1YVDA

Gppnhp-bound rab22 gtpase
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
166
structure length
166
Chain Sequence
SLRELKVCLLGDTGVGKSSIVWRFVEDSFDPNINPTIGASFMTKTVQYQNELHKFLIWDTAGQERFRALAPMYYRGSAAAIIVYDITKEETFSTLKNWVRELRQHGPPSIVVAIAGNKCDLTDVREVMERDAKDYADSIHAIFVETSAKNAININELFIEISRRIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of family-wide Rab GTPase recognition by rabenosyn-5.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein transport
molecule keywords Ras-related protein Rab-22A
total genus 53
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2005-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1yvdA00
3IKJA 2FOLA 5TMPA 2OO7A 2IWRA 5CYPA 3EA0A 4Q9JA 4YDHB 4AI6A 2P0EA 2ZAOA 3AVPA 4V03A 4LJAA 4YQFA 2AFHE 1OW3B 1A2KC 221PA 5DO9A 1U94A 4XVQA 1T3LA 1E2QA 2BJWA 2I3BA 1CXZA 4OQFA 1YZUA 2WWYA 3TLXA 4HDOB 4JYCA 4MRSA 4PQYA 1KHTA 1GFIA 4NMMA 4NH0A 2BMDA 3AH8A 1TQ2A 3QXXA 3MMPA 4OI2A 3OHMA 1X1SA 4QGGA 1IM2A 2EYQA 5M04A 4NL4H 2HDNB 1JPJA 1UEJA 3C4JA 1OXXK 4QNMA 5B64A 1KO1A 4YLGA 1E94E 3VNVA 4MUBA 4DCTA 4Q4AB 1OH7A 2O8CA 1GKYA 1M7BA 1ZD1A 3NTUA 1T9HA 1S3GA 1NN3A 2AN9A 2OE2A 4KSCA 1TEVA 2ZI6A 4NPHA 4Q4HA 1ONBA 5G41A 1XP8A 1E9SA 3KJHA 3PUWA 1IHUA 3CM0A 2OT3B 4D0NA 2QM8A 1JXOA 2IYRA 4PC7A 2BBSA 3A36A 2YWGA 4Z8YA 1GILA 1H8HD 3RS3A 4PHTA 2HEIA 3WMFA 2AR7A 4WZBE 3ND8A 3BORA 3VTKA 4HAZA 4B44A 3GJ5A 1NLZA 2QRZA 3I73A 3L0SA 2WWGA 3PEUA 4MYUA 4TWZA 4HAXA 2G3YA 1XEWY 1QHSA 1W47A 2KE5A 4IHQA 3K0SA 3PUZA 4IJMA 3C5HA 2ZI4A 1KK3A 2EFHB 5IRCD 5GJVC 4B35A 4UNSA 2ZI7A 4LBVA 4XSGA 2Z0MA 5K8UA 5F2EA 4HDQB 3TR0A 2H5EA 2D7DA 3RS4A 4KVGA 2JLRA 3NC0C 5GJWC 3QE0A 4LJ4A 5SZKB 3TUZC 1FQKA 1KI8A 1Z29A 5EXSA 3QG5A 1OIXA 1ZNWA 2G83A 3QENA 3SZRA 4B74A 4KU4A 3QNUA 3DOFA 5KTYA 1LV7A 1OFUX 5JWOA 3HU1A 2HF9A 2I1VB 2B7CA 3NBZC 1JBKA 4FIDA 2YKGA 1FX0B 4ERNA 5CB6A 3LFUA 1IY2A 2ZJZA 4LSGA 4ZI3A 3VR4A 1OIWA 1U90A 1MRNA 5E7IA 2JA1A 4FCTA 4DCSA 4Q9HA 4FD2A 1AA9A 4GOXA 3CX7A 3CF0A 4KHZA 4IEEA 3QUSA 4LY6A 3E1SA 4BLSA 2AKYA 3WBJA 4LYHA 4AWXA 1CKEA 4ZCLA 1XWIA 4GNKA 5C46F 4FINA 4O3MA 1LVGA 2BCJQ 1IOZA 1JAIA 2JJ2A 2W2TA 3ICQB 5K8TA 3C16C 1YHNA 2VP0A 2BKEA 2I1QA 3KKPA 2CK3D 2CL0X 3NIBA 2DHRA 4LJ9A 1KO5A 1XTIA 2W6ID 2DWOA 1A4RA 3GLHE 4HUQB 5DI3A 1ZNZA 4DDVA 2OFXA 3I5YA 1JNYA 1JR3D 1I4TD 1ODFA 3U6BA 2R65A 4YMSA 1SKYE 1BS1A 4RCZA 2D3WA 2HT6A 2OBLA 3GJ0A 3TUJC 1RJ9A 4KI0A 1LNZA 4RZ2A 2L0XA 3HYTA 2ZYUX 4WW0A 1S96A 3KB2A 2F3RA 4V0KA 4LHYA 1US8B 3U3MA 4LZZA 4HB3A 1ELOA 4B43A 2IL1A 2AXPA 2WZQA 5BYKA 4Q9IA 3RRYA 2IHBA 4LV6A 4RCYA 1TUIA 1OB5A 1EFHA 5CM9C 5JEEA 4ZDKA 4Q48A 2QMEA 3FKQA 2XAUA 2DWPA 2X8AA 3OAAA 2V4ZA 3LQRA 2DB3A 4B2PA 1Z0IA 3N5CA 3VU9B 4DHEA 4C7OB 1AN0A 721PA 1XMIA 2NOAA 2F7SA 2R6GA 3QY0A 3A58B 4QBIA 3QG1A 3QVVA 3FKSA 3WHKA 2DFKB 2BEJA 4KODA 1EFTA 2CNWD 1KZ7B 3SYKA 4PZLA 5JWHA 4XD7D 5EP3A 4LBYA 1FP6A 2O0JA 5KDDA 3CBQA 3GLFB 2QPTA 3BIFA 4IDQA 4Z1MD 1Q1QA 2CHQA 2VSFA 4BWYA 1OV4A 1US8A 3A4NA 5C1BA 3HR8A 2WHXA 3KZ1E 1NJFA 3NKVA 1XF9A 1QHXA 2DWQA 1Y63A 2JLQA 4EJSC 1VG8A 1G3QA 4RKFA 1EWQA 2QAJA 2WSSD 3AVOA 1NBMA 1I2MA 3CF6R 1T3HA 1NVUQ 4G1UC 4R2HA 4M1YA 2VHJA 4PHFA 3EIEA 4OK3A 2VHTA 3KXKA 1J70A 1E4YA 3KTAA 5H68A 3ADBA 1E2IA 1VG9B 3FOZA 5G53C 2JDID 1G9XA 1E0AA 1S1CA 4BFUA 2IYUA 4PANA 1VPLA 5LDDC 3ND9A 4LC1A 2PCJA 621PA 2Z83A 4LPKA 4LX0A 3H84A 4BRUA 4KYUA 2FMXA 3GLIB 4QJ5A 2CE2X 1N6LA 3I8SA 1E1RD 2P5SA 1G8FA 3QPVA 4ZDIA 1XNJA 3KUDA 2HLDA 3AB3A 3ZYCA 4I1SA 1Z83A 1XXHA 3SJZA 1ZIOA 2O0KA 1G16A 5HCIA 1DOAA 1FNMA 3BBPA 3TW8B 1Z2CA 4B6EA 1IXZA 1RIFA 1H8ED 2ZE5A 3NHAA 4EQ6B 3U3JA 4NCJA 3UKDA 2ZRIA 3DKPA 3W6PA 4HLCA 3U3RA 2OFOA 2B92A 2VYFA 1W4CA 2YJTD 2AWOA 4JBXA 4R98A 3E5HA 2JLSA 2W0MA 4Q00A 3RABA 1PLLA 5HE9A 2GRJA 3I3SR 1CRPA 1U8ZA 2ODEA 2IS4A 5TVKA 4LJ6A 3GFTA 1QVRA 2YYZA 1VCNA 2ZM5A 2GETA 2OESA 3EZ2A 3L82B 3OIYA 3PEYA 2JLVA 2Q6TA 4ILEA 5F9FA 1XJCA 1H8EA 1YRBA 3ZS9A 3TMKA 3K9LA 3KQUA 5LB2A 1EFUA 2JAQA 3BFKA 4A6XA 3O8BA 2GCOB 4NYIQ 2OEPA 3AUXA 1UEIA 3RSOA 2MSDB 3LWNA 1MO3A 3K0AB 4PTLA 4PZYA 1A1VA 3LY5A 3IDQA 1BMFA 4QJ3A 5BN5A 4M1SA 3I32A 3OE7A 1NSFA 4DEXA 4URZR 4ZIRB 1W4RA 4TZ6A 4LCBA 1Q3HA 1KSJA 4JLOA 3PIRA 4J0QA 2WMNB 2ASEA 5CK4A 4B76A 4E5UA 4TL7A 2ZROA 4P4SA 1CJMA 5DH9A 1MO6A 3FVQA 4GL2A 4C7OA 2J0UB 4PC2A 3D3QA 5FI1B 3AF1A 2FSHA 4LHXA 1W49A 4XSHA 4EPTA 4ZDJA 1NNEA 1HEIA 3Q3JB 1U81A 1P9RA 4DCVA 2GJSA 3CW2A 2ZJYA 3KFVA 4A15A 3SU8A 3A1SA 5JWRA 2HYIC 1X1RA 3ZZUA 1XD8A 4IFEA 1KGDA 3BB4A 3GLFA 3Q85A 3FKSD 2HLDD 3LRPA 2AK2A 4NYMR 1G3IA 3IHWA 1AK2A 4UJ5A 5KSOA 2PEZA 1UKZA 4QM7A 1TF2A 4BFVA 421PA 5LD2C 1DVRA 2JJ8A 3OIVA 3K9HA 4M1TA 4WIAA 4EPVA 1Z63A 4DUGA 4OYHA 4CEJA 4FXPA 1A82A 4TLAA 3B2EA 2ZRAA 2F9MA 1FNNA 1JR3A 1XX6A 4QHYA 3ZZ0A 1KSHA 5HZKA 2NO6A 5DLQC 1DPFA 2GESA 4JBYA 1MV5A 5TXGA 3EZ9A 1DAMA 2D2EA 2FZLA 5CJ2A 2C8VA 3PEWA 4Q1BA 4ZV4A 4A0RA 2ECKA 2QI9C 1UM8A 4UNNA 3KB1A 4FWIB 1J7KA 821PA 1H8HA 1DO2A 1G18A 2EWWA 1M74A 2GKSA 3FYHA 4UNQA 4R9UC 1DAEA 1E2EA 4C2TA 1N2CE 1R5OA 5JSZA 3NBXX 4HZIA 2FA9A 2CK3A 3QBVA 5GJCA 3IO3A 1E2NA 4DLUA 3QF4B 3K70D 2V55B 2D62A 2YNMA 1MT0A 4DBLC 3U7GA 1A7JA 5AWFC 5KOYA 4HLUA 3CPEA 4QGHA 3KXIA 2OV2A 4F4IA 2FZ4A 2IF2A 2ORWA 1OXUA 2BBOA 4WXPA 4RD4A 5AJXA 2GJKA 4C0BA 1KO8A 4TLDA 2BWJA 5TB5A 1N0WA 3AP3A 3UWOA 4O2RA 1CJVC 1T91A 4GSYA 2IUUA 2R6CA 4RZUA 1YQTA 1F60A 5IK2D 1SXJE 1RC8A 2VA8A 521PA 3E70C 5FL7D 3THYB 3UMRA 3C41J 4TYPA 1P7CA 4B3CA 1W36C 4OK5A 4XH9B 1XFAA 3ZD6A 3OFNA 2QGZA 3C15C 4AK9A 4KO8A 4JL6A 2OAP1 3ASYA 3UXMA 3LQQA 3REGA 1FPMA 1UDWA 2NMVA 2VPPA 1G20E 1UPTA 1G5TA 5AJYA 2WJYA 3U3OA 3VKHA 1OF1A 2FE4A 4A36A 4AKHA 4TQ9A 5CDFE 1SVSA 1P2TA 1GRRA 4DDUA 1JI0A 2QORA 4LYAA 4L15A 3SJBA 3GQBA 2IWHA 2ZRFA 1SZPA 2OAQ1 4Q1AA 3TJZA 4NCIA 2QP4A 1ZP6A 2YOHA 1NP6A 2A3RA 3BD9A 1E2PA 2AFIE 3QXSA 1GDDA 3W8RA 4MDFA 3IBGA 1TMKA 4P0TA 5IF9A 2C5LA 3R9IA 4AURA 4L5BA 1XCGB 2C9OA 2YWEA 4V02A 2GTPA 4WAUA 2OXCA 4TMWA 3W5IA 4B3DA 4B34A 3K09A 4PC6A 2PL3A 2GAAA 4EPWA 2XSZD 1DAKA 4AYTA 3RWOA 4YXWA 2D7CA 1E2KA 2QUZA 3OF5A 4X8MA 3KKOA 2X2EA 2K5UA 4V0LA 4UNRA 2ZSAA 4PPGA 1IN8A 4I1VA 1JQJC 4HAUA 4BFWA 2O8EA 3NBYC 4G5RA 1YKSA 1Z0FA 4OHVA 4BZPA 5L3QA 2BBWA 1W2HA 2EQBA 3T34A 3ZVRA 4LPSA 3EA5A 2ZRGA 3EASA 5GADl 1W5SA 1P2VA 4LJYA 2F9LA 5HKKD 4CEHB 4BZXA 1SVMA 1RRGA 1TUEA 3AUYA 3P27A 4CZ2A 4EFLA 1GM5A 4JJKA 3CRW1 1U0LA 5JECA 3L8YA 4U5XA 5B2ZA 5EXPA 3EPJA 2P2LA 2CLDX 2J0SA 4D81A 2ZIAA 4HB0A 2ZSBA 1WDTA 2WIBA 3L43A 2ORIA 5FBVB 4Q47A 3WNBA 1FW6A 4PPFA 3SOPA 2J0VA 2OUKA 3I1FA 5H1YA 3LH5A 2FF7A 3BERA 4RVCA 1OXTA 3AKEA 3U3KA 4B2LA 4AKIA 4DLTA 1CRQA 2ODWA 1Z6YA 1NF3A 2CCJA 3W5JA 3RRZA 4PR0A 4PO1A 1TQ6A 1YR8A 3Q9LA 1KK0A 1VCIA 2RCNA 1N3BA 2QL6A 4FCWA 1P6XA 5EP1A 1P2UA 3RLFA 4BLQA 4DT1B 3O8CA 2QENA 4B3BA 2QP3A 2P5TB 3Q72A 1OKKD 2GA8A 1OFIA 4URWR 3S1AA 4BFYA 1G4AE 1SXJA 1R0ZA 1LFDB 3LD9A 4TL9A 3CX8A 3EZFA 4Q1FA 2C95A 4ARZA 1BKDR 4DDTA 2HYDA 4ZCIA 4PSKA 3MWLA 4CT4B 4Q9KA 4I1OA 4GMDA 1ZC3A 4ZKDA 4TTPA 1LS6A 1TTTA 3TGPA 3O8RA 1W1WA 1KDRA 4UNPA 5HCNA 5EE5B 2AX4A 3N70A 5IHPA 3QJYA 3X2SA 3ZVNA 2WOJA 1W7AA 2AXNA 1X8JA 5JI2E 1KY3A 1J2JA 1Q1BA 2XOKA 2IYWA 4HAYA 5ELXA 3F0TA 3VKWA 5GVRA 1Z6XA 1VTKA 4EFMA 5BYJA 3VU9A 2WAYA 1CLUA 1MABA 1E32A 1SVWA 4TLCA 4Q4AA 5FTNA 2FPMA 4QBHA 1E1QD 4TT3A 1IN6A 3KUCA 2BMJA 2R6FA 4TQUS 1G5PA 3NEJA 3KKQA 1TQ4A 1IQPA 2J9RA 3EPKA 4G3XA 4TMKA 3LA6A 3HPRA 4DC9A 4OQNA 4IDPA 3A4MA 1RKBA 4GOKA 2YC4C 1X8LA 1SHZA 4FWTA 4Q4HB 1WA5A 3DKVA 3EC1A 3WYGA 3N2IA 4HB2A 4G5SA 3U44B 4K8OA 1P5ZB 2D74A 3MWYW 1OHHD 3TH5A 4G5QA 4PHHA 3FFAA 2IK8A 1E9EA 1NN1A 3OE7D 2X77A 2PCLA 3TAUA 2JLZA 3HWSA 4HB4A 1QZXA 1NMXA 2C96A 3WRYC 3C14C 4DSTA 1W4AA 4G5OA 3KQNA 3C8UA 2PLRA 1U98A 1PVOA 3HYRA 1WCV1 3DPUA 4JLVA 5CK5A 3CH5A 3TAHA 5KNBA 3KL4A 1R0WA 4KFRA 4UKDA 4JBWA 4KV9A 3U7HB 1JJ7A 1U9IA 4YDSA 5A0FA 3JZAA 2QZ4A 2V1XA 2YOFA 1E79D 4KFUA 1YZGA 1COWD 1VIYA 4A92A 1U0HC 2B8TA 3CONA 1PUJA 1X3SA 4QXAA 1JXMA 2Q21A 1FOEB 5DSZA 3L0OA 5HR5A 2XNDD 2IA5A 1JEEA 2YINC 1AIPA 1RVDA 2JATA 3V4FA 4AYXA 4U7DA 2IS2A 1GL6A 1P4SA 4JJZA 1TAGA 4ACBA 3AVWA 1N0UA 2WWIA 1SVIA 4DB4A 4LBWA 1ZCBA 2EU8A 2GNOA 3UIEA 1ESNA 1OT3A 1Z0DA 1WP9A 3DEFA 2ZR9A 4HATA 2HXSA 3UG7A 3VR5A 3NHBA 3CRMA 3OEEA 4KAXA 4NYJQ 2JCSA 1DEKA 3RAPR 3RC8A 4AY2A 4IRUB 5EE9A 1NLYA 3ZGXA 3B6EA 1XPUA 2GJAA 4GI7A 2GJ9A 2FDCA 2RAPA 3FMIA 1MO4A 3RC3A 1VYTA 3ADCA 4Q7MB 4I1UA 5CIWA 4BLOA 2ONKA 3QF4A 5HE8A 4MYCA 5BXQC 2XTZA 4QKQA 2JDIA 1KI3A 4LWZA 3T06B 2O8BB 1TNDA 1M1YE 5FTMA 2ZS8A 3QKUA 2PMDA 5TARA 2F3TA 5J4KA 1I2DA 3CZQA 1XTKA 1G64A 4HUQA 2ORVA 1GP2A 1XXHB 2Q9CA 2J1LA 2XTNA 2IUSA 4LYFA 3UWKA 1ANKA 3PENA 4A2WA 5P21A 3V4RA 3H4MA 4L16A 4JVMA 5LBIA 4XVUA 3M0EA 4NHOA 1S9HA 1T0HB 2WIAA 4MA4A 2QP9X 2ATXA 2V7QD 3IBYA 3IPYA 3HPQA 4E22A 2VP2A 3GJ4A 4KYIB 5CYOA 1QHGA 3DMNA 4QBGB 5FTJA 4V0NA 4BRWA 3AF0A 4KFTA 4D6PA 2ZITA 4ON9A 4MGZR 1BIFA 2RGAA 3MJHA 5JJIA 1LY1A 2RHMA 1E2JA 2OCYC 1FX0A 2VO1A 2W6JD 1WB9A 4DJTA 3T15A 3KQLA 3I5XA 1EX6A 3V9PA 2D4HA 4AYWA 1RFLA 1EXMA 1LB1B 5C4GB 4NBSA 2CHGA 1V43A 3H1TA 2C2HA 3TE6A 3PEVA 2A7QA 3W9YA 1E1QA 2RGCA 1P9NA 2BMFA 3PFIA 4JKIA 2QT0A 4NKRA 4P31A 2QTHA 2GAOA 2XOKD 4LK2A 2QMHA 3K0EA 4Q1CA 2DBYA 1UAAA 1RYHA 1TPZA 2BMEA 1XTSA 2QAGA 1COWA 2FPLA 2VBCA 1OFTA 2V6IA 1NMYA 2NO9A 2DR3A 3KFXA 3TIFA 3AVUA 1XEXA 5FUXA 1FMJA 1MABB 3NH6A 4HAWA 2TMKA 1EFRA 5EE0A 4UXIA 4R71A 3ZDQA 2H17A 2O8EB 4C0LA 2HV8A 2VSOA 5JRJA 3TVTA 3RANA 2ZTSA 3CH4B 2R6AA 3EZ7A 2ONJA 5FFMA 3NC1C 3SYLA 5FI0B 3MJRA 2C99A 4GZMA 4IXMA 1R0YA 5JMTA 1PV4A 1JR3E 3RS7A 2DY1A 1E9DA 5D3QA 1CU1A 2ZRKA 2F43A 2R62A 3GLGB 1G7CA 2WSMA 1Z6GA 4M53A 1UKEA 1Q57A 1DAFA 2PZEA 1NBME 3Q5EA 3W6NA 1KI2A 1E2DA 1SVLA 1Q12A 1G6OA 1R5BA 5L8VA 1OLOA 4NONA 5BN3A 3BB3A 2OG2A 3LNCA 3B78A 4XD7A 4MKIA 3KJGA 1KIMA 4EJSB 1DARA 4A0GA 1Q1ZA 2YVUA 1BO6A 4PC3A 4TMTA 3W90A 3BWDD 3LXRA 2H16A 2BV3A 4CEJB 4C0JA 3NDPA 4KXFB 2XXAB 3FTQA 3RS5A 3BFXA 1G3RA 2WKRA 4HYYA 1Z06A 2XSZA 2UKDA 1CR4A 3PXGA 4CRWB 1NRJB 4L4UA 3EW9A 1HH4A 4GRAA 1EX7A 2WICA 3NWJA 2WMOB 1OFHA 1NJGA 4ARZB 1AGRA 2O8DA 2PEYA 1QHNA 3CR8A 1GNQA 1KJZA 2F1RA 3D6TB 4BPBA 5FOUA 3TR5A 3A37A 5HZHA 2FWRA 3EG5A 4GP7A 3CF2A 4DSUA 4ZIRA 5FH9A 1ZIPA 3VHLB 2PT5A 2ZVPX 2AD5A 5KUTA 2IBMA 4EIWA 4M9ZA 1K5GA 3VR6A 2W6IA 3BRWD 3AVVA 1RRCA 4K46A 2UVQA 1RRFA 5E7MA 1GVNB 2MSEB 2VRWA 2FN4A 3IUYA 4FMBB 4IOJA 5IT5A 4CVNA 1M34E 3H2YA 3A8TA 1YRAA 4D82A 1FTSA 1VKJA 2LKDA 2ZE6A 3EX7C 4JL5A 4P4SB 3W6OA 1Z5ZA 1RZ3A 1P62B 2GZHA 3THYA 2WVJA 2HJVA 4TTQA 1S1MA 5FTLA 1E2HA 2A5FA 4AKEA 1KOFA 2DFLA 3BS4A 3OFND 2G0NA 1P60A 4Y0AA 1GNRA 2ZANA 2G88A 1NVXQ 2ERXA 2XJ4A 1P72A 4FMCF 1II8B 4F4CA 2WBLC 1YR9A 3KDSE 4BECA 4AC9A 2GCNA 2JIZD 2PT7A 3BB1A 4F7WA 3QSYA 4POAA 1UF9A 4X8LA 4JLNA 3NXSA 4UXHA 6Q21A 1ZU4A 1MOZA 1HE8B 1VYUA 1H65A 1WQ1R 2FJUA 2G6BA 3B13B 1L2TA 4OJKA 2ZE7A 1R6BX 2CJWA 2NG1A 4ZCMA 1DG3A 4XVRA 1X6VA 2IEZA 3VAAA 4IOMA 1ZMXA 2NPFA 4A82A 1R0XA 1E98A 1P2SA 4PPNA 3ZJYA 3ZZTA 3THXA 1AS2A 1YZTA 3EWSA 1A2BA 2ZJOA 3I8XA 3TK1A 4A4DA 1TU3A 3REFA 2OCAA 2KI5A 2IYYA 1TX4B 2FGKA 4BFXA 1CIPA 3KJEA 4ZDWA 1J8MF 3CNNA 4ITRC 4MGYR 3D7MA 4US2R 3B9PA 2D06A 4M1OA 1J90A 3CRRA 3QEOA 2WKPA 4Q4LA 5F3WB 3PCRB 3IGFA 4Q4JA 1TQDA 2WJJA 1L7VC 1KTVA 2F1IA 1UADA 1GNPA 2HT1A 1DBSA 1KMQA 1UDXA 4D80A 4BEJA 1NVWQ 3TSZA 1CP2A 4LHZA 3E2IA 2OSBA 1T3SA 3TBKA 1XB2A 1ZBDA 2Z5FA 3CRQA 2CJWB 3CWZA 4YMUA 2D2FA 5DHFA 4BFZA 1OJLA 4QHSA 3UATA 2O8BA 2ZREA 4PQRA 3L0PA 4HLUC 2BHRA 4MGKR 3DMDA 4BGDA 3X1ZA 4WOPA 4DLXA 3EC2A 3U4QA 2WAXA 3BAFA 1KDTA 3R9XA 5E7JA 2OCBA 2NGRA 1ZM7A 1QBKC 4OQMA 1KJWA 3T1OA 3P20A 1MKYA 3GLFE 4M1WA 3SC3A 1R2QA 3GMTA 4Q1EA 1G8PA 1IJFA 3K70C 4AD8A 1LF0A 1KKLA 3AKCA 4Z54A 5DISB 3FMPB 1OSNA 1KKMA 4JL8A 3ZD7A 5HPYB 2GEDA 1NIJA 2WSSA 4HUTA 5JLJA 4WZ6A 1R7RA 1YZQA 5F98A 2QBYB 2RGNA 3HDTA 4HAVA 2GCOA 4PSVA 3R7WB 2BKUA 1O3YA 2CLCX 5TV2A 3K09C 1HYQA 1XDBA 3SJCA 2FSGA 1OH8A 4DKXA 2UZIR 5FBLB 2EFCB 4B47A 2H18A 4DLSA 2WWWA 2OFWA 3K0AA 2ZYTX 2Q3FA 3LLUA 3MD0A 3WYFA 2W0SA 1XTJA 2IUTA 3AKYA 1F2UB 3LX8A 1KI6B 3T61A 1AGPA 3K0CA 3A1UA 3K0FB 3WRXC 2ZS9A 4PPQA 3LDAA 5JCZA 2QRNA 3QXHA 4PSAA 2VP9A 4HSEA 5AK0A 1AS3A 2ZEJA 1HE1C 3F3YA 2GDJA 4FMCB 4DLZA 5JBQA 3TQFA 2NO0A 2A5YB 4OJQA 4CGZA 1QF9A 2CEAA 4RZXA 4US1R 2GXQA 1OYYA 3AQ4A 5FPSA 4KLNA 4R2IA 4U02A 4DCUA 3IHLA 5J40A 3UMSA 5FL7A 1D9ZA 2B6HA 1G3UA 4ASUA 2NQ2C 2FH5B 3RSLA 5UKDA 2Z6VA 1YR7A 4HLDA 4RFSA 5FPKA 2A5GA 4Q02A 5KNCA 4IVQA 1AQUA 5EXXA 3U44A 1E0JA 1G8GA 2ZYVX 3NBFA 3QKTA 4YMWA 5DNYB 2DFTA 3GJ6A 2VH5R 3THXB 2O0HA 1Z8FA 2GILA 1E79A 3WMEA 4DWJA 2F1HA 3I62A 1G1MA 3HU3A 3M4YA 2VP5A 1GKIA 4O25A 4F92B 3RRMA 4GDFA 1E99A 1QDEA 4LV8B 1R5NA 1NBMD 3WP0A 2WJHA 2WKQA 3U5ZB 1KJYA 2MMGA 3OZXA 3TKLA 1NKSA 1UBFA 4DSNA 1U2RA 4ESHA 2W2XA 3GLGE 4E07A 4GFDA 4DT1A 2QE7A 2CDNA 3P32A 3EIHA 1XZQA 4TSFD 1IXRC 5AJWA 2HUPA 3GP8A 1K5DA 3EPHA 3FDIA 4W9MC 3D8BA 1XRJA 1XJQA 3KX2A 1X86B 2ZRLA 4MDEA 1Z0KA 1JPNA 1JR6A 5JSZB 2GHIA 4OBEA 4D0LB 4DRZA 1E0SA 3P1JA 1XCPA 4M8NE 4URYR 1D2EA 1NI3A 3RRNA 3GJ8A 3P4YA 1DS6A 4B73A 3O47A 2XNSA 2C9YA 3R8CA 3W3AA 1VYVA 1SHKA 1Z6TA 1VG1A 3K70B 3EARA 4BLPA 4D4JA 2ODBA 1W0JD 2QQEA 3ZIAD 1OB2A 4OI0A 5KPJA 3DVLA 2QMUA 2VLIA 3PQCA 4KVAA 4RD1A 4DZZA 4EKDA 5A5GA 2XNDA 3KKMA 2LCFA 2HJGA 3I61A 1Z22A 2NZJA 3AP1A 4V0ME 1D5CA 3AVQA 3MWKA 4OQLA 4RJLA 2PX0A 2QM7A 3C5CA 4B33A 1QG4A 5JJLA 1QHYA 3ZLJA 5AJVB 3OIUA 2QBYA 3SHWA 4RD6A 4YONB 1S0UA 2YZ2A 5FBWB 1U99A 2ZVQX 1CJTC 4RD2A 1GOTA 4TYYA 3VX3A 2B21A 3KQHA 5SZJA 1GUAA 3BC1A 3B85A 2P67A 1E69A 4PO9A 3F8TA 4MKGA 4A2QA 5JEDA 1M7GA 1N5IA 3LW8A 2ZJ5A 1JB1A 4BLTA 1XBTA 3S1AB 1W36B 4GP6A 5J47A 3LLMA 3JVVA 2GJ8A 1OIVA 2CCKA 2JJ1D 2H1LA 4ESVA 4D26A 4ACAA 1BMFD 4TL6A 1XEWX 4A1FA 3QEJA 4M2LA 4PFSA 5KDOA 4B3GA 4N3NA 1NY5A 2UZ3A 5FUYA 3K1JA 4NCNA 2PZGA 4OHYA 3LV8A 2FG5A 4CYMA 1G7SA 4Q9LA 3O8DA 4CDGA 5E95A 1FMLA 4NYMQ 4UXJA 2KJQA 4KSBA 1LF5A 4KLZA 2ZJ2A 2EWVA 2HXYA 4MRPA 5G3ZA 1TL7C 1Q22A 4DLRA 2QROA 2VF7A 1KK1A 1VIAA 4IOKA 1N6NA 3QPUA 4DVGA 3HJNA 1DELA 3SBEA 1L8QA 4X8HA 1D2MA 4D4LA 2JLUA 4KJZA 4MH0R 5EUQB 2C9CA 1VCMA 2CVHA 3MGCA 2Z43A 4LUCA 2FU5C 5L3QB 1FZQA 2CL7X 1QRAA 4LV5B 1QHIA 2J7PD 3PV0A 3JVUA 4NE2A 5AUNB 2KBFA 3GEIA 2QAGB 4CEHA 1EFCA 1CR0A 4TLEA 4TQAA 4C0AC 2QEQA 4OKSA 2GZAA 2IS6A 3GLHA 3MCAA 3T1QA 1E2FA 3EZ6A 3UG6A 3VQTA 1JQLB 1E9CA 1F3OA 3ZQ6A 3SJAA 2QG6A 2A30A 3LBHA 5FPTA 3SR0A 4B71A 1YZKA 5C2JB 1TU4A 2ZSDA 3QQ5A 1JAHA 2IXFA 1T5IA 2W2VA 3QOFA 3VKGA 2J87A 4W7SA 3WNDA 5FOWA 4OHWA 4HDCA 3RVBA 2AHOA 4MYHA 5FOSA 1YR6A 3VR1A 5EJEA 2DFNA 3ADKA 3THOA 5B57C 4JKYA 3THWA 4F4JA 4HZUA 4L9SA 1XEFA 2N42A 1GRNA 4IDOA 2VHCA 2Q3MA 3QI2A 2ZUCA 4R7ZA 1WF3A 1YZLA 1FTNA 3DZDA 1ZD8A 2ZETA 1ZINA 3WY9A 4NP6A 5FUWA 5HTKA 1K8RA 1W4BA 2LKCA 4PO8A 5EZ6B 1M2OB 1ZUNB 2OM2A 5JHHB 2BCGY 2FEMA 4S2EA 2EFDB 2V3CC 121PA 4QHTA 4CT5A 4LJ7A 4NCKA 5K8IA 4RD0A 1Z3IX 1WMSA 1XJ0A 3FWYA 3KJIA 1FFHA 1FUKA 1N25A 3WYAA 3CPJB 4TTRA 3SQXA 5JZVA 3EIQA 2RMKA 3A4LA 4A0FA 3T1TA 3MFYA 4FI3C 1ZM9A 5HKKA 4URVR 1ETUA 1CBUA 2GZDA 4JIMA 1I4DD 1PLJA 1KO4A 2CCGA 3FGNA 1T0JB 3B60A 3BH0A 3H86A 5DIFA 2E1RA 1GL7A 5L3SB 5EQTA 2NIPA 1IJEA 1U0JA 3IIKA 4FW9A 5CB8A 3GLIA 5JJKA 3QXCA 2KBEA 1Z47A 2YV5A 4PAOA 3BJIC 2XZOA 3ZVMA 2P6NA 1RE0A 2E87A 1XMJA 2PBRA 5KSPA 3SHFA 4DXAA 4I99A 3V00A 2ZSFA 1V5WA 1HQCA 4YMVA 1OH6A 3K0CC 1QHHA 4W5JA 2QPAA 2CVFA 2V8OA 2DYKA 2GXUA 2VTKA 3HP1A 3TQCA 1GL9B 4E03A 2FNAA 1ZNYA 1S2MA 1W0KA 2AD1A 3B1XA 2ODNA 4C0KA 4Q01A 1DADA 4PAQA 5G40A 2REOA 2IT1A 3L8ZA 4V0MA 3MLEA 2A9KA 1GITA 3TUIC 3K9NA 1KMHA 1G41A 1P73A 4JVSB 3SFZA 2RHDA 1ZNXA 2WJIA 3GCGA 2O8FB 1Q3TA 4C3ZA 1G21E 4PAMA 5EZ5A 4D4KA 4TMXA 1KAGA 1DAHA 2J7PA 4IVPA 2O8CB 2W58A 4FCVA 4DB2A 1S4QA 2W00A 4W5WA 2ZI5A 4BFSA 2RKOA 1Y3AA 2REXB 4JVLA 1JECA 2PMKA 4XJXA 1AZSC 2B8WA 2ZI3A 1LS1A 1E2MA 1N5LA 3B82A 4P4TA 2J46A 4OI1A 4P33A 5L3RA 2X1VA 3BH6A 5KSYA 1KI1A 3K8YA 4C2UA 4M4SA 5JHGB 4NU0A 2HCJB 2WWFA 3PUXA 4JSTA 3D31A 5CM8B 2BM0A 4ABYA 1OXSC 3TNFA 1E2LA 3I4LA 1GZSA 2B7BA 2ZU6A 3ONWA 4Q19A 4D4MA 3AVTA 2J0UA 2FV8A 1E9AA 3AP2A 3DM9B 1E6CA 2FFBA 1CEEA 3U7EB 4JT4A 2ZU0C 2ZUDA 2ZJBA 3LVQE 2XB2A 3THWB 1ZM4A 1NG1A 4O0MA 4EDHA 1SKYB 3FFBA 4XWOA 4W5HA 3QKRB 4RY2A 1ZD9A 1VCOA 4H1UA 2QTFA 2JJ1A 3BH7A 2Q9BA 2GBLC 1M6NA 2V7QA 2FFAA 4LHVA 2G1JA 4C0QC 3A6PC 4OL0A 4LYJA 1UJ2A 2QE7D 5FBQB 2OLKA 5CLLA 4LI0A 1XMVA 3RHFA 4M9QA 1XTQA 2NPIA 1XMSA 3QKSA 5AUOB 5GJBA 1JALA 2Q9AA 1UKVY 4Q18A 2VEDA 5CDFA 1WRBA 2G9NA 4XWKA 4MUAA 4OK6A 3LW7A 1XZPA 3CR7A 4AKGA 1RYFA 3CZPA 3K53A 1N6RA 3U61B 1BH2A 5KSZA 3GLIE 2RH5A 2QAGC 1AM4D 1D8TA 1RRPA 4JLDA 3ZQJA 1KSFX 4XWAA 1TEXA 4US0R 4ZKEA 3WNCA 2PX3A 1O87A 2RB4A 1Z08A 3IILA 4GPTA 4EFNA 2P6RA 2IF0A 4JT2A 3WP1B 4OHZA 1PUIA 2W6JA 3AGQA 2XX3A 2AL7A 3W34A 5FPYA 4EAQA 4TYWA 3WMGA 3X1XA 2FSFA 2VIIA 1T4GA 3GFPA 2EFGA 4MQBA 1Z07A 1ZCAA 2FSIA 3GD7A 2W83A 1PZNA 3GEEA 2WWHA 4Q21A 4GZLA 3PUYA 2VSXA 1WXQA 2OILA 4QFMA 3SNHA 3DM5A 1IONA 4BUJA 3FHOA 1AZTA 5BN4A 1YVDA 3U7FB 1YJ5A 5E4FA 4C4PA 5EP2A 2HCBA 4BFTA 2FX3A 4KITB 5JS7A 1D9XA 5JRZA 1KDOA 1ZUHA 2JGNA 3U60B 2DPXA 4BASA 1XXHE 4B75A 1LTQA 4AIIA 4NDZA 2QY9A 3TSOA 1UBCA 2GVZC 4MRNA 1HTWA 2Q0HA 1A5TA 2FEOA 1NN0A 3AEZA 1J99A 1PLKA 3CO5A 4IDNA 2QNRA 3T12A 1CR2A 1UFQA 3OESA 3A1WA 1KNXA 3G0HA 2KSQA 4L8GA 1IN7A 3KXLA 1UBGA 4N0EA 5JFGA 3L0IB 1XEXB 2ZE8A 1RW4A 2CLSA 2C98A 1L4YA 4JYBA 1XU4A 4IDHA 2XZLA 2J59A 4QOSA 2PJRA 1NKTA 2OHFA 3L2OB 1C1YA 2AKAB 1LW7A 1UBEA 4Z1MA 2J5XA 2QGNA 2FPKA 1VHTA 5J4LA 4UJ3A 2SHKA 5D3MA 3GLHB 2IC5A 3MUFA 3QF7A 4CEIB 2CNWA 5KYKA 1G291 2OBMA 4IVRA 4ASUD 3K9GA 5SZIA 4BQSA 4YMTA 4O2LA 3CUEF 4M9SA 1DAIA 3PG5A 2WOOA 3I72A 4G5GA 4B6FA 3R20A 2YHSA 1MH1A 2F43B 5TDHA 3GLGA 1DG1G 3NVAA 3P26A 1OXVA 2VHUA 1G8HA 2QSYA 2BM1A 1XD9A 4TL8A 4PZZA 4RFSB 3B1ZA 4URUR 4Q7KA 3FMOB 2MMCA 5LB4A 1XPOA 3VNUA 2MSCB 1Z0JA 4JMPA 1BOFA 4C0HA 4D0GA 3G5UA 5CITA 2P6UA 2NO1A 4QGAA 1EK0A 3IO5A 1F2TB 1KZGB 1XD2A 1T6NA 1G7RA 4Q7LA 2GBLA 1Q44A 1GG2A 1NVVR 3AVYA 2NTYC 1E9FA 5GVSA 2ZRPA 1U9IC 4JS0A 3MRSA 4QJ4A 2VL7A 1JJVA 3NG1A 1G4UR 1IAQA 5CJPA 4KCGA 4M21A 5DN6A 1AJEA 4JLBA 2GF0A 2BOVA 1M8PA 1OYWA 2YWFA 1IN5A 1SXJD 4RSGA 4AG5A 4Z8XA 3TVDA 2OBNA 5DHAA 4PX9A 1K6MA 1N6OA 4QL3A 1FP7A 1TADA 3R7WA 2FFHA 3P4XA 3SFVA 1CJKC 3SS8A 1U8AA 4DEYA 1HQYE 4DLWA 1CS4C 2JLYA 1XCMA 5C4MA 3TSWA 3ETLA 2HF8A 1PJRA 2REBA 5L3SA 5H70A 1XPRA 4XTCS 1ZM2A 4L9WA 1G7TA 1F5NA 1P3JA 1SXJC 2J3EA 4KBGA 4S35A 5FUVA 2IYVA 3X1DA 4PHGA 1SXJB 2IXGA 1IY0A 2OZEA 2ZJAA 3WHLA 2VP4A 4P32A 3ICEA 3K0FA 1GRQA 3SQWA 4C9BA 4WA7A 2J0QA 4Q66C 1AKYA 3ASZA 3MSXA 1QHHB 1VG0B 3PR1A 2RGGA 5EE1A 4FMDB 1OE0A 2ZRBA 4NZYA 2V6JA 3TRFA 2BBTA 2WPDD 5CIQA 1BYIA 4TLBA 4TMZA 5FTKA 2ZXUA 5FL3A 5KPDA 4QG7A 1Q21A 3KQKA 2IW3A 2H92A 5EP4A 1IY1A 1Q1EA 1ZVQA 1NMZA 3B1YA 3LVRE 4UQOA 4A9AA 5IDVA 1NIPA 1NLFA 3GEHA 2P65A 3JZMA 1E2GA 3NEYA 5J4HA 1TF7A 2VP6A 3C7KA 4WBSA 3Q7PA 5E3HA 4DLVA 2OXRA 2ZRCA 3DL0A 1S3SA 2H57A 2ZRMA 1EGAA 4TMVA 3AGPA 1KAOA 4PC1A 4Y0VA 2JJ2D 1BYUA 2XXAA 2H8KA 3CNLA 4EPRA 2KWIA 5G3YA 2C04A 1YZNA 3RNLA 1KNQA 4MKHA 2CHVA 1G6HA 1F2UA 2J41A 3NH9A 2ZSEA 1VHLA 1NSTA 4V0OA 4OQXA 1P61B 4LC0A 5L3VA 4DDWA 2ZRHA 3FMFA 1ZW6A 4MYTA 3R8FA 4M22A 1CF4A 4E09A 3N2EA 5AUPB 1MR3F 2XJ9A 3CNOA 3AF3A 4XTRA 1HURA 1IN4A 2GXSA 4D25A 3FHTA 5IK2A 4RZ3A 1N6IA 4NCHA 1E0KA 1KK2A 2QT1A 2A2ZA 3CPHA 3ECCA 4MGIR 5DE3A 2GCPA 2Y8EA 3QKRA 5J5CA 1F2TA 2ANBA 5DGXA 4LOAA 1C4OA 3DOEA 2QQ0A 1D6JA 4MRVA 3BOSA 2C03A 4JLKA 1HT2E 1KDPA 4U00A 2VQSA 3B8HA 4JLPA 4QBFA 3B1WA 2QMOA 2R6DA 3CX6A 4G01B 1UKYA 5J4YA 2OLJA 1SVOA 3QKSB 1EFRD 4N0DA 4BEBA 5KU1A 3B1VA 4MKFA 3RS2A 2BC9A 4HEJA 5LD2B 3A1TA 3B5JA 4ZO4A 5DYIA 2WWXA 1N5JA 5DYGA 4WXRA 5ANRB 2RGXA 1W44A 3LBNA 2ZRNA 1KYIA 1R10A 2IYTA 5JCPA 1ZU5A 3IIMA 3VFDA 3EXAA 3GJXC 2GVDC 2CL6X 2X19A 3LX5A 4TYQA 2N46A 3GFOA 4C0SA 3AV0B 4IXNA 2O8DB 1EWRA 4QNRA 2FGJA 1AKEA 2JIZA 5J4VA 2NO7A 2RGDA 1CJUC 1N6HA 2IHYA 3DO6A 1W5TA 4WZAE 4CF7A 1YE8A 4DUGD 5K8LA 1XTRA 3F5FA 1QVAA 3BGWA 2ERYA 2VF8A 2PH1A 1HT1E 3AF2A 4B32A 1GAJA 2ZI9A 1IXSB 2H7VA 2WPDA 2IYLD 4DIEA 1FUUA 4M0LA 3BFVA 4H9GA 3ZIAA 1NG9A 1FL9A 1HA3A 1E96A 1F48A 1ZRHA 1E9RA 1KI6A 1T5LA 2Z4SA 4A2PA 2X2FA 4NYJR 4ZI2A 4Q5IA 1EESA 4CW7A 1P9WA 1T8UA 2ZR0A 1DO0A 5FR1A 1NL3A 4B48A 2LWIA 2O5VA 1M7HA 3LAWA 4AG6A 5F9HA 2GK7A 2ZRJA 3EAQA 3GJ7A 3PUVA 4BE7B 2E9SA 2G1KA 4NTZA 5LPNA 4QRHA 2YWHA 3CLVA 1HV8A 4CIDA 1KI4A 4K81B 3PVSA 3RDPA 5DN6D 1Z28A 4Q4JB 4I81A 1W48A 4TSFA 3Q7QA 2XEXA 2GXAA 5SZHB 1SQ5A 3IQXA 3KKNA 2F1JA 1GWNA 4X8OA 4II7A 5FOTA 3SYNA 5JS8A 4Q03A 3AKDA 3HR7A 3FB4A 2ZPTX 4IFBA 4YXWD 2CBZA 3CRVA 3W8NA 4LJ8A 3ZH9B 3NDBB 8OHMA 2JLWA 2XTMA 5EE3A 5DI3B 3ZVLA 2EYUA 1E9BA 2ZQ5A 1KI9A 1Q0UA 1E4VA 3LXXA 4JSYA 4TN1A 4XOIA 5D3MB 4A6PA 4RKEA 1G8YA 2A5JA 2WV9A 4YC7A 4DSOA 3LO5A 2ZJ8A 4GMXA 1AS0A 2QU8A 3OEED 2PJZA 1ZAKA 3W3ZB 3IEUA 3X1YA 1ZM3A 3PJRA 2R9VA 2XGJA 1DTSA 1FQJA 2O52A 1AQYA 2ZS7A 3I92A 5FPHA 4HZUB 5FR2A 1B23P 3ZS8A 4IW3B 2RGEA 3EWAA 1CR1A 4DCNA 4QGFA 3QIAA 5AUQA 4EUNA 4DIDA 1P75A 5H8WA 2AWNA 2R8RA 3PITA 1N5KA 3CWQA 4A8JC 1G3MA 1SKQA 2FFQA 4G0NA 4BZQA 3VMFA 2NZ8A 4RFVA 1N0VC 5AJZA 3IQWA 4EQ6A 1U8YA 2CE7A 2ZUBA 3FPAA 3CKLA 2V54A 1YU9A 1S8FA 4FN5A 3GJ3A 3TW4A 3MAAC 1DAGA 2YC2C 1W46A 1W2GA 2KB0A 4B3FX 4XIGS 3MWJA 4LJ5A 1OPXA 5KNDA 4HLQB 1WBDA 2A5DA 3Q8XB 3RWMB 1WE2A 3UANA 4Q7JB 2DCUA 1OH5A 1CTQA 3IPXA 4N1AA 3SI7A 2XB4A 4P3YA 1ZJ6A 3DHWC 3UPUA 3SEAA 1T8TA 4LDJA 3U4QB 1NN5A 1VECA 3KTAB 4JLMA 4QC2A 1SVKA 4B3XA 2GK6A 4A8JB 4PQFA 2BEKA 4I4LA 4M9XA 2IXEA 5JI3E 1Z6AA 1GIAA 4TYNA 1JEDA 2IYQA 1G17A 4QM6A 1NVVQ 2CXXA 4M1MA 1Z2AA 3QBTA 1J8YF 4GBMA 2WTUA 1II0A 1NY6A 2N1BA 4EPXA 4MITA 2RGNC 5B30A 2JLXA 4BLRA 1D2NA 3CB4A 4HI0E 4GT1A 3B7GA 2AK3A 2XITA 5B58C 5KHOC 3M1IA 3Q5DA 4KFSA 4DLYA 2Z4RA 3HU2A 3IIJA 2QSZA 1ZC4A 2EW1A 1KMHB 5FBRB 3SN6A 1GSIA 2WJVA 2O8FA 3OEHD 2EVWX 2ANCA 3U2QA 4IKEA 1RPZA 4TZ0A 3SBDA 1S9DA 4CEIA 4A0HA 2BJVA 1R8SA 2ZYWX 1II9A 1KO7A 2QPOA 3BK7A 1N6KA 1N6PA 4OI4A 1KSGA 4Q1DA 2ZAMA 3BE4A 1R4AA 3DZ8A 1GTVA 1E1RA 4TT3D 3MG9A 3FHCB 1W0JA 4GOJA 2QA5A 2V1UA 2GWHA 3G82C 2GF9A 4MRRA 2EFEB 5TY0A 2JEOA 4WVFA 3UK6A 1L4UA 4D2IA 2C78A 4KBFA 3R9WA 3M6AA 3ADDA 2G77B 2GEVA 3RYTC 3AVXA 1VMAA 2ATVA 3OIWA 4NYIR 4A8JA 1MRSA 4RD3A 2CMKA 4F91B 2IEYA 1KI7A 2WJGA 2WM9B 3A1VA 1SGWA 3AF4A 3QVUA 5BW8A 2I4IA 3T5GA 2IS1A 3U6KA 2RGBA 3LBIA 2BVNA 1ZUIA 4EPYA 4H1VA 3J81k 1C9KA 1SULA 3BXZA 4LBZA 4IEIA 1HY3A 5FOVA 4IOLA 1E3MA 1W36D 4Z51A 2BDTA 2IX3A 5DI9A 2OCPA 5FOXA 1X8KA 4PXAA 4LHWA 3B9QA 3QPWA 1HUQA 4OHXA 4FMDF 3T5DA 4LGMA 1R8QA 1ESMA 1II8A 1VDZA 4ZPXA 4EJSA 3WXMA 3WBKA 2V9PA 2PZFA 1IBRA 2G0TA 2YOGA 3EPLA 3IEVA 3CIOA 2IYXA 5BQ5A 4B2IA 4JLJA 3SE0A 1MO5A 2QTVB 2XZPA 4M1KA 5EXTA 4LRWA 1CULC 5KO2A 2IYSA 4P4UA 5AR1A 3OAAD 3GPLA 1Z0AA 3RS0A 1I4LD 3OEHA 4F93B 1B0UA 2J7KA 1EG7A 1DE0A 2P3SA 2J45A 3FE2A 3UMFA 3X1WA 3T35A 1TF5A 2Q3HA 5BWMA 1RJ9B 1QG2A 1XD2B 3T1VA 1F6BA 1G5RA 3VR2A 3QXJA 4JZKA 4URXR 5CLQA 3SDZA 5A4JA 1ZYUA 1KY2A 2R44A 4F38A 3VR3A 3DDCA 2JASA 2QN6A 2F55A 2R2AA 5C18A 3VX4A 2VHQA 4C30A 1W0KD 1OHHA 2F6RA 2PLFA 2ZRDA 3VHXA 1G19A 3H0KA 4JLAA 5KDLA 2ZR7A 2GEUA 3AM1A 5EUMA 1Q20A 2BIFA 1WBBA 4JVNA 1GKUB 2C77A 1OKKA 2A78A 2IYZA
chains in the Genus database with same CATH superfamily
1XKTA 1I9GA 1G98A 2PWZA 4IGKA 1GCGA 4I08A 2OO7A 5A3JA 2GCIA 2G40A 3SBOA 5TMPA 2IWRA 3HBLA 3PYMA 3WK6A 1MBZA 1RTKA 3DCIA 3Q9NA 2B5VA 2HAEA 2ZT5A 1DNPA 4FBLA 4RXUA 3ZY3A 2XXBA 1ACLA 3DZBA 5LOVF 1J39A 1UPXA 3PC8C 1T3ZA 5F2NA 3F9IA 2Q5IA 4GMGA 1A0OA 1CXZA 3QOXA 2O2HA 1QS0B 3SLGA 5LVAA 5CVTA 3CCBA 1JSXA 4JYCA 1UDAA 4MRSA 1LTKA 4IDFA 1GFIA 1P0MA 3CH6A 3QXXA 4NH0A 2QSUA 4PQYA 1J7JA 2JI8A 3MWEB 1X1SA 4F3NA 1IM2A 1SHUX 1FBTA 1A95A 2EYQA 4IGEA 2W70A 4D8YA 1UEJA 2BGUA 3Q9UA 3VU8A 5B64A 2JVKA 4YLGA 1E94E 4LGVA 4I9FA 4C21A 4MRMB 2Y68A 1L7OA 1OH7A 3HM9A 1RWOA 3BJMA 5FV4A 4G0VA 2WHEA 1ZD1A 1S3GA 4JEIA 2AN9A 5FAKA 2GA9A 1KQPA 3T5CA 2ZI6A 3RLIA 4S1NA 3TZLA 1XMOB 4H7EA 4IZIA 1S3IA 3H0EA 1XP8A 1E9SA 5AXBA 3EEYA 3KJHA 3I30X 4X3PA 4D0NA 3A27A 2BZ1A 4NARA 4RENA 1JXOA 2NAPA 4MMXB 3CHYA 3MJ4A 4YJ3A 2BBSA 3A36A 4C4YA 3KHTA 4ETWA 3U4HA 3R41A 1K7XB 4Z8YA 3QX3A 1Q19A 3D6HA 1HDRA 3OY7A 4NECA 3RS3A 2ZWIA 3IUJA 3KZMA 1WAMA 3O9VA 2G25A 4Z9FA 1T36B 1XLWA 2HMYB 4KW7A 3VTKA 4QARA 3UJNA 4E32A 2HREA 4ALJA 1NLZA 1MB0A 1YS6A 2WWGA 3L0SA 3LUGA 3C8MA 2VR1A 2G3YA 4MRMA 4DC1A 3K0SA 3PUZA 3DE2X 4IJMA 4RO0A 3ZZ1A 2ECPA 3UCXA 2ZBDA 4JVOA 1BX1A 4UUAA 2B98A 4B35A 4UNSA 2ZI7A 3TIXB 4KPEC 1MORA 4DR4B 1TD9A 3ZN2A 1QUEA 5C8YF 4ZRNA 5K8UA 3TR0A 2YHAA 2GOYA 2ISSD 2YXBA 4KVGA 3RS4A 1F12A 3AM4A 4JXJA 2WDZA 2H1CA 3VKVA 1QRRA 4F11A 1ZMTA 1FQKA 3HB0A 1KI8A 2BGRA 1YZVA 4L5YA 3WHPA 6REQA 2WHYA 3DEKA 1QKJA 5EXSA 1EVZA 4X85A 2OV3A 5H3HA 3DL2A 1IJBA 4BNDB 1UJBA 2C2KA 1E6UA 2QMQA 4MWSA 1XG5A 2J0EA 2YJ5A 4KU4A 4MCJA 2OORC 5AI9A 1AE1A 2HK6A 5BVGB 1P4HA 2VYVA 3HBMA 4JUFA 5CCEA 3I6YA 1QK4A 4HBGA 1FX0B 2X8JB 2CJYA 4FZVA 4PSUA 3RRFA 3S5UA 1IY2A 1T34A 4CUJA 1ZG3A 3SICE 2VSQA 1M6EX 1RVV1 5DYNA 2JA1A 4ZEMA 4FCTA 5F1PA 4PCVA 1FDOA 1NF2A 3MGAA 4LOLA 4DJJA 2YTZA 4ZHQF 1SU6A 3WFIA 3CX7A 4BY9E 1M1XB 1R6UA 3P2MA 5ILQA 4LY6A 4U9UA 4YLEA 3DFIA 4DCOA 3M7IA 3VTAA 3TLAA 2OQVA 1MIOA 4LYHA 3UXHA 3V8VA 4IG9A 1TD1A 1VM6A 4ZCLA 2IPAB 4YN3A 5K8VA 4FINA 4DMFA 1Z4LA 3U31A 4K6FA 1LVGA 5JR3A 4KIUA 4EJ0A 1IOZA 1JAIA 1G2PA 2N47A 3EZYA 4M6WB 3ICWA 2G1PA 3C16C 2ATIA 4PZ0A 3ICQB 1Z37A 2VP0A 3MUEA 4PX3A 3CV3A 1J22A 1X77A 3NJRA 3S1SA 1NP7A 3UT5A 1KAEA 3OTIA 3H87A 2EZ8A 5TGZA 4QZVA 4YRRA 2QGFA 4LGYA 1FFEA 5DI3A 4DM7A 1DG9A 1ZNZA 1Y7IA 4EX6A 3VPBA 1Y6GA 4RCZA 1VRVA 3DPIA 2NU6B 2HI0A 2R8YA 4KMOA 5EKXA 1PG2A 2YYAA 1QE3A 4XB2A 1RJ9A 2BUCA 4CWAA 5NLLA 3CUYA 4FDVA 5IEJA 2EX0A 4V0KA 4LHYA 3HXQA 3I2FA 4BNTA 1FSSA 4EHFA 3BK2A 2IL1A 2WZQA 4MUNA 4CBVA 1L3CA 2HHAA 2BMWA 3KU1A 1YBAA 2OG1A 3ESBA 4RCYA 3REQB 2J9FA 2NQ8A 2O1XA 8LDHA 5CM9C 3S4YA 5LQUA 2QMEA 3FKQA 2XAUA 1L7MA 3DW1X 4OIFA 3SZMA 1XT6A 3W5BA 4TV8B 4B2PA 2X0NA 3DDSA 1TYZA 5B4TA 4YO8A 1JL3A 721PA 1FYXA 2YV2A 1PJTA 3CNBA 5BN3B 1FFBA 1I2ZA 1ZSVA 2VAWA 4QDOA 4EELA 5JVDF 4QBIA 2JLBA 3GRKA 4DUYB 3WHKA 1F1JA 2QDXA 1C3OB 3VOBA 3ID6C 3W5SA 5JZBA 1XNQB 1SZCA 2R3SA 1B3RA 1KZ7B 3IAM1 4PZLA 2V4MA 2LZ0A 3IKLA 3JD1A 3R5SA 4Q05A 4XD7D 5EP3A 2YWRA 4PRLA 5C51B 1JH9A 3GLFB 3CBQA 2IYOA 2QPTA 4KVFA 5AW2A 4WJZA 2JFXA 1D09A 3KSZO 1XVLA 5EIWA 2OYCA 5L9AA 1OV4A 3QLEA 2CV0A 1GGNA 1QWOA 1NYLA 2BZGA 1SHTX 2PX6A 2WF5A 2WHXA 3A4NA 1TK9A 3CE6A 2FMHA 4JCCA 1DTWB 2GN6A 1VJ0A 2DWQA 2CLFB 4EJSC 3NNNA 4UTPA 2R96A 4YWHA 1G3QA 1RADA 4RKFA 3M5PA 4XLLA 4DG8A 2J4DA 3EVNA 1O7JA 1EWQA 1NVUQ 1THZA 3D6VA 4I4TF 2IYEA 4RH3A 4ZI7B 5TPZD 4I36A 4OK3A 3PIDA 4YAEA 2VHTA 1OLXA 2LNDA 3RNOA 3SC6A 2GSDA 4BP9A 1U04A 2IEIA 1BXRA 4XQ9A 5CT9A 1WXWA 3KJQA 1E0AA 3FI0A 4IJ6A 3WGZA 1V35A 2IYUA 2NV6A 2YRXA 3FF1A 3IDSA 5BOSB 6ADHA 1S2GA 1CUDA 3JY6A 4RANA 3WQQA 2PCJA 4QXQA 3BMCB 1PYDA 4BIIA 3M5CA 4BRUA 4KYUA 3LCRA 2FMXA 3GLIB 4Q82A 2CE2X 1N6LA 1DAOA 1ZGGA 4QEZA 4TVOA 4G86A 2P5SA 2I33A 3QFCA 4ZDIA 3KUDA 2P1ZA 1T8YA 3OQHA 1E6MA 2A58A 3SJZA 1VJ5A 3TSCA 5FLXA 4HL6A 3G88A 2QRVB 2XWSA 3TW8B 1VL0A 1PGJA 1IXZA 3QEKA 3QY9A 3DJYA 2HWUA 2DEUA 2VSYA 4LJLA 1IG3A 4D3DA 2XCTB 3UKDA 1CHNA 1THTA 2I2AA 2WUGA 4Q39A 2OFOA 2B92A 3V8NA 2O19A 4QUEA 4LYGA 2JVIA 1W4CA 1QCCA 4YYEA 1HORA 1UBKS 2AWOA 3OTOB 4R98A 3N8KA 4F45A 5JH7B 4A26A 2JGAA 1KEZA 5KU7A 3W79A 2W0MA 1N2SA 5JCJA 4NOJA 1PLLA 1XTUA 4UHCA 3VC3A 3I3SR 1CRPA 1OGYA 1RJWA 2ODEA 5TVKA 8ATCA 1J1ZA 3A1EA 4LJ6A 4DMKA 1MMFB 4JSRA 2HU7A 3ZWKA 4UC0A 1UM9B 2GETA 2OESA 3BAZA 2C5AA 3OIYA 1K8ZB 1NRXA 2CNNA 2PZJA 4K28A 2JLVA 2UXCB 3EHEA 2FUKA 5F9FA 1H8EA 4H18A 3ZS9A 3TMKA 4BATA 3EIXA 2H1OA 3OPMA 2QN1A 1ID8A 4EENA 3S40A 2HGSA 2BKVA 2FLVA 2QN8A 4LDZA 1U0EA 4DWWA 3BHNA 1HQDA 3LWNA 3X44A 4EYKA 4G26A 4BMXA 2DERA 1ZWKA 1Q0QA 2CYCA 3VI4B 2FPOA 6YASA 2WWTA 1NU8A 4I7EA 3RADC 4Z99A 2A9OA 4QJ3A 2MSKA 2ZDQA 2EKQA 7MDHA 5LP6B 3KJZA 1JBQA 4HMPA 2ADFA 1BA2A 1E4EA 1Q3HA 2HWKA 1KSJA 1DRKA 2QZSA 5L51A 4JLOA 3QM1A 5LJLA 1NVAA 3Q3IA 3M1YA 4E5UA 4RH1A 3G59A 4I50F 1PW7A 4JB0A 2ZROA 1CWUA 5LXTA 4DR6B 4YP9A 4GL2A 5LYJF 2H06A 1G20A 2GEJA 2K2QB 2PA3A 2XMGA 3FVQA 3IP8A 1XZIA 2YFQA 3OE1A 4CN9A 3LLVA 2CLOB 4DVJA 5C5CA 5A4DA 3G9ZA 1QYIA 3WADA 1W49A 1D03A 2R25B 1JFVA 5HJEA 4MEAA 1JB9A 2GJSA 2NX2A 3CW2A 3OSUA 4IL5A 3UUGA 3KFVA 5EZQA 2O7VA 4A15A 2VWPA 5JWRA 2HYIC 4C4TA 2HRCA 1ZH8A 2JC3A 3BB4A 3LMKA 4J1QA 3GLFA 1ORHA 4ZQGA 1IBMB 1XVUA 2HN9A 2OOSA 3IHWA 1ESEA 3GCWA 4UJ5A 3JQBC 1UKZA 3MBKA 3OQIA 4M0FA 4NMXB 2ACWA 4MJ3A 3RWBA 1QFZA 4EZEA 1TF2A 3KSAC 3LF1A 4BFVA 4CF4A 4OHUA 421PA 4RHEA 4W9NC 2Z4TA 2FAXA 4O4LB 1J23A 3K9HA 1U02A 1UJ6A 1UJ5A 4M1TA 3KAPA 4QAJA 3QPCA 1Z63A 1JFFB 1I1QB 3DDWA 4RIFA 1FTQA 2XNCA 3B2EA 2IE0A 2F9MA 4H4DA 1ZXBA 4HNVA 2C8LA 2OGUA 4QHYA 2YDYA 2ZQYA 4JBYA 1DCFA 4PV7A 5DWVA 3KUUA 2FZLA 1G55A 3HI4A 4J0GA 4MVYA 4RV4A 1RBZA 3ZU5A 1BS9A 2EKPA 4A0RA 2ECKA 1UM8A 4IGFA 1EE2A 1F5SA 4UNNA 4KREA 3UHJA 4MWEA 2HRQA 1Z15A 3A9UA 4FYYA 1DO2A 1G18A 5DCWA 2YS6A 4OXIA 3D3EA 1PWZA 3ON5A 3G1WA 3G9TA 1ULTA 4L02A 3GVPA 5T4BA 1R5OA 2C4NA 1XTBA 4TSRA 2FA9A 5LOVA 3FOAA 3V5NA 3IO3A 3ND6A 4WXYB 4RHCA 3GLKA 3U39A 4A6DA 4X44A 2YNMA 1PX2A 4UOQA 4BNKA 4DBLC 2R66A 5A7FA 1EIZA 2WMYA 2YRFA 4GBGA 1C7FA 5FWYB 4ZU6X 3IMGA 4BV9A 3B3QA 2IF2A 2ORWA 4RPKA 2VAPA 1OXUA 4NEHB 3H1GA 3X0DA 1M2JA 4L4ZA 3PNPA 3O21A 1D2CA 2J6IA 4MA5A 5AJXA 1JU9A 4TLDA 2Z2XA 1HOXA 5TB5A 1N0WA 3AP3A 3GY0A 2C00A 1XWFA 5IVIA 1T91A 4XWGA 3DNFA 1P6UA 1JHAA 4PF1A 1YQTA 1F60A 1ODIA 3LRTA 1A5SB 1UM9A 3E9RA 4U4AA 4XVCA 2VA8A 2IHKA 3HP4A 4XX0A 3CKKA 2YN4A 4OB8A 4R69A 5F21A 521PA 3T94A 3TLZA 5BNWA 3THYB 3IB6A 3UMRA 1OFGA 1NV8A 1UJCA 2JCGA 1DWUA 3LU1A 1CQWA 3CZ9A 3KPUA 3OFNA 2QGZA 3C15C 4ETNA 2H63A 4AK9A 2OAP1 5FXMA 5GY7A 3UXMA 5MHTA 5CFLA 5DHRA 5EJ6A 3LQQA 1OD6A 3REGA 1FPMA 3PJGA 4FFNA 2CHFA 1KE1A 2DFDA 2VPPA 1OLUB 3EYWA 1DIBA 4HDRB 1QZTA 4GLLA 5AJYA 4JOBA 3V1KA 2QXTA 3H7AA 4J29A 3U3OA 1OF1A 2FE4A 2QTRA 3IXLA 3KR2A 2C8KA 4F4DA 1K98A 1RRMA 3ZGVA 2BSAA 2GUWA 4DDMA 4G2TA 4R01A 5E4JA 2ZK7A 2ZRFA 1CJSA 3GHHA 3PLNA 4Q1AA 3TJZA 3OPYB 2QP4A 1ESZA 1B76A 1QJ4A 4ZD6A 1IBCA 4H27A 1ZRNA 2E89A 3BD9A 1QLWA 2AFIE 2G80A 3E8XA 3QXSA 4P34A 1EUCB 4MDFA 3T9CA 1UBJS 2QI9F 2YJ4A 4KO2S 4UM5A 5H16A 5LQSA 4ZYVA 1M76A 5HRUA 1ZOPA 5ENVA 3I04A 5DT2A 4D46A 2I22A 2P9TA 4B3DA 1Y6ZA 2OXCA 3PUJA 3DMHA 5TQ0B 1A96A 1U3WA 4UMDA 3T3EA 2IH5A 4PC6A 2PL3A 2GCGA 1VGRA 3H2BA 3KSRA 4YGYA 2OR3A 1IM5A 1E2KA 2D7CA 1OGJA 4X8MA 4CQMB 4K1LA 2ZSAA 2YN2A 5F1OA 4IQ8A 5AJUA 3F78A 2XDQA 1WIWA 2FPWA 3OE5A 3N75A 4IH1A 5L3ZA 4B8WA 4D3SA 1Z0FA 3HB4X 2W2OA 4IDDA 3RU3A 4JR2A 3ST7A 3W6ZA 5L3QA 3CVUA 4KQ9A 1URPA 3ZVRA 3EA5A 2ZRGA 2A8YA 3NPAA 3E3NA 2F9LA 2QWXA 1ECGA 3LC7O 3LGXA 4BZXA 2QTVA 1RRGA 3RVOA 3AUYA 1DBRA 5HKKD 3MRVA 1VKNA 1ZD2P 2GN8A 2RGWA 4HGNA 2NUPB 4ZVUA 3VZBA 5F7OA 1M2FA 4DHWA 1U0GA 1OTHA 1E5DA 4LVOA 1M2VA 2IZ5A 4C4SA 5CLIA 2CXRA 2ZWPA 3NUQA 5J5VA 5KJEA 2J0SA 4D81A 2ZIAA 2N3ZA 4HB0A 2I3ZA 2ZSBA 2HNBA 4PXYA 2F8TA 2ORIA 4RMJA 3WNBA 3UJAA 4M38A 4EY7A 1XRNA 5H1YA 2Q07A 2V0GA 1W4ZA 1IPHA 2FF7A 1CDZA 3LH5A 3AKEA 3LP8A 1AXGA 3QU2A 4W6ZA 3V7YA 3ZE2B 4DLTA 3JYHA 2FLWA 5A05A 1Z6YA 1HZZA 2BH2A 4K6KA 4CT0A 2G82A 1RQRA 2ZP1A 1VJGA 1HFWA 3I42A 3WGLA 5EWMA 4K88A 3RRZA 2QJOA 1CQJA 1T5OA 2F4NA 4PCUA 1Q15A 2Z2IA 2H11A 2Z5GA 4ZQHA 1M2HA 3X2EA 4DT1B 1P2UA 2CJPA 3DBIA 4IS3A 5CLHA 2OQIA 3MXTA 5K2MA 3TTYA 3C7CB 1JFTA 1PEDA 4R41A 2GAFA 2L17A 1JA1A 4CMKA 1TYDE 4URWR 1UH5A 1T35A 2W6NA 4PVCA 2X9NA 2DKNA 3S1AA 3VXKA 2Y1XA 3PE4A 2FPIB 3AR4A 4D9FA 3HFJA 4WNCA 1Y6RA 1HDCA 3BCHA 3EUEA 3KAKA 1IK6A 3O2NA 2HYDA 5K8CA 1N2OA 3KQOA 4O2AB 2JFQA 3OICA 4FVTA 4CT4B 1NJ5A 3IFSA 4ZKDA 4RGBA 4M99A 1LS6A 3CC8A 1TTTA 4C4RA 4ER7A 4DA4A 1YT5A 2D5AA 1W1WA 2GYWA 1KDRA 3LDGA 3O8RA 2QL5A 5HCNA 3PKIA 2PUVA 4IIUA 2IV2X 1YRWA 2AX4A 3N70A 4Q6WA 3E9YA 2XYVA 3EMVA 2YFHA 3E84A 3QJYA 5EMJA 3X2SA 3ZVNA 1GG5A 1KQOA 1KY3A 2J3IA 1Q1BA 1X7WB 4CG1A 4YUWA 3OT4A 1ABEA 4E94A 5DLEA 4WFQA 2IYNA 2G9VA 5B1DA 5FV7A 4J3NA 4AZ0B 1JDTA 4P7FA 3OU2A 1JIJA 2OWDA 3IJEB 2H65A 2FEAA 4DARA 4DFDA 2ZAGA 4Q3DA 2X86A 4B8ZA 4KOAA 4TQUS 3KUCA 4M8LA 4YP5A 4HXFB 3WRWA 4ALNA 3NEJA 3LBYA 4EY3A 3VKUA 3E03A 3L3BA 2RB5A 4G3XA 4RZSA 5HCUA 3ZLVA 3QUBA 4OQNA 4IDPA 1FLVA 4DZTA 3CVXA 3RVKA 3D1JA 1J5XA 3E0XA 4D57A 3HFGA 3HY4A 3L6OO 2FUNB 4CCYB 5A3QA 4E14A 4E70A 4E5VA 1BROA 2QTCA 2H4ZA 1JLHA 3MWYW 1JFRA 1WG8A 1OHHD 3SZ3A 4AG3A 2ACVA 4K1XA 1CY0A 3ENQA 4JAVC 2R5NA 1E9EA 4B5LA 1Z33A 2X77A 4P4NA 3OP1A 1AH2A 4FQ7A 1QGDA 2FPPA 3WRYC 3VU3A 4QUKA 5JPCA 1ML4A 2Y1KA 3EH2A 2X0DA 2FF5A 1EXNA 1IY8A 1U1EA 3C8UA 5HS6A 4KUGA 4NU5A 1U98A 4P7JA 3T3MB 3TAHA 3G23A 5CK5A 1KQNA 1EINA 2WB2A 1OI4A 1A5AB 3KL2A 4HS9A 2H0RA 4M36A 5KNBA 4ND7A 3U7HB 4Y6RA 5HUQA 1JJ7A 4H7HA 5A0FA 3NCTA 2MJLA 2PH5A 3F4KA 3TKAA 1NBOA 5F1YA 3HWWA 4DMCA 3QLJA 4CCSA 1YZGA 2Z08A 1TGYA 1U0HC 2PQ6A 5CAEA 2DWUA 4X7RA 5FEMA 1PUJA 4CCYA 1DOHA 3G9UA 2WSYB 2A14A 2IX9A 2P9FA 2B4YA 3L0OA 4OXNA 4MVJF 3CRNA 5HR5A 3RAEC 1JWAB 3ER6A 1FFSA 2IA5A 2RBEA 3C97A 1Q77A 2JATA 2W6ZA 4KN6A 4C7JA 4ER3A 3F7NA 4GYKA 1P4SA 4H6PA 1U6IA 4HXGA 3MAJA 4MB6A 1IM8A 1TC1A 2OPBA 1U2GC 4KZKA 4WWHA 1EEHA 1V5IA 4GZ6A 1GZ6A 1IUOA 2PV0A 1UBSB 3BWBA 3L01A 4LBWA 1AMOA 3FGOA 2GHRA 3UIEA 3OPYI 2R0QC 1Z0DA 3I01M 2AQHA 4NG4A 1Y3IA 1NW6A 1HRDA 4NK5A 1IOVA 2C8JA 4JQZA 1O5TA 3UN1A 1FLNA 2AI3A 4INPA 4FZ3A 2JCSA 3LCMA 2I6SA 2P41A 3RC8A 3LCCA 2XKBA 1VJRA 1ZONA 3MTBA 2W2LD 3B6EA 1JQBA 3WGNA 3ZGXA 5DNUA 2GJAA 3KTOA 4L4XA 2AGVA 1VYTA 3TQQA 3ADCA 3BDIA 2FSVA 3PT5A 1OI2A 4M8SA 4GYYA 2JGDA 1UDRA 2JI9A 3WLJA 2HPVA 4FNAA 1KI3A 1TLTA 3BMCA 4DXDA 4LWZA 2QNBA 2O8BB 1Q7CA 2W98A 4Y2PA 4ENWA 1JDNA 1B0ZA 1M1YE 5FTMA 3PD7A 3I34X 5KAMA 1JVNA 3HVJA 2ZS8A 4PZAA 5JO9A 2PMDA 1DCTA 5J4KA 4Z7NB 3JR3A 1XTKA 1G64A 1GUZA 1OZFA 2ORVA 4GBJA 5GPBA 1W94A 1RU3A 3T41A 4FC7A 4LYFA 4QUJA 5I7OA 1KPIA 2XQGA 1C0KA 3IQEA 3PENA 4WERA 3ZBUA 5P21A 4C4OA 3V4RA 4D1YA 1USKA 3NHMA 2JEYA 3P45A 1NYRA 5JVDB 5LBIA 1TT5B 3CLRD 2UXDB 3OPVA 3M0EA 2HSGA 2FQYA 4MA4A 4HAIA 2QP9X 3HDQA 3LT4A 1IMOA 3R7NA 3GROA 2NSHA 5A1TA 4FYKA 1GT91 5DHQA 1R64A 3DMNA 3MT0A 5FTJA 1UODA 1VLVA 3PI6A 1QFSA 3M6XA 4BRWA 3AF0A 5CP8A 3H9UA 1JJIA 4D6PA 4Z5XA 1CZOA 2ZITA 3DBLB 3CUVA 2QUHA 1R0CA 3GFQA 1BIFA 2RGAA 5ICEA 1BTOA 2YHIB 5JJIA 3SJ7A 4EO7A 2LE0A 1FX0A 1T5DX 3RUEA 5IJ9B 1IG0A 1WXHA 3I5XA 4BFLA 4MQ5A 3V9PA 2D4HA 3F7TA 3O8QB 4AYWA 1EXMA 1DJMA 4D98A 1MC4A 1V43A 3H1TA 2C2HA 1L5FA 4BAGA 1VIVA 3SSMA 4AJPA 1QPZA 4YAJA 4LN1A 4EUKA 2I9KA 1YQEA 1EYZA 2ZDGA 3LOUA 2H48A 3HC7A 4JXZA 5KNBD 3KKLA 4D74A 1JEAA 2Q8NA 3SXJA 2Y0CA 3P52A 1S8AA 2QTHA 2XQKA 1Q50A 3WQRA 3AHEA 4I55B 3E7WA 3OD5A 2QMHA 2QVLA 1UAAA 4H15A 4FP9A 2QAGA 4M88A 5F3DA 1GUYA 1RSZA 3D81A 3GGJA 1DPGA 4I9NA 4RX1A 3TIFA 1WR8A 1LDNA 1OZ0A 1HNWB 1DEXA 2B34A 4PBTA 1A9TA 4G0UA 3V8MA 3VBEA 3ZK8A 2XAAA 1PGQA 5EE0A 4CLOB 4UXIA 3TEMA 2V7UA 3VPXA 4IFIA 4GG1A 2O8EB 4IM7A 4FLEA 4BBPA 2AV6A 2VSOA 2HU8A 3S7ZA 1Y8CA 2J08A 4GEKA 4RK7A 3WYBA 1FYEA 2DHCA 1JDUA 2O2GA 3CSDA 4MPRA 2ONJA 3OZDA 3TWOA 4BLVA 2ZSJA 2Q27A 4IWXA 3MJRA 2C99A 5I48A 1R0YA 2NTVA 4GGMX 1RXIA 5EQJB 5JMTA 4PZDA 5J23A 1LBHA 5HMLA 1K66A 1CU1A 4PYMA 2AFHB 2ZRKA 1C7QA 5EESA 1I7LA 1TCCA 4CMIB 2ZUEA 4D0SA 3CH7A 1Q57A 4TGLA 3K1ZA 3NRJA 5AW8A 1JFFA 1SVLA 1XRRA 1Q12A 1KJNA 1O97D 1YHZA 4IRXA 5LZ7A 2BLNA 1OLOA 5L8VA 5BRNA 3V7NA 2F3PA 2FZEA 3E05A 4XASA 4ZALA 1RPTA 5BN3A 3MGGA 1GT6A 2AJTA 1SPXA 3SKXA 3LNCA 4QD3A 2I65A 4BNDA 1X7YB 2WT8A 3LUDA 2PNJA 4A0GA 1Q1ZA 4EI2A 4PC3A 3HM2A 4TMTA 1ZN2A 3EFEA 3L1VA 4BHTA 3W90A 1SOVA 4YUXA 2BV3A 4LDQA 4DY4A 3RIHA 3NDPA 5BWLA 3ENNA 2XXAB 2WG0A 2OK8A 3PQ7A 1R9MA 4I9HA 2NZYA 2GDZA 2PQ2A 3R7FA 3JQFC 1CR4A 5CT5A 1H2YA 3D54D 4FHGA 4JUIA 2I6XA 4AY4A 4E5SA 2BAGA 4EGFA 1EU1A 1HH4A 1L9KA 1RI3A 1XNRB 1NJGA 4PYOA 2NSYA 2OYSA 3T54A 3A2KA 1QHNA 1SUBA 3CR8A 1GNQA 1KJZA 4BWFB 1FY2A 1SN7A 3R24A 4QRIA 4DXHA 2FW0A 1V2GA 2YN0A 3D6TB 4EY8A 4BPBA 1R27A 3A37A 3IPCA 5HZHA 4W4TA 2FWRA 4D4GA 2B94A 1OH5A 5E0KB 3CF2A 1F2VA 4DSUA 3CVWA 4ME6A 3B53X 1R0SA 3D6AA 3H13A 1HXHA 2PT5A 1X1CA 4PRZA 1TFRA 1Y5NA 2NZUG 4KQWA 4TROA 4GX5A 2V7XA 1XZNA 1P1JA 2I4RA 2I6GA 2GD6A 2PS9A 2W6IA 3EQ2A 3EZLA 4HQKA 4QFCA 2LP4Y 4BCBA 4X41A 3PR3A 1RWVA 4GMKA 2I6TA 5SY4A 1RRFA 5T3YA 3W2FA 1T8RA 4G85A 2VRWA 3LECA 1YQQA 4IOJA 4JLSA 5IAAA 4XIFA 1UK8A 2RKWA 5CFQA 3ACDA 4OHKA 3RSSA 2QR2A 3Q2IA 4IX9A 4LNHA 3U3ZA 4G24A 1O95D 1W8DA 5JO0A 4ND8A 2B1IA 2G9QA 4JL5A 5DM60 2WSLA 5HJ5A 3O1IC 1H2EA 2PL5A 3A9CA 4KH1A 1DKUA 3VPDA 1OLUA 1I51A 4HDRA 3RYFA 1IIRA 4JBNA 4HRYA 4ZVOA 3TNYA 4ESEA 3C43A 3GARA 4ZXPA 4D8XA 4PTZA 4TTQA 4MULA 4X62B 1EJ6A 2BZ0A 5FTLA 3D7KA 4G1FA 4AKEA 1X70A 3FD8A 5LC1A 4Z1OA 1KOFA 1E2UA 3FNEA 1J09A 2VXCA 4P3PA 1NQTA 3OU6A 5ALQA 1TM7E 5C1DA 3DLIA 3WO1A 2BI8A 3U0VA 1HSOA 4JJ6A 2W7TA 4YJ2F 2Z2ZA 2ZANA 5CCBA 3N2YA 3IMKA 3RU2A 2FN7A 1EVQA 4HX5A 1Y81A 2EERA 1IEXA 1II8B 5FNVB 1YR9A 2AJ8A 3D8SA 3BB1A 2JIZD 3IPAA 3FPEA 5AHOA 3V4PB 1Q7TA 2I7VA 1CCWA 4JLNA 2OECA 3NXSA 1MVOA 1ZU4A 5B2EA 4JB2A 2VPQA 5IJWA 1BMQA 3HH8A 4GOOD 5A7GA 2YV3A 4JH0A 3U37A 4OAPA 1WPGA 3KFLA 2BHNA 3GGDA 4OJKA 2CXUA 3OY2A 4DNOA 2NG1A 2YR0A 2HA0A 3MHPA 3QVTA 1H2BA 4XVRA 4BKOA 3W5DA 5K3FB 4C14A 3VISA 1O54A 2PSFA 3Q5GA 5HDQA 2VYQA 4DREA 2IEZA 3ZEAA 4MKRA 1CT9A 1E98A 4PPNA 2R8BA 3ZJYA 3M9XA 4DLNA 4FFSA 2PK3A 2Q29A 3PQ2A 4BO8A 5DV9A 4ZYLA 3TK1A 1AXEA 4DQKA 4YCLA 1Y34E 2OCAA 5B7NA 4FZRA 3FDJA 2J31A 4HYEA 4BUZA 4DYHA 1J8MF 1C8LA 1TM2A 3CNNA 3K4HA 4ITRC 4IIFA 1KPGA 5WRFA 2YASA 3A0RB 1J90A 2L69A 3KR0A 5F3WB 3PCRB 3IGFA 1T9GS 3I4FA 4MMYB 4WK0B 1S01A 1XK6A 4BQFA 3KHUA 2QX7A 3TTUA 1GVHA 1KTVA 2F1IA 1L5LA 1TZMA 3CKYA 3I09A 1KMQA 3R2JA 1N2JA 2OKCA 4BEVA 3KO8A 1XMQB 3SF0A 1CP2A 1KBZA 1Z7WA 1U2DA 4LHZA 4Q3EA 3ZX4A 3QEBZ 3LUCA 1T3SA 4DE5A 1NURA 1XB2A 3CWZA 2WYUA 4EB6A 1E3IA 1PK9A 1QO7A 2RBKA 1ARZA 4CCWA 1JKIA 1RKQA 2D2FA 2XYRA 4IJQA 3BMQB 4KDCA 4GXTA 2HLPA 4R7GA 1TUBA 1C7JA 4W5OA 2GPTA 4TS1A 1T5SA 2ZREA 3F4LA 3WJAA 4XM0A 3S8EA 3Q7EA 4MGKR 4BGDA 2WHQA 2ZIXB 3EC2A 3WV4A 4D7AA 3U4QA 2WAXA 3T7JA 1PF7E 1KDTA 3Q0IA 5TPWA 4DA8A 5E7JA 4WK4B 1UBLS 2NVWA 2P4EA 2Z3ZA 4OQMA 1KJWA 3A3OA 4J0DA 5EJGA 3P20A 1MKYA 4BB5A 4D9IA 4F2PA 3SC3A 1Q95A 5GGXA 3RE1A 4CU2A 3UA4A 1Z4PX 3P8ZA 4PGMA 2GZSA 3PHJA 2GPWA 4G1VA 3C8HA 3DOIA 1RR6A 1WOMA 2P1DA 1BW9A 3WV5A 1KKLA 1OBCA 3AKCA 1NASA 4Z54A 5MDHA 1KERA 2VCYA 3FVRA 2JRLA 5DISB 1PUXA 3M3HA 4XR9A 3NIWA 4JL8A 3UWPA 4E5DA 2GEDA 2ONZA 1YFZA 1ORVA 1R7RA 1IU9A 3WRVA 5CDHA 2JJYA 1YBVA 3WYDA 2RGNA 2RH4A 1K4MA 3ASVA 5EZYF 4AZSA 4DLZA 3IQHX 2CLCX 3PXDA 4C05A 3K09C 6NULA 1HYQA 4HR7A 2FSGA 5AKJA 1VE5A 2ZRQA 2JFUA 2XT6A 3CF4A 2DTDA 3GJYA 5FBLB 3E1KA 2EFCB 2NVUA 5IX8A 4B47A 1VBFA 1PWEA 1M6VB 1ILWA 1O5OA 2W0SA 3ELBA 2VH1A 3LZCA 1FNSA 3MD0A 4ILKA 5ALDA 2Q2OA 1ZN8A 3LX8A 3T61A 4L27A 3MYYA 4M37A 3KOXA 3K0FB 3WRXC 3NORA 1PO7A 2ZS9A 3NRCA 3EVGA 4U7PB 3DT9A 3EUAA 3V7WA 3IVCA 3OJCA 2VP9A 4HSEA 1R9GA 5AK0A 1AS3A 3F3YA 1XQXA 1NQOA 4KIFA 4V3BA 3W9BA 4EA7A 4ND1A 1WSAA 1ULUA 1SU4A 1PJAA 4OJQA 3UHPA 3WBFA 4ZK6A 2QUIA 3I0ZA 1PYOA 3INRA 3KSBC 1M2KA 1YZYA 2R00C 2VG8A 3ANXA 3OZCA 1CYEA 3RVJA 1J1IA 4RQAA 5FA8A 1GZHB 2I55A 2PGDA 2NQ2C 3BIXA 1X87A 4FFVA 5K51A 4C2BA 4DQXA 1KDYA 1Z0UA 3NQ41 1O0CA 3PF8A 2A0XA 4Q02A 2RI6A 4IVQA 2O06A 1NXPA 1UC8A 3Q8WA 3HR4A 2QF7A 1GTZA 2WLTA 3GQVA 1G8GA 2RARA 2R8PA 3HDVA 3NBFA 3O4RA 5K4AA 1LRKA 3IAS6 4IYRA 2DFTA 5EPUA 1SXHA 5KQPA 1D04A 4KXWA 1Z8FA 4U2KA 5FULA 1CNEA 2MU1A 1F4VA 2FOXA 4DWJA 3AILA 3RQIA 2Q45A 3LP6A 4D9GA 1DKNA 3FYCA 1SCDA 3M4YA 5J2TF 3ZWCA 4F92B 5KQRA 3INNA 3OFKA 1Q0HA 1G6KA 3I2JA 1ML3A 4CMHA 1IOWA 1W93A 2NTNA 3DF9A 1LBSA 3U5ZB 2IZ6A 2EARA 1UBFA 1FP2A 3ETHA 3NGXA 2W2XA 4ESHA 3U48A 2PD3A 4HH3C 1DXHA 3KOWA 2BKXA 2P2GA 4GUAA 1VSUA 4XQGA 2GM9A 4NBRA 3WZ2A 4DOMA 2CUNA 3OOEA 4R6XA 2LW7A 2Q1SA 3I76A 3VMMA 4C0XA 3ZHVA 5KIAA 1K5DA 3WWOA 4YRNA 2JGLA 3GXOA 3EPHA 3KYBA 2AZ4A 1T24A 3FDIA 3QZUA 4B9EA 5E6RB 2HRDA 4AY5A 4P58A 1J2TA 3KX2A 3IBCA 1JPNA 5JSZB 4ZO9A 3M2PA 1L6RA 1HTBA 4D0LB 3GWZA 3OJOA 4M8NE 1P81A 1Z8HA 1E9VA 1F8UA 1NI3A 2GRAA 2JFYA 3U4DA 3S6JA 2AE2A 3H5RA 2FRDA 1YK0A 1NATA 4WLVA 5DTJA 4B4WA 3DMYA 3ZUGA 4YYZA 4DV4B 4NAUA 5HP4A 3NBUA 1EBBA 3K70B 2DUMA 2F9FA 3EARA 5CCDA 3TQSA 4D4JA 2QQEA 4OI0A 4G9EA 3RYIB 5EI5A 1OB2A 3C1AA 3H2ZA 2IHVA 1DKPA 3ZCPA 3AHHA 4IIJF 4AZ3A 3LHKA 3MOSA 4DZZA 5A5GA 2XNDA 5FI5A 2HJGA 1BW9B 4F71A 1Z22A 3AP1A 1RYYA 4V0ME 4MPTA 3MWKA 4RJLA 2QM7A 3ABZA 5ESWA 3ZWWA 2DTEA 1K2WA 1R16A 2B5OA 1QHYA 4RESA 4JJEA 1JWLA 2QTAA 2K4MA 5AW9A 1BXGA 1S0UA 1KWKA 4R51A 1BWQA 1JTFA 3N86A 4TMYA 5FBWB 1IPEA 4CM9D 1Y4SA 1JXAA 2V03A 1CJTC 2C7QA 3BRSA 1U3CA 4RD2A 3KM0A 4RABA 4TRMA 2VF4X 4YPVA 4ZYYA 2FSVC 4TYYA 2O1SA 1XYYA 4W7IA 4OJMX 2P6MA 3VX3A 4UUNA 5SZJA 4PXSA 2ADMA 1E69A 4A2QA 4MKGA 1GY8A 1YBFA 5JTUA 5JEDA 2IQ5A 3FUVA 2DP4E 2ZJ5A 3PNOA 2J9XB 3JYQA 1JDSA 3AR5A 2H4XA 1JH8A 1MZVA 1QB8A 2J5BA 3KSUA 5H83A 3S1AB 2A3NA 4KMMA 2YZMA 2QVGA 3G2NA 4B4DA 5CDYA 1E92A 1XEWX 3T7EA 5A4AA 3GP3A 2V7BA 4JOQA 5ARBA 2GTHA 3AR8A 3BE8A 1HK7A 1RI1A 5HJ7A 2AMVA 4G8DA 1GQYA 4KSYA 2H07A 4KXMA 3NC4A 1EUCA 2BGTA 5TMBA 3K1JA 1DQYA 2RFLA 2E2WA 5HFJA 3TRDA 4GM0A 1IUPA 4OHYA 4QSMA