8A 2BBSA 1RRGA 1KSJA 4V0LA 4JYBA 1VYUA 2KE5A 2J7KA 2WSSD 4L8GA 4PTLA 4IHQA 3OFNA 3IPYA 1WBBA 3W3AA 5FUWA 4EQ6B 1YJ5A 2BBWA 4JSYA 3V4RA 3D31A 4MGIR 2EQBA 1ZU4A 1GZSA 2WKQA 3CZQA 4MDEA 2XB2A 2F9LA 1H8ED 2ZRMA 1QHYA 1X1RA 1JB1A 3IIJA 4XD7D 5C4MA 5JBQA 5KU1A 2P0EA 1U99A 3L0IB 3X1ZA 1G41A 4A92A 4M9SA 1BO6A 1NLFA 3LH5A 2WWIA 4JT4A 4WIAA 1YZKA 2GF0A 1VG9B 3A4LA 3QJYA 3EPLA 1TQ4A 4D0NA 4FD2A 4PHTA 3A58B 4QHTA 1DAHA 2QE7D 1LY1A 4C0LA 2GK6A 4AG6A 2DBYA 4Q4AA 5K8UA 3PQCA 2IX3A 1BYIA 2YWGA 2WAYA 1Z07A 4N0DA 1CTQA 1P5ZB 1ZUIA 5CDFE 1TQDA 1KDTA 1W1WA 1OXTA 1EX6A 4MA4A 1BIFA 4NONA 3F8TA 4HSEA 2DWOA 1KNXA 3UANA 3TKLA 1S2MA 2CL0X 5E7MA 3UXMA 1YZTA 4KFSA 3CRQA 2NO9A 1BOFA 3PXGA 4BFWA 3CIOA 3TVDA 4FWIB 2AFHE 3E2IA 1HQCA 2QPOA 3FGNA 4E22A 1PZNA 5LD2B 4ZCIA 1E0AA 1FQJA 4IJMA 4M1OA 2QU8A 3AKCA 4MGZR 1KMQA 1XF9A 4C7OB 1P7CA 2H92A 4L15A 1E2LA 3QXXA 1D9ZA 3ND8A 2AKYA 2IUTA 2WMNB 2CHVA 5FOUA 3ZS8A 1KZGB 5KO2A 3FYHA 2JEOA 1VECA 1RRCA 4A8JA 3C7KA 3LX5A 2DFTA 2C95A 4GP7A 4PPGA 4JLJA 4EDHA 1LF5A 3B8HA 5J4YA 5JRJA 2QNRA 5HE8A 1T6NA 2C04A 4C2UA 1CJMA 2O8DB 2B8TA 2W6JA 4RD3A 4AK9A 3IPXA 3L8YA 1N6KA 3PEVA 4LJ9A 3TJZA 3UIEA 4TLBA 2KB0A 1XPUA 3KZ1E 1TU4A 1U0HC 5J4LA 3EIQA 1DO0A 3D6TB 2J41A 2F3TA 1TX4B 4PR0A 4B44A 4QHYA 3DKPA 4BFXA 2ERYA 1YR9A 4JVLA 1DOAA 4FN5A 1BKDR 3CPHA 3I8XA 1EFTA 2IW3A 2V6JA 4IOKA 2XEXA 3GJXC 2ODWA 3IEVA 1KY3A 4TLCA 3TR0A 1KO7A 2IC5A 3D3QA 2XZLA 5DLQC 2HEIA 4OHWA 2YC4C 3TBKA 3UWOA 3U4QA 4EFLA 1UKYA 3KTAB 1UF9A 3MSXA 3KKMA 2EU8A 2AR7A 1UDWA 1ZNZA 1SVIA 1WMSA 2NO1A 4LI0A 4Q1AA 2LKCA 1QHSA 1E2GA 1VIAA 4E03A 3TQCA 1OPXA 1XTJA 1YR7A 2OM2A 3I8SA 3AF2A 1MR3F 1XTQA 4IKEA 1XRJA 2NPFA 1E2JA 5DHAA 3U6KA 1CJVC 3KKOA 4F93B 2ZRIA 4QXAA 2ZUCA 1FTSA 2Y8EA 4OBEA 2EFDB 2IL1A 4M8NE 2G9NA 4B3CA 4B6EA 4YMVA 1DAIA 3RS7A 2NZJA 1ONBA 521PA 2QGZA 1GG2A 1XD9A 2J45A 3TQFA 2DY1A 3L2OB 4PC1A 2F55A 4KYUA 1G4AE 3FKQA 2GZAA 3W5IA 4ON9A 4URXR 1KI1A 1GSIA 2QAGC 3ZVLA 4Q21A 4CEJB 1IN4A 1DE0A 1FUKA 1IBRA 3GFTA 4LBZA 2FFBA 4MKIA 3SNHA 5BYKA 1EESA 3JZAA 4OHVA 2ZJ5A 1GAJA 2XGJA 1MRNA 5F98A 4CRWB 1ZP6A 4ZKDA 4B3BA 3DEFA 4TQUS 4G5OA 4AKGA 1NLZA 1F2UB 4QL3A 1RRFA 5EXTA 4A8JB 4MGKR 2QT0A 5FPHA 3U7GA 3BB3A 5B2ZA 2PMKA 4AKHA 1IN6A 2FPLA 1RYFA 5FR2A 4AYXA 3AP3A 3IGFA 3BJIC 1ZM3A 2OLJA 2DHRA 4DWJA 3OEED 5FOTA 4EPVA 5L8VA 2JLYA 5FOWA 2R44A 4Z1MD 3T15A 5CITA 4TLAA 4UNPA 2AL7A 4M4SA 4BLSA 4QGFA 3LLUA 3VHXA 4U02A 2J0UB 1HTWA 2ZRLA 5EXPA 2IT1A 2FJUA 4GFDA 4LV8B 1MABB 2Q21A 4OK6A 3RC8A 5JI2E 2WSSA 4UQOA 3OIVA 5AJZA 2D2FA 2F1IA 1P3JA 1XP8A 5HZKA 5JSZA 2OE2A 3VR6A 3I1FA 2W0SA 1FOEB 3LD9A 4LK2A 5F2EA 4PHHA 3C41J 3QEJA 1VG8A 1FP7A 1H8EA 3KKNA 2EFCB 5DO9A 3FOZA 2GHIA 2BCGY 4ACAA 4XD7A 5LDDC 5EUQB 5KDDA 1OE0A 1KO8A 3C14C 2EVWX 3U3JA 3D8BA 1KSGA 2G77B 4KFTA 3FMIA 2VLIA 1KI6A 2QG6A 1TUIA 3CPEA 4BZPA 3MCAA 4MUBA 3VR1A 1N6IA 2ZR9A 1FTNA 3A36A 1N2CE 3QXCA 3AUYA 3KB2A 5D3QA 4OK5A 2IYXA 2OCPA 2QE7A 4AI6A 3BD9A 3W6PA 2GDJA 2IUUA 3L0PA 4JLAA 1DVRA 3BFXA 1XTRA 4GOKA 2XAUA 5JS7A 3PJRA 4YC7A 1AJEA 1G17A 4QJ3A 1AIPA 4D4JA 3CW2A 4TMWA 4D81A 4FINA 1VCMA 2BVNA 4I1OA 1W0KD 2XXAA 1F48A 1KAGA 5FOVA 4TLDA 4ACBA 4JZKA 3EA0A 2GZHA 4NCNA 4GZLA 4F91B 4N3NA 4KSBA 3GEHA 3IO3A 2NGRA 2BM1A 2R6GA 1NNEA 1Z47A 2FFHA 5KSYA 2HV8A 3MJRA 2WWFA 2GBLA 2Q3HA 1L7VC 3P1JA 4TQAA 2P6UA 5HR5A 1LF0A 2ONJA 2IS4A 1I4TD 2OFXA 2OBMA 3MG9A 3CBQA 2GJAA 5CIQA 1OV4A 4BLPA 4KI0A 2WSMA 4NE2A 2GBLC 5JEDA 2WWXA 5B64A 4MRPA 1H65A 2CJWB 2JJ1D 4BFSA 4DCSA 1XMVA 1NG9A 5JJIA 1ZUNB 4MGYR 3LO5A 1HYQA 1E4VA 1NIJA 1P72A 1WRBA 1XBTA 2ZJAA 1R0XA 3GLHE 3OAAD 5EP3A 2HYIC 4B2IA 3BGWA 1WQ1R 1U8ZA 1XCPA 1TEXA 2HF9A 3CPJB 3EA5A 4IW3B 2MSDB 1HH4A 2WWWA 4NKRA 4PO1A 4LJ7A 1HT2E 4FMCB 4LC1A 4YONB 3GLHB 3DVLA 1GITA 1XB2A 2P2LA 4EUNA 2ZPTX 2GWHA 1Z8FA 4RD1A 8OHMA 2V6IA 3X1XA 3W8NA 2QRNA 2O5VA 3I61A 2IYWA 3CB4A 4WZAE 3IIKA 3X1DA 4OI2A 1CEEA 1D5CA 1EG7A 2FWRA 3QKSB 1AKEA 1D2EA 1KK2A 1GUAA 1PLKA 4I4LA 1G6HA 4GDFA 1VTKA 3LBHA 2AK2A 3SC3A 3QUSA 2DYKA 3W9YA 4HI0E 2W00A 3P26A 1SQ5A 3HPQA 3SFVA 2FGKA 2ZJ2A 1B23P 3MWYW 3R8FA 2OXCA 4JLNA 3CH5A 2BOVA 2GXUA 2O0KA 3MWLA 2PT5A 4HYYA 1GIAA 3L82B 1AA9A 2HCJB 2KSQA 3WY9A 4BZXA 2QZ4A 2ODNA 4CT5A 2VHJA 1CF4A 2Z6VA 4Q4JA 1PV4A 4CDGA 1JAHA 3PVSA 3U60B 1X8LA 1L2TA 2WWHA 2WPDD 4TT3A 5DH9A 3O8CA 2O0JA 1WE2A 4JL6A 3BOSA 2CDNA 3S1AA 1N6HA 2V8OA 2QENA 3MFYA 4GZMA 2UZIR 3H84A 4P4TA 5J40A 2QBYB 1TNDA 1S4QA 2OCAA 1A82A 3SR0A 3HJNA 1W46A 1UM8A 3DKVA 4OKSA 4B3XA 1XZPA 3TVTA 1OIWA 2QTVB 4GNKA 4GT1A 3UKDA 5JECA 3BH6A 4V0ME 5EE3A 1R2QA 3EWSA 1Z29A 2BBTA 4WBSA 4DCNA 3O8DA 2WTUA 4TYNA 3SZRA 4KVAA 1G9XA 2VRWA 3T35A 3K0EA 5G3ZA 2VP4A 2ZI7A 3B82A 2OZEA 2BEJA 1KI2A 3VX3A 1QG4A 2IF0A 3C4JA 1A4RA 2QUZA 2HDNB 2ZUDA 1F2TA 3CZPA 3OEEA 3WMGA 4LCBA 4TL8A 1N0WA 4Z1MA 4DVGA 1GVNB 2V3CC 5KDLA 3KJHA 3R9WA 2VTKA 4A1FA 1XEWX 3FTQA 4Q5IA 1FMJA 1JQJC 1UBFA 1GNQA 1S0UA 1VHLA 3CF0A 5G40A 1ZRHA 5DI3A 1OSNA 1HA3A 3KJGA 2VSFA 2ZIAA 3F0TA 3U61B 1QHHA 3THWA 1VYVA 1U8YA 4IOJA 1ZCBA 1DG3A 5DHFA 2HUPA 1QZXA 2CHQA 4V0KA 3X1WA 1HY3A 1ZYUA 2XTNA 3SFZA 3FKSD 2WICA 1Z63A 2YNMA 1MO3A 3QF7A 1QHIA 4IDHA 1HV8A 3SJCA 2ZAOA 2AX4A 5FR1A 1T0HB 2ZJZA 1IJFA 1GOTA 1XXHA 2R6AA 2OXRA 5DNYB 3SJZA 1KI9A 1Z28A 4IRUB 3THXA 2OT3B 2IS2A 1JJ7A 1E9RA 1TADA 4G01B 2QSYA 5CK5A 3I4LA 1SKYE 2ZRCA 4TSFD 4OHZA 1CJKC 4LUCA 1G3QA 2WJIA 3PUZA 1U9IA 2BMDA 1NN0A 1OXSC 1GL6A 4BLQA 1LNZA 4TN1A 3EPHA 2CLDX 3S1AB 1SKYB 2MMGA 5CJ2A 3THOA 2ZSBA 2R62A 3CWQA 2QM7A 4CZ2A 2NO7A 2VBCA 2VF7A 3M1IA 3UG7A 1KY2A 5SZHB 4XTRA 1UJ2A 2VHCA 5KYKA 1KDPA 1CJUC 3TGPA 2ORIA 3I5YA 4LOAA 1Z0AA 1U90A 4E07A 1E1RD 4LJYA 5KPDA 2RMKA 2ZETA 1ZNWA 3RRYA 4JL5A 4US1R 3ADBA 1NN1A 4AG5A 1WBDA 2H18A 2V4ZA 1RPZA 1HURA 4LYAA 2BJWA 4PPNA 1VCNA 2E87A 1LV7A 4KFRA 5EZ5A 1X8JA 4KLZA 1DELA 5AUNB 1WF3A 2ZE8A 1QHNA 5EJEA 1E9BA 3GFPA 2I4IA 3OAAA 4JKIA 5BN4A 3ECCA 4TYQA 3AGQA 1MH1A 4K8OA 1OFHA 1FNMA 4MRRA 3AVXA 2J59A 1ZUHA 3E70C 3FPAA 3PR1A 4BRUA 3VKWA 621PA 2QRZA 2WJJA 1G7CA 4M1KA 1M7HA 5DI3B 3RRZA 2GJ9A 4KO8A 4ZI2A 4LBYA 1YHNA 2VP2A 4AKEA 1DADA 2QQ0A 1TQ6A 3OEHD 3QENA 5JLJA 2WVJA 5EP4A 2VEDA 3OZXA 4A9AA 4M53A 1QHHB 3H0KA 4QBIA 3P27A 3THWB 3AVYA 5JRZA 1F60A 4Q1BA 3PITA 3AVPA 1KK3A 4V0OA 3GJ8A 3ICEA 2ZJBA 5TARA 2MSEB 5E7IA 1RKBA 4HUQA 1M8PA 5D3MB 4WAUA 2EYUA 1WB9A 3SYLA 2PLRA 1UDXA 2GNOA 1JR6A 3DL0A 1JEDA 3B5JA 2H7VA 3ZD6A 3K8YA 1KJWA 3PIRA 4LBWA 1RYHA 4C3ZA 2DB3A 2OEPA 2YZ2A 4W7SA 1CR0A 1DAGA 4JSTA 1OW3B 2KBFA 1Q3TA 3VFDA 1CRPA 4LZZA 2FSHA 2OV2A 3T1QA 3SHFA 1J70A 2RGGA 2X77A 2WPDA 1JPJA 3SI7A 4A6XA 2CL6X 4LWZA 1XDBA 2ZRPA 1Z6XA 1ZMXA 4PQRA 3PUVA 1BMFD 3V9PA 4LJ8A 3ZDQA 1SHZA 1NF3A 4JKYA 4BFUA 3EZ7A 4U5XA 1NKSA 1AQYA 2FEMA 2GJSA 3SBEA 1G8YA 3LRPA 4C0QC 4MRSA 3IBGA 3QXJA 2ZI6A 5FPYA 2O8EA 1S9HA 4PZYA 5L3RA 5JZVA 3IQXA 2C99A 2QY9A 5EE0A 2X8AA 1E2QA 4IVRA 5EE1A 1YZGA 3HWSA 3V4FA 2JLXA 1X6VA 3L43A 1XD8A 3B60A 2ZRBA 2FE4A 1Z5ZA 2GTPA 1I4LD 4B6FA 3BWDD 4JVNA 4M9ZA 1GKYA 4Q1EA 2CMKA 4DDUA 1S3SA 1ZJ6A 3GLFE 2FDCA 5JWHA 3IIMA 1GKUB 1JEEA 1YZQA 5SZJA 4Q9KA 1S1CA 2GK7A 1DAFA 4M0LA 2JLZA 5CDFA 3WP0A 2BMJA 4HUTA 1P75A 2GCPA 4B32A 3AVVA 5LB2A 1E2IA 3GLFB 3B1XA 1E3MA 4EKDA 1Z22A 3TSZA 1G5RA 2XZPA 4OL0A 2OCBA 2ZANA 3DZ8A 4JLVA 4YMUA 3NG1A 3SEAA 1RFLA 1LB1B 5AWFC 3VR5A 3HU2A 3O8BA 4TMZA 5LD2C 1VG0B 1NP6A 2OAP1 3U3MA 1VIYA 1Q44A 2N1BA 1F5NA 2QP9X 2IXEA 2ZS9A 4HUQB 4PC7A 3FKSA 1XEXB 4C0HA 4LHYA 1J8MF 1QBKC 5GVRA 3NH6A 1DO2A 1AS3A 2JIZD 1KI3A 4EPRA 4BPBA 3QG5A 3QBTA 3B85A 4P4SB 4Q02A 2ZAMA 4UXIA 2RHDA 2ECKA 1ZNYA 4BFYA 3B1YA 3HPRA 3VX4A 1IJEA 3FHOA 3CF6R 4CGZA 1PUJA 3RSOA 4D26A 5E7JA 3ZIAD 3ZZ0A 1R4AA 4HB3A 1C9KA 3EPJA 4Q7MB 4Q18A 3U5ZB 1GL7A 1GL9B 2QI9C 4B2LA 721PA 4TSFA 2RGEA 5AUQA 2J3EA 4GMDA 4PSKA 2ZYUX 5TY0A 1R5BA 2BIFA 4K81B 4PHGA 4PAQA 3RANA 3QKUA 2K5UA 4RVCA 3A1UA 2GEDA 4B48A 3TR5A 2FEOA 2LCFA 5H70A 2ZUBA 2AXNA 2BV3A 4EFNA 4UJ3A 5H68A 1QRAA 4M1YA 2ZE6A 3EZ2A 1SVMA 5EUMA 3R8CA 4BASA 3BB1A 1UKZA 2IYSA 4ABYA 3I92A 2V55B 3WYAA 4DSNA 2O8EB 3KX2A 1YZNA 2ANBA 3KTAA 5AR1A 4D0GA 1E1RA 3Q3JB 3PEWA 3G0HA 4LRWA 4S35A 1ZW6A 1UFQA 2L0XA 4FIDA 3T5GA 4ZIRB 2GXQA 2X2EA 3ZLJA 4CF7A 1II9A 1ZIPA 4XSHA 2AD1A 2IWRA 4BFZA 5M04A 3FHCB 4HDQB 4ZDKA 2CLCX 4DBLC 5SZIA 2XTZA 1K5DA 2XSZD 3AF0A 2F43B 4JLPA 5KNDA 4I1UA 2AFIE 4M22A 3QKRB 3Q5DA 2NZ8A 1G7TA 1MKYA 4EPXA 4LDJA 3CKLA 1DAEA 1ZM9A 1JR3E 3AB3A 1V43A 4JLMA 2IUSA 1G3MA 3NBFA 5ELXA 2FSFA 821PA 4CEJA 3HR8A 4C0KA 2ZROA 4NCHA 3OEHA 1E0JA 3NVAA 1DG1G 1G291 1X86B 1Z2CA 4DEXA 1KI7A 3QXHA 1R8QA 1P62B 3QE0A 2NO6A 3K53A 4A4DA 1E2FA 2QSZA 5CK4A 1F2UA 1MO5A 2EFEB 1EFRD 2J9RA 2A5YB 1E79D 2XOKD 3WYGA 4QKQA 2TMKA 3DOFA 4Q9JA 3GJ6A 1OYWA 4AKIA 2BKEA 4BFVA 5CB8A 2GAOA 2IEZA 1R5OA 4HAVA 4DIDA 2AD5A 3ZVRA 1ZD9A 3ADDA 2VL7A 1T4GA 4A8JC 3WHLA 4EPTA 3CNOA 1JAIA 1OH8A 1SGWA 5JJLA 5SZKB 5JCZA 1QVRA 2P6NA 1KYIA 3FWYA 4IVQA 4WZBE 2J0UA 3GEIA 5F9HA 1WCV1 2BEKA 2AK3A 1ZM7A 2XITA 1MABA 4RJLA 2VSXA 4M21A 4C30A 5FUYA 2ZI9A 2DFNA 4FW9A 2DWPA 4CYMA 3CO5A 2A78A 3RWOA 4FXPA 4F38A 5K8IA 1R7RA 3FMPB 4K46A 5KNBA 2PZGA 2W2VA 3FDIA 1P60A 2CBZA 5GADl 4QBFA 2HT6A 1BMFA 3GLIA 2BM0A 4LHZA 4DHEA 2ORWA 2UZ3A 3GEEA 3QVUA 3PEYA 1NG1A 5CLQA 4URUR 3UMRA 4BECA 1J99A 4P3YA 4NYJR 4B2PA 3EASA 4KV9A 3RSLA 2IXGA 4KVGA 3GFOA 4FWTA 2R65A 4EFMA 4CEIA 3EWAA 4B3FX 4A36A 5KSOA 5FPTA 3VTKA 2C9OA 1T3HA 4NYJQ 4XWAA 2GESA 2H16A 3VR2A 4XVQA 1XWIA 1LS1A 1ZBDA 4DLWA 1N6LA 5TXGA 3SJAA 4FMCF 2QN6A 4LYHA 4LPKA 121PA 1FNNA 5FTLA 4Q19A 5FPSA 2BHRA 2IS1A 3DMDA 3EC2A 3MAAC 3Q5EA 2W2TA 3ETLA 2D7CA 2IYRA 2C96A 1GDDA 3B1VA 1OHHD 1ZVQA 1G3UA 3EZ9A 4X8MA 2ZI3A 4C0BA 3A37A 4PSVA 4R9UC 1Z6GA 2ZRAA 1W5TA 4D2IA 1UEJA 1ZD8A 4AD8A 2HLDD 5H1YA 2Z4RA 4BEBA 4EJSA 4DDTA 1NJGA 1U0LA 2R6DA 1KJZA 1S96A 1E9FA 4O25A 2CJWA 2ZJOA 1TL7C 3BFVA 1D6JA 5EP1A 2AXPA 3AKYA 3LW8A 4XTCS 2GRJA 1J2JA 2JIZA 3MJHA 4NZYA 3TMKA 2A5DA 4TMTA 3I62A 5KHOC 4JIMA 2C2HA 1DPFA 1W49A 3GPLA 4MH0R 4HZIA 2Q3MA 2XB4A 4XIGS 1A2BA 2V54A 1Q20A 2VHQA 3ZYCA 1R5NA 3ZIAA 4RKFA 3SHWA 3GLHA 3FB4A 2LWIA 3WNDA 1QG2A 3GLIE 4YMSA 2YWEA 2O8BA 3LNCA 4B3GA 2F3RA 2PT7A 3TNFA 3Q7PA 2EWVA 5CYOA 3E5HA 2G1KA 3QNUA 4D80A 4DXAA 3HP1A 2WHXA 2OESA 1XFAA 4MYTA 1JPNA 1GILA 2HYDA 4B75A 4BQSA 3GLIB 2FSIA 1T0JB 1Z0IA 3QKSA 1RC8A 1P9RA 4ILEA 1KKLA 1E1QD 5DSZA 2QROA 5EXSA 3TLXA 4YDHB 3ZVNA 5FBRB 2JLSA 1E9DA 1JNYA 1HQYE 1AGRA 1SVKA 2XTMA 4PHFA 3AVTA 3ADKA 3DHWC 4M2LA 2WJVA 4Z8XA 3CR8A 1TF5A 1R0YA 3KKQA 1ELOA 1E99A 1TTTA 4CEIB 3VAAA 1AS2A 1W7AA 5F9FA 1K6MA 1VCOA 5J4KA 3WMEA 3X2SA 1M1YE 3OIYA 5HPYB 1OYYA 2ODEA 5IK2D 1SXJE 2E1RA 4Q4LA 3NEJA 2D06A 3LWNA 3QPVA 1G4UR 4R2HA 4TYYA 3VMFA 3EXAA 2XSZA 3QY0A 5K8LA 4IFEA 1SXJB 5E3HA 2QBYA 2DR3A 3KXKA 1UKVY 3IILA 3ADCA 4V02A 4TMKA 2YWHA 3UG6A 3JVVA 4XWOA 5HE9A 1N5LA 3DM9B 2BBOA 4OQMA 2AWOA 4NPHA 5AUPB 1NVWQ 2QMOA 1EX7A 1ZNXA 1T9HA 3BXZA 2ZEJA 4EJSB 2YHSA 3F3YA 3RLFA 1G1MA 4EPYA 1EFRA 1E79A 2XOKA 1JXOA 4V0MA 1NSFA 3MD0A 5L3SB 1SHKA 3IHWA 4TL7A 3DOEA 4AY2A 2CE7A 3C16C 4Q66C 4TYWA 4L16A 4PQFA 3L0OA 1YQTA 2XJ9A 3AP1A 3C15C 1KSFX 2JASA 3KB1A 2GVZC 1COWD 1OH7A 1KAOA 4PX9A 2GXSA 2P5TB 3OF5A 2O8BB 5AJXA 4OQLA 4DDVA 3TAHA 5BWMA 2JLVA 3SQWA 5GJVC 4FMDF 3GJ7A 4TTQA 4Y0AA 1N5KA 4A0FA 4BLTA 1IOZA 3AF3A 2OLKA 1Z0KA 1VCIA 2GZDA 3DDCA 2ZS8A 4HAUA 2B8WA 1ZU5A 1II0A 3UMFA 3LQRA 2FF7A 2VF8A 4IDPA 2F1RA 3K0AB 5P21A 2OFOA 3WRXC 2FX3A 4BLRA 1G64A 4M1WA 5EQTA 1QDEA 3LVRE 2Z43A 5LB4A 3FE2A 4B33A 3RS5A 3K9NA 3TIFA 5DYGA 4DB2A 4DSOA 2DFLA 2WWGA 3AVQA 2WWYA 4BRWA 2H17A 3EAQA 1PVOA 2D7DA 2ZI5A 2QEQA 3PUXA 3TH5A 1YU9A 3WMFA 3L8ZA 1I2DA 4PZLA 4AC9A 1E9EA 5FUVA 4DCTA 5JHHB 1U94A 2UVQA 3GJ5A 4QGAA 3WYFA 4B43A 4DUGD 4QBGB 1U8AA 3TE6A 2CNWD 2H8KA 3ZVMA 4RD6A 4HATA 3PEUA 1OHHA 4W5WA 1W4CA 2GEVA 1G5TA 2CL7X 4FCTA 1CJTC 1U98A 1X1SA 4C0JA 2W0MA 3AUXA 1M34E 4XVRA 1AN0A 2HLDA 2IYLD 3RWMB 2KBEA 2Z83A 3GJ0A 4Q1DA 4OJKA 2F1HA 3LXRA 3PUWA 4B35A 2CLSA 4IXNA 1B0UA 1AS0A 1A5TA 1FX0B 3NWJA 4HB2A 1GRNA 1P2TA 1RJ9A 1N0VC 3NH9A 4GPTA 4NMMA 4NTZA 5KSZA 1JALA 4XVUA 1Q1BA 1L4UA 2IYUA 2Q9CA 4B73A 3RS4A 1W36B 4Q48A 1Q12A 2JJ2D 5IDVA 4Q7KA 4IDNA 3P4XA 2FN4A 3HYRA 2CK3D 4TL9A 4QOSA 5JI3E 4O0MA 1E9SA 3ZGXA 4EIWA 1JR3D 1KSHA 4AURA 3HU3A 4BLOA 4MKHA 4C9BA 2OO7A 1E0SA 3A1VA 2O0HA 3BBPA 2WJYA 4F4JA 4ZCMA 1YE8A 2V1UA 2CHGA 1XPRA 1KDOA 4QJ4A 1J7KA 4S2EA 2FFAA 1IQPA 3NC1C 4LYFA 4GSYA 4US0R 3QI2A 1LS6A 1E1QA 2X1VA
chains in the Genus database with same CATH superfamily
1GCIA 1LLUA 4LC0A 1PEAA 5JCPA 3K1YA 4W5OA 1NQOA 3G1WA 1SIUA 2EG5A 1V48A 4P5DA 1SUWA 3V3TA 1OXUA 2VHUA 4AYTA 2WM3A 2WIJA 5B1DA 4Y0VA 2ASVA 4RV4A 5J4HA 4RA6B 3KV1A 2OQ2A 2VP5A 1KIFA 1N92A 1NQ5A 1V7PC 3O31A 1FUUA 4GP6A 5T64A 3SS8A 2PX6A 1OIVA 4BP3A 1GRQA 4H7IA 7REQA 1O97D 4LMPA 2V7GA 1PJ4A 2EW2A 1JLLB 2VPQA 4GRDA 3H2HA 2HMYB 2D74A 4GXNA 1F0YA 2FI1A 2A9PA 3BRWD 3G59A 2I03A 3MUNA 1FLNA 2MINB 3GH1A 5IK2A 1L5HA 3THYA 1TLLA 3P4YA 5AH0A 1QRUA 4FMDB 1YE3A 2VAWA 1KZ7B 3KOYA 2PKWA 1HE8B 1Q21A 1YZ3A 2RGBA 4JLOA 2ZSUA 3N2KA 4IQFA 4BQNA 4ALJA 1ZWKA 1URPA 2XYPA 4OQFA 5EPOA 5FAXA 3FOFC 5IRCD 3VR3D 3N2EA 4HNAB 4JGBA 2Q6KA 1KJYA 1NI3A 1NURA 1TZCA 1KI4A 3M0EA 4QQNA 3U26A 5JZSA 3CH4B 1SA0A 1CQJB 5KSPA 4NU0A 2JLUA 2FVXA 1XR3A 4MVJH 4NXNB 5CM8B 5I9TA 3FDZA 2GETA 1CLEA 2Y6UA 4LDAA 3NHAA 3TI9A 2OXEA 2W43A 3HADA 4I0WB 2JFQA 3KQHA 3S3TA 2TYSB 2M1ZA 2YFKA 4MO9A 2VPYA 3HB1A 4FK8A 1YGPA 5EINA 3AB8A 3NHLA 2G7ZA 2CXOA 3ESXA 4MW4A 4Y30A 3OCUA 3C3WA 3AHDA 2IODA 4G0ZA 5DM70 4PCAA 5ESXA 4NH4A 1HX7A 4JWTA 1MAVA 2XNCA 3LGSA 2VQSA 4IVPA 1H0RA 4UBJA 1TAUA 2R7KA 2B0JA 5E7QA 2QYHA 3COZA 2HMVA 4BB9A 4WBNF 2CYCA 3L1VA 1FCJA 3JYHA 3QELA 1K7XB 1E2PA 2P65A 3CG4A 3BGVA 2HK8A 3ESCA 3UYKA 1Q92A 2Y71A 3QKTA 3H9UA 1V5EA 2R8OA 4KAAA 3KJEA 3ODPA 3MWEA 1U02A 3W77A 2A0KA 3GJ4A 2BFCB 1RI5A 2WKPA 4CL0A 1E2HA 4GH5A 3WP1B 3ZH2A 1QXSA 2B94A 5EUBA 5F21A 1J2YA 2HLHA 4I8IA 2VAPA 1NPTO 5HFAA 3U1BA 2QA5A 1Y5MA 3T5DA 8ADHA 5JAUA 2YXBA 1L8QA 1OBHA 2EX4A 5AXDA 1UBEA 3TSOA 1R4NA 1QF9A 1WOYA 3G6KA 2P6PA 2YCBA 5DOZA 4ZZIA 1QGZA 1W5AA 1YWGO 3W7VA 3WBKA 1HDRA 3VSCA 3GPDG 3ZXSA 1PV2A 3ZZ1A 4BAUA 4YR7A 3L4KA 3RFVA 1LK5A 3O83A 3SC6A 5D3ZA 3RHSA 2ZUSA 2H4JA 3T7EA 5COAA 2GHTA 4C04A 1E6WA 1T36B 3KCQA 3LLVA 2YV5A 5HM8A 4ZGBA 4RULA 1W2HA 2AKAB 3OZEA 1ADYA 1HG1A 1W4BA 2ZIZA 4G56A 5MFZA 4E21A 3LBIA 2XMBA 3BE4A 3R7FA 2XDQB 4WCFA 1PTKA 3GRRA 3ZNNA 2FZ4A 1C50A 2RHCA 1NP3A 1FYVA 1FL9A 2HU5A 3EGOA 5I4BA 3AM1A 1PBNA 1UBLS 1O57A 5ALZA 1M6NA 1US8B 2BM9A 4II7A 3RQSA 3PQFA 3W9UA 2Q5FA 4K1XA 3SR3A 4ZYVA 1RHMA 4HOYA 4Q0MA 1CHNA 2FPMA 1BSVA 1EX9A 1MP0A 2J5RA 3RIMA 1RWMA 4X1IA 5I7OA 2PMWB 3BN3A 3QJ5A 4PZ9A 4MQ6A 1PD1A 3FCCA 4JITA 1X19A 1DRJA 2RGUA 4LPSA 2R8RA 3HJRA 3IMFA 3CX8A 2GPNA 2UZ1B 4R5HA 3G5LA 4UHBA 3V4PB 3WJ2A 4DIMA 3B8EA 3KOWA 1O95A 3NTUA 5I5GA 5AVTA 1JH8A 1DT3A 1PFGA 2XZDA 4H7KA 1E2EA 1Q3HA 1H2AS 1RT9A 1WAMA 4DUZB 1JECA 2F43A 1Q11A 4RORA 2WG2A 2FMTA 2W8BB 1DQPA 2XNKA 5FOSA 3ZE7A 1YQDA 1SXJD 1G2IA 1JW9B 3MTEA 4P4UA 3C74A 4C1NA 4YT4A 4N5MA 1P77A 1P2GA 2OUKA 2PJZA 3QMPA 1XCMA 1R9JA 4LY6A 1XJCA 4EFKA 2JJ2A 2YXPX 3U7EB 5K03A 1JEYA 1G8JA 1B16A 1UAYA 3MS7A 2F4NA 2AFIA 2ZM6B 1RBZA 2QNIA 1IJBA 1GQQA 4WTOA 2BISA 2FG5A 3LUPA 4FOPA 1A9XA 2FR0A 1RE1A 3HCOA 3ICQB 5AK6A 3JVUA 4IJQA 4GPEA 3QG1A 3RVDA 3EXG2 3MB5A 3RIGA 1IMJA 3HY4A 3WTBA 4AZVA 2P6RA 4LHSA 5IDQA 1FNSA 4ZVPA 1J8FA 1I7NA 1TUGA 3OT1A 4C22A 4RTPA 1E94E 3NBYC 1ZGJA 4LTMA 4X7MA 1FDRA 4AJ9A 3EVDA 2VIIA 3U1VA 5JS6A 1IN8A 3OKCA 2I6QA 4QGBA 3RRMA 1DX6A 4LSMA 3BERA 1IE3A 1LSUA 5JCJD 3BEOA 4G2NA 2JLBA 1U8XX 2QDKA 2DUNA 3CU5A 2ZR0A 5B1SA 1SCKA 3TZBA 2R7MA 1N5JA 1M54A 1JILA 2FZLA 1P6UA 3LT4A 5L3QB 1KO5A 1TZBA 1PEYA 3IP1A 2RKBA 1RI3A 5BNWA 4XIJA 1JIVA 4CF5A 2CVQA 1L4KA 3ROTA 1NQXA 3Q7SA 2ZCUA 4L9RA 1Z4QA 4KR6A 3B6EA 3ED5A 4NFYA 3WJ1A 3INTA 4L5JA 4WZBA 3PXDA 2CWDA 5KYTA 4RY9A 4ZO4A 4DR1B 4ZVTA 3U3KA 2AI2A 1Z2PX 3BORA 5LVAA 4CXMA 4MA0A 3N7AA 1R6VA 4NH0A 3UATA 2WEKA 2BUAA 4FDTA 1Y5LA 5LA6B 2ECOA 1YK0A 2NTJA 1SUFA 2ZIVB 3K0CC 1TM7E 1TK2A 1OFUX 2HWKA 2JGEA 5LPNA 1MFPA 2O2DA 3VOSA 1IK4A 2FW7A 2XNSA 3OURA 1P0FA 2YTZA 2QMEA 4HPWA 3ZE8A 4W9NC 1CPYA 1M72A 4OREX 1EFCA 3FNQA 1MB9A 2WMDA 1MOPA 1U7UA 3A06A 2GQ0A 3O1HB 4Q39A 2F3PA 2C9ZA 4PC3A 4YJ3F 4LJKA 2B7LA 2H6EA 1J2EA 2CHFA 2PZ8A 4HN4B 4LRXA 5IKEA 4IV5A 3K9HA 4PLHA 4E6PA 5EJ2A 1BCSB 3LE8A 2DUUA 3QU9A 4KE9A 3SLKA 3E4CA 3KT3A 4JLDA 1BVYF 1GPDG 3DO6A 3FFBA 3FOCA 1JS1X 3A32A 3B1WA 1PF7E 4URHA 3CKKA 4KQMA 3STXA 1NP7A 2WJ4A 5IVIA 2BEVB 4UZFA 3TRHA 2FPUA 2PH5A 2QTCA 1MDFA 2GYVA 1EXVA 4JX8A 3OPYI 5FTNA 4I2VA 3U6BA 1C1XA 4EATA 2OBNA 5JDIC 1DQZA 3IKJA 5F51A 4O08A 5FOQA 1REQB 3ZBTA 1BW9A 4GGPA 5C3UA 4F1JA 4ZCSA 5LBIA 1I6KA 1H8HA 3ANXA 5CG1A 2O8FB 4HHEA 3L4EA 4HGZA 4H16A 2WYIA 5DF1A 1G2PA 1OIXA 4O8ZA 5FCDA 1KPHA 4D4LA 1WVMA 3QFFA 4Q4HA 2NQ8A 4IG9A 4XWYA 4MIEA 5CA1A 3JYQA 4W5RA 1P6XA 4E4TA 1AA6A 3GJ3A 2QD3A 2V7QD 4TXHA 3MT7A 4YJ3A 2VFAA 4L74A 4EABA 1Z2AA 4LHWA 4CE6A 2LP4Y 2V7WA 2FPIA 2V6MA 4S12A 2ATEA 4RCVA 1QRSA 1QLHA 4OI0A 1Q22A 5AFSA 4Y9UA 3M81A 4ZAZA 3KM0A 2PVCA 4YGXB 4Z54A 1T91A 1Z2DA 4PLPA 1Q6ZA 3AUTA 3HR4A 5K7SA 1P2FA 3WNBA 5IAKA 5C7IO 1G38A 3WGQA 2RGYA 4KRFA 2ZR7A 4TT8A 3U09A 1W36D 3D7MA 3RVSA 2P2GA 4HB4A 4R8LA 4XDYA 1A5SB 1NULA 5JWOA 2RG7A 4U1RA 1MA0A 4QBTA 3WKBA 5I7RA 4M38A 5JDCA 5AI9A 1WHTB 4BP9A 5EUCA 2Z5GA 1CLUA 4S04A 1F4PA 4IHKA 1Z6AA 5C4GB 1QGED 4S1WA 1WG8A 1C7QA 4F5YA 1IY2A 1U28A 2VO1A 2Z5LA 1XYYA 2ZT8A 3BRCA 3H9CA 2QMUA 2Y1FA 2C9YA 2Q3FA 3OE4A 3ZE1B 3AH8A 4ZPXA 3B9RA 3RC1A 4OYRA 4JXXA 3VYWA 4KE6A 4RTOA 3MWDA 3D7SA 3PYLA 1XMXA 2ASEA 2C92A 2WF8A 3WDSA 5AOAA 3ZI4A 1MDBA 3GB9A 4KPEC 2WIAA 2RGNA 1R0KA 1AK2A 2IOHA 3DWGA 1ZD1A 2DH5A 3HA5A 4J75A 4WGFA 5GZ1A 5KO2A 4TZ6A 5F1YA 5BVHA 2ATIA 5CH5A 3D4BA 2YWRA 4X00A 3V42A 1XLTA 1U2GA 1EVZA 3DAYA 3RAPR 3RPEA 5I7VA 3NMUF 1JHUA 1L5FA 3I53A 3RIEA 1ZIDA 2XVXA 4DLYA 4BUCA 2C77A 5KVAA 3R9KA 4LOLA 1WM1A 4UKDA 2CT8A 1W5EA 4COOA 1B2LA 3E0QA 4OLBA 1QTRA 2CLMB 4DCGA 1Q15A 3ZUGA 3IMEA 1BQEA 5KI6A 3UB3A 4PLCA 5EHIA 1NNLA 3MW8A 2W83A 3HEAA 1M1YA 4MRVA 5FPQA 3M5PA 1Q0ZA 5L7TA 3UJNA 1DKOA 4AWXA 5CDUA 4W5NA 2LRHA 1OI3A 4HNUA 1K7YA 1GWNA 1M74A 2DSNA 3ETCA 3FF1A 5KKAA 3SX0A 1DXHA 1U2DC 4JGGA 5AJVB 5TNXA 5TQJA 4D0RA 1E2UA 1HMPA 5CDSA 3KAPA 1AKRA 3D2CA 3QPUA 4ITRC 4U2FA 3F5QA 3ROEA 2V1XA 1T29A 3SF0A 5IWAB 1P61B 3DWIA 1NWCA 5GJCA 2YOFA 5BRAA 1DC3A 1S2IA 4FFMA 4PICA 3PCRB 4FZRA 3L92A 3PC4A 3IEPA 5HCIA 1QDUA 2QAGA 1HLGA 1YH3A 2VT3A 3HHEA 3QVVA 2WG0A 4QPZA 4ARUA 2FLVA 2XLCA 2EQAA 2OCIA 3H4IA 4PGMA 3EQ7A 1H2YA 4BY9E 2VI5A 2HPVA 1DCTA 1Y3AA 4ZYZA 1QIHA 5IN4A 3R7WA 3AOGA 3JQRA 5KNCA 3H1FA 4YCLA 1QV7A 2E4VA 5FORA 3OPYB 2FOLA 5FUMA 1RAIA 3P20A 1M8JA 3KPYA 3D4NA 4YRPA 4ZEOA 1ZJ4A 1UWLA 4KJZA 1CUDA 2DZDA 3N2ZB 2EBUA 3NHZA 3NOQA 2ZBGA 4AU1A 4URYR 5BR4A 2IDMA 4I9HA 1G8GA 3EFOA 1HE3A 1N9KA 1XTSA 2F8LA 3H1GA 3OQBA 4HFNA 4HWTA 1O8BA 4KQGA 4JBLA 5FL3A 4TMXA 5EJ9A 5K8VA 1Q1AA 4MGEA 2DEUA 4E46A 1NLYA 1U0NA 4J16C 1A2OA 1M0SA 1NXOA 2G1AA 1WDWB 2G9ZA 3CZ5A 2JCYA 3NUQA 3B13B 4FGWA 3FBGA 5CTAA 5CMLA 3VV3A 1Q14A 2FMXA 3FMOB 3DONA 1H2HA 4W1SA 5BNZA 2Z1MA 5JR3A 4RZIA 3MLBA 5HM6A 2Z5VA 2ZXEA 1E5XA 1L4FA 4MW1A 1AQIA 3DNPA 5JCOC 3E58A 4JBNA 3BE6A 1OZAA 2X76A 1JKMA 4DY4A 4L8YA 3NV9A 5ISMA 1VJGA 3K5IA 3ZJ5A 1O03A 4JJKA 1X80B 4G3XA 4M1ZA 2AJDA 1CX9B 4QOFA 2YXDA 1YTUA 3ZXYA 2DQSA 5ALVA 3UW3A 2WJGA 1NRJB 2QJTA 4EG6A 3A2KA 1I7SB 2JRLA 2IP1A 4LN1A 1E7WA 1R64A 2EDCA 3T5BA 1DJPA 2ST1A 1XDDA 2R9VA 1VHDA 4G0MA 2Z4TA 4OO3A 5J5CA 3WO1A 3F9CA 1K3UB 4PQGA 4F3RA 5JD5A 1VE3A 2F00A 4Q9LA 3S5UA 3DV2A 1FFWA 4XGKA 2A2ZA 2E9SA 2J3MA 4NDZA 4YQFA 4V3CA 2PUAA 2H5EA 5I3ZA 1Y5RA 4U39A 4U8GA 4R05A 1OYVA 3N9IA 1MAHA 1L8OA 1JT2A 1Z7BA 2H1LA 1WXFA 4UEKA 3DUFB 4YAIA 4DSTA 1K2WA 3INGA 5KOYA 1XTKA 5DJ5A 3BH7A 2FETA 2P67A 5DYTA 1ISRA 3RAFC 1NR7A 2AIRA 1IM8A 3EXEA 3ESYA 4TUYF 4TKVA 1J2TA 1T5DX 1THTA 1WSDA 2HCFA 4YUYA 3D4IA 4K9DA 1TO6A 2C29D 3G2OA 4UCXA 2KMLA 4B82A 5KYXA 5BVGA 5LU8A 3M6IA 2NU8A 1Q7EA 1FX0A 3D6JA 3RC3A 2CNLA 2HREA 3K2BA 3KHKA 4MW7A 4P3XA 1H9AA 2P3SA 2ZQZA 1GJRA 3O1IC 1JFVA 1JHQA 1W75A 1KEKA 2ZBRA 1EQUA 1HEIA 2IEGA 2QVXX 3EEBA 2NLOA 1KVSA 2PV0A 2VCYA 3GPIA 3HO6A 3RS8A 2RC6A 2X9LA 4KPFC 1RRPA 4YUXA 2GFIA 3N8NA 3ER8A 1CBUA 2Q0SA 4I55B 4J0JA 5GJWC 1W48A 1EDDA 4O59O 1A0OA 3I9OA 5FTMA 4WFQA 1KYYA 4TV9F 3PFIA 4PLYA 4J9VA 3BA1A 5C4IA 1NY5A 4NOMA 3AOEA 4EI9A 4CI0B 3WL4A 3CIFA 1R16A 3Q8LA 3NTXA 3V2GA 3FYUB 4C4ZA 5IJ0A 4MRNA 2D62A 5GGYA 4I1SA 2BMAA 2JA2A 1X7YB 1ORDA 3RYCA 4AYWA 4PY2A 1A9ZA 4KYTA 5EJ4A 1PYOA 4QVKA 4DT1A 1NTOA 2GEJA 2YDXA 2ZJ7A 3CR7A 3L0BA 3L06A 1CC1S 1JB9A 3I34X 4IH1A 4TUYA 3IKLA 3R7DA 3TSYA 2YJ6A 2XMZA 1BGWA 1B4DA 2R2AA 3H9BA 3EQ2A 3RLIA 1I6LA 4B7CA 1VJ5A 3SC2A 4DWVA 5IT0A 2YHUA 2I4OA 3VKVA 4GOJA 3RAEC 1JEQA 1ORIA 2F9MA 2ID8A 2A5FA 2PSDA 3UK6A 1T2NA 4IR7A 2XUJA 3MPUA 1PR0A 2D1QA 3KXDA 5B6JA 3TSWA 1VE9A 2Y67A 4JBHA 3DGFC 1DS6A 3FTDA 4KAFA 3WL7A 1HI9A 1ZJ5A 2ZRHA 1TEVA 3FNBA 4R2MA 4FEGA 3NDIA 2VHWA 5J1TB 4F6RB 1E9CA 2A9JA 2JFYA 4O33A 4UPEA 3C5CA 1G6Q1 4AMGA 4EEZA 2C4UA 1RM5A 2PL3A 3WIVA 4TV9A 2JIBA 3LMKA 2O2JA 1LRJA 1OVMA 4QPDA 5IULC 3RS0A 5GGXA 1NGSA 4EY3A 4Z49A 1U7XA 1NKTA 2WMOB 4IDEA 1IHUA 2C2OA 5IF3A 1PQUA 3A31A 4IHAA 4DJAA 4YY3B 1N57A 5EJ8A 4OATA 1LPBB 2WHYA 4HAOA 2YR0A 4EZEA 3AL3A 2OKGA 3DE7X 1D4ZA 4KO1S 6REQB 3AL2A 2BUCA 4LSGA 2X6QA 1VLHA 4D99A 1EEXB 2BFWA 4NBLA 4BIIA 4Q3LA 3K4PA 2JEZA 4D74A 3EQZA 4G5RA 2WHQA 3RSCA 4E2YA 4F11A 2AC2A 2EYQA 3PQDA 3HKBB 4DJ5X 3E7DA 1OXXK 3GMTA 3I3SR 4M49A 5DULA 1JBEA 5ED0A 2D0PB 2AG8A 4FNOA 4EPWA 3B1ZA 2HQBA 1MT3A 1Q3KA 1A69A 1KL7A 3L7JA 5GOTA 5FH9A 1M8KA 5CIWA 4JXKA 2V98A 2W6OA 1X8KA 2E4AA 2YASA 1U8TA 3B3JA 1P4GA 4ZAFA 3WOVA 8MHTA 1YC5A 1Q0RA 2JHFA 1VLQA 3GNTA 2NAFA 3GMDA 4G5SA 4XX0A 4Y1GA 3AV0B 3VR4A 1UPTA 2G0TA 2OAGA 3M5CA 4P3OA 2PMCA 4WKPA 1RJEA 2NIPA 1OTYA 3BXHA 3O7WA 4FIZA 4HAYA 2OHIA 3H2GA 3M5WA 4LS3A 4RETA 3SE0A 3U7QB 3UJCA 1DEHA 1DRWA 1UMBA 3DXFA 3VJKA 1AUVA 3ETEA 4M99A 4PO3X 4C20A 2AJLI 3NM4A 2ZBPA 4INPA 1JZSA 4OQEA 1N6PA 4HKTA 4WY2A 4AZTA 1VBFA 3O3MB 3TZLA 4EO9A 3ENWA 4HP8A 2O4UX 1B6GA 3MWFA 3R5XA 2C0QA 4DW8A 2C7QA 2O59A 1T5LA 1Y7LA 5E3IA 4C4TA 1H0SA 2B98A 4QFBA 3OOHA 3KKZA 4BWYA 1PR3A 3I9MA 4UZSA 4H7DA 4PG7A 1IQUA 1M2VB 2QVCA 1EM6A 4P32A 2QVLA 3VPCA 1R0CA 1UDCA 1XMIA 4OGKA 3R5HA 3UPTA 4HYTA 1BX1A 3U16A 5J59A 1QGDA 1VDZA 1YKFA 3IPRA 3R5SA 4FBGA 3IT0A 5FBLB 4CMKA 4NEQA 4QOGA 2WYVA 4KPUB 5JJBA 2IK8A 1SHTX 2OHGA 2Y76A 3OD5A 4BTLA 3DAHA 1QHFA 9MHTA 1O8CA 4URZR 3KZVA 4C88A 5BV7A 1J25A 1LTQA 4WCDA 5B1HA 1E69A 3WGIA 2Q9UA 1K4MA 3QVLA 2G9RA 1WMFA 3D6MA 3H8VA 4CN8A 2FN8A 4LX0A 3NONA 1GA4A 5F2KA 5AQEA 3EFEA 2HSWA 5BXQC 4PV7A 4ZI7A 3SDSA 2E85A 3VQTA 1BHJA 2ZRKA 4UU0A 2JJMA 4LHXA 4OB7A 1CDDA 1I80A 2ZRJA 1M7BA 2VZ8A 3TNDA 2R8PA 4ZXPA 5ALSA 4JZYA 2WG1A 3C8DA 4JX9A 3VU1A 5AK5A 1MEJA 5L3VA 1VFPA 3DQQA 3E9DA 3FPGA 1VHTA 3ENVA 3FRJA 1ZK4A 4YAWA 3OFKA 1LPPA 3IT2A 3UUWA 5BT8A 1AHPA 1KA9H 3GUUA 1NXPA 4KIUA 2EJVA 3D0KA 3HB4X 4EVIA 1V8DA 4KB5A 2X8LA 3NAZA 3G68A 2R7NA 4LY0A 1EHIA 3TW8B 3W34A 5HNKA 4GPIB 1VSTA 3Q3EA 1NBME 3F5SA 2WIGA 2J9GA 4W7IA 4HAWA 5HZHA 1JNXX 4UMEA 2I76A 4ZO8A 1N8SA 3T9BA 4C3UA 4CTNA 3HB9A 4Q00A 3NT2A 3I01M 3NBXX 3ZWWA 1CUIA 3Q3VA 2CNDA 4H18A 1FTQA 4MV1A 4NAVA 4J91A 4D4GA 3KOMA 4A26A 2A0XA 4G6ZA 1YL6A 2LKDA 2QQEA 1U4SA 3SS7X 2WE7A 4LJ4A 1PGPA 2XX3A 4BFTA 1PJTA 2V7UA 2FRXA 2R5FA 3FFXA 3R75A 3JAKB 1XDSA 2HUNA 2QPTA 3GARA 2YXNA 4ERNA 4OMCA 3QIVA 2D2IA 4M6WA 1A8IA 3QF4B 2PU7A 4PX2A 4DEYA 5KWVA 3ETDA 1PR2A 4IJ6A 5GP1A 2CXTA 4Y1EA 2G9VA 2XT6A 1JBKA 1EM8A 1PZHA 2GTIA 3CBGA 1XD2A 4N3GA 1C3OB 3EQ9A 5ELLA 2I65A 2VJCA 1LD3A 1GG5A 3GY0A 5DSXA 2AEMA 4ASUA 5AW8A 3VKGA 4NK4A 1TMGE 4MEJA 1DKNA 2ID9A 1Q95A 3IQWA 4A2QA 4Y1RB 5BUCA 4QT4A 1E32A 2KW5A 4MW6A 2MSCB 1OGIA 4RVSA 2X6RA 3ZI7A 4B71A 5KNLA 1N7JA 1SU4A 4R98A 4OHYA 1Y7PA 1RJGA 1MT0A 3A4MA 2A7QA 3Q40A 3DEIA 4J4HA 4WXHA 4RTRA 2FF5A 2OORC 3DEZA 4R8RA 3PENA 4EW1A 2BGWA 2DFKB 1MW8X 1OA1A 3BK1A 2UYYA 5F1PA 3FHTA 1Z7WA 2CF5A 4QWMA 1KIMA 2QZ9A 5ENVA 4XOIA 2WABA 1USIA 1WXQA 5C1BA 1BXRB 2FU5C 3TEFA 4KL8S 5IDXA 4QNMA 5C2JB 3GJQA 1RXUA 4RIIA 1SD5A 4RVOA 3L0SA 1Z13A 3D3EA 4UXHA 5UKDA 3OI7A 4H3KB 1GNRA 4BBJA 1DMSA 2PMDA 2NOAA 3GNSA 1JJVA 2I5PO 2P2SA 3FKJA 5HIKA 4LV5B 3KQNA 1BNCA 1QH9A 2D5AA 2H3HA 5FF9A 2BHLA 2W6JD 2ZB2A 2HT1A 2OY0A 1OX5A 1S8NA 1VSUA 3THXB 1K8ZB 3H7IA 4PC2A 4M86A 5CLGA 5COQA 1O6FA 1RZ3A 1T25A 4WXMA 4PRZA 3P9XA 3A10A 4WCFC 3EZGA 2DPMA 3C24A 2OILA 4LJAA 1XJQA 3C6BA 5CB4B 2VYFA 3JSXA 1DO8A 3X3HA 2G72A 1J8DA 1SVNA 2HXYA 4HMQA 2R8BA 1UEIA 4REQA 5LZ4A 5HX7A 5K0GA 1POWA 2C9CA 2F3SA 3GBPA 4GS5A 5EIOA 5F4BA 4UM9D 4CKCB 3UN1A 1HT1E 4IQGA 4JFAA 3M49A 2FUKA 1PUIA 3EYAA 4HLDA 3C5WP 4GOLD 4ZWNA 5IEBA 5KOJA 5EKXA 3VVCA 4CTKA 1VKJA 2LTAA 2OCDA 2Z9DA 4JQOA 3GLVA 2JAOA 3T94A 2IH2A 2ZBVA 1GVHA 3LT0A 3VU9B 1KU6A 1M1NB 2RGDA 2Q8PA 4V03A 1XF1A 2QGNA 2YJ3A 2LR0A 2ZU6A 1KKMA 3OOSA 4P81A 2XHEA 3ZDXB 4KMMA 2Q2NA 4LWOA 4CMAA 5B36A 3B36A 5F77A 5BOSA 1FU7A 1YTLA 2I6TA 4IM7A 4M0PA 4I50A 1H1DA 1MH9A 3N58A 1FJHA 1ZM2A 1W1UA 4TROA 5DK6A 2RGXA 1WXDA 2NQ2C 3KT8A 4XI9A 4OH7A 5DBHX 4BC0A 5IVPA 1T2EA 2ZVQX 4ARCA 5DVZA 1M0WA 2X0RA 3RVQA 3I05A 4ZI3A 3ZE9A 2DP4E 3AQIA 4C5CA 1WB6A 5DB4A 3IEMA 4D9FA 3T1TA 3HBLA 3FVTA 1RQGA 2RCNA 5TS2A 4U00A 2ZYTX 1T2DA 4C05A 1O6CA 2A0FA 2ZWIA 3AF1A 1NNUA 1K6JA 1QFYA 5E4JA 2C84A 1PVDA 1XL1A 4R7ZA 1G20B 4KLCA 2GD1O 1QVVA 3MJSA 1JA1A 2F62A 3D8NA 5ESWA 3RJZA 4A7PA 1PYDA 2C7OA 2I6FA 4DLSA 1L4BA 3BRQA 5LJLA 4EYOA 3RU7A 4AF7A 1YC2A 3EWNA 1W4AA 2MCFA 1XV5A 1P73A 2OGSA 2VP6A 5HCUA 3GG2A 3ASYA 3L9XA 3ND7A 4C7OA 4AS3A 1N25A 4J1NA 3K8QA 1FYEA 4OIFA 4WY8A 2D3WA 2B5WA 2PBRA 4XRGA 4ZT4A 1I1NA 2FUG6 2PSJA 4OA5A 4WNYA 4M1MA 1J9GA 1ISFA 4GW3A 3HKCA 4NNPA 1VGQA 2IQ5A 4DL9A 4IOLA 3OZBA 1M73E 1Z33A 3JVIA 1Z08A 3PP8A 4CHGA 5JD6A 1XX6A 4G0VA 3I2JA 1PJZA 4J9UE 2C5GA 4YQEA 3RF7A 1G8MA 3G17A 1JIQA 5F33A 3GRYA 3QKIA 2I6UA 4HGPA 4B3RB 2FPKA 3PXUA 3EN0A 3ZD8A 1NMXA 1JI0A 3DDSA 3TLCA 3H8JA 1OU0A 4A82A 1LLCA 1XCBA 2VT7A 2ZJ8A 5BO5A 3FMFA 1LBIA 4FDUA 4I1VA 2O8DA 4NQZA 4P8RA 5K0FA 1SBIA 4PIMA 3FNIA 3EAGA 4NCBA 2W2NA 1K8YB 4LQDA 3FAZA 4BYGA 5LLTA 3MZ0A 5LMZA 3BWBA 2BTEA 1N1GA 4JYBA 1VYUA 4MSUA 2J7KA 2VHEA 4L8GA 4CMEC 4KIFA 3W3AA 4TTTS 3AFHA 1ZN7A 2NADA 4OOFA 4ATNA 4KUEA 4C03A 4DMRA 3M1YA 3VR6D 2Q5JA 3FVRA 1PFYA 4YFYA 5DLYA 1MJGM 2WKQA 3CZQA 4P58A 2BF7A 4QDJA 1BEZA 1ES9A 1KJIA 3T0FA 3HXOA 1JB1A 3GZJA 3EZNA 5C4MA 2ID7A 1F0PA 1U99A 3O1LA 1G41A 3VH3A 4M9SA 2NNWB 4PR3A 3HFRA 4MMZB 4WIAA 4EFDA 4HFJA 4MQFA 2OZKA 2XPCA 1UDRA 4N01A 4Q9DA 4REMA 4D0NA 4FD2A 4PHTA 2AYXA 2AE1A 4QHTA 3GEDA 2ERCA 4Q3NA 1UBUS 1ZN8A 2BTOA 4RQAA 5E1OA 2FWIA 1JAZA 2DBYA 1XN4A 3BX1A 3PQCA 4Q4AA 2V65A 2ZIWB 4AG6A 4AY3A 2IX3A 4J29A 2Y27A 3CUSA 1C30A 2H08A 1Z07A 3GN1A 1CTQA 1V5IA 3L8CA 2XADA 4EG1A 2X3FA 1TQDA 1WVGA 2ZUUA 3GUVA 5EZYF 1RAEA 3DZFA 5JD3A 4BX9A 4MA4A 4FHGA 1JPVA 3F8TA 2DWOA 1KDZA 3RVKA 4TPKA 2HBZA 2R8ZA 4BVEA 2CL0X 2D0DA 4U6NA 1F20A 4CM3A 4RZHA 5JH7B 3E22A 2AN3A 4UUPA 1I10A 2NO9A 5MGBA 4F0JA 2FZVA 2XMSA 3TVDA 2IFTA 4FSDA 1F2VA 4YJHB 2C5SA 3R40A 5FWXB 2AFHE 1JWBB 5IKOA 3FGNA 5ALNA 1F8UA 2PR2A 3EUEA 3HDJA 1FQJA 4P80A 4PZPA 2JVIA 1K75A 3KALA 1N2HA 3NT4A 4WV3A 2H92A 2G09A 3SBEA 2HHHB 5BRNA 3QXXA 4JJ7A 3ND8A 4JI6B 4C6SA 4H6PA 3R77A 4W8OA 2CHVA 4UREA 3ZS8A 1KWGA 3C6KA 3CXUA 3SWWA 3FYHA 3TCXB 2OFPA 1ILWA 4QDTA 4F85A 2IYPA 1UAGA 2G36A 2E48A 2HIAA 1XZIA 4HWPA 5A7GA 5K8UA 3ZQ4A 1HNWB 2ZYIA 2A9RA 4K9OA 4ZTBA 5HRCA 1GAEO 1UPBA 4PPGA 1M76A 2P7IA 4O2AB 1FE8A 2P90A 5FNZA 3B8HA 4G0QA 3MMSA 3TZHA 2QNRA 2F48A 1T6NA 3DT6A 4MB0A 4PLFA 3T38A 4C2UA 2LNDA 2NYRA 5EZYA 4RD3A 4M7RA 3E9RA 5JDCC 4U7FA 2O5EA 3ABQB 3PEVA 4JKOA 3LKBA 4NMXB 4XVCA 4TLBA 2KB0A 5ARBA 3KZ1E 1XPUA 1U28C 8ABPA 5T4FA 3KWMA 3NWBA 1DGQA 4FB4A 1W87A 3P9IA 1TX4B 3KKKA 3UJ6A 2FVYA 4BNZA 4ND2A 4QHYA 4K9MA 5F52A 2ERYA 1M2FA 3MBIA 2FZEA 3DTYA 4JVLA 3AILA 1DOAA 3F1KA 3IDAA 1IWBB 5FNVB 2MIIA 2PYDA 2YCLA 4K6CA 1RC0A 1NUSA 2CXPA 2R8XA 3U9TA 1Y6GA 1P7ZA 1SIOA 1YCDA 4MAFA 3WV5A 3GJXC 2R00A 3OA2A 3IEVA 3VVMA 2H4XA 1ATZA 4J7XA 1SCNE 1Y80A 4TLCA 4DBLE 4BX3A 2IC5A 1JF8A 3GWZA 2XY4A 2ZTHA 1U2GC 3OC0A 3DZGA 2YC4C 2GARA 3TBKA 4BGEA 3U4QA 4MV7A 3MSXA 1E20A 5G2OA 5JQGF 2WZDA 5AKLA 1FMCA 2AR7A 3CVYA 2CV2A 5IVHA 2BCEA 1V4NA 3IH5A 1VIAA 1TLFA 4ZT2A 4RK1A 1H3EA 2C9DA 2DR0A 5CH3A 1A5ZA 1MJNA 5AIAA 2V45A 1WTCA 4QEDA 5IBPA 3V2IA 1XRJA 4MS1A 4AZ3A 5EKDA 3TZEA 1PU2A 2X15A 5E6SB 2WD7A 3KKOA 1A88A 4M7WA 3U4GA 4QXAA 1QE0A 5IABA 1EGQA 1FTSA 2CLEB 3BZWA 2CB0A 4MYDA 5AHXA 3UXHA 4YT8A 1KERA 3OEWA 4HH0A 2YMPA 5B58T 3VYUB 3PYXA 4IJ5A 4FDAA 4B6EA 2HSJA 5LQNA 4F4FA 1CUWA 3RS7A 3RQIA 1MENA 4KWTA 2GAJA 3O38A 5DM2A 2QGZA 3O8OA 2ZIGA 2O06A 1JFFA 3L2OB 3BHJA 5LXTF 4KYUA 2OP1A 1KFCB 1KI1A 1U9YA 2QAGC 3GVHA 3TM4A 2JH3A 2X14A 1Z4PX 1IBRA 1NLMA 5BYKA 4UFOA 5FI5A 4JXZA 1EESA 4OHVA 1N1EA 1Y7TA 3HKEB 2GHQA 3LF1A 1PDVA 4RY0A 4ER7A 1ZP6A 2QWXA 5FBHA 4B3BA 4EGAA 4F4HA 1NV9A 5DCWA 1GLNA 1F2UB 1NLZA 4QL3A 1ZH8A 5EXTA 4MGKR 2PKRA 4REOA 3BB3A 3KLMX 2PMKA 4AKHA 1UXOA 1RYFA 1XDWA 4MMYB 3TLGB 3PNPA 5T7BA 4YO7A 2DOKA 5A9SA 2R68A 2ZDGA 2AVDA 4AF8A 1ZM3A 4DWJA 3PXEA 3V5NA 3SICE 2B35A 4YAGA 1ENYA 5FOWA 5K3CA 5JROA 5L8VA 2PL5A 3EOBI 1ILEA 1MX3A 3ITKA 2B1RA 3A14A 3KG2A 2HWWA 5CITA 2ZTLA 4RDHA 2BFEB 2H7CA 3VHXA 1LXCA 3SSAA 3ZLUA 1C4WA 2H7XA 2J0UB 3B20A 3MHPA 4YIHA 5K0SA 4N0QA 2HLNA 4MLPA 3I1IA 2IT1A 4FQ7A 2FJUA 3L8MA 5IJWA 5G0SA 3SKXA 4HCJA 3G7NA 1CS0A 3PR3A 2COKA 1B93A 1XEAA 1FF9A 4BO6A 1XP8A 2O7SA 1OI4A 4UM9B 2W0SA 5KCMA 1XZNA 2O23A 4V3BA 2PO7A 1NPYA 4LK2A 2R8EA 1QH8B 2YNMD 1OILA 3C41J 4DILA 1NRWA 2MSNA 3FOZA 5DO9A 1SQ6A 1TJ4A 2UYOA 1DWQA 1E5VA 3CNHA 1MZVA 3VRHA 2E4WA 5DWDA 2CLFB 2V5UA 1U3TA 1OE0A 2C3UA 4HQ6A 5B7GA 1INLA 4GEKA 5L6MB 3D8BA 4MWBA 4FX5A 1W1IA 3O5AA 1KSGA 3D7RA 4CLOB 4B2YA 4UBOA 2QUKA 3C5HA 4UZEA 3CPEA 3D3WB 3HYSA 4MUBA 4BZPA 2JLXA 2P9CA 3A36A 3QXCA 4PAGA 3OPMA 3EGDB 1JHDA 3DFIA 4OK5A 2O0MA 3OJFA 3ZK8A 3MGKA 2G1UA 2GT1A 4HQRA 1EA7A 3BFXA 2FP4B 1XTRA 1X7WB 2UVPB 2XAUA 2B82A 2H1VA 4F12A 1A76A 2QV7A 4D4JA 4UBLA 5CLFA 4D81A 2XXAA 3IT1A 4FYPA 4EG8A 3ME5A 4G25A 2DWUA 3UPDA 4JZKA 1JR2A 2GZHA 3I42A 1TIPA 2J3HA 4GZLA 4N3NA 5CVVA 4LK3A 4F91B 2JGIA 3GEHA 4D6XA 1I94B 3F96A 3SPXA 3CURA 2BM1A 3KLOA 1N8NA 3O21A 1Z47A 1GYRA 1DKMA 2H9AA 2I1WA 3DOIA 2HV8A 3K9WA 3VDQA 5ALYA 2W2OA 2IZ1A 2PRKA 2WWFA