1YUZA

Partially reduced state of nigerythrin
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
202
structure length
200
Chain Sequence
MKVRAQVPTVKNATNFNMVADSKTAVGSTLENLKAAIAGETGAHAKYTAFAKAAREQGYEQIARLFEATAAAELIHIGLEYALVAEMEPGYEKPTVPSAYSCDLNLISGANGEIYETSDMYPAFIRKAQEEGNSKAVHVFTRAKLAESVHAERYLAAYNDIDAPDDDKFHLCPICGYIHKGEDFEKCPICFRPKDTFTAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nigerythrin
publication title High-resolution crystal structures of Desulfovibrio vulgaris (Hildenborough) nigerythrin: facile, redox-dependent iron movement, domain interface variability, and peroxidase activity in the rubrerythrins.
pubmed doi rcsb
source organism Desulfovibrio vulgaris subsp. vulgaris
molecule tags Oxidoreductase
total genus 68
structure length 200
sequence length 202
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02915 Rubrerythrin Rubrerythrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 1yuzA01
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 1yuzA02
1RB9A 3F35A 2WLUA 2M4YA 2Z5PA 2PVXA 4YWMA 1BCFA 1R0GA 2V2RA 2V2PA 2JD60 3ERZA 5JKMG 5RXNA 2V2LA 1MOJA 3R2SA 4LQNA 3RGDA 1BQ9A 4CY9A 2XJOA 5D8PA 4REUA 4CYAA 3R2KA 3SH6A 5D8OA 4AR6A 3F38A 1QYBA 4TOFA 1R0IA 4U3GA 3E2CA 2ZG7X 1RWDA 2Y3QA 1F30A 1TKPA 5GOUA 2C41A 4ZJKA 4LPNA 5FFCA 1BE7A 2YJJA 1YV1A 3E1OA 4DYXA 3PW1A 3SS2A 1NFVA 4MUDA 3QD8A 3PW8A 4CMYV 3PVRA 3QB9A 4POFA 3E1QA 4TPUA 3F32A 3AJOA 1JYBA 4MY7A 3EZ0A 5CZUA 3A44A 2CHPA 1L8HA 1EUMA 4QUWA 5ERJA 4RC7B 2PYAA 1TKOA 3ISEA 1HRSA 2YJKA 3UOFA 5K53A 1LKMA 2QF9A 3ES3A 2QQYA 1O9RA 4XGSA 1QGHA 1IU6A 3O7RA 3KA3A 4PGIA 3GHQA 3QVDA 3E1PA 4II4B 1IU5A 4ME3A 3QZ3A 3SE1A 3IS7A 4XKSA 3AJPA 5AXSA 1JI4A 4XKTA 4YWLA 2UX1A 2FJCA 2Z5QA 1FHMA 5HJHA 2CIHA 4YKHA 3QHBA 4EVCA 5K52A 4CVSA 2BJYA 1OTKA 5IX6A 1FHHA 2XKQA 3RZTA 4ZL6A 5E1UA 2V2JA 3HIUA 3KYUA 5HQOA 1JKVA 1VJXA 4MN9A 1SOFA 3KX9A 1JI5A 1R0JA 5D8RA 1IERA 2V2NA 4TOGA 2RDVA 2CHIA 3E6RA 2V2MA 5D8XA 2BKCA 4ZTTA 2OC5A 1SMMA 3RZ6A 3BVFA 2OH3A 3IS8A 3AF7X 4RC6A 3BVIA 5D8SA 4EVEA 3AK8A 2FL0A 1SMWA 4K9FA 5GN8B 1B2OA 2D5KA 3KXUA 2HR5A 1FHAA 3GE4A 2VL6A 4CVPA 1NF4A 3R2MA 3F39A 2Z6MA 4DYUA 4KVQA 3H7GA 4TOAA 1ZRPA 2LCQA 4M34A 1JTSA 4TOCA 5C6FA 3OJ5A 3PW8C 4MJYA 3VNXA 1RCIA 4M35A 3R2OA 1RCCA 3HL1A 3FI6A 4ETRA 2XJMA 5D8QA 3UNOA 4AR5A 2KN9A 2WTLA 2G4HA 2QL0A 3Q4NA 1BRFA 1CAAA 3NP2X 3FSEA 1S3QA 4RC5A 2ZG9X 4DZ0A 5E2DA 5GU0X 3WVUA 3F36A 4IXKA 1RDGA 4AM4A 3PWQA 2F7NA 4E6KA 3SHXA 3WNWA 1Z6OA 4OYNA 1JKUA 2C2FA 3E1JA 3PW1B 2GYDA 2K2DA 2KKDA 4DYYA 2C2JA 2FG8A 1BG7A 3PVRB 2ZA6A 1C09A 2PVEA 1IRNA 1JREA 1NF6A 5JACA 3BKNA 4IWJA 4RC7A 1R0FA 3MPSA 4P18A 1VELA 5CMQA 3KWOA 8RXNA 3UOIA 4ZMCA 3QHCA 3F37A 2JD80 4DYZA 2WLAA 2FKZA 2V2SA 2CEIA 1UVHA 2CLBA 4Z3BA 2C6RA 4TO9A 2IB0A 2VZBA 4AM5A 1Z4AA 5GU3X 1T9QA 1IESA 2ZA8A 5JKMA 4TOHA 4DI0A 1J30A 1UMNA 5ERKA 3T9JA 4ITWA 3RBCA 1VCXA 3ISFA 4EVBA 3R2RA 1R03A 3PVYA 1QCVA 1S30A 2ZURX 4ZKWA 1JGCA 5J9VA 4ZLWA 1LTLA 3Q4RA 4LQVA 3BVLA 4TW3A 3RAVA 1T9OA 3KYYA 2PYBA 2IY4A 3R2HA 1B71A 4ITTA 3IQ1A 3PVTA 2CLUA 2X170 3FVBA 1H7VA 2CN6A 4EVDA 1ZUJA 4RXNA 1O9IA 4LQJA 3E1MA 5FFDA 2VXIA 1L8IA 5FFAA 4AM2A 3Q4QA 1JIGA 4POGA 2VXXA 2ZA7A 2V2IA 3NP0X 2JD70 5GU1X 4CVTA 5AI2A 2Z90A 2GYQA 3A68A 4ZKHA 3F33A 5FEJA 4XKUA 3RYGA 3KA6A 2V2OA 3KA4A 4LQHA 5GN8A 5FFBA 5HJFA 1H96A 1KRQA 2V15A 3RE7A 4CMYA 1YK4A 1MFRA 1YUZA 1Z6OM 4ML5A 1RYTA 1YK5A 4ISPA 4KVSA 3KYWA 5LG2A 3PWQC 3WVVA 1S24A 4ZL5A 1YUXA 3BVKA 5LS9A 1DATA 4MKUA 1RCGA 3KA9A 5I4JA 3E6SA 4TODA 4ERUA 1VLGA 3KYXA 1GWGA 2RBDA 2ZG8X 4PG0A 2XJNA 5D8YA 2C2UA 4PG1A 5LG8A 3AJQA 2Z5RA 3GVYA 3KYVA 3R2LA 2FG4A 2FHAA 4IWKA 2ITBA 4RC5B 1F33A 1VEIA 4TOEA 4AR3A 1NNQA 1LB3A 4M33A 5IY0A 7RXNA 4RC8A 2V3BB 4PGKA 3RD0A 3NOZX 5FFEA 2DSXA 3F34A 5GU2X 5JKLA 4Z5SA 2BK6A 3PZAA 5CMRA 3SIDA 3AF9X 1RCDA 3Q4OA 2W0OA 1ZS3A 1T9PA 5J8WA 4II4A 2CF7A 3O7SA 2HTNA 5AI3A 1R0HA 1VEQA 4M32A 5LBHA 4CVRA 3KA8A 1RDVA 3WVWA 3BT5A 1DX8A 4DASA 1LKPA 1RCEA 3AF8X 1XZ1A 5J8SA 5J93A 3E1LA 2FFXJ 4LYUA 1TJOA 3PVYB 2GS4A 3EGMA 1LKOA 4Y08A 1E8JA 1AEWA 4CYBA 4ZKXA 1SQ3A 3BVEA 1CADA 3U90A 4AR4A 1TK6A 4R42A 3AK9A 3A9QA 1BQ8A 4TOBA 1S2ZA 2FZFA 3PVTB 3EZUA 4LYXA 3TA8A 4LPMA 1DVBA 1IROA 3PWFA 1SMUA 2YW6A 6RXNA 3OGHA 2MS3A 2CN7A 1N1QA 2GMGA 4RC6B 4ISMA 1XZ3A 1B2JA 1DPSA 4DE6A 4A25A 1BFRA 2YW7A 4KVRA 4LPJA 1B13A 5JKLG 2IU2A 3E1NA 1BFYA 2XGWA 2BW1A
chains in the Genus database with same CATH superfamily
1RB9A 3F35A 2WLUA 2M4YA 4AHYA 2Z5PA 2PVXA 4YWMA 1BCFA 1R0GA 2V2RA 2V2PA 2JD60 3ERZA 2WB1P 5JKMG 5RXNA 2V2LA 1MOJA 4W4LB 3R2SA 1VZHA 3FRSA 4LQNA 1TWAL 1TWHL 3H99A 3RGDA 1BQ9A 4G6BA 4CY9A 3LWVB 2XJOA 5D8PA 4REUA 4CYAA 5M5YL 1BFYA 3R2KA 3SH6A 5D8OA 4AR6A 3F38A 1QYBA 4TOFA 1R0IA 4Y7NL 3NFPI 4U3GA 3E2CA 2ZG7X 3HOYL 1RYQA 1RWDA 2WAQP 2Y3QA 2J9UB 1F30A 3JZAB 1TKPA 3M6JA 2MGYA 5GOUA 4YXJA 5GAGc 1I50L 2C41A 3VV9A 4ZJKA 4LPNA 1OWBA 2B63L 5FFCA 1BE7A 2YJJA 1YV1A 3E1OA 4DYXA 3VPBE 3PW1A 3SS2A 1NFVA 4MUDA 2R93L 3K35A 3QD8A 3PW8A 4CMYV 3PVRA 3QB9A 5DM71 4POFA 3E1QA 3C1YA 4TPUA 3F32A 3H9BA 3AJOA 2VUML 1JYBA 4MY7A 3EZ0A 5CZUA 3A44A 1Y1VL 2CHPA 4BXXL 4AYBP 1L8HA 1EUMA 4QUWA 4YXMA 4JAGA 5ERJA 4RC7B 1NXGA 3KHKA 2PYAA 2HVYC 1TKOA 4A3FL 1TWCL 3ISEA 2XJVA 1HRSA 2YJKA 3UOFA 5K53A 1LKMA 2QF9A 3ES3A 2QQYA 5C4XL 3M4OL 2ZIXA 2NVXL 1O9RA 4XGSA 4C2M1 1QGHA 1IU6A 1VZGA 3O7RA 3KA3A 4PGIA 3GHQA 3QVDA 3E1PA 4II4B 1IU5A 2CR8A 4ME3A 3QZ3A 1SFOL 3SE1A 3IS7A 4XKSA 3AJPA 5AXSA 1JI4A 4XKTA 4YWLA 3HKZP 2V8UA 2JI1A 2UX1A 1I3QL 3J7Z1 3S2HL 2FJCA 2Z5QA 4V196 2JA7L 1FHMA 5GAHc 2M4VA 5HJHA 3S1RL 2CIHA 4YKHA 3QHBA 4EVCA 4GS7D 5K52A 4CVSA 2JI3A 5JVG1 2BJYA 3W54A 1OTKA 4BBSL 5IX6A 1FHHA 3LPEB 3JZ9A 2XKQA 3RZTA 4ZL6A 5E1UA 2V2JA 3HIUA 3KYUA 3JR7A 5HQOA 1JKVA 1VJXA 4MN9A 1SOFA 3KX9A 1JI5A 1R0JA 5D8RA 1IERA 5DM61 3LWOB 4KXRB 2V2NA 4TOGA 5C3EL 2RDVA 2CHIA 3E6RA 2V2MA 5D8XA 2BKCA 1F4LA 4ZTTA 5MF6A 3K7AL 2V8TA 2OC5A 1SMMA 3RZ6A 3C21A 3BVFA 3WWNB 2OH3A 5MGNA 3IS8A 4AHXA 3AF7X 1QQTA 4RC6A 3BVIA 1NXEA 4B8CD 5D8SA 4EVEA 5JDOB 1Z92B 3AK8A 2FL0A 1SMWA 4K9FA 5GN8B 1B2OA 2D5KA 3KXUA 2HR5A 1FHAA 3GE4A 2VL6A 4CVPA 1NF4A 3R2MA 3F39A 5EINC 2Z6MA 2RFKB 3QQCE 4DYUA 4KVQA 3H7GA 3FDJA 4TOAA 1ZRPA 2LCQA 4MXPA 3GTQL 3S1NL 2JA5L 4M34A 1JTSA 4TOCA 5C6FA 2NVTL 4AI1A 3OJ5A 5AI2A 3HOWL 3PW8C 4MJYA 3VNXA 3PKJA 4A3LL 5MFPA 1RCIA 2A6HD 4M35A 3R2OA 4JAEA 1RCCA 5IP7L 4Y52L 3HL1A 3FI6A 4ETRA 4WFN1 4W4KB 2XJMA 2CWLA 5D8QA 3GTOL 3UNOA 4AR5A 4A3EL 2KN9A 2WTLA 3D19A 2G4HA 2QL0A 3Q4NA 5H1Sc 1BRFA 1CAAA 1PFYA 3NP2X 3FSEA 2JA6L 1S3QA 4RC5A 2ZG9X 4DZ0A 3IU3I 3S16L 5E2DA 5GU0X 3WVUA 2M6PA 3F36A 4IXKA 1RDGA 4A3IL 2ERSA 4AM4A 2AQCA 3PWQA 2F7NA 2PSMC 4E6KA 3SHXA 3WNWA 4BBRL 1Z6OA 4OYNA 1JKUA 2C2FA 3E1JA 3PW1B 2GYDA 3DBYA 2K2DA 2KKDA 2A69D 4DYYA 3ZG6A 2E2HL 2AUSB 2C2JA 2XJQA 3L0MA 5K2ME 2FG8A 1BG7A 3PVRB 2ZA6A 1C09A 2PVEA 1IRNA 1JREA 1NF6A 4AHWA 5JACA 3BKNA 5M5WL 4IWJA 4RC7A 1R0FA 3MPSA 4P18A 2XJRA 1VELA 5CMQA 3KWOA 8RXNA 3UOIA 4ZMCA 3HJYB 3QHCA 3F37A 2JD80 4DYZA 2WLAA 4LHNA 2FKZA 2V2SA 2CEIA 4BY7L 1UVHA 4JADA 2CLBA 4YVZA 4Z3BA 2C6RA 4TO9A 2IB0A 2VZBA 3LKDA 4AM5A 5IYCL 1Z4AA 5GU3X 1T9QA 1IESA 2ZA8A 5JKMA 2R92L 4UY81 4TOHA 4DI0A 1OWCA 1TWFL 1J30A 1UMNA 3PKIA 5ERKA 3T9JA 4A3KL 4ITWA 3RBCA 1VCXA 3ISFA 4EVBA 3R2RA 3VVAA 1R03A 3PVYA 3V3KB 1QCVA 1S30A 2ZURX 4ZKWA 1JGCA 5J9VA 1WCML 4E6YA 4ZLWA 1LTLA 2Y0SP 3Q4RA 4LQVA 3H9CA 3BVLA 4TW3A 1PFWA 3RAVA 4C3JL 1T9OA 2A6ED 3KYYA 2PYBA 2IY4A 3R2HA 1B71A 4ITTA 4X6AL 3IQ1A 3PVTA 2PPTA 2CLUA 3PO3L 2X170 3HAXC 3FVBA 1H7VA 2CN6A 2WWXB 4EVDA 1ZUJA 3S14L 4X0JA 4A3DL 4RXNA 1O9IA 4LQJA 1IW7D 3E1MA 5JVH1 2V0EA 5FFDA 2VXIA 1L8IA 4A3ML 5FFAA 4AM2A 5C4JL 2Y44A 4E40A 3PO2L 3Q4QA 1JIGA 3S2DL 4POGA 2VXXA 5MFZA 2BE5D 2ZA7A 4TVMA 2V2IA 3NP0X 2JD70 5GU1X 4CVTA 1PFUA 2Z90A 2GYQA 3A68A 4ZKHA 3F33A 5FEJA 4XKUA 5JDOA 3KA6A 3CQZL 2V2OA 3KA4A 4LQHA 3HOZL 5GN8A 1Y1WL 4A3JL 5FFBA 5HJFA 1H96A 3RZDL 3PIO1 1KRQA 2V15A 3RE7A 4CMYA 1YK4A 4U671 3S17L 2H12A 4ZN3B 3GTLL 1MFRA 3M3YL 1YUZA 1Z6OM 4ML5A 1RYTA 1YK5A 5IYDL 4ISPA 4JAFA 4KVSA 2NYDA 3KYWA 5LG2A 3PWQC 3S15L 3WVVA 1S24A 4ZL5A 1YUXA 3GTPL 3BVKA 2XJUA 5LS9A 1DATA 4MKUA 2JA8L 1RCGA 3KA9A 3I4ML 5I4JA 3E6SA 4XGHA 4TODA 2APOB 4ERUA 1VLGA 3LWRB 3MQKB 5FLML 2B5ID 3J7Y1 5C44L 3KYXA 1GWGA 2RBDA 2ZG8X 4PG0A 5M5XL 5GADc 2XJNA 5D8YA 2C2UA 3S1ML 4PG1A 3N6OA 5LG8A 1K83L 3AJQA 2Z5RA 3GVYA 3KYVA 3R2LA 2XJSA 4BY1L 1I6HL 2FG4A 3LWPB 2FHAA 4IWKA 2CKAA 3LNLA 2ITBA 4ZN1B 4RC5B 1F33A 3UFBA 1VEIA 4TOEA 4AR3A 2Z3QB 1NNQA 4LHLA 5GAEc 3GTKL 3C1ZA 1R9TL 1LB3A 2G38B 4M33A 2V0FA 2E2JL 2M6OA 2YU9L 5IY0A 7RXNA 3HJWB 4RC8A 5M3ML 2V3BB 4C3IL 5EIOC 3B08B 3WWLA 4PGKA 4C3HL 3RD0A 3NOZX 5FFEA 2DSXA 3RYGA 3F34A 5GU2X 1VZIA 5JKLA 3HOXL 4Z5SA 4AHZA 2BK6A 3PZAA 3GGZA 5CMRA 3GGYA 2N02A 3AF9X 3SIDA 1RCDA 2PMZP 3Q4OA 2W0OA 3H97A 1ZS3A 1T9PA 5J8WA 2A68D 4II4A 2CF7A 3O7SA 2HTNA 5FJ8L 2XJPA 5AI3A 1VEQA 1R0HA 2Z3RB 4M32A 3H0GL 5LBHA 3GTGL 4CVRA 3KA8A 1PFVA 2EY4E 2R7ZL 2CKCA 1P7PA 1RDVA 3PIP1 3WVWA 3BT5A 3B0AB 3GTJL 4XXBB 1DX8A 4DASA 2JI2A 1LKPA 1RCEA 3AF8X 1XZ1A 5J8SA 2XJTA 5J93A 3E1LA 5MLC3 2FFXJ 4LYUA 2ERJA 3MSUA 1TJOA 4WJG4 3P8BA 2AYJA 2O5JD 4AI3A 3P2AA 5M3FL 2E2IL 5AN9H 3PVYB 1ODHA 2GS4A 3EGMA 1LKOA 3RZOL 3I4NL 4Y08A 1E8JA 1AEWA 4CYBA 4ZKXA 1SQ3A 3GTML 3BVEA 1CADA 4A3GL 3U90A 4AI0A 4AR4A 1TK6A 2C6AA 2L0ZA 4R42A 3AK9A 2AR0A 3A9QA 1BQ8A 4TOBA 4AI2A 1S2ZA 2FZFA 3PVTB 5IYBL 3EZUA 4LYXA 3TA8A 3HOVL 4LPMA 1DVBA 3S1QL 1IROA 2OKCA 3PWFA 1PZXA 3PL5A 2NVYL 1SMUA 3C23A 1WJVA 2YW6A 6RXNA 3OGHA 3KDQA 2MS3A 2CN7A 4A3CL 4A93L 1N1QA 2GMGA 4A3BL 3LWQB 4RC6B 1TWGL 4ISMA 1XZ3A 1B2JA 1DPSA 3HOUL 4DE6A 4A25A 2C6BA 4QIWP 2NVQL 1BFRA 2YW7A 3FKIL 4KVRA 4LPJA 1B13A 5HU6D 5JKLG 2IU2A 5IP9L 3E1NA 3H3VM 3FRRA 2XGWA 2BW1A
chains in the Genus database with same CATH topology
1RB9A 3F35A 2WLUA 2M4YA 4AHYA 2Z5PA 2PVXA 4YWMA 1BCFA 1R0GA 2V2RA 2V2PA 2JD60 3ERZA 5JKMG 5RXNA 2V2LA 1MOJA 4W4LB 3R2SA 1VZHA 3FRSA 4LQNA 3RGDA 1BQ9A 4G6BA 4CY9A 2XJOA 5D8PA 4REUA 4CYAA 3R2KA 3SH6A 5D8OA 4AR6A 3F38A 1QYBA 4TOFA 1R0IA 3NFPI 4U3GA 3E2CA 2ZG7X 1RYQA 1RWDA 2Y3QA 2J9UB 1F30A 3JZAB 1TKPA 3M6JA 2MGYA 5GOUA 4YXJA 5GAGc 2C41A 3VV9A 4ZJKA 4LPNA 1OWBA 5FFCA 1BE7A 2YJJA 1YV1A 3E1OA 4DYXA 3VPBE 3PW1A 3SS2A 1NFVA 4MUDA 3K35A 3QD8A 3PW8A 4CMYV 3PVRA 3QB9A 5DM71 4POFA 3E1QA 3C1YA 4TPUA 3F32A 3AJOA 1JYBA 4MY7A 3EZ0A 5CZUA 3A44A 2CHPA 1L8HA 1EUMA 4QUWA 4YXMA 4JAGA 5ERJA 4RC7B 1NXGA 3KHKA 2PYAA 1TKOA 3ISEA 2XJVA 1HRSA 2YJKA 3UOFA 5K53A 1LKMA 2QF9A 3ES3A 2QQYA 2ZIXA 1O9RA 4XGSA 1QGHA 1IU6A 1VZGA 3O7RA 3KA3A 4PGIA 3GHQA 3QVDA 3E1PA 4II4B 1IU5A 2CR8A 4ME3A 3QZ3A 3SE1A 3IS7A 4XKSA 3AJPA 5AXSA 1JI4A 4XKTA 4YWLA 2V8UA 2JI1A 2UX1A 3J7Z1 2FJCA 2Z5QA 4V196 1FHMA 5GAHc 2M4VA 5HJHA 2CIHA 4YKHA 3QHBA 4EVCA 4GS7D 5K52A 4CVSA 2JI3A 5JVG1 2BJYA 3W54A 1OTKA 5IX6A 1FHHA 3LPEB 3JZ9A 2XKQA 3RZTA 4ZL6A 5E1UA 2V2JA 3HIUA 3KYUA 5HQOA 1JKVA 1VJXA 4MN9A 1SOFA 3KX9A 1JI5A 1R0JA 5D8RA 1IERA 5DM61 4KXRB 2V2NA 4TOGA 2RDVA 2CHIA 3E6RA 2V2MA 5D8XA 2BKCA 4ZTTA 5MF6A 2V8TA 2OC5A 1SMMA 3RZ6A 3C21A 3BVFA 3WWNB 2OH3A 5MGNA 3IS8A 4AHXA 3AF7X 4RC6A 3BVIA 1NXEA 4B8CD 5D8SA 4EVEA 5JDOB 1Z92B 3AK8A 2FL0A 1SMWA 4K9FA 5GN8B 1B2OA 2D5KA 3KXUA 2HR5A 1FHAA 3GE4A 2VL6A 4CVPA 1NF4A 3R2MA 3F39A 5EINC 2Z6MA 3QQCE 4DYUA 4KVQA 3H7GA 4TOAA 1ZRPA 2LCQA 4MXPA 4M34A 1JTSA 4TOCA 5C6FA 4AI1A 3OJ5A 3PW8C 4MJYA 3VNXA 3PKJA 5MFPA 1RCIA 2A6HD 4M35A 3R2OA 4JAEA 1RCCA 3HL1A 3FI6A 4ETRA 4WFN1 4W4KB 2XJMA 2CWLA 5D8QA 3UNOA 4AR5A 2KN9A 2WTLA 3D19A 2G4HA 2QL0A 3Q4NA 5H1Sc 1BRFA 1CAAA 3NP2X 3FSEA 1S3QA 4RC5A 2ZG9X 4DZ0A 3IU3I 5E2DA 5GU0X 3WVUA 2M6PA 3F36A 4IXKA 1RDGA 2ERSA 4AM4A 3PWQA 2F7NA 2PSMC 4E6KA 3SHXA 3WNWA 1Z6OA 4OYNA 1JKUA 2C2FA 3E1JA 3PW1B 2GYDA 3DBYA 2K2DA 2KKDA 2A69D 4DYYA 3ZG6A 2C2JA 2XJQA 3L0MA 5K2ME 2FG8A 1BG7A 3PVRB 2ZA6A 1C09A 2PVEA 1IRNA 1JREA 1NF6A 4AHWA 5JACA 3BKNA 4IWJA 4RC7A 1R0FA 3MPSA 4P18A 2XJRA 1VELA 5CMQA 3KWOA 8RXNA 3UOIA 4ZMCA 3QHCA 3F37A 2JD80 4DYZA 2WLAA 4LHNA 2FKZA 2V2SA 2CEIA 1UVHA 4JADA 2CLBA 4YVZA 4Z3BA 2C6RA 4TO9A 2IB0A 2VZBA 3LKDA 4AM5A 1Z4AA 5GU3X 1T9QA 1IESA 2ZA8A 5JKMA 4UY81 4TOHA 4DI0A 1OWCA 1J30A 1UMNA 3PKIA 5ERKA 3T9JA 4ITWA 3RBCA 1VCXA 3ISFA 4EVBA 3R2RA 3VVAA 1R03A 3PVYA 3V3KB 1QCVA 1S30A 2ZURX 4ZKWA 1JGCA 5J9VA 4E6YA 4ZLWA 1LTLA 3Q4RA 4LQVA 3BVLA 4TW3A 3RAVA 1T9OA 2A6ED 3KYYA 2PYBA 2IY4A 3R2HA 1B71A 4ITTA 3IQ1A 3PVTA 2PPTA 2CLUA 2X170 3FVBA 1H7VA 2CN6A 2WWXB 4EVDA 1ZUJA 4X0JA 4RXNA 1O9IA 4LQJA 1IW7D 3E1MA 5JVH1 2V0EA 5FFDA 2VXIA 1L8IA 5FFAA 4AM2A 2Y44A 4E40A 3Q4QA 1JIGA 4POGA 2VXXA 5MFZA 2BE5D 2ZA7A 4TVMA 2V2IA 3NP0X 2JD70 5GU1X 4CVTA 5AI2A 2Z90A 2GYQA 3A68A 4ZKHA 3F33A 5FEJA 4XKUA 5JDOA 3KA6A 2V2OA 3KA4A 4LQHA 5GN8A 5FFBA 5HJFA 1H96A 3PIO1 1KRQA 2V15A 3RE7A 4CMYA 1YK4A 4U671 2H12A 4ZN3B 1MFRA 1YUZA 1Z6OM 4ML5A 1RYTA 1YK5A 4ISPA 4JAFA 4KVSA 2NYDA 3KYWA 5LG2A 3PWQC 3WVVA 1S24A 4ZL5A 1YUXA 3BVKA 2XJUA 5LS9A 1DATA 4MKUA 1RCGA 3KA9A 5I4JA 3E6SA 4XGHA 4TODA 4ERUA 1VLGA 2B5ID 3J7Y1 3KYXA 1GWGA 2RBDA 2ZG8X 4PG0A 5GADc 2XJNA 5D8YA 2C2UA 4PG1A 3N6OA 5LG8A 3AJQA 2Z5RA 3GVYA 3KYVA 3R2LA 2XJSA 2FG4A 2FHAA 4IWKA 2CKAA 3LNLA 2ITBA 4ZN1B 4RC5B 1F33A 3UFBA 1VEIA 4TOEA 4AR3A 2Z3QB 1NNQA 4LHLA 5GAEc 3C1ZA 1LB3A 2G38B 4M33A 2V0FA 2M6OA 5IY0A 7RXNA 4RC8A 2V3BB 5EIOC 3B08B 3WWLA 4PGKA 3RD0A 3NOZX 5FFEA 2DSXA 3RYGA 3F34A 5GU2X 1VZIA 5JKLA 4Z5SA 4AHZA 2BK6A 3PZAA 3GGZA 5CMRA 3GGYA 2N02A 3AF9X 3SIDA 1RCDA 3Q4OA 2W0OA 1ZS3A 1T9PA 5J8WA 2A68D 4II4A 2CF7A 3O7SA 2HTNA 2XJPA 5AI3A 1VEQA 1R0HA 2Z3RB 4M32A 5LBHA 4CVRA 3KA8A 2CKCA 1RDVA 3PIP1 3WVWA 3BT5A 3B0AB 4XXBB 1DX8A 4DASA 2JI2A 1LKPA 1RCEA 3AF8X 1XZ1A 5J8SA 2XJTA 5J93A 3E1LA 5MLC3 2FFXJ 4LYUA 2ERJA 3MSUA 1TJOA 4WJG4 3P8BA 2AYJA 2O5JD 4AI3A 3P2AA 5AN9H 3PVYB 1ODHA 2GS4A 3EGMA 1LKOA 4Y08A 1E8JA 1AEWA 4CYBA 4ZKXA 1SQ3A 3BVEA 1CADA 3U90A 4AI0A 4AR4A 1TK6A 2C6AA 2L0ZA 4R42A 3AK9A 2AR0A 3A9QA 1BQ8A 4TOBA 4AI2A 1S2ZA 2FZFA 3PVTB 3EZUA 4LYXA 3TA8A 4LPMA 1DVBA 1IROA 2OKCA 3PWFA 1SMUA 3C23A 1WJVA 2YW6A 6RXNA 3OGHA 3KDQA 2MS3A 2CN7A 1N1QA 2GMGA 4RC6B 4ISMA 1XZ3A 1B2JA 1DPSA 4DE6A 4A25A 2C6BA 1BFRA 2YW7A 4KVRA 4LPJA 1B13A 5HU6D 5JKLG 2IU2A 3E1NA 1BFYA 3FRRA 2XGWA 2BW1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RB9 A;  3F35 A;  2WLU A;  2M4Y A;  2Z5P A;  2PVX A;  4YWM A;  1BCF A;  1R0G A;  2V2R A;  2V2P A;  2JD6 0;  3ERZ A;  5JKM G;  5RXN A;  2V2L A;  1MOJ A;  3R2S A;  4LQN A;  3RGD A;  1BQ9 A;  4CY9 A;  2XJO A;  5D8P A;  4REU A;  4CYA A;  3R2K A;  3SH6 A;  5D8O A;  4AR6 A;  3F38 A;  1QYB A;  4TOF A;  1R0I A;  4U3G A;  3E2C A;  2ZG7 X;  1RWD A;  2Y3Q A;  1F30 A;  1TKP A;  5GOU A;  2C41 A;  4ZJK A;  4LPN A;  5FFC A;  1BE7 A;  2YJJ A;  1YV1 A;  3E1O A;  4DYX A;  3PW1 A;  3SS2 A;  1NFV A;  4MUD A;  3QD8 A;  3PW8 A;  4CMY V;  3PVR A;  3QB9 A;  4POF A;  3E1Q A;  4TPU A;  3F32 A;  3AJO A;  1JYB A;  4MY7 A;  3EZ0 A;  5CZU A;  3A44 A;  2CHP A;  1L8H A;  1EUM A;  4QUW A;  5ERJ A;  4RC7 B;  2PYA A;  1TKO A;  3ISE A;  1HRS A;  2YJK A;  3UOF A;  5K53 A;  1LKM A;  2QF9 A;  3ES3 A;  2QQY A;  1O9R A;  4XGS A;  1QGH A;  1IU6 A;  3O7R A;  3KA3 A;  4PGI A;  3GHQ A;  3QVD A;  3E1P A;  4II4 B;  1IU5 A;  4ME3 A;  3QZ3 A;  3SE1 A;  3IS7 A;  4XKS A;  3AJP A;  5AXS A;  1JI4 A;  4XKT A;  4YWL A;  2UX1 A;  2FJC A;  2Z5Q A;  1FHM A;  5HJH A;  2CIH A;  4YKH A;  3QHB A;  4EVC A;  5K52 A;  4CVS A;  2BJY A;  1OTK A;  5IX6 A;  1FHH A;  2XKQ A;  3RZT A;  4ZL6 A;  5E1U A;  2V2J A;  3HIU A;  3KYU A;  5HQO A;  1JKV A;  1VJX A;  4MN9 A;  1SOF A;  3KX9 A;  1JI5 A;  1R0J A;  5D8R A;  1IER A;  2V2N A;  4TOG A;  2RDV A;  2CHI A;  3E6R A;  2V2M A;  5D8X A;  2BKC A;  4ZTT A;  2OC5 A;  1SMM A;  3RZ6 A;  3BVF A;  2OH3 A;  3IS8 A;  3AF7 X;  4RC6 A;  3BVI A;  5D8S A;  4EVE A;  3AK8 A;  2FL0 A;  1SMW A;  4K9F A;  5GN8 B;  1B2O A;  2D5K A;  3KXU A;  2HR5 A;  1FHA A;  3GE4 A;  2VL6 A;  4CVP A;  1NF4 A;  3R2M A;  3F39 A;  2Z6M A;  4DYU A;  4KVQ A;  3H7G A;  4TOA A;  1ZRP A;  2LCQ A;  4M34 A;  1JTS A;  4TOC A;  5C6F A;  3OJ5 A;  3PW8 C;  4MJY A;  3VNX A;  1RCI A;  4M35 A;  3R2O A;  1RCC A;  3HL1 A;  3FI6 A;  4ETR A;  2XJM A;  5D8Q A;  3UNO A;  4AR5 A;  2KN9 A;  2WTL A;  2G4H A;  2QL0 A;  3Q4N A;  1BRF A;  1CAA A;  3NP2 X;  3FSE A;  1S3Q A;  4RC5 A;  2ZG9 X;  4DZ0 A;  5E2D A;  5GU0 X;  3WVU A;  3F36 A;  4IXK A;  1RDG A;  4AM4 A;  3PWQ A;  2F7N A;  4E6K A;  3SHX A;  3WNW A;  1Z6O A;  4OYN A;  1JKU A;  2C2F A;  3E1J A;  3PW1 B;  2GYD A;  2K2D A;  2KKD A;  4DYY A;  2C2J A;  2FG8 A;  1BG7 A;  3PVR B;  2ZA6 A;  1C09 A;  2PVE A;  1IRN A;  1JRE A;  1NF6 A;  5JAC A;  3BKN A;  4IWJ A;  4RC7 A;  1R0F A;  3MPS A;  4P18 A;  1VEL A;  5CMQ A;  3KWO A;  8RXN A;  3UOI A;  4ZMC A;  3QHC A;  3F37 A;  2JD8 0;  4DYZ A;  2WLA A;  2FKZ A;  2V2S A;  2CEI A;  1UVH A;  2CLB A;  4Z3B A;  2C6R A;  4TO9 A;  2IB0 A;  2VZB A;  4AM5 A;  1Z4A A;  5GU3 X;  1T9Q A;  1IES A;  2ZA8 A;  5JKM A;  4TOH A;  4DI0 A;  1J30 A;  1UMN A;  5ERK A;  3T9J A;  4ITW A;  3RBC A;  1VCX A;  3ISF A;  4EVB A;  3R2R A;  1R03 A;  3PVY A;  1QCV A;  1S30 A;  2ZUR X;  4ZKW A;  1JGC A;  5J9V A;  4ZLW A;  1LTL A;  3Q4R A;  4LQV A;  3BVL A;  4TW3 A;  3RAV A;  1T9O A;  3KYY A;  2PYB A;  2IY4 A;  3R2H A;  1B71 A;  4ITT A;  3IQ1 A;  3PVT A;  2CLU A;  2X17 0;  3FVB A;  1H7V A;  2CN6 A;  4EVD A;  1ZUJ A;  4RXN A;  1O9I A;  4LQJ A;  3E1M A;  5FFD A;  2VXI A;  1L8I A;  5FFA A;  4AM2 A;  3Q4Q A;  1JIG A;  4POG A;  2VXX A;  2ZA7 A;  2V2I A;  3NP0 X;  2JD7 0;  5GU1 X;  4CVT A;  5AI2 A;  2Z90 A;  2GYQ A;  3A68 A;  4ZKH A;  3F33 A;  5FEJ A;  4XKU A;  3RYG A;  3KA6 A;  2V2O A;  3KA4 A;  4LQH A;  5GN8 A;  5FFB A;  5HJF A;  1H96 A;  1KRQ A;  2V15 A;  3RE7 A;  4CMY A;  1YK4 A;  1MFR A;  1YUZ A;  1Z6O M;  4ML5 A;  1RYT A;  1YK5 A;  4ISP A;  4KVS A;  3KYW A;  5LG2 A;  3PWQ C;  3WVV A;  1S24 A;  4ZL5 A;  1YUX A;  3BVK A;  5LS9 A;  1DAT A;  4MKU A;  1RCG A;  3KA9 A;  5I4J A;  3E6S A;  4TOD A;  4ERU A;  1VLG A;  3KYX A;  1GWG A;  2RBD A;  2ZG8 X;  4PG0 A;  2XJN A;  5D8Y A;  2C2U A;  4PG1 A;  5LG8 A;  3AJQ A;  2Z5R A;  3GVY A;  3KYV A;  3R2L A;  2FG4 A;  2FHA A;  4IWK A;  2ITB A;  4RC5 B;  1F33 A;  1VEI A;  4TOE A;  4AR3 A;  1NNQ A;  1LB3 A;  4M33 A;  5IY0 A;  7RXN A;  4RC8 A;  2V3B B;  4PGK A;  3RD0 A;  3NOZ X;  5FFE A;  2DSX A;  3F34 A;  5GU2 X;  5JKL A;  4Z5S A;  2BK6 A;  3PZA A;  5CMR A;  3SID A;  3AF9 X;  1RCD A;  3Q4O A;  2W0O A;  1ZS3 A;  1T9P A;  5J8W A;  4II4 A;  2CF7 A;  3O7S A;  2HTN A;  5AI3 A;  1R0H A;  1VEQ A;  4M32 A;  5LBH A;  4CVR A;  3KA8 A;  1RDV A;  3WVW A;  3BT5 A;  1DX8 A;  4DAS A;  1LKP A;  1RCE A;  3AF8 X;  1XZ1 A;  5J8S A;  5J93 A;  3E1L A;  2FFX J;  4LYU A;  1TJO A;  3PVY B;  2GS4 A;  3EGM A;  1LKO A;  4Y08 A;  1E8J A;  1AEW A;  4CYB A;  4ZKX A;  1SQ3 A;  3BVE A;  1CAD A;  3U90 A;  4AR4 A;  1TK6 A;  4R42 A;  3AK9 A;  3A9Q A;  1BQ8 A;  4TOB A;  1S2Z A;  2FZF A;  3PVT B;  3EZU A;  4LYX A;  3TA8 A;  4LPM A;  1DVB A;  1IRO A;  3PWF A;  1SMU A;  2YW6 A;  6RXN A;  3OGH A;  2MS3 A;  2CN7 A;  1N1Q A;  2GMG A;  4RC6 B;  4ISM A;  1XZ3 A;  1B2J A;  1DPS A;  4DE6 A;  4A25 A;  1BFR A;  2YW7 A;  4KVR A;  4LPJ A;  1B13 A;  5JKL G;  2IU2 A;  3E1N A;  1BFY A;  2XGW A;  2BW1 A; 
#chains in the Genus database with same CATH topology
 1RB9 A;  3F35 A;  2WLU A;  2M4Y A;  4AHY A;  2Z5P A;  2PVX A;  4YWM A;  1BCF A;  1R0G A;  2V2R A;  2V2P A;  2JD6 0;  3ERZ A;  2WB1 P;  5JKM G;  5RXN A;  2V2L A;  1MOJ A;  4W4L B;  3R2S A;  1VZH A;  3FRS A;  4LQN A;  1TWA L;  1TWH L;  3H99 A;  3RGD A;  1BQ9 A;  4G6B A;  4CY9 A;  3LWV B;  2XJO A;  5D8P A;  4REU A;  4CYA A;  5M5Y L;  1BFY A;  3R2K A;  3SH6 A;  5D8O A;  4AR6 A;  3F38 A;  1QYB A;  4TOF A;  1R0I A;  4Y7N L;  3NFP I;  4U3G A;  3E2C A;  2ZG7 X;  3HOY L;  1RYQ A;  1RWD A;  2WAQ P;  2Y3Q A;  2J9U B;  1F30 A;  3JZA B;  1TKP A;  3M6J A;  2MGY A;  5GOU A;  4YXJ A;  5GAG c;  1I50 L;  2C41 A;  3VV9 A;  4ZJK A;  4LPN A;  1OWB A;  2B63 L;  5FFC A;  1BE7 A;  2YJJ A;  1YV1 A;  3E1O A;  4DYX A;  3VPB E;  3PW1 A;  3SS2 A;  1NFV A;  4MUD A;  2R93 L;  3K35 A;  3QD8 A;  3PW8 A;  4CMY V;  3PVR A;  3QB9 A;  5DM7 1;  4POF A;  3E1Q A;  3C1Y A;  4TPU A;  3F32 A;  3H9B A;  3AJO A;  2VUM L;  1JYB A;  4MY7 A;  3EZ0 A;  5CZU A;  3A44 A;  1Y1V L;  2CHP A;  4BXX L;  4AYB P;  1L8H A;  1EUM A;  4QUW A;  4YXM A;  4JAG A;  5ERJ A;  4RC7 B;  1NXG A;  3KHK A;  2PYA A;  2HVY C;  1TKO A;  4A3F L;  1TWC L;  3ISE A;  2XJV A;  1HRS A;  2YJK A;  3UOF A;  5K53 A;  1LKM A;  2QF9 A;  3ES3 A;  2QQY A;  5C4X L;  3M4O L;  2ZIX A;  2NVX L;  1O9R A;  4XGS A;  4C2M 1;  1QGH A;  1IU6 A;  1VZG A;  3O7R A;  3KA3 A;  4PGI A;  3GHQ A;  3QVD A;  3E1P A;  4II4 B;  1IU5 A;  2CR8 A;  4ME3 A;  3QZ3 A;  1SFO L;  3SE1 A;  3IS7 A;  4XKS A;  3AJP A;  5AXS A;  1JI4 A;  4XKT A;  4YWL A;  3HKZ P;  2V8U A;  2JI1 A;  2UX1 A;  1I3Q L;  3J7Z 1;  3S2H L;  2FJC A;  2Z5Q A;  4V19 6;  2JA7 L;  1FHM A;  5GAH c;  2M4V A;  5HJH A;  3S1R L;  2CIH A;  4YKH A;  3QHB A;  4EVC A;  4GS7 D;  5K52 A;  4CVS A;  2JI3 A;  5JVG 1;  2BJY A;  3W54 A;  1OTK A;  4BBS L;  5IX6 A;  1FHH A;  3LPE B;  3JZ9 A;  2XKQ A;  3RZT A;  4ZL6 A;  5E1U A;  2V2J A;  3HIU A;  3KYU A;  3JR7 A;  5HQO A;  1JKV A;  1VJX A;  4MN9 A;  1SOF A;  3KX9 A;  1JI5 A;  1R0J A;  5D8R A;  1IER A;  5DM6 1;  3LWO B;  4KXR B;  2V2N A;  4TOG A;  5C3E L;  2RDV A;  2CHI A;  3E6R A;  2V2M A;  5D8X A;  2BKC A;  1F4L A;  4ZTT A;  5MF6 A;  3K7A L;  2V8T A;  2OC5 A;  1SMM A;  3RZ6 A;  3C21 A;  3BVF A;  3WWN B;  2OH3 A;  5MGN A;  3IS8 A;  4AHX A;  3AF7 X;  1QQT A;  4RC6 A;  3BVI A;  1NXE A;  4B8C D;  5D8S A;  4EVE A;  5JDO B;  1Z92 B;  3AK8 A;  2FL0 A;  1SMW A;  4K9F A;  5GN8 B;  1B2O A;  2D5K A;  3KXU A;  2HR5 A;  1FHA A;  3GE4 A;  2VL6 A;  4CVP A;  1NF4 A;  3R2M A;  3F39 A;  5EIN C;  2Z6M A;  2RFK B;  3QQC E;  4DYU A;  4KVQ A;  3H7G A;  3FDJ A;  4TOA A;  1ZRP A;  2LCQ A;  4MXP A;  3GTQ L;  3S1N L;  2JA5 L;  4M34 A;  1JTS A;  4TOC A;  5C6F A;  2NVT L;  4AI1 A;  3OJ5 A;  5AI2 A;  3HOW L;  3PW8 C;  4MJY A;  3VNX A;  3PKJ A;  4A3L L;  5MFP A;  1RCI A;  2A6H D;  4M35 A;  3R2O A;  4JAE A;  1RCC A;  5IP7 L;  4Y52 L;  3HL1 A;  3FI6 A;  4ETR A;  4WFN 1;  4W4K B;  2XJM A;  2CWL A;  5D8Q A;  3GTO L;  3UNO A;  4AR5 A;  4A3E L;  2KN9 A;  2WTL A;  3D19 A;  2G4H A;  2QL0 A;  3Q4N A;  5H1S c;  1BRF A;  1CAA A;  1PFY A;  3NP2 X;  3FSE A;  2JA6 L;  1S3Q A;  4RC5 A;  2ZG9 X;  4DZ0 A;  3IU3 I;  3S16 L;  5E2D A;  5GU0 X;  3WVU A;  2M6P A;  3F36 A;  4IXK A;  1RDG A;  4A3I L;  2ERS A;  4AM4 A;  2AQC A;  3PWQ A;  2F7N A;  2PSM C;  4E6K A;  3SHX A;  3WNW A;  4BBR L;  1Z6O A;  4OYN A;  1JKU A;  2C2F A;  3E1J A;  3PW1 B;  2GYD A;  3DBY A;  2K2D A;  2KKD A;  2A69 D;  4DYY A;  3ZG6 A;  2E2H L;  2AUS B;  2C2J A;  2XJQ A;  3L0M A;  5K2M E;  2FG8 A;  1BG7 A;  3PVR B;  2ZA6 A;  1C09 A;  2PVE A;  1IRN A;  1JRE A;  1NF6 A;  4AHW A;  5JAC A;  3BKN A;  5M5W L;  4IWJ A;  4RC7 A;  1R0F A;  3MPS A;  4P18 A;  2XJR A;  1VEL A;  5CMQ A;  3KWO A;  8RXN A;  3UOI A;  4ZMC A;  3HJY B;  3QHC A;  3F37 A;  2JD8 0;  4DYZ A;  2WLA A;  4LHN A;  2FKZ A;  2V2S A;  2CEI A;  4BY7 L;  1UVH A;  4JAD A;  2CLB A;  4YVZ A;  4Z3B A;  2C6R A;  4TO9 A;  2IB0 A;  2VZB A;  3LKD A;  4AM5 A;  5IYC L;  1Z4A A;  5GU3 X;  1T9Q A;  1IES A;  2ZA8 A;  5JKM A;  2R92 L;  4UY8 1;  4TOH A;  4DI0 A;  1OWC A;  1TWF L;  1J30 A;  1UMN A;  3PKI A;  5ERK A;  3T9J A;  4A3K L;  4ITW A;  3RBC A;  1VCX A;  3ISF A;  4EVB A;  3R2R A;  3VVA A;  1R03 A;  3PVY A;  3V3K B;  1QCV A;  1S30 A;  2ZUR X;  4ZKW A;  1JGC A;  5J9V A;  1WCM L;  4E6Y A;  4ZLW A;  1LTL A;  2Y0S P;  3Q4R A;  4LQV A;  3H9C A;  3BVL A;  4TW3 A;  1PFW A;  3RAV A;  4C3J L;  1T9O A;  2A6E D;  3KYY A;  2PYB A;  2IY4 A;  3R2H A;  1B71 A;  4ITT A;  4X6A L;  3IQ1 A;  3PVT A;  2PPT A;  2CLU A;  3PO3 L;  2X17 0;  3HAX C;  3FVB A;  1H7V A;  2CN6 A;  2WWX B;  4EVD A;  1ZUJ A;  3S14 L;  4X0J A;  4A3D L;  4RXN A;  1O9I A;  4LQJ A;  1IW7 D;  3E1M A;  5JVH 1;  2V0E A;  5FFD A;  2VXI A;  1L8I A;  4A3M L;  5FFA A;  4AM2 A;  5C4J L;  2Y44 A;  4E40 A;  3PO2 L;  3Q4Q A;  1JIG A;  3S2D L;  4POG A;  2VXX A;  5MFZ A;  2BE5 D;  2ZA7 A;  4TVM A;  2V2I A;  3NP0 X;  2JD7 0;  5GU1 X;  4CVT A;  1PFU A;  2Z90 A;  2GYQ A;  3A68 A;  4ZKH A;  3F33 A;  5FEJ A;  4XKU A;  5JDO A;  3KA6 A;  3CQZ L;  2V2O A;  3KA4 A;  4LQH A;  3HOZ L;  5GN8 A;  1Y1W L;  4A3J L;  5FFB A;  5HJF A;  1H96 A;  3RZD L;  3PIO 1;  1KRQ A;  2V15 A;  3RE7 A;  4CMY A;  1YK4 A;  4U67 1;  3S17 L;  2H12 A;  4ZN3 B;  3GTL L;  1MFR A;  3M3Y L;  1YUZ A;  1Z6O M;  4ML5 A;  1RYT A;  1YK5 A;  5IYD L;  4ISP A;  4JAF A;  4KVS A;  2NYD A;  3KYW A;  5LG2 A;  3PWQ C;  3S15 L;  3WVV A;  1S24 A;  4ZL5 A;  1YUX A;  3GTP L;  3BVK A;  2XJU A;  5LS9 A;  1DAT A;  4MKU A;  2JA8 L;  1RCG A;  3KA9 A;  3I4M L;  5I4J A;  3E6S A;  4XGH A;  4TOD A;  2APO B;  4ERU A;  1VLG A;  3LWR B;  3MQK B;  5FLM L;  2B5I D;  3J7Y 1;  5C44 L;  3KYX A;  1GWG A;  2RBD A;  2ZG8 X;  4PG0 A;  5M5X L;  5GAD c;  2XJN A;  5D8Y A;  2C2U A;  3S1M L;  4PG1 A;  3N6O A;  5LG8 A;  1K83 L;  3AJQ A;  2Z5R A;  3GVY A;  3KYV A;  3R2L A;  2XJS A;  4BY1 L;  1I6H L;  2FG4 A;  3LWP B;  2FHA A;  4IWK A;  2CKA A;  3LNL A;  2ITB A;  4ZN1 B;  4RC5 B;  1F33 A;  3UFB A;  1VEI A;  4TOE A;  4AR3 A;  2Z3Q B;  1NNQ A;  4LHL A;  5GAE c;  3GTK L;  3C1Z A;  1R9T L;  1LB3 A;  2G38 B;  4M33 A;  2V0F A;  2E2J L;  2M6O A;  2YU9 L;  5IY0 A;  7RXN A;  3HJW B;  4RC8 A;  5M3M L;  2V3B B;  4C3I L;  5EIO C;  3B08 B;  3WWL A;  4PGK A;  4C3H L;  3RD0 A;  3NOZ X;  5FFE A;  2DSX A;  3RYG A;  3F34 A;  5GU2 X;  1VZI A;  5JKL A;  3HOX L;  4Z5S A;  4AHZ A;  2BK6 A;  3PZA A;  3GGZ A;  5CMR A;  3GGY A;  2N02 A;  3AF9 X;  3SID A;  1RCD A;  2PMZ P;  3Q4O A;  2W0O A;  3H97 A;  1ZS3 A;  1T9P A;  5J8W A;  2A68 D;  4II4 A;  2CF7 A;  3O7S A;  2HTN A;  5FJ8 L;  2XJP A;  5AI3 A;  1VEQ A;  1R0H A;  2Z3R B;  4M32 A;  3H0G L;  5LBH A;  3GTG L;  4CVR A;  3KA8 A;  1PFV A;  2EY4 E;  2R7Z L;  2CKC A;  1P7P A;  1RDV A;  3PIP 1;  3WVW A;  3BT5 A;  3B0A B;  3GTJ L;  4XXB B;  1DX8 A;  4DAS A;  2JI2 A;  1LKP A;  1RCE A;  3AF8 X;  1XZ1 A;  5J8S A;  2XJT A;  5J93 A;  3E1L A;  5MLC 3;  2FFX J;  4LYU A;  2ERJ A;  3MSU A;  1TJO A;  4WJG 4;  3P8B A;  2AYJ A;  2O5J D;  4AI3 A;  3P2A A;  5M3F L;  2E2I L;  5AN9 H;  3PVY B;  1ODH A;  2GS4 A;  3EGM A;  1LKO A;  3RZO L;  3I4N L;  4Y08 A;  1E8J A;  1AEW A;  4CYB A;  4ZKX A;  1SQ3 A;  3GTM L;  3BVE A;  1CAD A;  4A3G L;  3U90 A;  4AI0 A;  4AR4 A;  1TK6 A;  2C6A A;  2L0Z A;  4R42 A;  3AK9 A;  2AR0 A;  3A9Q A;  1BQ8 A;  4TOB A;  4AI2 A;  1S2Z A;  2FZF A;  3PVT B;  5IYB L;  3EZU A;  4LYX A;  3TA8 A;  3HOV L;  4LPM A;  1DVB A;  3S1Q L;  1IRO A;  2OKC A;  3PWF A;  1PZX A;  3PL5 A;  2NVY L;  1SMU A;  3C23 A;  1WJV A;  2YW6 A;  6RXN A;  3OGH A;  3KDQ A;  2MS3 A;  2CN7 A;  4A3C L;  4A93 L;  1N1Q A;  2GMG A;  4A3B L;  3LWQ B;  4RC6 B;  1TWG L;  4ISM A;  1XZ3 A;  1B2J A;  1DPS A;  3HOU L;  4DE6 A;  4A25 A;  2C6B A;  4QIW P;  2NVQ L;  1BFR A;  2YW7 A;  3FKI L;  4KVR A;  4LPJ A;  1B13 A;  5HU6 D;  5JKL G;  2IU2 A;  5IP9 L;  3E1N A;  3H3V M;  3FRR A;  2XGW A;  2BW1 A; 
#chains in the Genus database with same CATH homology
 1RB9 A;  3F35 A;  2WLU A;  2M4Y A;  4AHY A;  2Z5P A;  2PVX A;  4YWM A;  1BCF A;  1R0G A;  2V2R A;  2V2P A;  2JD6 0;  3ERZ A;  5JKM G;  5RXN A;  2V2L A;  1MOJ A;  4W4L B;  3R2S A;  1VZH A;  3FRS A;  4LQN A;  3RGD A;  1BQ9 A;  4G6B A;  4CY9 A;  2XJO A;  5D8P A;  4REU A;  4CYA A;  3R2K A;  3SH6 A;  5D8O A;  4AR6 A;  3F38 A;  1QYB A;  4TOF A;  1R0I A;  3NFP I;  4U3G A;  3E2C A;  2ZG7 X;  1RYQ A;  1RWD A;  2Y3Q A;  2J9U B;  1F30 A;  3JZA B;  1TKP A;  3M6J A;  2MGY A;  5GOU A;  4YXJ A;  5GAG c;  2C41 A;  3VV9 A;  4ZJK A;  4LPN A;  1OWB A;  5FFC A;  1BE7 A;  2YJJ A;  1YV1 A;  3E1O A;  4DYX A;  3VPB E;  3PW1 A;  3SS2 A;  1NFV A;  4MUD A;  3K35 A;  3QD8 A;  3PW8 A;  4CMY V;  3PVR A;  3QB9 A;  5DM7 1;  4POF A;  3E1Q A;  3C1Y A;  4TPU A;  3F32 A;  3AJO A;  1JYB A;  4MY7 A;  3EZ0 A;  5CZU A;  3A44 A;  2CHP A;  1L8H A;  1EUM A;  4QUW A;  4YXM A;  4JAG A;  5ERJ A;  4RC7 B;  1NXG A;  3KHK A;  2PYA A;  1TKO A;  3ISE A;  2XJV A;  1HRS A;  2YJK A;  3UOF A;  5K53 A;  1LKM A;  2QF9 A;  3ES3 A;  2QQY A;  2ZIX A;  1O9R A;  4XGS A;  1QGH A;  1IU6 A;  1VZG A;  3O7R A;  3KA3 A;  4PGI A;  3GHQ A;  3QVD A;  3E1P A;  4II4 B;  1IU5 A;  2CR8 A;  4ME3 A;  3QZ3 A;  3SE1 A;  3IS7 A;  4XKS A;  3AJP A;  5AXS A;  1JI4 A;  4XKT A;  4YWL A;  2V8U A;  2JI1 A;  2UX1 A;  3J7Z 1;  2FJC A;  2Z5Q A;  4V19 6;  1FHM A;  5GAH c;  2M4V A;  5HJH A;  2CIH A;  4YKH A;  3QHB A;  4EVC A;  4GS7 D;  5K52 A;  4CVS A;  2JI3 A;  5JVG 1;  2BJY A;  3W54 A;  1OTK A;  5IX6 A;  1FHH A;  3LPE B;  3JZ9 A;  2XKQ A;  3RZT A;  4ZL6 A;  5E1U A;  2V2J A;  3HIU A;  3KYU A;  5HQO A;  1JKV A;  1VJX A;  4MN9 A;  1SOF A;  3KX9 A;  1JI5 A;  1R0J A;  5D8R A;  1IER A;  5DM6 1;  4KXR B;  2V2N A;  4TOG A;  2RDV A;  2CHI A;  3E6R A;  2V2M A;  5D8X A;  2BKC A;  4ZTT A;  5MF6 A;  2V8T A;  2OC5 A;  1SMM A;  3RZ6 A;  3C21 A;  3BVF A;  3WWN B;  2OH3 A;  5MGN A;  3IS8 A;  4AHX A;  3AF7 X;  4RC6 A;  3BVI A;  1NXE A;  4B8C D;  5D8S A;  4EVE A;  5JDO B;  1Z92 B;  3AK8 A;  2FL0 A;  1SMW A;  4K9F A;  5GN8 B;  1B2O A;  2D5K A;  3KXU A;  2HR5 A;  1FHA A;  3GE4 A;  2VL6 A;  4CVP A;  1NF4 A;  3R2M A;  3F39 A;  5EIN C;  2Z6M A;  3QQC E;  4DYU A;  4KVQ A;  3H7G A;  4TOA A;  1ZRP A;  2LCQ A;  4MXP A;  4M34 A;  1JTS A;  4TOC A;  5C6F A;  4AI1 A;  3OJ5 A;  3PW8 C;  4MJY A;  3VNX A;  3PKJ A;  5MFP A;  1RCI A;  2A6H D;  4M35 A;  3R2O A;  4JAE A;  1RCC A;  3HL1 A;  3FI6 A;  4ETR A;  4WFN 1;  4W4K B;  2XJM A;  2CWL A;  5D8Q A;  3UNO A;  4AR5 A;  2KN9 A;  2WTL A;  3D19 A;  2G4H A;  2QL0 A;  3Q4N A;  5H1S c;  1BRF A;  1CAA A;  3NP2 X;  3FSE A;  1S3Q A;  4RC5 A;  2ZG9 X;  4DZ0 A;  3IU3 I;  5E2D A;  5GU0 X;  3WVU A;  2M6P A;  3F36 A;  4IXK A;  1RDG A;  2ERS A;  4AM4 A;  3PWQ A;  2F7N A;  2PSM C;  4E6K A;  3SHX A;  3WNW A;  1Z6O A;  4OYN A;  1JKU A;  2C2F A;  3E1J A;  3PW1 B;  2GYD A;  3DBY A;  2K2D A;  2KKD A;  2A69 D;  4DYY A;  3ZG6 A;  2C2J A;  2XJQ A;  3L0M A;  5K2M E;  2FG8 A;  1BG7 A;  3PVR B;  2ZA6 A;  1C09 A;  2PVE A;  1IRN A;  1JRE A;  1NF6 A;  4AHW A;  5JAC A;  3BKN A;  4IWJ A;  4RC7 A;  1R0F A;  3MPS A;  4P18 A;  2XJR A;  1VEL A;  5CMQ A;  3KWO A;  8RXN A;  3UOI A;  4ZMC A;  3QHC A;  3F37 A;  2JD8 0;  4DYZ A;  2WLA A;  4LHN A;  2FKZ A;  2V2S A;  2CEI A;  1UVH A;  4JAD A;  2CLB A;  4YVZ A;  4Z3B A;  2C6R A;  4TO9 A;  2IB0 A;  2VZB A;  3LKD A;  4AM5 A;  1Z4A A;  5GU3 X;  1T9Q A;  1IES A;  2ZA8 A;  5JKM A;  4UY8 1;  4TOH A;  4DI0 A;  1OWC A;  1J30 A;  1UMN A;  3PKI A;  5ERK A;  3T9J A;  4ITW A;  3RBC A;  1VCX A;  3ISF A;  4EVB A;  3R2R A;  3VVA A;  1R03 A;  3PVY A;  3V3K B;  1QCV A;  1S30 A;  2ZUR X;  4ZKW A;  1JGC A;  5J9V A;  4E6Y A;  4ZLW A;  1LTL A;  3Q4R A;  4LQV A;  3BVL A;  4TW3 A;  3RAV A;  1T9O A;  2A6E D;  3KYY A;  2PYB A;  2IY4 A;  3R2H A;  1B71 A;  4ITT A;  3IQ1 A;  3PVT A;  2PPT A;  2CLU A;  2X17 0;  3FVB A;  1H7V A;  2CN6 A;  2WWX B;  4EVD A;  1ZUJ A;  4X0J A;  4RXN A;  1O9I A;  4LQJ A;  1IW7 D;  3E1M A;  5JVH 1;  2V0E A;  5FFD A;  2VXI A;  1L8I A;  5FFA A;  4AM2 A;  2Y44 A;  4E40 A;  3Q4Q A;  1JIG A;  4POG A;  2VXX A;  5MFZ A;  2BE5 D;  2ZA7 A;  4TVM A;  2V2I A;  3NP0 X;  2JD7 0;  5GU1 X;  4CVT A;  5AI2 A;  2Z90 A;  2GYQ A;  3A68 A;  4ZKH A;  3F33 A;  5FEJ A;  4XKU A;  5JDO A;  3KA6 A;  2V2O A;  3KA4 A;  4LQH A;  5GN8 A;  5FFB A;  5HJF A;  1H96 A;  3PIO 1;  1KRQ A;  2V15 A;  3RE7 A;  4CMY A;  1YK4 A;  4U67 1;  2H12 A;  4ZN3 B;  1MFR A;  1YUZ A;  1Z6O M;  4ML5 A;  1RYT A;  1YK5 A;  4ISP A;  4JAF A;  4KVS A;  2NYD A;  3KYW A;  5LG2 A;  3PWQ C;  3WVV A;  1S24 A;  4ZL5 A;  1YUX A;  3BVK A;  2XJU A;  5LS9 A;  1DAT A;  4MKU A;  1RCG A;  3KA9 A;  5I4J A;  3E6S A;  4XGH A;  4TOD A;  4ERU A;  1VLG A;  2B5I D;  3J7Y 1;  3KYX A;  1GWG A;  2RBD A;  2ZG8 X;  4PG0 A;  5GAD c;  2XJN A;  5D8Y A;  2C2U A;  4PG1 A;  3N6O A;  5LG8 A;  3AJQ A;  2Z5R A;  3GVY A;  3KYV A;  3R2L A;  2XJS A;  2FG4 A;  2FHA A;  4IWK A;  2CKA A;  3LNL A;  2ITB A;  4ZN1 B;  4RC5 B;  1F33 A;  3UFB A;  1VEI A;  4TOE A;  4AR3 A;  2Z3Q B;  1NNQ A;  4LHL A;  5GAE c;  3C1Z A;  1LB3 A;  2G38 B;  4M33 A;  2V0F A;  2M6O A;  5IY0 A;  7RXN A;  4RC8 A;  2V3B B;  5EIO C;  3B08 B;  3WWL A;  4PGK A;  3RD0 A;  3NOZ X;  5FFE A;  2DSX A;  3RYG A;  3F34 A;  5GU2 X;  1VZI A;  5JKL A;  4Z5S A;  4AHZ A;  2BK6 A;  3PZA A;  3GGZ A;  5CMR A;  3GGY A;  2N02 A;  3AF9 X;  3SID A;  1RCD A;  3Q4O A;  2W0O A;  1ZS3 A;  1T9P A;  5J8W A;  2A68 D;  4II4 A;  2CF7 A;  3O7S A;  2HTN A;  2XJP A;  5AI3 A;  1VEQ A;  1R0H A;  2Z3R B;  4M32 A;  5LBH A;  4CVR A;  3KA8 A;  2CKC A;  1RDV A;  3PIP 1;  3WVW A;  3BT5 A;  3B0A B;  4XXB B;  1DX8 A;  4DAS A;  2JI2 A;  1LKP A;  1RCE A;  3AF8 X;  1XZ1 A;  5J8S A;  2XJT A;  5J93 A;  3E1L A;  5MLC 3;  2FFX J;  4LYU A;  2ERJ A;  3MSU A;  1TJO A;  4WJG 4;  3P8B A;  2AYJ A;  2O5J D;  4AI3 A;  3P2A A;  5AN9 H;  3PVY B;  1ODH A;  2GS4 A;  3EGM A;  1LKO A;  4Y08 A;  1E8J A;  1AEW A;  4CYB A;  4ZKX A;  1SQ3 A;  3BVE A;  1CAD A;  3U90 A;  4AI0 A;  4AR4 A;  1TK6 A;  2C6A A;  2L0Z A;  4R42 A;  3AK9 A;  2AR0 A;  3A9Q A;  1BQ8 A;  4TOB A;  4AI2 A;  1S2Z A;  2FZF A;  3PVT B;  3EZU A;  4LYX A;  3TA8 A;  4LPM A;  1DVB A;  1IRO A;  2OKC A;  3PWF A;  1SMU A;  3C23 A;  1WJV A;  2YW6 A;  6RXN A;  3OGH A;  3KDQ A;  2MS3 A;  2CN7 A;  1N1Q A;  2GMG A;  4RC6 B;  4ISM A;  1XZ3 A;  1B2J A;  1DPS A;  4DE6 A;  4A25 A;  2C6B A;  1BFR A;  2YW7 A;  4KVR A;  4LPJ A;  1B13 A;  5HU6 D;  5JKL G;  2IU2 A;  3E1N A;  1BFY A;  3FRR A;  2XGW A;  2BW1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...