1YUZA

Partially reduced state of nigerythrin
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
202
structure length
200
Chain Sequence
MKVRAQVPTVKNATNFNMVADSKTAVGSTLENLKAAIAGETGAHAKYTAFAKAAREQGYEQIARLFEATAAAELIHIGLEYALVAEMEPGYEKPTVPSAYSCDLNLISGANGEIYETSDMYPAFIRKAQEEGNSKAVHVFTRAKLAESVHAERYLAAYNDIDAPDDDKFHLCPICGYIHKGEDFEKCPICFRPKDTFTAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nigerythrin
publication title High-resolution crystal structures of Desulfovibrio vulgaris (Hildenborough) nigerythrin: facile, redox-dependent iron movement, domain interface variability, and peroxidase activity in the rubrerythrins.
pubmed doi rcsb
source organism Desulfovibrio vulgaris subsp. vulgaris
molecule tags Oxidoreductase
total genus 68
structure length 200
sequence length 202
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02915 Rubrerythrin Rubrerythrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 1yuzA01
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 1yuzA02
3AK9A 1H7VA 2CLBA 2FFXJ 2VL6A 1SMUA 1SMWA 2M4YA 2JD60 3EGMA 5E2DA 5JKMG 1VEIA 3KYWA 3KXUA 1SMMA 1O9IA 1MFRA 2V3BB 5J8SA 1JGCA 3HL1A 4LYUA 4RC7B 2JD80 4ITWA 3RBCA 1L8IA 3AJOA 3TA8A 3R2SA 3A9QA 4EVEA 5D8SA 5E1UA 3ERZA 4DI0A 4RC6B 2CHPA 1TJOA 3SHXA 1RDGA 4MUDA 1IRNA 4PG0A 1NF4A 3MPSA 1RYTA 2Y3QA 4TODA 4P18A 2X170 2PYBA 5JKLA 3PWFA 3PW1B 4MJYA 3PVRA 1VJXA 4ZL6A 2RBDA 4RC8A 3SIDA 1J30A 1R0GA 1ZUJA 3RZ6A 3E6SA 2CLUA 4CYBA 1JI5A 4M34A 4TPUA 1RCGA 2YJJA 5GU2X 4TOEA 4AM4A 3Q4NA 2F7NA 3RD0A 3PW8A 4R42A 3BT5A 4ML5A 4LQNA 3IS7A 5LG2A 4DYXA 2XJNA 3R2MA 3H7GA 2K2DA 3U90A 5AI3A 3PWQC 1BQ9A 4IWJA 2QL0A 5FEJA 3BVFA 4RXNA 3KA3A 5J9VA 3KA9A 3E1JA 4II4B 1TKOA 2WTLA 4MKUA 3NP0X 4TOCA 4AM2A 3BKNA 4TOFA 5FFDA 2PVXA 5GOUA 1TKPA 1FHMA 1DATA 1QCVA 1F33A 3PVYA 4QUWA 1T9QA 3KA4A 1YUZA 5FFEA 5ERJA 2V2RA 2CHIA 3E1LA 1R0IA 2CN6A 3KA6A 5D8PA 5CMRA 2IU2A 1B13A 2V2IA 1B2OA 4ISPA 4IXKA 3FVBA 2YW7A 2W0OA 3O7SA 2GMGA 3PVTA 4M35A 1YK5A 3HIUA 3F37A 3WVVA 3GE4A 2GYQA 1LTLA 2V2NA 1S24A 7RXNA 3KYVA 3O7RA 1BRFA 3PVYB 4LQJA 2QF9A 1BG7A 3QHBA 2CN7A 3WVWA 4Y08A 2BW1A 1Z4AA 2GS4A 3QD8A 2C41A 3BVEA 5HQOA 4MN9A 4CVPA 1YV1A 2Z5RA 3KX9A 4RC5B 4EVDA 1IERA 4ZJKA 1LKPA 1N1QA 3WVUA 3R2RA 1AEWA 4ZLWA 3F39A 2ZA6A 2VXXA 5J8WA 2C2JA 2CEIA 3BVIA 3PW8C 4LPNA 3EZ0A 3SE1A 4YKHA 2ZA7A 1QYBA 2FZFA 2V2LA 1RB9A 5K53A 1EUMA 5JACA 3UNOA 4E6KA 1NFVA 3OJ5A 1OTKA 4DE6A 4M33A 3RYGA 3KYUA 1FHHA 3WNWA 3E2CA 5IX6A 4DYUA 1C09A 5AI2A 3RAVA 3Q4OA 3E1QA 2LCQA 5CMQA 1L8HA 3KYYA 5ERKA 1LKOA 3AK8A 1R0HA 3RGDA 4AR3A 3GHQA 1QGHA 3R2OA 4TO9A 5D8RA 3Q4QA 2HTNA 4XGSA 1UMNA 3AJQA 3NOZX 5RXNA 4CY9A 1BQ8A 6RXNA 2FKZA 3PVRB 2FJCA 1DPSA 5D8XA 2C6RA 1NF6A 4PGKA 4TOBA 3T9JA 1LB3A 5K52A 2ITBA 2DSXA 4AR5A 5LBHA 4LQHA 3R2HA 4ZL5A 3KYXA 3AF7X 4AR4A 4CYAA 4YWMA 3ISEA 5C6FA 5GU0X 2HR5A 3QVDA 2ZG9X 5J93A 1JKVA 1VCXA 1S30A 1B2JA 4LPJA 4YWLA 4IWKA 1BFRA 4ITTA 2D5KA 4CMYA 2PYAA 4EVCA 1VLGA 1E8JA 1BE7A 2Z5PA 2XJOA 4XKSA 2IB0A 2Z90A 2JD70 5JKMA 1FHAA 2V15A 1NNQA 4ZKHA 4CVTA 4CMYV 3E1MA 1SQ3A 5GU1X 4ZTTA 3F34A 4LPMA 1RWDA 3F32A 1YK4A 3QZ3A 3RE7A 2WLUA 5IY0A 3QB9A 1Z6OM 2FHAA 1RCEA 1S3QA 1TK6A 3IS8A 2IY4A 2QQYA 4ERUA 4AM5A 4MY7A 2KN9A 4ZKXA 2XKQA 1JTSA 1CAAA 4LQVA 5GN8A 4A25A 3F33A 1VEQA 2CIHA 2ZURX 1ZS3A 3PW1A 4M32A 5HJFA 2XGWA 1LKMA 3KWOA 4TOAA 3FI6A 3IQ1A 4DYZA 1H96A 1JYBA 1RCCA 2PVEA 2V2PA 1IESA 2BJYA 1VELA 2ZG7X 2V2MA 4U3GA 1CADA 3F36A 4DZ0A 5AXSA 1YUXA 2Z6MA 2Z5QA 2BKCA 5FFBA 3PVTB 1XZ3A 4PG1A 4XKUA 5D8YA 1T9PA 3ES3A 3F35A 3F38A 2FL0A 1JREA 2G4HA 1DX8A 3R2KA 1Z6OA 2YW6A 1T9OA 4POFA 4EVBA 4KVQA 3R2LA 1IU5A 5GU3X 1JI4A 2C2UA 5GN8B 3SS2A 5I4JA 4OYNA 1KRQA 4DASA 3NP2X 3OGHA 5HJHA 1XZ1A 4II4A 4CVSA 2ZG8X 2UX1A 3QHCA 2MS3A 5FFAA 3RZTA 3E1OA 1ZRPA 3ISFA 5D8OA 1JIGA 1RCDA 3KA8A 2XJMA 4POGA 5JKLG 8RXNA 2ZA8A 4ZMCA 4XKTA 3E1PA 3A44A 1UVHA 2BK6A 2V2OA 4TOGA 1DVBA 3UOFA 4DYYA 5LG8A 3GVYA 4TOHA 2YJKA 4Z3BA 3BVKA 3FSEA 4ME3A 1GWGA 3AF9X 1HRSA 5FFCA 2OH3A 2WLAA 3AF8X 3EZUA 2VZBA 3SH6A 4Z5SA 1JKUA 4TW3A 2GYDA 4REUA 4AR6A 1IU6A 2OC5A 4KVRA 1RCIA 3A68A 1B71A 2FG4A 1RDVA 4CVRA 1S2ZA 4RC7A 3UOIA 2VXIA 3PWQA 5D8QA 1BCFA 4RC5A 1R0FA 1IROA 1O9RA 2CF7A 4PGIA 4RC6A 5LS9A 4KVSA 4ZKWA 3VNXA 3E1NA 3AJPA 4ISMA 4LYXA 2RDVA 1R0JA 1MOJA 1R03A 4ETRA 3Q4RA 3BVLA 2C2FA 1BFYA 4K9FA 2KKDA 5CZUA 2V2JA 2V2SA 1F30A 3PZAA 2FG8A 1SOFA 3E6RA
chains in the Genus database with same CATH superfamily
3AK9A 3K35A 2CLBA 5EINC 1H7VA 2FFXJ 2VL6A 4B8CD 1SMUA 1SMWA 2M4YA 3I4ML 2JD60 3EGMA 5E2DA 1IW7D 5JKMG 3M3YL 1VEIA 2A69D 3KYWA 3KXUA 1SMMA 1O9IA 1MFRA 2V3BB 4V196 5J8SA 1JGCA 3HL1A 4LYUA 4A3JL 5C4JL 4RC7B 3S2HL 2JD80 4ITWA 3RBCA 4JADA 4A3CL 1L8IA 3AJOA 3TA8A 3R2SA 3A9QA 4EVEA 5D8SA 5E1UA 3HAXC 3ERZA 3DBYA 4DI0A 4RC6B 2CHPA 1TJOA 2AR0A 3SHXA 3LWPB 1RDGA 4MUDA 1IRNA 1PFYA 4PG0A 2JA5L 1NF4A 3MPSA 1RYTA 2Y3QA 4TODA 3LNLA 4P18A 2X170 3GGZA 4LHLA 2PYBA 2G38B 5JKLA 3PIO1 3PWFA 3PW1B 4G6BA 2E2JL 4MJYA 4AHZA 3NFPI 3PVRA 3K7AL 4WJG4 1VJXA 2N02A 4ZL6A 2RBDA 3RZDL 5C3EL 2WAQP 2RFKB 4RC8A 3JZ9A 3SIDA 1J30A 3UFBA 5JDOA 1R0GA 1ZUJA 3RZ6A 2ERSA 3E6SA 5EIOC 2CLUA 2JI3A 4CYBA 1JI5A 1RYQA 4X0JA 1PZXA 4ZN1B 4M34A 4TPUA 1Y1WL 3PKJA 5GAHc 1RCGA 2YJJA 5GU2X 4TOEA 4AM4A 3Q4NA 2F7NA 3RD0A 3PW8A 1P7PA 4TVMA 4R42A 1VZIA 3BT5A 2JA8L 4ML5A 2AYJA 4LQNA 3L0MA 3IS7A 1WCML 4LHNA 5MFPA 3C1YA 3S16L 5LG2A 3H9CA 4DYXA 2XJNA 2OKCA 3R2MA 3C23A 3H7GA 2K2DA 3U90A 5AI3A 2C6BA 3PWQC 3JR7A 1BQ9A 2NYDA 4IWJA 2XJTA 2QL0A 1R9TL 3KHKA 5FEJA 3S1QL 3BVFA 2CR8A 4RXNA 4Y7NL 2M6PA 5IP9L 3KA3A 5J9VA 3KA9A 5GADc 3E1JA 3MSUA 4JAFA 4II4B 1TKOA 2WTLA 4MKUA 3NP0X 4TOCA 4AM2A 3BKNA 4TOFA 5FFDA 2PVXA 2WB1P 5GOUA 1TKPA 1FHMA 1DATA 1QCVA 4C3IL 1F33A 3PVYA 4QUWA 1T9QA 3KA4A 2V0FA 1PFWA 1YUZA 5FFEA 5ERJA 1VZHA 1Z92B 2V2RA 4XGHA 4Y52L 2NVXL 2CHIA 3E1LA 3GTGL 1TWHL 4BBSL 1R0IA 2CN6A 3KA6A 1QQTA 5D8PA 5CMRA 3P8BA 2IU2A 1B13A 2V2IA 1B2OA 2VUML 4ISPA 4IXKA 5JVH1 3FVBA 2YW7A 1NXGA 2C6AA 2W0OA 2O5JD 3O7SA 5K2ME 2XJVA 2GMGA 3PVTA 4M35A 1YK5A 3HIUA 3F37A 3WVVA 1TWAL 3GE4A 1I6HL 2GYQA 2JI1A 1LTLA 2V2NA 4YXMA 4JAEA 5IYBL 2M6OA 2JI2A 1S24A 7RXNA 1Y1VL 3B0AB 3KYVA 3O7RA 4A3KL 1BRFA 3PVYB 4LQJA 4BXXL 2QF9A 2PPTA 4AI1A 1BG7A 3QHBA 3KDQA 2CN7A 3J7Y1 3WVWA 3GTML 2NVQL 4Y08A 2BW1A 1Z4AA 2GS4A 3QD8A 2C41A 3J7Z1 2CKCA 3BVEA 5HQOA 4MN9A 4CVPA 1NXEA 4AYBP 1YV1A 2Z5RA 3KX9A 3HOUL 4RC5B 4EVDA 1IERA 4ZJKA 2E2HL 1LKPA 5MLC3 1N1QA 3WVUA 3R2RA 1AEWA 4ZLWA 4XXBB 3VPBE 3F39A 4ZN3B 2ZA6A 2VXXA 5J8WA 3ZG6A 2C2JA 2CEIA 3BVIA 3PW8C 4LPNA 3EZ0A 3GTQL 3SE1A 2L0ZA 5FLML 1K83L 4YKHA 2CKAA 2ZA7A 1QYBA 3PKIA 5M3ML 2FZFA 2A6ED 3WWNB 2V2LA 1RB9A 3LWRB 2R93L 3S17L 5K53A 3FRSA 1EUMA 5JACA 3UNOA 4U671 2HVYC 4E6KA 4QIWP 1NFVA 3OJ5A 1VZGA 1OTKA 4DE6A 4M33A 3RYGA 3KYUA 1FHHA 3WNWA 3E2CA 5IX6A 4DYUA 1C09A 1PFVA 5AI2A 4W4LB 3RAVA 2JA6L 3Q4OA 2AQCA 3M4OL 4X6AL 5C4XL 3E1QA 2LCQA 5CMQA 1L8HA 3KYYA 3LWVB 3N6OA 1LKOA 5ERKA 3FDJA 3H99A 3AK8A 5GAGc 1R0HA 3RGDA 4AR3A 3GHQA 1QGHA 2E2IL 2BE5D 3R2OA 2EY4E 4YXJA 1OWBA 1WJVA 4TO9A 3H9BA 5D8RA 3LPEB 3Q4QA 2HTNA 2PMZP 4XGSA 1UMNA 2ERJA 3AJQA 3NOZX 5RXNA 4CY9A 5AN9H 1BQ8A 6RXNA 3C21A 4W4KB 2FKZA 3PVRB 2FJCA 1DPSA 5D8XA 2C6RA 1NF6A 4PGKA 4TOBA 4BBRL 3H0GL 4A3ML 2MGYA 3T9JA 2B63L 1LB3A 5K52A 2ITBA 5JDOB 2DSXA 5LBHA 4LQHA 3R2HA 4AR5A 3HJYB 4ZL5A 4UY81 2A68D 3KYXA 3AF7X 4AR4A 4CYAA 4YWMA 3ISEA 5FJ8L 5C6FA 5DM61 5GU0X 2HR5A 3QVDA 2ZG9X 3LWOB 5J93A 1JKVA 3PL5A 1VCXA 1S30A 1B2JA 4LPJA 4YWLA 4IWKA 1BFRA 1TWFL 4A3EL 4ITTA 2NVYL 2WWXB 5IP7L 2D5KA 4CMYA 2PYAA 4EVCA 1VLGA 4C3HL 1BE7A 4AHWA 1E8JA 3CQZL 2Z5PA 2XJOA 3FRRA 4XKSA 3V3KB 5MFZA 2IB0A 2Z90A 4A3IL 2JD70 3HOWL 5JKMA 1FHAA 3MQKB 2V15A 2R7ZL 4BY1L 3GTLL 1NNQA 4ZKHA 3GTJL 3S2DL 4CVTA 4CMYV 3E1MA 1SQ3A 3GGYA 5GU1X 4ZTTA 3F34A 4LPMA 1RWDA 3F32A 1YK4A 3QZ3A 3RE7A 2WLUA 5IY0A 3QB9A 1Z6OM 3VVAA 2FHAA 1RCEA 1S3QA 1TK6A 3IS8A 2IY4A 2QQYA 4ERUA 3HOXL 4AM5A 4MY7A 2KN9A 4E40A 4ZKXA 2XKQA 3I4NL 3D19A 1ODHA 1JTSA 1CAAA 4LQVA 5GN8A 4A25A 3F33A 1VEQA 2CIHA 2ZURX 1ZS3A 3PW1A 4M32A 5H1Sc 2YU9L 5HJFA 2XGWA 1LKMA 3KWOA 2Z3RB 4TOAA 5C44L 3FI6A 5JVG1 3IQ1A 4DYZA 1H96A 1JYBA 1RCCA 2PVEA 3GTKL 2V2PA 2V8TA 1IESA 2BJYA 1VELA 2ZG7X 2V2MA 4U3GA 5M5WL 5M3FL 2XJPA 1TWCL 1CADA 3F36A 4DZ0A 4GS7D 1PFUA 5AXSA 1YUXA 3HOVL 2Z6MA 4WFN1 2Z5QA 2BKCA 5FFBA 3PVTB 2Y44A 1XZ3A 4PG1A 4XKUA 3W54A 2Z3QB 2V0EA 4KXRB 4A93L 5D8YA 3S14L 1T9PA 3ES3A 3F35A 3F38A 2FL0A 1JREA 2NVTL 2G4HA 1DX8A 1OWCA 3S15L 3R2KA 1Z6OA 2YW6A 1T9OA 4POFA 4EVBA 4KVQA 3R2LA 1IU5A 5GU3X 3HOZL 4MXPA 1JI4A 2C2UA 5GN8B 3SS2A 5I4JA 4AI3A 3JZAB 4OYNA 1KRQA 1SFOL 4DASA 4C2M1 3NP2X 3C1ZA 3OGHA 5HJHA 5IYCL 1XZ1A 2PSMC 4II4A 4CVSA 3H3VM 2ZG8X 4AHYA 2UX1A 5M5XL 3QHCA 2AUSB 5FFAA 2MS3A 3RZTA 4AHXA 3E1OA 1ZRPA 3ISFA 5D8OA 1TWGL 1JIGA 1RCDA 5DM71 3GTOL 5IYDL 3KA8A 2XJMA 1F4LA 3HKZP 4POGA 5JKLG 8RXNA 2ZA8A 4ZMCA 3S1ML 4XKTA 2J9UB 4A3GL 3E1PA 2A6HD 3A44A 3M6JA 3LWQB 1UVHA 2BK6A 5HU6D 2V2OA 4TOGA 1DVBA 3UOFA 4DYYA 5LG8A 3B08B 4A3FL 4AI2A 5GAEc 3WWLA 3GVYA 3GTPL 4A3DL 2XJRA 4TOHA 2YJKA 4Z3BA 3BVKA 2XJUA 3FSEA 4ME3A 5MGNA 1GWGA 3HOYL 3AF9X 1HRSA 5FFCA 2OH3A 2B5ID 4BY7L 2WLAA 3AF8X 3EZUA 3PIP1 3IU3I 5M5YL 4JAGA 2VZBA 3SH6A 4AI0A 4Z5SA 1I3QL 2JA7L 1JKUA 3VV9A 2R92L 4TW3A 3HJWB 2GYDA 4REUA 4AR6A 3S1RL 1IU6A 5MF6A 2OC5A 4KVRA 2XJQA 1RCIA 2XJSA 3A68A 3LKDA 1B71A 2V8UA 2APOB 2FG4A 1RDVA 4CVRA 1S2ZA 4RC7A 2H12A 3UOIA 3QQCE 2VXIA 3PWQA 3PO2L 4A3BL 5D8QA 1BCFA 3H97A 4RC5A 1R0FA 1IROA 1O9RA 2CF7A 4YVZA 4PGIA 4RC6A 5LS9A 4KVSA 4ZKWA 3VNXA 3E1NA 3FKIL 3AJPA 4ISMA 4LYXA 2M4VA 2RDVA 3S1NL 1R0JA 4A3LL 3P2AA 1MOJA 2Y0SP 1R03A 2ZIXA 4ETRA 3Q4RA 3BVLA 2C2FA 1BFYA 4K9FA 4C3JL 3PO3L 2KKDA 5CZUA 2V2JA 2V2SA 1F30A 4E6YA 3RZOL 3PZAA 2FG8A 1I50L 1SOFA 2CWLA 3E6RA
chains in the Genus database with same CATH topology
3AK9A 3K35A 2CLBA 5EINC 1H7VA 2FFXJ 2VL6A 4B8CD 1SMUA 1SMWA 2M4YA 2JD60 3EGMA 5E2DA 1IW7D 5JKMG 1VEIA 2A69D 3KYWA 3KXUA 1SMMA 1O9IA 1MFRA 2V3BB 4V196 5J8SA 1JGCA 3HL1A 4LYUA 4RC7B 2JD80 4ITWA 3RBCA 4JADA 1L8IA 3AJOA 3TA8A 3R2SA 3A9QA 4EVEA 5D8SA 5E1UA 3ERZA 3DBYA 4DI0A 4RC6B 2CHPA 1TJOA 2AR0A 3SHXA 1RDGA 4MUDA 1IRNA 4PG0A 1NF4A 3MPSA 1RYTA 2Y3QA 4TODA 3LNLA 4P18A 2X170 3GGZA 4LHLA 2PYBA 2G38B 5JKLA 3PIO1 3PWFA 3PW1B 4G6BA 4MJYA 4AHZA 3NFPI 3PVRA 4WJG4 1VJXA 2N02A 4ZL6A 2RBDA 4RC8A 3JZ9A 3SIDA 1J30A 3UFBA 5JDOA 1R0GA 1ZUJA 3RZ6A 2ERSA 3E6SA 5EIOC 2CLUA 2JI3A 4CYBA 1JI5A 1RYQA 4X0JA 4ZN1B 4M34A 4TPUA 3PKJA 5GAHc 1RCGA 2YJJA 5GU2X 4TOEA 4AM4A 3Q4NA 2F7NA 3RD0A 3PW8A 4TVMA 4R42A 1VZIA 3BT5A 4ML5A 2AYJA 4LQNA 3L0MA 3IS7A 4LHNA 5MFPA 3C1YA 5LG2A 4DYXA 2XJNA 2OKCA 3R2MA 3C23A 3H7GA 2K2DA 3U90A 5AI3A 2C6BA 3PWQC 1BQ9A 2NYDA 4IWJA 2XJTA 2QL0A 3KHKA 5FEJA 3BVFA 2CR8A 4RXNA 2M6PA 3KA3A 5J9VA 3KA9A 5GADc 3E1JA 3MSUA 4JAFA 4II4B 1TKOA 2WTLA 4MKUA 3NP0X 4TOCA 4AM2A 3BKNA 4TOFA 5FFDA 2PVXA 5GOUA 1TKPA 1FHMA 1DATA 1QCVA 1F33A 3PVYA 4QUWA 1T9QA 3KA4A 2V0FA 1YUZA 5FFEA 5ERJA 1VZHA 1Z92B 2V2RA 4XGHA 2CHIA 3E1LA 1R0IA 2CN6A 3KA6A 5D8PA 5CMRA 3P8BA 2IU2A 1B13A 2V2IA 1B2OA 4ISPA 4IXKA 5JVH1 3FVBA 2YW7A 1NXGA 2C6AA 2W0OA 2O5JD 3O7SA 5K2ME 2XJVA 2GMGA 3PVTA 4M35A 1YK5A 3HIUA 3F37A 3WVVA 3GE4A 2GYQA 2JI1A 1LTLA 2V2NA 4YXMA 4JAEA 2M6OA 2JI2A 1S24A 7RXNA 3B0AB 3KYVA 3O7RA 1BRFA 3PVYB 4LQJA 2QF9A 2PPTA 4AI1A 1BG7A 3QHBA 3KDQA 2CN7A 3J7Y1 3WVWA 4Y08A 2BW1A 1Z4AA 2GS4A 3QD8A 2C41A 3J7Z1 2CKCA 3BVEA 5HQOA 4MN9A 4CVPA 1NXEA 1YV1A 2Z5RA 3KX9A 4RC5B 4EVDA 1IERA 4ZJKA 1LKPA 5MLC3 1N1QA 3WVUA 3R2RA 1AEWA 4ZLWA 4XXBB 3VPBE 3F39A 4ZN3B 2ZA6A 2VXXA 5J8WA 3ZG6A 2C2JA 2CEIA 3BVIA 3PW8C 4LPNA 3EZ0A 3SE1A 2L0ZA 4YKHA 2CKAA 2ZA7A 1QYBA 3PKIA 2FZFA 2A6ED 3WWNB 2V2LA 1RB9A 5K53A 3FRSA 1EUMA 5JACA 3UNOA 4U671 4E6KA 1NFVA 3OJ5A 1VZGA 1OTKA 4DE6A 4M33A 3RYGA 3KYUA 1FHHA 3WNWA 3E2CA 5IX6A 4DYUA 1C09A 5AI2A 4W4LB 3RAVA 3Q4OA 3E1QA 2LCQA 5CMQA 1L8HA 3KYYA 3N6OA 1LKOA 5ERKA 3AK8A 5GAGc 1R0HA 3RGDA 4AR3A 3GHQA 1QGHA 2BE5D 3R2OA 4YXJA 1OWBA 1WJVA 4TO9A 5D8RA 3LPEB 3Q4QA 2HTNA 4XGSA 1UMNA 2ERJA 3AJQA 3NOZX 5RXNA 4CY9A 5AN9H 1BQ8A 6RXNA 3C21A 4W4KB 2FKZA 3PVRB 2FJCA 1DPSA 5D8XA 2C6RA 1NF6A 4PGKA 4TOBA 2MGYA 3T9JA 1LB3A 5K52A 2ITBA 5JDOB 2DSXA 5LBHA 4LQHA 3R2HA 4AR5A 4ZL5A 4UY81 2A68D 3KYXA 3AF7X 4AR4A 4CYAA 4YWMA 3ISEA 5C6FA 5DM61 5GU0X 2HR5A 3QVDA 2ZG9X 5J93A 1JKVA 1VCXA 1S30A 1B2JA 4LPJA 4YWLA 4IWKA 1BFRA 4ITTA 2WWXB 2D5KA 4CMYA 2PYAA 4EVCA 1VLGA 1E8JA 1BE7A 4AHWA 2Z5PA 2XJOA 3FRRA 4XKSA 3V3KB 5MFZA 2IB0A 2Z90A 2JD70 5JKMA 1FHAA 2V15A 1NNQA 4ZKHA 4CVTA 4CMYV 3E1MA 1SQ3A 3GGYA 5GU1X 4ZTTA 3F34A 4LPMA 1RWDA 3F32A 1YK4A 3QZ3A 3RE7A 2WLUA 5IY0A 3QB9A 1Z6OM 3VVAA 2FHAA 1RCEA 1S3QA 1TK6A 3IS8A 2IY4A 2QQYA 4ERUA 4AM5A 4MY7A 2KN9A 4E40A 4ZKXA 2XKQA 3D19A 1ODHA 1JTSA 1CAAA 4LQVA 5GN8A 4A25A 3F33A 1VEQA 2CIHA 2ZURX 1ZS3A 3PW1A 4M32A 5H1Sc 5HJFA 2XGWA 1LKMA 3KWOA 2Z3RB 4TOAA 3FI6A 5JVG1 3IQ1A 4DYZA 1H96A 1JYBA 1RCCA 2PVEA 2V2PA 2V8TA 1IESA 2BJYA 1VELA 2ZG7X 2V2MA 4U3GA 2XJPA 1CADA 3F36A 4DZ0A 4GS7D 5AXSA 1YUXA 2Z6MA 4WFN1 2Z5QA 2BKCA 5FFBA 3PVTB 2Y44A 1XZ3A 4PG1A 4XKUA 3W54A 2Z3QB 2V0EA 4KXRB 5D8YA 1T9PA 3ES3A 3F35A 3F38A 2FL0A 1JREA 2G4HA 1DX8A 1OWCA 3R2KA 1Z6OA 2YW6A 1T9OA 4POFA 4EVBA 4KVQA 3R2LA 1IU5A 5GU3X 4MXPA 1JI4A 2C2UA 5GN8B 3SS2A 5I4JA 4AI3A 3JZAB 4OYNA 1KRQA 4DASA 3NP2X 3C1ZA 3OGHA 5HJHA 1XZ1A 2PSMC 4II4A 4CVSA 2ZG8X 4AHYA 2UX1A 3QHCA 2MS3A 5FFAA 3RZTA 4AHXA 3E1OA 1ZRPA 3ISFA 5D8OA 5DM71 1JIGA 1RCDA 3KA8A 2XJMA 4POGA 5JKLG 8RXNA 2ZA8A 4ZMCA 4XKTA 2J9UB 3E1PA 2A6HD 3A44A 3M6JA 1UVHA 2BK6A 5HU6D 2V2OA 4TOGA 1DVBA 3UOFA 4DYYA 5LG8A 3B08B 4AI2A 5GAEc 3WWLA 3GVYA 2XJRA 4TOHA 2YJKA 4Z3BA 3BVKA 2XJUA 3FSEA 4ME3A 5MGNA 1GWGA 3AF9X 1HRSA 5FFCA 2OH3A 2B5ID 2WLAA 3AF8X 3EZUA 3PIP1 3IU3I 4JAGA 2VZBA 3SH6A 4AI0A 4Z5SA 1JKUA 3VV9A 4TW3A 2GYDA 4REUA 4AR6A 1IU6A 5MF6A 2OC5A 4KVRA 2XJQA 1RCIA 2XJSA 3A68A 3LKDA 1B71A 2V8UA 2FG4A 1RDVA 4CVRA 1S2ZA 4RC7A 2H12A 3UOIA 3QQCE 2VXIA 3PWQA 5D8QA 1BCFA 4RC5A 1R0FA 1IROA 1O9RA 2CF7A 4YVZA 4PGIA 4RC6A 5LS9A 4KVSA 4ZKWA 3VNXA 3E1NA 3AJPA 4ISMA 4LYXA 2M4VA 2RDVA 1R0JA 3P2AA 1MOJA 1R03A 2ZIXA 4ETRA 3Q4RA 3BVLA 2C2FA 1BFYA 4K9FA 2KKDA 5CZUA 2V2JA 2V2SA 1F30A 4E6YA 3PZAA 2FG8A 1SOFA 2CWLA 3E6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AK9 A;  1H7V A;  2CLB A;  2FFX J;  2VL6 A;  1SMU A;  1SMW A;  2M4Y A;  2JD6 0;  3EGM A;  5E2D A;  5JKM G;  1VEI A;  3KYW A;  3KXU A;  1SMM A;  1O9I A;  1MFR A;  2V3B B;  5J8S A;  1JGC A;  3HL1 A;  4LYU A;  4RC7 B;  2JD8 0;  4ITW A;  3RBC A;  1L8I A;  3AJO A;  3TA8 A;  3R2S A;  3A9Q A;  4EVE A;  5D8S A;  5E1U A;  3ERZ A;  4DI0 A;  4RC6 B;  2CHP A;  1TJO A;  3SHX A;  1RDG A;  4MUD A;  1IRN A;  4PG0 A;  1NF4 A;  3MPS A;  1RYT A;  2Y3Q A;  4TOD A;  4P18 A;  2X17 0;  2PYB A;  5JKL A;  3PWF A;  3PW1 B;  4MJY A;  3PVR A;  1VJX A;  4ZL6 A;  2RBD A;  4RC8 A;  3SID A;  1J30 A;  1R0G A;  1ZUJ A;  3RZ6 A;  3E6S A;  2CLU A;  4CYB A;  1JI5 A;  4M34 A;  4TPU A;  1RCG A;  2YJJ A;  5GU2 X;  4TOE A;  4AM4 A;  3Q4N A;  2F7N A;  3RD0 A;  3PW8 A;  4R42 A;  3BT5 A;  4ML5 A;  4LQN A;  3IS7 A;  5LG2 A;  4DYX A;  2XJN A;  3R2M A;  3H7G A;  2K2D A;  3U90 A;  5AI3 A;  3PWQ C;  1BQ9 A;  4IWJ A;  2QL0 A;  5FEJ A;  3BVF A;  4RXN A;  3KA3 A;  5J9V A;  3KA9 A;  3E1J A;  4II4 B;  1TKO A;  2WTL A;  4MKU A;  3NP0 X;  4TOC A;  4AM2 A;  3BKN A;  4TOF A;  5FFD A;  2PVX A;  5GOU A;  1TKP A;  1FHM A;  1DAT A;  1QCV A;  1F33 A;  3PVY A;  4QUW A;  1T9Q A;  3KA4 A;  1YUZ A;  5FFE A;  5ERJ A;  2V2R A;  2CHI A;  3E1L A;  1R0I A;  2CN6 A;  3KA6 A;  5D8P A;  5CMR A;  2IU2 A;  1B13 A;  2V2I A;  1B2O A;  4ISP A;  4IXK A;  3FVB A;  2YW7 A;  2W0O A;  3O7S A;  2GMG A;  3PVT A;  4M35 A;  1YK5 A;  3HIU A;  3F37 A;  3WVV A;  3GE4 A;  2GYQ A;  1LTL A;  2V2N A;  1S24 A;  7RXN A;  3KYV A;  3O7R A;  1BRF A;  3PVY B;  4LQJ A;  2QF9 A;  1BG7 A;  3QHB A;  2CN7 A;  3WVW A;  4Y08 A;  2BW1 A;  1Z4A A;  2GS4 A;  3QD8 A;  2C41 A;  3BVE A;  5HQO A;  4MN9 A;  4CVP A;  1YV1 A;  2Z5R A;  3KX9 A;  4RC5 B;  4EVD A;  1IER A;  4ZJK A;  1LKP A;  1N1Q A;  3WVU A;  3R2R A;  1AEW A;  4ZLW A;  3F39 A;  2ZA6 A;  2VXX A;  5J8W A;  2C2J A;  2CEI A;  3BVI A;  3PW8 C;  4LPN A;  3EZ0 A;  3SE1 A;  4YKH A;  2ZA7 A;  1QYB A;  2FZF A;  2V2L A;  1RB9 A;  5K53 A;  1EUM A;  5JAC A;  3UNO A;  4E6K A;  1NFV A;  3OJ5 A;  1OTK A;  4DE6 A;  4M33 A;  3RYG A;  3KYU A;  1FHH A;  3WNW A;  3E2C A;  5IX6 A;  4DYU A;  1C09 A;  5AI2 A;  3RAV A;  3Q4O A;  3E1Q A;  2LCQ A;  5CMQ A;  1L8H A;  3KYY A;  5ERK A;  1LKO A;  3AK8 A;  1R0H A;  3RGD A;  4AR3 A;  3GHQ A;  1QGH A;  3R2O A;  4TO9 A;  5D8R A;  3Q4Q A;  2HTN A;  4XGS A;  1UMN A;  3AJQ A;  3NOZ X;  5RXN A;  4CY9 A;  1BQ8 A;  6RXN A;  2FKZ A;  3PVR B;  2FJC A;  1DPS A;  5D8X A;  2C6R A;  1NF6 A;  4PGK A;  4TOB A;  3T9J A;  1LB3 A;  5K52 A;  2ITB A;  2DSX A;  4AR5 A;  5LBH A;  4LQH A;  3R2H A;  4ZL5 A;  3KYX A;  3AF7 X;  4AR4 A;  4CYA A;  4YWM A;  3ISE A;  5C6F A;  5GU0 X;  2HR5 A;  3QVD A;  2ZG9 X;  5J93 A;  1JKV A;  1VCX A;  1S30 A;  1B2J A;  4LPJ A;  4YWL A;  4IWK A;  1BFR A;  4ITT A;  2D5K A;  4CMY A;  2PYA A;  4EVC A;  1VLG A;  1E8J A;  1BE7 A;  2Z5P A;  2XJO A;  4XKS A;  2IB0 A;  2Z90 A;  2JD7 0;  5JKM A;  1FHA A;  2V15 A;  1NNQ A;  4ZKH A;  4CVT A;  4CMY V;  3E1M A;  1SQ3 A;  5GU1 X;  4ZTT A;  3F34 A;  4LPM A;  1RWD A;  3F32 A;  1YK4 A;  3QZ3 A;  3RE7 A;  2WLU A;  5IY0 A;  3QB9 A;  1Z6O M;  2FHA A;  1RCE A;  1S3Q A;  1TK6 A;  3IS8 A;  2IY4 A;  2QQY A;  4ERU A;  4AM5 A;  4MY7 A;  2KN9 A;  4ZKX A;  2XKQ A;  1JTS A;  1CAA A;  4LQV A;  5GN8 A;  4A25 A;  3F33 A;  1VEQ A;  2CIH A;  2ZUR X;  1ZS3 A;  3PW1 A;  4M32 A;  5HJF A;  2XGW A;  1LKM A;  3KWO A;  4TOA A;  3FI6 A;  3IQ1 A;  4DYZ A;  1H96 A;  1JYB A;  1RCC A;  2PVE A;  2V2P A;  1IES A;  2BJY A;  1VEL A;  2ZG7 X;  2V2M A;  4U3G A;  1CAD A;  3F36 A;  4DZ0 A;  5AXS A;  1YUX A;  2Z6M A;  2Z5Q A;  2BKC A;  5FFB A;  3PVT B;  1XZ3 A;  4PG1 A;  4XKU A;  5D8Y A;  1T9P A;  3ES3 A;  3F35 A;  3F38 A;  2FL0 A;  1JRE A;  2G4H A;  1DX8 A;  3R2K A;  1Z6O A;  2YW6 A;  1T9O A;  4POF A;  4EVB A;  4KVQ A;  3R2L A;  1IU5 A;  5GU3 X;  1JI4 A;  2C2U A;  5GN8 B;  3SS2 A;  5I4J A;  4OYN A;  1KRQ A;  4DAS A;  3NP2 X;  3OGH A;  5HJH A;  1XZ1 A;  4II4 A;  4CVS A;  2ZG8 X;  2UX1 A;  3QHC A;  2MS3 A;  5FFA A;  3RZT A;  3E1O A;  1ZRP A;  3ISF A;  5D8O A;  1JIG A;  1RCD A;  3KA8 A;  2XJM A;  4POG A;  5JKL G;  8RXN A;  2ZA8 A;  4ZMC A;  4XKT A;  3E1P A;  3A44 A;  1UVH A;  2BK6 A;  2V2O A;  4TOG A;  1DVB A;  3UOF A;  4DYY A;  5LG8 A;  3GVY A;  4TOH A;  2YJK A;  4Z3B A;  3BVK A;  3FSE A;  4ME3 A;  1GWG A;  3AF9 X;  1HRS A;  5FFC A;  2OH3 A;  2WLA A;  3AF8 X;  3EZU A;  2VZB A;  3SH6 A;  4Z5S A;  1JKU A;  4TW3 A;  2GYD A;  4REU A;  4AR6 A;  1IU6 A;  2OC5 A;  4KVR A;  1RCI A;  3A68 A;  1B71 A;  2FG4 A;  1RDV A;  4CVR A;  1S2Z A;  4RC7 A;  3UOI A;  2VXI A;  3PWQ A;  5D8Q A;  1BCF A;  4RC5 A;  1R0F A;  1IRO A;  1O9R A;  2CF7 A;  4PGI A;  4RC6 A;  5LS9 A;  4KVS A;  4ZKW A;  3VNX A;  3E1N A;  3AJP A;  4ISM A;  4LYX A;  2RDV A;  1R0J A;  1MOJ A;  1R03 A;  4ETR A;  3Q4R A;  3BVL A;  2C2F A;  1BFY A;  4K9F A;  2KKD A;  5CZU A;  2V2J A;  2V2S A;  1F30 A;  3PZA A;  2FG8 A;  1SOF A;  3E6R A; 
#chains in the Genus database with same CATH topology
 3AK9 A;  3K35 A;  2CLB A;  5EIN C;  1H7V A;  2FFX J;  2VL6 A;  4B8C D;  1SMU A;  1SMW A;  2M4Y A;  3I4M L;  2JD6 0;  3EGM A;  5E2D A;  1IW7 D;  5JKM G;  3M3Y L;  1VEI A;  2A69 D;  3KYW A;  3KXU A;  1SMM A;  1O9I A;  1MFR A;  2V3B B;  4V19 6;  5J8S A;  1JGC A;  3HL1 A;  4LYU A;  4A3J L;  5C4J L;  4RC7 B;  3S2H L;  2JD8 0;  4ITW A;  3RBC A;  4JAD A;  4A3C L;  1L8I A;  3AJO A;  3TA8 A;  3R2S A;  3A9Q A;  4EVE A;  5D8S A;  5E1U A;  3HAX C;  3ERZ A;  3DBY A;  4DI0 A;  4RC6 B;  2CHP A;  1TJO A;  2AR0 A;  3SHX A;  3LWP B;  1RDG A;  4MUD A;  1IRN A;  1PFY A;  4PG0 A;  2JA5 L;  1NF4 A;  3MPS A;  1RYT A;  2Y3Q A;  4TOD A;  3LNL A;  4P18 A;  2X17 0;  3GGZ A;  4LHL A;  2PYB A;  2G38 B;  5JKL A;  3PIO 1;  3PWF A;  3PW1 B;  4G6B A;  2E2J L;  4MJY A;  4AHZ A;  3NFP I;  3PVR A;  3K7A L;  4WJG 4;  1VJX A;  2N02 A;  4ZL6 A;  2RBD A;  3RZD L;  5C3E L;  2WAQ P;  2RFK B;  4RC8 A;  3JZ9 A;  3SID A;  1J30 A;  3UFB A;  5JDO A;  1R0G A;  1ZUJ A;  3RZ6 A;  2ERS A;  3E6S A;  5EIO C;  2CLU A;  2JI3 A;  4CYB A;  1JI5 A;  1RYQ A;  4X0J A;  1PZX A;  4ZN1 B;  4M34 A;  4TPU A;  1Y1W L;  3PKJ A;  5GAH c;  1RCG A;  2YJJ A;  5GU2 X;  4TOE A;  4AM4 A;  3Q4N A;  2F7N A;  3RD0 A;  3PW8 A;  1P7P A;  4TVM A;  4R42 A;  1VZI A;  3BT5 A;  2JA8 L;  4ML5 A;  2AYJ A;  4LQN A;  3L0M A;  3IS7 A;  1WCM L;  4LHN A;  5MFP A;  3C1Y A;  3S16 L;  5LG2 A;  3H9C A;  4DYX A;  2XJN A;  2OKC A;  3R2M A;  3C23 A;  3H7G A;  2K2D A;  3U90 A;  5AI3 A;  2C6B A;  3PWQ C;  3JR7 A;  1BQ9 A;  2NYD A;  4IWJ A;  2XJT A;  2QL0 A;  1R9T L;  3KHK A;  5FEJ A;  3S1Q L;  3BVF A;  2CR8 A;  4RXN A;  4Y7N L;  2M6P A;  5IP9 L;  3KA3 A;  5J9V A;  3KA9 A;  5GAD c;  3E1J A;  3MSU A;  4JAF A;  4II4 B;  1TKO A;  2WTL A;  4MKU A;  3NP0 X;  4TOC A;  4AM2 A;  3BKN A;  4TOF A;  5FFD A;  2PVX A;  2WB1 P;  5GOU A;  1TKP A;  1FHM A;  1DAT A;  1QCV A;  4C3I L;  1F33 A;  3PVY A;  4QUW A;  1T9Q A;  3KA4 A;  2V0F A;  1PFW A;  1YUZ A;  5FFE A;  5ERJ A;  1VZH A;  1Z92 B;  2V2R A;  4XGH A;  4Y52 L;  2NVX L;  2CHI A;  3E1L A;  3GTG L;  1TWH L;  4BBS L;  1R0I A;  2CN6 A;  3KA6 A;  1QQT A;  5D8P A;  5CMR A;  3P8B A;  2IU2 A;  1B13 A;  2V2I A;  1B2O A;  2VUM L;  4ISP A;  4IXK A;  5JVH 1;  3FVB A;  2YW7 A;  1NXG A;  2C6A A;  2W0O A;  2O5J D;  3O7S A;  5K2M E;  2XJV A;  2GMG A;  3PVT A;  4M35 A;  1YK5 A;  3HIU A;  3F37 A;  3WVV A;  1TWA L;  3GE4 A;  1I6H L;  2GYQ A;  2JI1 A;  1LTL A;  2V2N A;  4YXM A;  4JAE A;  5IYB L;  2M6O A;  2JI2 A;  1S24 A;  7RXN A;  1Y1V L;  3B0A B;  3KYV A;  3O7R A;  4A3K L;  1BRF A;  3PVY B;  4LQJ A;  4BXX L;  2QF9 A;  2PPT A;  4AI1 A;  1BG7 A;  3QHB A;  3KDQ A;  2CN7 A;  3J7Y 1;  3WVW A;  3GTM L;  2NVQ L;  4Y08 A;  2BW1 A;  1Z4A A;  2GS4 A;  3QD8 A;  2C41 A;  3J7Z 1;  2CKC A;  3BVE A;  5HQO A;  4MN9 A;  4CVP A;  1NXE A;  4AYB P;  1YV1 A;  2Z5R A;  3KX9 A;  3HOU L;  4RC5 B;  4EVD A;  1IER A;  4ZJK A;  2E2H L;  1LKP A;  5MLC 3;  1N1Q A;  3WVU A;  3R2R A;  1AEW A;  4ZLW A;  4XXB B;  3VPB E;  3F39 A;  4ZN3 B;  2ZA6 A;  2VXX A;  5J8W A;  3ZG6 A;  2C2J A;  2CEI A;  3BVI A;  3PW8 C;  4LPN A;  3EZ0 A;  3GTQ L;  3SE1 A;  2L0Z A;  5FLM L;  1K83 L;  4YKH A;  2CKA A;  2ZA7 A;  1QYB A;  3PKI A;  5M3M L;  2FZF A;  2A6E D;  3WWN B;  2V2L A;  1RB9 A;  3LWR B;  2R93 L;  3S17 L;  5K53 A;  3FRS A;  1EUM A;  5JAC A;  3UNO A;  4U67 1;  2HVY C;  4E6K A;  4QIW P;  1NFV A;  3OJ5 A;  1VZG A;  1OTK A;  4DE6 A;  4M33 A;  3RYG A;  3KYU A;  1FHH A;  3WNW A;  3E2C A;  5IX6 A;  4DYU A;  1C09 A;  1PFV A;  5AI2 A;  4W4L B;  3RAV A;  2JA6 L;  3Q4O A;  2AQC A;  3M4O L;  4X6A L;  5C4X L;  3E1Q A;  2LCQ A;  5CMQ A;  1L8H A;  3KYY A;  3LWV B;  3N6O A;  1LKO A;  5ERK A;  3FDJ A;  3H99 A;  3AK8 A;  5GAG c;  1R0H A;  3RGD A;  4AR3 A;  3GHQ A;  1QGH A;  2E2I L;  2BE5 D;  3R2O A;  2EY4 E;  4YXJ A;  1OWB A;  1WJV A;  4TO9 A;  3H9B A;  5D8R A;  3LPE B;  3Q4Q A;  2HTN A;  2PMZ P;  4XGS A;  1UMN A;  2ERJ A;  3AJQ A;  3NOZ X;  5RXN A;  4CY9 A;  5AN9 H;  1BQ8 A;  6RXN A;  3C21 A;  4W4K B;  2FKZ A;  3PVR B;  2FJC A;  1DPS A;  5D8X A;  2C6R A;  1NF6 A;  4PGK A;  4TOB A;  4BBR L;  3H0G L;  4A3M L;  2MGY A;  3T9J A;  2B63 L;  1LB3 A;  5K52 A;  2ITB A;  5JDO B;  2DSX A;  5LBH A;  4LQH A;  3R2H A;  4AR5 A;  3HJY B;  4ZL5 A;  4UY8 1;  2A68 D;  3KYX A;  3AF7 X;  4AR4 A;  4CYA A;  4YWM A;  3ISE A;  5FJ8 L;  5C6F A;  5DM6 1;  5GU0 X;  2HR5 A;  3QVD A;  2ZG9 X;  3LWO B;  5J93 A;  1JKV A;  3PL5 A;  1VCX A;  1S30 A;  1B2J A;  4LPJ A;  4YWL A;  4IWK A;  1BFR A;  1TWF L;  4A3E L;  4ITT A;  2NVY L;  2WWX B;  5IP7 L;  2D5K A;  4CMY A;  2PYA A;  4EVC A;  1VLG A;  4C3H L;  1BE7 A;  4AHW A;  1E8J A;  3CQZ L;  2Z5P A;  2XJO A;  3FRR A;  4XKS A;  3V3K B;  5MFZ A;  2IB0 A;  2Z90 A;  4A3I L;  2JD7 0;  3HOW L;  5JKM A;  1FHA A;  3MQK B;  2V15 A;  2R7Z L;  4BY1 L;  3GTL L;  1NNQ A;  4ZKH A;  3GTJ L;  3S2D L;  4CVT A;  4CMY V;  3E1M A;  1SQ3 A;  3GGY A;  5GU1 X;  4ZTT A;  3F34 A;  4LPM A;  1RWD A;  3F32 A;  1YK4 A;  3QZ3 A;  3RE7 A;  2WLU A;  5IY0 A;  3QB9 A;  1Z6O M;  3VVA A;  2FHA A;  1RCE A;  1S3Q A;  1TK6 A;  3IS8 A;  2IY4 A;  2QQY A;  4ERU A;  3HOX L;  4AM5 A;  4MY7 A;  2KN9 A;  4E40 A;  4ZKX A;  2XKQ A;  3I4N L;  3D19 A;  1ODH A;  1JTS A;  1CAA A;  4LQV A;  5GN8 A;  4A25 A;  3F33 A;  1VEQ A;  2CIH A;  2ZUR X;  1ZS3 A;  3PW1 A;  4M32 A;  5H1S c;  2YU9 L;  5HJF A;  2XGW A;  1LKM A;  3KWO A;  2Z3R B;  4TOA A;  5C44 L;  3FI6 A;  5JVG 1;  3IQ1 A;  4DYZ A;  1H96 A;  1JYB A;  1RCC A;  2PVE A;  3GTK L;  2V2P A;  2V8T A;  1IES A;  2BJY A;  1VEL A;  2ZG7 X;  2V2M A;  4U3G A;  5M5W L;  5M3F L;  2XJP A;  1TWC L;  1CAD A;  3F36 A;  4DZ0 A;  4GS7 D;  1PFU A;  5AXS A;  1YUX A;  3HOV L;  2Z6M A;  4WFN 1;  2Z5Q A;  2BKC A;  5FFB A;  3PVT B;  2Y44 A;  1XZ3 A;  4PG1 A;  4XKU A;  3W54 A;  2Z3Q B;  2V0E A;  4KXR B;  4A93 L;  5D8Y A;  3S14 L;  1T9P A;  3ES3 A;  3F35 A;  3F38 A;  2FL0 A;  1JRE A;  2NVT L;  2G4H A;  1DX8 A;  1OWC A;  3S15 L;  3R2K A;  1Z6O A;  2YW6 A;  1T9O A;  4POF A;  4EVB A;  4KVQ A;  3R2L A;  1IU5 A;  5GU3 X;  3HOZ L;  4MXP A;  1JI4 A;  2C2U A;  5GN8 B;  3SS2 A;  5I4J A;  4AI3 A;  3JZA B;  4OYN A;  1KRQ A;  1SFO L;  4DAS A;  4C2M 1;  3NP2 X;  3C1Z A;  3OGH A;  5HJH A;  5IYC L;  1XZ1 A;  2PSM C;  4II4 A;  4CVS A;  3H3V M;  2ZG8 X;  4AHY A;  2UX1 A;  5M5X L;  3QHC A;  2AUS B;  5FFA A;  2MS3 A;  3RZT A;  4AHX A;  3E1O A;  1ZRP A;  3ISF A;  5D8O A;  1TWG L;  1JIG A;  1RCD A;  5DM7 1;  3GTO L;  5IYD L;  3KA8 A;  2XJM A;  1F4L A;  3HKZ P;  4POG A;  5JKL G;  8RXN A;  2ZA8 A;  4ZMC A;  3S1M L;  4XKT A;  2J9U B;  4A3G L;  3E1P A;  2A6H D;  3A44 A;  3M6J A;  3LWQ B;  1UVH A;  2BK6 A;  5HU6 D;  2V2O A;  4TOG A;  1DVB A;  3UOF A;  4DYY A;  5LG8 A;  3B08 B;  4A3F L;  4AI2 A;  5GAE c;  3WWL A;  3GVY A;  3GTP L;  4A3D L;  2XJR A;  4TOH A;  2YJK A;  4Z3B A;  3BVK A;  2XJU A;  3FSE A;  4ME3 A;  5MGN A;  1GWG A;  3HOY L;  3AF9 X;  1HRS A;  5FFC A;  2OH3 A;  2B5I D;  4BY7 L;  2WLA A;  3AF8 X;  3EZU A;  3PIP 1;  3IU3 I;  5M5Y L;  4JAG A;  2VZB A;  3SH6 A;  4AI0 A;  4Z5S A;  1I3Q L;  2JA7 L;  1JKU A;  3VV9 A;  2R92 L;  4TW3 A;  3HJW B;  2GYD A;  4REU A;  4AR6 A;  3S1R L;  1IU6 A;  5MF6 A;  2OC5 A;  4KVR A;  2XJQ A;  1RCI A;  2XJS A;  3A68 A;  3LKD A;  1B71 A;  2V8U A;  2APO B;  2FG4 A;  1RDV A;  4CVR A;  1S2Z A;  4RC7 A;  2H12 A;  3UOI A;  3QQC E;  2VXI A;  3PWQ A;  3PO2 L;  4A3B L;  5D8Q A;  1BCF A;  3H97 A;  4RC5 A;  1R0F A;  1IRO A;  1O9R A;  2CF7 A;  4YVZ A;  4PGI A;  4RC6 A;  5LS9 A;  4KVS A;  4ZKW A;  3VNX A;  3E1N A;  3FKI L;  3AJP A;  4ISM A;  4LYX A;  2M4V A;  2RDV A;  3S1N L;  1R0J A;  4A3L L;  3P2A A;  1MOJ A;  2Y0S P;  1R03 A;  2ZIX A;  4ETR A;  3Q4R A;  3BVL A;  2C2F A;  1BFY A;  4K9F A;  4C3J L;  3PO3 L;  2KKD A;  5CZU A;  2V2J A;  2V2S A;  1F30 A;  4E6Y A;  3RZO L;  3PZA A;  2FG8 A;  1I50 L;  1SOF A;  2CWL A;  3E6R A; 
#chains in the Genus database with same CATH homology
 3AK9 A;  3K35 A;  2CLB A;  5EIN C;  1H7V A;  2FFX J;  2VL6 A;  4B8C D;  1SMU A;  1SMW A;  2M4Y A;  2JD6 0;  3EGM A;  5E2D A;  1IW7 D;  5JKM G;  1VEI A;  2A69 D;  3KYW A;  3KXU A;  1SMM A;  1O9I A;  1MFR A;  2V3B B;  4V19 6;  5J8S A;  1JGC A;  3HL1 A;  4LYU A;  4RC7 B;  2JD8 0;  4ITW A;  3RBC A;  4JAD A;  1L8I A;  3AJO A;  3TA8 A;  3R2S A;  3A9Q A;  4EVE A;  5D8S A;  5E1U A;  3ERZ A;  3DBY A;  4DI0 A;  4RC6 B;  2CHP A;  1TJO A;  2AR0 A;  3SHX A;  1RDG A;  4MUD A;  1IRN A;  4PG0 A;  1NF4 A;  3MPS A;  1RYT A;  2Y3Q A;  4TOD A;  3LNL A;  4P18 A;  2X17 0;  3GGZ A;  4LHL A;  2PYB A;  2G38 B;  5JKL A;  3PIO 1;  3PWF A;  3PW1 B;  4G6B A;  4MJY A;  4AHZ A;  3NFP I;  3PVR A;  4WJG 4;  1VJX A;  2N02 A;  4ZL6 A;  2RBD A;  4RC8 A;  3JZ9 A;  3SID A;  1J30 A;  3UFB A;  5JDO A;  1R0G A;  1ZUJ A;  3RZ6 A;  2ERS A;  3E6S A;  5EIO C;  2CLU A;  2JI3 A;  4CYB A;  1JI5 A;  1RYQ A;  4X0J A;  4ZN1 B;  4M34 A;  4TPU A;  3PKJ A;  5GAH c;  1RCG A;  2YJJ A;  5GU2 X;  4TOE A;  4AM4 A;  3Q4N A;  2F7N A;  3RD0 A;  3PW8 A;  4TVM A;  4R42 A;  1VZI A;  3BT5 A;  4ML5 A;  2AYJ A;  4LQN A;  3L0M A;  3IS7 A;  4LHN A;  5MFP A;  3C1Y A;  5LG2 A;  4DYX A;  2XJN A;  2OKC A;  3R2M A;  3C23 A;  3H7G A;  2K2D A;  3U90 A;  5AI3 A;  2C6B A;  3PWQ C;  1BQ9 A;  2NYD A;  4IWJ A;  2XJT A;  2QL0 A;  3KHK A;  5FEJ A;  3BVF A;  2CR8 A;  4RXN A;  2M6P A;  3KA3 A;  5J9V A;  3KA9 A;  5GAD c;  3E1J A;  3MSU A;  4JAF A;  4II4 B;  1TKO A;  2WTL A;  4MKU A;  3NP0 X;  4TOC A;  4AM2 A;  3BKN A;  4TOF A;  5FFD A;  2PVX A;  5GOU A;  1TKP A;  1FHM A;  1DAT A;  1QCV A;  1F33 A;  3PVY A;  4QUW A;  1T9Q A;  3KA4 A;  2V0F A;  1YUZ A;  5FFE A;  5ERJ A;  1VZH A;  1Z92 B;  2V2R A;  4XGH A;  2CHI A;  3E1L A;  1R0I A;  2CN6 A;  3KA6 A;  5D8P A;  5CMR A;  3P8B A;  2IU2 A;  1B13 A;  2V2I A;  1B2O A;  4ISP A;  4IXK A;  5JVH 1;  3FVB A;  2YW7 A;  1NXG A;  2C6A A;  2W0O A;  2O5J D;  3O7S A;  5K2M E;  2XJV A;  2GMG A;  3PVT A;  4M35 A;  1YK5 A;  3HIU A;  3F37 A;  3WVV A;  3GE4 A;  2GYQ A;  2JI1 A;  1LTL A;  2V2N A;  4YXM A;  4JAE A;  2M6O A;  2JI2 A;  1S24 A;  7RXN A;  3B0A B;  3KYV A;  3O7R A;  1BRF A;  3PVY B;  4LQJ A;  2QF9 A;  2PPT A;  4AI1 A;  1BG7 A;  3QHB A;  3KDQ A;  2CN7 A;  3J7Y 1;  3WVW A;  4Y08 A;  2BW1 A;  1Z4A A;  2GS4 A;  3QD8 A;  2C41 A;  3J7Z 1;  2CKC A;  3BVE A;  5HQO A;  4MN9 A;  4CVP A;  1NXE A;  1YV1 A;  2Z5R A;  3KX9 A;  4RC5 B;  4EVD A;  1IER A;  4ZJK A;  1LKP A;  5MLC 3;  1N1Q A;  3WVU A;  3R2R A;  1AEW A;  4ZLW A;  4XXB B;  3VPB E;  3F39 A;  4ZN3 B;  2ZA6 A;  2VXX A;  5J8W A;  3ZG6 A;  2C2J A;  2CEI A;  3BVI A;  3PW8 C;  4LPN A;  3EZ0 A;  3SE1 A;  2L0Z A;  4YKH A;  2CKA A;  2ZA7 A;  1QYB A;  3PKI A;  2FZF A;  2A6E D;  3WWN B;  2V2L A;  1RB9 A;  5K53 A;  3FRS A;  1EUM A;  5JAC A;  3UNO A;  4U67 1;  4E6K A;  1NFV A;  3OJ5 A;  1VZG A;  1OTK A;  4DE6 A;  4M33 A;  3RYG A;  3KYU A;  1FHH A;  3WNW A;  3E2C A;  5IX6 A;  4DYU A;  1C09 A;  5AI2 A;  4W4L B;  3RAV A;  3Q4O A;  3E1Q A;  2LCQ A;  5CMQ A;  1L8H A;  3KYY A;  3N6O A;  1LKO A;  5ERK A;  3AK8 A;  5GAG c;  1R0H A;  3RGD A;  4AR3 A;  3GHQ A;  1QGH A;  2BE5 D;  3R2O A;  4YXJ A;  1OWB A;  1WJV A;  4TO9 A;  5D8R A;  3LPE B;  3Q4Q A;  2HTN A;  4XGS A;  1UMN A;  2ERJ A;  3AJQ A;  3NOZ X;  5RXN A;  4CY9 A;  5AN9 H;  1BQ8 A;  6RXN A;  3C21 A;  4W4K B;  2FKZ A;  3PVR B;  2FJC A;  1DPS A;  5D8X A;  2C6R A;  1NF6 A;  4PGK A;  4TOB A;  2MGY A;  3T9J A;  1LB3 A;  5K52 A;  2ITB A;  5JDO B;  2DSX A;  5LBH A;  4LQH A;  3R2H A;  4AR5 A;  4ZL5 A;  4UY8 1;  2A68 D;  3KYX A;  3AF7 X;  4AR4 A;  4CYA A;  4YWM A;  3ISE A;  5C6F A;  5DM6 1;  5GU0 X;  2HR5 A;  3QVD A;  2ZG9 X;  5J93 A;  1JKV A;  1VCX A;  1S30 A;  1B2J A;  4LPJ A;  4YWL A;  4IWK A;  1BFR A;  4ITT A;  2WWX B;  2D5K A;  4CMY A;  2PYA A;  4EVC A;  1VLG A;  1E8J A;  1BE7 A;  4AHW A;  2Z5P A;  2XJO A;  3FRR A;  4XKS A;  3V3K B;  5MFZ A;  2IB0 A;  2Z90 A;  2JD7 0;  5JKM A;  1FHA A;  2V15 A;  1NNQ A;  4ZKH A;  4CVT A;  4CMY V;  3E1M A;  1SQ3 A;  3GGY A;  5GU1 X;  4ZTT A;  3F34 A;  4LPM A;  1RWD A;  3F32 A;  1YK4 A;  3QZ3 A;  3RE7 A;  2WLU A;  5IY0 A;  3QB9 A;  1Z6O M;  3VVA A;  2FHA A;  1RCE A;  1S3Q A;  1TK6 A;  3IS8 A;  2IY4 A;  2QQY A;  4ERU A;  4AM5 A;  4MY7 A;  2KN9 A;  4E40 A;  4ZKX A;  2XKQ A;  3D19 A;  1ODH A;  1JTS A;  1CAA A;  4LQV A;  5GN8 A;  4A25 A;  3F33 A;  1VEQ A;  2CIH A;  2ZUR X;  1ZS3 A;  3PW1 A;  4M32 A;  5H1S c;  5HJF A;  2XGW A;  1LKM A;  3KWO A;  2Z3R B;  4TOA A;  3FI6 A;  5JVG 1;  3IQ1 A;  4DYZ A;  1H96 A;  1JYB A;  1RCC A;  2PVE A;  2V2P A;  2V8T A;  1IES A;  2BJY A;  1VEL A;  2ZG7 X;  2V2M A;  4U3G A;  2XJP A;  1CAD A;  3F36 A;  4DZ0 A;  4GS7 D;  5AXS A;  1YUX A;  2Z6M A;  4WFN 1;  2Z5Q A;  2BKC A;  5FFB A;  3PVT B;  2Y44 A;  1XZ3 A;  4PG1 A;  4XKU A;  3W54 A;  2Z3Q B;  2V0E A;  4KXR B;  5D8Y A;  1T9P A;  3ES3 A;  3F35 A;  3F38 A;  2FL0 A;  1JRE A;  2G4H A;  1DX8 A;  1OWC A;  3R2K A;  1Z6O A;  2YW6 A;  1T9O A;  4POF A;  4EVB A;  4KVQ A;  3R2L A;  1IU5 A;  5GU3 X;  4MXP A;  1JI4 A;  2C2U A;  5GN8 B;  3SS2 A;  5I4J A;  4AI3 A;  3JZA B;  4OYN A;  1KRQ A;  4DAS A;  3NP2 X;  3C1Z A;  3OGH A;  5HJH A;  1XZ1 A;  2PSM C;  4II4 A;  4CVS A;  2ZG8 X;  4AHY A;  2UX1 A;  3QHC A;  2MS3 A;  5FFA A;  3RZT A;  4AHX A;  3E1O A;  1ZRP A;  3ISF A;  5D8O A;  5DM7 1;  1JIG A;  1RCD A;  3KA8 A;  2XJM A;  4POG A;  5JKL G;  8RXN A;  2ZA8 A;  4ZMC A;  4XKT A;  2J9U B;  3E1P A;  2A6H D;  3A44 A;  3M6J A;  1UVH A;  2BK6 A;  5HU6 D;  2V2O A;  4TOG A;  1DVB A;  3UOF A;  4DYY A;  5LG8 A;  3B08 B;  4AI2 A;  5GAE c;  3WWL A;  3GVY A;  2XJR A;  4TOH A;  2YJK A;  4Z3B A;  3BVK A;  2XJU A;  3FSE A;  4ME3 A;  5MGN A;  1GWG A;  3AF9 X;  1HRS A;  5FFC A;  2OH3 A;  2B5I D;  2WLA A;  3AF8 X;  3EZU A;  3PIP 1;  3IU3 I;  4JAG A;  2VZB A;  3SH6 A;  4AI0 A;  4Z5S A;  1JKU A;  3VV9 A;  4TW3 A;  2GYD A;  4REU A;  4AR6 A;  1IU6 A;  5MF6 A;  2OC5 A;  4KVR A;  2XJQ A;  1RCI A;  2XJS A;  3A68 A;  3LKD A;  1B71 A;  2V8U A;  2FG4 A;  1RDV A;  4CVR A;  1S2Z A;  4RC7 A;  2H12 A;  3UOI A;  3QQC E;  2VXI A;  3PWQ A;  5D8Q A;  1BCF A;  4RC5 A;  1R0F A;  1IRO A;  1O9R A;  2CF7 A;  4YVZ A;  4PGI A;  4RC6 A;  5LS9 A;  4KVS A;  4ZKW A;  3VNX A;  3E1N A;  3AJP A;  4ISM A;  4LYX A;  2M4V A;  2RDV A;  1R0J A;  3P2A A;  1MOJ A;  1R03 A;  2ZIX A;  4ETR A;  3Q4R A;  3BVL A;  2C2F A;  1BFY A;  4K9F A;  2KKD A;  5CZU A;  2V2J A;  2V2S A;  1F30 A;  4E6Y A;  3PZA A;  2FG8 A;  1SOF A;  2CWL A;  3E6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...