1YVIA

X-ray structure of putative histidine-containing phosphotransfer protein from rice, ak104879
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
143
structure length
140
Chain Sequence
SAAAALRDQLTALLSSMFSQGLVDEQFQQLQMLQDTPGFVSEVVTLFCDDADRIINEIATLLEQPVVNFDKVDAYVHQLKGSSASVGAQKVKFTCMQFRQFCQDKSRDGCLMALAVVRNDFYDLRNKFQTMLQLEQQIQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords histidine-containing phosphotransfer protein
publication title X-RAY STRUCTURE OF PUTATIVE HISTIDINE-CONTAINING PHOSPHOTRANSFER PROTEIN FROM RICE, AK104879
rcsb
source organism Oryza sativa
molecule tags Signaling protein
total genus 61
structure length 140
sequence length 143
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01627 Hpt Hpt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 1yviA00
1A0BA 1SR2A 4PACA 2LD6A 3MYFA 1BDJB 3KYIA 2Q4FA 3U3BA 1TQGA 4G78A 1Y6DA 1I5NA 1WN0A 2OOCA 3IQTA 1YVIA 3KYJA 1C03A 1QSPA 2LP4A 2A0BA 2R25A 1FR0A 1OXKA 4EUKB 1C02A 2LCHA 1OXBA 3US6A
chains in the Genus database with same CATH superfamily
1PD1A 2R7SA 2YKZA 3EG9B 2XL6A 5T1DB 3SXYA 3S0XA 5DS5A 1GGQA 1C17M 5L0IA 2BL2A 3JCUQ 1HE1A 2FFHA 1FTSA 4MW8A 5T3WA 5L0HA 3FAPB 2QY9A 3L0IA 4YWQA 1XZQA 2CCYA 3FVYA 1D0YA 1YZCA 2KJGA 1WATA 1E85A 4IWBA 2XLEA 3TK0A 4J7YA 1M2OA 4XLPF 1DOVA 4JKVA 4O79A 2VB6A 3DJNB 5A69A 2OJQA 2AWYA 1J8YF 2WZGA 4PJLA 5DQTA 1W2WA 2HZ8A 1ZW3A 3N24A 4W8KA 2IXMA 3ZIBA 4BEMJ 4IAQA 2A0BA 2NSFA 3MYIA 2CW0F 4IARA 3WG7C 4AX2A 3B0VC 3C7JA 1GM5A 4E0HA 5F5HA 4YL0A 4IJJA 1LIHA 5EK0A 4QI2A 3MBGA 2A69F 3K1HA 4H54A 3W8IA 3CZ6A 2Q7RA 2IXPA 2LCHA 1NG1A 2Y3DA 4XTKA 3US6A 4P6IC 4PFPA 1IW7F 1Q0DA 3HNIA 256BA 1YYXA 2AU5A 2J8WA 3DD7A 1WGWA 5AC4A 1VK5A 3G4XA 1ZHZA 4DVZA 3ZTMA 3GEHA 3IEEA 2PFDA 3T6JA 2NUPB 1MMNA 2BC5A 3RFYA 3ABMC 3IQTA 4AK9A 3NMIA 2XL8A 1ZU5A 1YVIA 1OKKD 1O5HA 2CNWD 1ST6A 1ZU4A 4K0DA 4W8PA 2OEXA 4HFFB 2HSQA 3V5ZA 2VCBA 4EKWA 5KYWA 4JE9A 1YJGA 1U6HA 2YL0A 3E70C 4MTFA 3EGXB 3B9QA 4LLEA 2VASA 1LS1A 2J7PA 3POVA 4R32A 2DYRC 4DBRA 1V54C 4XLNF 3SXMA 2LQGA 2P61A 5COFA 1CGNA 4MVMA 4CDAA 4J32B 3C18A 2VC9A 3O39A 4JTCB 1AVOB 4O7GA 1ZHTA 3LESA 3MYFA 3Q7LA 1VOMA 1S7ZA 3SP1A 3PCVA 4BJ6C 1LE2A 2QLAA 3MFNA 1HW2A 2XXAB 4Q5SF 2KGOA 3C8GD 3EJNA 3AJMA 2DYSC 4BJTA 5JS5A 4BJ5A 3KPHA 2ZXPA 2V26A 4PR9A 4EHPA 3U3FA 1OQCA 3JYYA 2G62A 5CI9A 3C8GB 3ZG1A 4P9FA 5KYNA 2EPOA 5A6JA 3LS1A 1QPUA 1D0ZA 2QUPA 2HJ3A 2WVOA 4JW1A 1YARO 1G4US 2OQMA 3W8HA 1V4AA 1MMGA 1HMOA 4HFKB 5JRAA 2OKUA 2EIKC 2RSEB 3Q6NA 5F28E 1WASA 1B68A 4JJFA 4CSAC 3CEXA 1HE9A 3LS0A 2WL8A 5JSLA 1HMDA 2UUIA 4RBNA 1MNDA 2XSEA 4M63A 2QNLA 3ECSA 3Q7GA 3S28A 1T6UA 3UMKA 5B1BC 4EIYA 4G7ZF 4XPYA 2R7VA 3LNRA 4JRZA 4FAPB 4ANJA 2KW3C 1LKXA 1ORSC 1RJ9B 2XS1A 3M4BA 3UGOA 2XLVA 2PX3A 2Y69C 3KL4A 1E84A 1GQAA 3RQEA 1UG7A 3BEHA 3Q6MA 1YYJA 1V55C 2R03A 4E7ZA 3KH2A 2OG2A 2Y3HA 1NBBA 4LACB 3DZAA 1O87A 4CIPA 5B1AC 4DVYP 1NZEA 2LSEA 4K7BA 1H9GA 5L0DA 3SZRA 2R7RA 1Q0GA 3H65A 3LLIA 4JZAA 5JT4A 2XL4A 2PNOA 3IHUA 4J30B 5DQZA 2O9XA 3K1IA 4GQHA 3UMHA 4L6RA 4YJWA 1ZHXA 4MTOA 3TJ5A 3LLKA 3ITFA 3QW1A 2HMQA 3G50A 4CDYA 2ZXOA 3M1CB 2A6HF 3EGDA 2VH3A 2ZXRA 4JC7A 2VCCA 2YL7A 2YLGA 4WGYA 4HEAJ 2R05A 3C63A 1YLMA 1XZPA 3F46A 1E83A 4C7OA 1EA8A 3NYMA 1Z23A 4AE4B 3U9MA 1YAUO 3S9OA 2XLOA 2Y39A 1ZW2A 2AWCA 3BRJA 5FCLA 3DAGA 1LI5A 2IXNA 4U5EE 3S27A 1JAFA 3DKAA 3DJUB 4YT5A 1AUEA 5L3VA 4QI0A 2YL3A 3LEOA 2Q9CA 1D1AA 1KNYA 2MHRA 2XS8A 4PK4A 4X0RA 2P6VA 2R7QA 1APCA 2WZLA 1GS9A 3IQCA 2D5RB 4MTGA 5KYYA 2EILC 3AOUA 3O6XA 4JEAA 3EHNA 4AL0A 1Y4CA 3HNKA 2YVKA 1M2VB 1QKRA 1RKCA 5B3SC 1O3UA 4OIPF 1Q0FA 4I44A 1CPRA 3DMDA 5KYXB 3PHF2 3V7OA 1HW1A 2KSFA 4WJ0A 4NTAA 4JTAB 4O6MA 1VB5A 2L6GA 4XWJA 3OA1A 3U8VA 5CIVA 4CS9C 3LJBA 1OKKA 2YLIA 5A6BA 2CNWA 4GEHA 4LLCA 1RKEA 4U5BE 2AP3A 1I4YA 1CGOA 4FX5A 2W4MA 4CS8C 3O55A 2GAQA 1OW7A 4IRUA 5KYUA 5L0CA 4OIRF 1VYIA 2KYHA 4JVSA 3M15A 4O6YA 5TJ5E 3RVYA 4CIHA 3K33A 4H4KC 1JRAA 1K04A 1NU7D 4PJMA 2WVQA 4MVOA 3RIPA 3U0CA 1BR4A 5BQHA 2LFDA 4KI2A 2EPMX 3G4ZA 1Z5ZA 2XM0A 4CS9A 3SEOA 1J8MF 3C8ZA 1M6TA 2P0NA 3EH1A 4HE8D 3X1OA 4CS8A 1Z3IX 3JSEO 3PDMP 2F22A 1XWJA 1ZHWA 4XEVA 2G3VA 1HY5A 3FHDA 2X0CA 1S05A 2X51A 5K0IA 4Z9HA 1A7EA 1YA7O 3AG4C 2HUJA 4YL3A 1OR2A 3M4CA 1TKNA 1VYKA 2CGEA 2J9WA 4RD9A 3S84A 4OIQF 3NKEA 2C03A 4LDQA 3S29A 1TWGA 2XLHA 2NSGA 3AG2C 3HNJA 3N0TA 4MVUA 3FDQA 4JCHA 2FAPB 1OW8A 3EFOB 2NUTA 1SMYF 3ZC4A 2RD9A 2Q3TA 3JT1A 4WGZA 2IOQA 1TFOB 2C04A 3K66A 5JUAA 1CPQA 4JJGA 1VLTA 2ETSA 3LAYA 5D92A 3RH3A 1OCCC 3CSKA 5COGA 5B3IA 1F1MA 1R4TA 3X2QC 3QTHA 5HSWA 5F5FA 3I4UA 4ZLCA 1KU2A 2H7BA 2Z15A 1OW6A 2WB7A 2HV6A 4LDKA 2ZPAA 1MNEA 2HS5A 1BBHA 2GWWA 2J0XA 2PX0A 3AQBA 3L1MA 4NTBA 2R25A 4OD4A 3R2PA 1JMWA 4DOZA 1CGME 2TMVP 3F47A 2J9VA 3GM3A 3H2UA 3JRMO 3I5QA 3MLGA 2L7AA 5L3QA 1C02A 1YDIA 1Q0KA 4BJ6A 2P7VA 2R9RB 1PD0A 3DI5A 3RF3A 2YL1A 3ASOC 4EWCA 2LFFA 1A7VA 4OINF 2V3CC 5DVWA 4NC3A 1LPEA 1BZ4A 1SF8A 5A6AA 2OEVA 1JPJA 2OU6A 2JD3A 4ULVA 4D4NA 3OEOA 4Z9JA 1MQVA 1WN0A 2OOCA 1YA9A 2L6FA 2LIGA 3U5SA 3T6GB 5JVEA 4OIOF 2JPUA 1QSPA 2I8BA 3VF0A 2E87A 3NKDA 2J7PD 2HJMA 2M64A 4CSAA 3JTLO 2Q9AA 3I5PA 3SXKA 2R02A 2EINC 3EG9A 2WZFA 5KYWB 3AG3C 2ICWG 2J0WA 2R7TA 4QDLA 1Q0MA 1FFTC 3E9VA 3TQOA 4IB4A 4EBBA 4MVQA 2H7VC 2NPUA 4E0IA 2PP4A 1M56C 3DE8A 4YN0B 1Z7Qc 3PMRA 3HNLA 3B0PA 3W2VA 4PACA 2LD6A 1T6IA 3HTKC 1K40A 1BDJB 1QZXA 1PCXA 2ZXWC 3NMKA 4MVZA 2XLMA 2KQ9A 3ZSUA 4Q4ZF 2YZSA 2A1DD 3RVZA 3LNMB 2HMZA 3GWNA 4LERA 4AL1A 1H6GA 2AVKA 1NLXA 2EIMC 3KKBA 3M79A 4XPWA 5E3CA 3W2WA 1U0BB 4FWVA 3FMSA 4WABA 3ABKC 4YK5A 3WODF 4E7SA 2A6EF 1QQ3A 3RQGA 4I1OB 2DGJA 5E2QA 3QZCA 4XPXA 4EBJA 3ABLC 1FR0A 2PF4E 2W4BA 4U9DA 1WWPA 1TWAA 4A2NB 3GANA 4I1MA 5EHHA 1EKYA 1OR3A 3IQ5A 3EPVA 3HJCA 1SR2A 3SYNA 2NUPA 3TOLA 2XM4A 5IY5C 3J06A 2I15A 4KNVA 3NMJA 3RKOF 2ASRA 2H8AA 3UGPA 3EH2A 4I3MA 1TWHA 2R7XA 3QW0A 3U9JA 5DS4A 4NCQA 3JYHA 4RDAA 4NQFA 3UMIA 3DE9A 1KTMA 3W4YA 3C62A 3DXJF 4FESA 1WTYA 1ZHYA 1YZAA 3QVYA 3QMKA 1LS4A 4YL1A 1OCZC 1BR1A 2R7OA 2LP4A 3L8JA 3VAYA 1D1BA 3NYJA 3EGXA 2M4EA 1R5ID 2QTVA 2YQYA 3AG1C 4LDRA 1T9KA 1TR2A 3EFOA 1ZYRF 3U2LA 1OXBA 3SXZA 2YHSA 3ZDLA 3VRCA 2DI3A 4MS2A 2HFIA 2GFHA 1FFHA 1M57C 2OJED 5JLIA 1TFKB 2IBFA 2VCAA 2XXAA 5BQIA 2IXOA 1E2XA 2BE5F 1G4WR 3TOMA 1U89A 3U3BA 3ZVRA 2A0UA 4U5GA 5E3AA 4DJ9A 1VMAA 4DRJB 4D4XA 4YT2A 4CX9A 5GPGB 1I5NA 3AGTA 3EGDB 3SNHA 3GORA 3C8GA 2NG1A 2HV7A 1WOLA 5AC5A 1MMDA 2J9UA 4Q7CA 2B0JA 1Z6AA 1ZZPA 3NRHA 3B29A 4NY3A 4XEFA 4C7OB 3TD7A 2P1AA 3H2VA 1H7IA 1OXKA 2KK1A 2W9YA 5HV9A 1OCOC 1T6QA 4BJ1A 2ZD9A 3HKKA 3NYLA 2KNHA 2W45A 4OD5A 4MW3A 3QVZA 3LUTB 4G0HA 2EPKX 2Q9BA 3GEIA 3FOPA 2LK4A 5E33A 4MNDA 1QVXA 4XEKA 2HSBA 4EBKA 3IQ6A 3T9OA 5AGFA 3EQLF 3V5YA 1D1CA 1G5ZA 1RJ9A 2Q4FA 3A11A 2IYLD 4KBLA 4PJNA 2UUHA 4G78A 1H9TA 1L3PA 5BQGA 2YLDA 5KYYB 3FXHA 5BUOA 4U5DE 2L9JA 1DOWA 1VLSA 4MQ9F 5T3TA 3R7CA 3T4RA 3GWLA 4ER9A 5EGYA 5A6BD 1I4ZA 1C03A 1FNTc 3JRTA 1A7DA 5JP7A 4CS7A 1ZVZA 1FMVA 3DAFA 3TULA 3EHMA 3IPMO 4B6IA 3LEVA 2YWAA 3HLZA 4BJ5C 5L0JA 1G8XA 4DXWA 1RKEB 2GA0A 2KC3A 4PFOA 4DRHB 4E17A 3DM5A 3EZIA 4E18A 2XRHA 4G7OF 2MYSA 5KYUB 4JCZA 5DLJA 1PV3A 4O6NA 1LVKA 4KC9A 2Y3GA 1JPNA 3VYWA 1TQGA 3WHNA 3RYLA 2YRFA 4N06A 1E86A 2J45A 5DS6A 1Y6DA 2B0HA 3CAXA 4J7TA 4N6CA 4F4BA 3NDBB 2A68F 2CDQA 3UNGC 2HKVA 4IGGA 3U2MA 4AE4A 4CBEA 1EQ1A 1FMWA 3JZ0A 5COMA 2XLDA 3O10A 1NFNA 4NTFA 1IZMA 1LE4A 3VM6A 3ZQVA 4G7HF 3MX3A 1D0XA 1T5OA 3KMIA 1MMAA 1LM3B 1VTMP 3T6BA 3ZWIA 3UR3C 4N4WA 4YT4A 4Z9IA 2L6HA 2Q00A 3ASNC 4YT8A 1UFBA 1SZIA 2YEVA 5A6KA 2H7OA 5L0FA 1JOGA 2PBEA 1QLEC 1T01A 3DWWA 3GEEA 4IAOA 4U5FE 4U9EA 1A41A 3ATPA 5FZTA 2GDCA 4JTDB 2D4UA 1M2VA 3FOOA 3RW0A 2NUTB 2Y3BA 4CJGA 3KYIA 2L81A 4BPMA 2J46A 1RXQA 3L8IA 4N6HA 4C3BA 3K1IC 4CJOA 3GM2A 5KYXA 4UDVA 3WAQA 3S90A 3L34A 4XQ1A 4A4AA 3JSZA 1JR8A 4JEBA 4K1OA 2EIJC 3TJ6A 1AEPA 3B71A 3KYJA 4ULWA 1N1CA 4DRIB 3B0UX 2XLWA 4DBQA 3FAJA 3A9CA 5CI8A 4JURI 3ZTZA 1LI7A 2DB4A 4MVSA 4C3EA 4MVRA 3EZHA 2EPLX 3U8PA 3ZQYA 3AQCA 3RQFA 4P9TA 5L0GA 1NSGB 1ORJA 4ONSA 1Z63A 1A0BA 1FAPB 3K7DA 2JX0A 1BR2A 3K6BA 3GM1A 4U5HA 2FGYA 5D91A 1EI7A 1SYQA 4ZLDA 2OCCC 4KNWA 2R7UA 4U5CE 4BEJA 2MWQA 3CQZA 4BG0A 2R7WA 4C3DA 3NG1A 3N2ZB 1RMVA 1NU9C 4JIOA 1NFOA 3V5XA 1V74B 4PJJA 4GYTA 2EPNA 3OWTA 2WVNA 3GODA 2QE9A 3DM9B 1ORYA 2G3KA 3AGUA 1K05A 1RCPA 2CYDA 1OCRC 1L7CA 1TWCA 4EUKB 2J9BA 2IM8A 4CDVA
chains in the Genus database with same CATH topology
1A0BA 1SR2A 4PACA 2LD6A 3MYFA 1BDJB 3KYIA 2Q4FA 3U3BA 1TQGA 4G78A 1Y6DA 1I5NA 1WN0A 2OOCA 3IQTA 1YVIA 3KYJA 1C03A 1QSPA 2LP4A 2A0BA 2R25A 1FR0A 1OXKA 4EUKB 1C02A 2LCHA 1OXBA 3US6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A0B A;  1SR2 A;  4PAC A;  2LD6 A;  3MYF A;  1BDJ B;  3KYI A;  2Q4F A;  3U3B A;  1TQG A;  4G78 A;  1Y6D A;  1I5N A;  1WN0 A;  2OOC A;  3IQT A;  1YVI A;  3KYJ A;  1C03 A;  1QSP A;  2LP4 A;  2A0B A;  2R25 A;  1FR0 A;  1OXK A;  4EUK B;  1C02 A;  2LCH A;  1OXB A;  3US6 A; 
#chains in the Genus database with same CATH topology
 1PD1 A;  2R7S A;  2YKZ A;  3EG9 B;  2XL6 A;  5T1D B;  3SXY A;  3S0X A;  5DS5 A;  1GGQ A;  1C17 M;  5L0I A;  2BL2 A;  3JCU Q;  1HE1 A;  2FFH A;  1FTS A;  4MW8 A;  5T3W A;  5L0H A;  3FAP B;  2QY9 A;  3L0I A;  4YWQ A;  1XZQ A;  2CCY A;  3FVY A;  1D0Y A;  1YZC A;  2KJG A;  1WAT A;  1E85 A;  4IWB A;  2XLE A;  3TK0 A;  4J7Y A;  1M2O A;  4XLP F;  1DOV A;  4JKV A;  4O79 A;  2VB6 A;  3DJN B;  5A69 A;  2OJQ A;  2AWY A;  1J8Y F;  2WZG A;  4PJL A;  5DQT A;  1W2W A;  2HZ8 A;  1ZW3 A;  3N24 A;  4W8K A;  2IXM A;  3ZIB A;  4BEM J;  4IAQ A;  2A0B A;  2NSF A;  3MYI A;  2CW0 F;  4IAR A;  3WG7 C;  4AX2 A;  3B0V C;  3C7J A;  1GM5 A;  4E0H A;  5F5H A;  4YL0 A;  4IJJ A;  1LIH A;  5EK0 A;  4QI2 A;  3MBG A;  2A69 F;  3K1H A;  4H54 A;  3W8I A;  3CZ6 A;  2Q7R A;  2IXP A;  2LCH A;  1NG1 A;  2Y3D A;  4XTK A;  3US6 A;  4P6I C;  4PFP A;  1IW7 F;  1Q0D A;  3HNI A;  256B A;  1YYX A;  2AU5 A;  2J8W A;  3DD7 A;  1WGW A;  5AC4 A;  1VK5 A;  3G4X A;  1ZHZ A;  4DVZ A;  3ZTM A;  3GEH A;  3IEE A;  2PFD A;  3T6J A;  2NUP B;  1MMN A;  2BC5 A;  3RFY A;  3ABM C;  3IQT A;  4AK9 A;  3NMI A;  2XL8 A;  1ZU5 A;  1YVI A;  1OKK D;  1O5H A;  2CNW D;  1ST6 A;  1ZU4 A;  4K0D A;  4W8P A;  2OEX A;  4HFF B;  2HSQ A;  3V5Z A;  2VCB A;  4EKW A;  5KYW A;  4JE9 A;  1YJG A;  1U6H A;  2YL0 A;  3E70 C;  4MTF A;  3EGX B;  3B9Q A;  4LLE A;  2VAS A;  1LS1 A;  2J7P A;  3POV A;  4R32 A;  2DYR C;  4DBR A;  1V54 C;  4XLN F;  3SXM A;  2LQG A;  2P61 A;  5COF A;  1CGN A;  4MVM A;  4CDA A;  4J32 B;  3C18 A;  2VC9 A;  3O39 A;  4JTC B;  1AVO B;  4O7G A;  1ZHT A;  3LES A;  3MYF A;  3Q7L A;  1VOM A;  1S7Z A;  3SP1 A;  3PCV A;  4BJ6 C;  1LE2 A;  2QLA A;  3MFN A;  1HW2 A;  2XXA B;  4Q5S F;  2KGO A;  3C8G D;  3EJN A;  3AJM A;  2DYS C;  4BJT A;  5JS5 A;  4BJ5 A;  3KPH A;  2ZXP A;  2V26 A;  4PR9 A;  4EHP A;  3U3F A;  1OQC A;  3JYY A;  2G62 A;  5CI9 A;  3C8G B;  3ZG1 A;  4P9F A;  5KYN A;  2EPO A;  5A6J A;  3LS1 A;  1QPU A;  1D0Z A;  2QUP A;  2HJ3 A;  2WVO A;  4JW1 A;  1YAR O;  1G4U S;  2OQM A;  3W8H A;  1V4A A;  1MMG A;  1HMO A;  4HFK B;  5JRA A;  2OKU A;  2EIK C;  2RSE B;  3Q6N A;  5F28 E;  1WAS A;  1B68 A;  4JJF A;  4CSA C;  3CEX A;  1HE9 A;  3LS0 A;  2WL8 A;  5JSL A;  1HMD A;  2UUI A;  4RBN A;  1MND A;  2XSE A;  4M63 A;  2QNL A;  3ECS A;  3Q7G A;  3S28 A;  1T6U A;  3UMK A;  5B1B C;  4EIY A;  4G7Z F;  4XPY A;  2R7V A;  3LNR A;  4JRZ A;  4FAP B;  4ANJ A;  2KW3 C;  1LKX A;  1ORS C;  1RJ9 B;  2XS1 A;  3M4B A;  3UGO A;  2XLV A;  2PX3 A;  2Y69 C;  3KL4 A;  1E84 A;  1GQA A;  3RQE A;  1UG7 A;  3BEH A;  3Q6M A;  1YYJ A;  1V55 C;  2R03 A;  4E7Z A;  3KH2 A;  2OG2 A;  2Y3H A;  1NBB A;  4LAC B;  3DZA A;  1O87 A;  4CIP A;  5B1A C;  4DVY P;  1NZE A;  2LSE A;  4K7B A;  1H9G A;  5L0D A;  3SZR A;  2R7R A;  1Q0G A;  3H65 A;  3LLI A;  4JZA A;  5JT4 A;  2XL4 A;  2PNO A;  3IHU A;  4J30 B;  5DQZ A;  2O9X A;  3K1I A;  4GQH A;  3UMH A;  4L6R A;  4YJW A;  1ZHX A;  4MTO A;  3TJ5 A;  3LLK A;  3ITF A;  3QW1 A;  2HMQ A;  3G50 A;  4CDY A;  2ZXO A;  3M1C B;  2A6H F;  3EGD A;  2VH3 A;  2ZXR A;  4JC7 A;  2VCC A;  2YL7 A;  2YLG A;  4WGY A;  4HEA J;  2R05 A;  3C63 A;  1YLM A;  1XZP A;  3F46 A;  1E83 A;  4C7O A;  1EA8 A;  3NYM A;  1Z23 A;  4AE4 B;  3U9M A;  1YAU O;  3S9O A;  2XLO A;  2Y39 A;  1ZW2 A;  2AWC A;  3BRJ A;  5FCL A;  3DAG A;  1LI5 A;  2IXN A;  4U5E E;  3S27 A;  1JAF A;  3DKA A;  3DJU B;  4YT5 A;  1AUE A;  5L3V A;  4QI0 A;  2YL3 A;  3LEO A;  2Q9C A;  1D1A A;  1KNY A;  2MHR A;  2XS8 A;  4PK4 A;  4X0R A;  2P6V A;  2R7Q A;  1APC A;  2WZL A;  1GS9 A;  3IQC A;  2D5R B;  4MTG A;  5KYY A;  2EIL C;  3AOU A;  3O6X A;  4JEA A;  3EHN A;  4AL0 A;  1Y4C A;  3HNK A;  2YVK A;  1M2V B;  1QKR A;  1RKC A;  5B3S C;  1O3U A;  4OIP F;  1Q0F A;  4I44 A;  1CPR A;  3DMD A;  5KYX B;  3PHF 2;  3V7O A;  1HW1 A;  2KSF A;  4WJ0 A;  4NTA A;  4JTA B;  4O6M A;  1VB5 A;  2L6G A;  4XWJ A;  3OA1 A;  3U8V A;  5CIV A;  4CS9 C;  3LJB A;  1OKK A;  2YLI A;  5A6B A;  2CNW A;  4GEH A;  4LLC A;  1RKE A;  4U5B E;  2AP3 A;  1I4Y A;  1CGO A;  4FX5 A;  2W4M A;  4CS8 C;  3O55 A;  2GAQ A;  1OW7 A;  4IRU A;  5KYU A;  5L0C A;  4OIR F;  1VYI A;  2KYH A;  4JVS A;  3M15 A;  4O6Y A;  5TJ5 E;  3RVY A;  4CIH A;  3K33 A;  4H4K C;  1JRA A;  1K04 A;  1NU7 D;  4PJM A;  2WVQ A;  4MVO A;  3RIP A;  3U0C A;  1BR4 A;  5BQH A;  2LFD A;  4KI2 A;  2EPM X;  3G4Z A;  1Z5Z A;  2XM0 A;  4CS9 A;  3SEO A;  1J8M F;  3C8Z A;  1M6T A;  2P0N A;  3EH1 A;  4HE8 D;  3X1O A;  4CS8 A;  1Z3I X;  3JSE O;  3PDM P;  2F22 A;  1XWJ A;  1ZHW A;  4XEV A;  2G3V A;  1HY5 A;  3FHD A;  2X0C A;  1S05 A;  2X51 A;  5K0I A;  4Z9H A;  1A7E A;  1YA7 O;  3AG4 C;  2HUJ A;  4YL3 A;  1OR2 A;  3M4C A;  1TKN A;  1VYK A;  2CGE A;  2J9W A;  4RD9 A;  3S84 A;  4OIQ F;  3NKE A;  2C03 A;  4LDQ A;  3S29 A;  1TWG A;  2XLH A;  2NSG A;  3AG2 C;  3HNJ A;  3N0T A;  4MVU A;  3FDQ A;  4JCH A;  2FAP B;  1OW8 A;  3EFO B;  2NUT A;  1SMY F;  3ZC4 A;  2RD9 A;  2Q3T A;  3JT1 A;  4WGZ A;  2IOQ A;  1TFO B;  2C04 A;  3K66 A;  5JUA A;  1CPQ A;  4JJG A;  1VLT A;  2ETS A;  3LAY A;  5D92 A;  3RH3 A;  1OCC C;  3CSK A;  5COG A;  5B3I A;  1F1M A;  1R4T A;  3X2Q C;  3QTH A;  5HSW A;  5F5F A;  3I4U A;  4ZLC A;  1KU2 A;  2H7B A;  2Z15 A;  1OW6 A;  2WB7 A;  2HV6 A;  4LDK A;  2ZPA A;  1MNE A;  2HS5 A;  1BBH A;  2GWW A;  2J0X A;  2PX0 A;  3AQB A;  3L1M A;  4NTB A;  2R25 A;  4OD4 A;  3R2P A;  1JMW A;  4DOZ A;  1CGM E;  2TMV P;  3F47 A;  2J9V A;  3GM3 A;  3H2U A;  3JRM O;  3I5Q A;  3MLG A;  2L7A A;  5L3Q A;  1C02 A;  1YDI A;  1Q0K A;  4BJ6 A;  2P7V A;  2R9R B;  1PD0 A;  3DI5 A;  3RF3 A;  2YL1 A;  3ASO C;  4EWC A;  2LFF A;  1A7V A;  4OIN F;  2V3C C;  5DVW A;  4NC3 A;  1LPE A;  1BZ4 A;  1SF8 A;  5A6A A;  2OEV A;  1JPJ A;  2OU6 A;  2JD3 A;  4ULV A;  4D4N A;  3OEO A;  4Z9J A;  1MQV A;  1WN0 A;  2OOC A;  1YA9 A;  2L6F A;  2LIG A;  3U5S A;  3T6G B;  5JVE A;  4OIO F;  2JPU A;  1QSP A;  2I8B A;  3VF0 A;  2E87 A;  3NKD A;  2J7P D;  2HJM A;  2M64 A;  4CSA A;  3JTL O;  2Q9A A;  3I5P A;  3SXK A;  2R02 A;  2EIN C;  3EG9 A;  2WZF A;  5KYW B;  3AG3 C;  2ICW G;  2J0W A;  2R7T A;  4QDL A;  1Q0M A;  1FFT C;  3E9V A;  3TQO A;  4IB4 A;  4EBB A;  4MVQ A;  2H7V C;  2NPU A;  4E0I A;  2PP4 A;  1M56 C;  3DE8 A;  4YN0 B;  1Z7Q c;  3PMR A;  3HNL A;  3B0P A;  3W2V A;  4PAC A;  2LD6 A;  1T6I A;  3HTK C;  1K40 A;  1BDJ B;  1QZX A;  1PCX A;  2ZXW C;  3NMK A;  4MVZ A;  2XLM A;  2KQ9 A;  3ZSU A;  4Q4Z F;  2YZS A;  2A1D D;  3RVZ A;  3LNM B;  2HMZ A;  3GWN A;  4LER A;  4AL1 A;  1H6G A;  2AVK A;  1NLX A;  2EIM C;  3KKB A;  3M79 A;  4XPW A;  5E3C A;  3W2W A;  1U0B B;  4FWV A;  3FMS A;  4WAB A;  3ABK C;  4YK5 A;  3WOD F;  4E7S A;  2A6E F;  1QQ3 A;  3RQG A;  4I1O B;  2DGJ A;  5E2Q A;  3QZC A;  4XPX A;  4EBJ A;  3ABL C;  1FR0 A;  2PF4 E;  2W4B A;  4U9D A;  1WWP A;  1TWA A;  4A2N B;  3GAN A;  4I1M A;  5EHH A;  1EKY A;  1OR3 A;  3IQ5 A;  3EPV A;  3HJC A;  1SR2 A;  3SYN A;  2NUP A;  3TOL A;  2XM4 A;  5IY5 C;  3J06 A;  2I15 A;  4KNV A;  3NMJ A;  3RKO F;  2ASR A;  2H8A A;  3UGP A;  3EH2 A;  4I3M A;  1TWH A;  2R7X A;  3QW0 A;  3U9J A;  5DS4 A;  4NCQ A;  3JYH A;  4RDA A;  4NQF A;  3UMI A;  3DE9 A;  1KTM A;  3W4Y A;  3C62 A;  3DXJ F;  4FES A;  1WTY A;  1ZHY A;  1YZA A;  3QVY A;  3QMK A;  1LS4 A;  4YL1 A;  1OCZ C;  1BR1 A;  2R7O A;  2LP4 A;  3L8J A;  3VAY A;  1D1B A;  3NYJ A;  3EGX A;  2M4E A;  1R5I D;  2QTV A;  2YQY A;  3AG1 C;  4LDR A;  1T9K A;  1TR2 A;  3EFO A;  1ZYR F;  3U2L A;  1OXB A;  3SXZ A;  2YHS A;  3ZDL A;  3VRC A;  2DI3 A;  4MS2 A;  2HFI A;  2GFH A;  1FFH A;  1M57 C;  2OJE D;  5JLI A;  1TFK B;  2IBF A;  2VCA A;  2XXA A;  5BQI A;  2IXO A;  1E2X A;  2BE5 F;  1G4W R;  3TOM A;  1U89 A;  3U3B A;  3ZVR A;  2A0U A;  4U5G A;  5E3A A;  4DJ9 A;  1VMA A;  4DRJ B;  4D4X A;  4YT2 A;  4CX9 A;  5GPG B;  1I5N A;  3AGT A;  3EGD B;  3SNH A;  3GOR A;  3C8G A;  2NG1 A;  2HV7 A;  1WOL A;  5AC5 A;  1MMD A;  2J9U A;  4Q7C A;  2B0J A;  1Z6A A;  1ZZP A;  3NRH A;  3B29 A;  4NY3 A;  4XEF A;  4C7O B;  3TD7 A;  2P1A A;  3H2V A;  1H7I A;  1OXK A;  2KK1 A;  2W9Y A;  5HV9 A;  1OCO C;  1T6Q A;  4BJ1 A;  2ZD9 A;  3HKK A;  3NYL A;  2KNH A;  2W45 A;  4OD5 A;  4MW3 A;  3QVZ A;  3LUT B;  4G0H A;  2EPK X;  2Q9B A;  3GEI A;  3FOP A;  2LK4 A;  5E33 A;  4MND A;  1QVX A;  4XEK A;  2HSB A;  4EBK A;  3IQ6 A;  3T9O A;  5AGF A;  3EQL F;  3V5Y A;  1D1C A;  1G5Z A;  1RJ9 A;  2Q4F A;  3A11 A;  2IYL D;  4KBL A;  4PJN A;  2UUH A;  4G78 A;  1H9T A;  1L3P A;  5BQG A;  2YLD A;  5KYY B;  3FXH A;  5BUO A;  4U5D E;  2L9J A;  1DOW A;  1VLS A;  4MQ9 F;  5T3T A;  3R7C A;  3T4R A;  3GWL A;  4ER9 A;  5EGY A;  5A6B D;  1I4Z A;  1C03 A;  1FNT c;  3JRT A;  1A7D A;  5JP7 A;  4CS7 A;  1ZVZ A;  1FMV A;  3DAF A;  3TUL A;  3EHM A;  3IPM O;  4B6I A;  3LEV A;  2YWA A;  3HLZ A;  4BJ5 C;  5L0J A;  1G8X A;  4DXW A;  1RKE B;  2GA0 A;  2KC3 A;  4PFO A;  4DRH B;  4E17 A;  3DM5 A;  3EZI A;  4E18 A;  2XRH A;  4G7O F;  2MYS A;  5KYU B;  4JCZ A;  5DLJ A;  1PV3 A;  4O6N A;  1LVK A;  4KC9 A;  2Y3G A;  1JPN A;  3VYW A;  1TQG A;  3WHN A;  3RYL A;  2YRF A;  4N06 A;  1E86 A;  2J45 A;  5DS6 A;  1Y6D A;  2B0H A;  3CAX A;  4J7T A;  4N6C A;  4F4B A;  3NDB B;  2A68 F;  2CDQ A;  3UNG C;  2HKV A;  4IGG A;  3U2M A;  4AE4 A;  4CBE A;  1EQ1 A;  1FMW A;  3JZ0 A;  5COM A;  2XLD A;  3O10 A;  1NFN A;  4NTF A;  1IZM A;  1LE4 A;  3VM6 A;  3ZQV A;  4G7H F;  3MX3 A;  1D0X A;  1T5O A;  3KMI A;  1MMA A;  1LM3 B;  1VTM P;  3T6B A;  3ZWI A;  3UR3 C;  4N4W A;  4YT4 A;  4Z9I A;  2L6H A;  2Q00 A;  3ASN C;  4YT8 A;  1UFB A;  1SZI A;  2YEV A;  5A6K A;  2H7O A;  5L0F A;  1JOG A;  2PBE A;  1QLE C;  1T01 A;  3DWW A;  3GEE A;  4IAO A;  4U5F E;  4U9E A;  1A41 A;  3ATP A;  5FZT A;  2GDC A;  4JTD B;  2D4U A;  1M2V A;  3FOO A;  3RW0 A;  2NUT B;  2Y3B A;  4CJG A;  3KYI A;  2L81 A;  4BPM A;  2J46 A;  1RXQ A;  3L8I A;  4N6H A;  4C3B A;  3K1I C;  4CJO A;  3GM2 A;  5KYX A;  4UDV A;  3WAQ A;  3S90 A;  3L34 A;  4XQ1 A;  4A4A A;  3JSZ A;  1JR8 A;  4JEB A;  4K1O A;  2EIJ C;  3TJ6 A;  1AEP A;  3B71 A;  3KYJ A;  4ULW A;  1N1C A;  4DRI B;  3B0U X;  2XLW A;  4DBQ A;  3FAJ A;  3A9C A;  5CI8 A;  4JUR I;  3ZTZ A;  1LI7 A;  2DB4 A;  4MVS A;  4C3E A;  4MVR A;  3EZH A;  2EPL X;  3U8P A;  3ZQY A;  3AQC A;  3RQF A;  4P9T A;  5L0G A;  1NSG B;  1ORJ A;  4ONS A;  1Z63 A;  1A0B A;  1FAP B;  3K7D A;  2JX0 A;  1BR2 A;  3K6B A;  3GM1 A;  4U5H A;  2FGY A;  5D91 A;  1EI7 A;  1SYQ A;  4ZLD A;  2OCC C;  4KNW A;  2R7U A;  4U5C E;  4BEJ A;  2MWQ A;  3CQZ A;  4BG0 A;  2R7W A;  4C3D A;  3NG1 A;  3N2Z B;  1RMV A;  1NU9 C;  4JIO A;  1NFO A;  3V5X A;  1V74 B;  4PJJ A;  4GYT A;  2EPN A;  3OWT A;  2WVN A;  3GOD A;  2QE9 A;  3DM9 B;  1ORY A;  2G3K A;  3AGU A;  1K05 A;  1RCP A;  2CYD A;  1OCR C;  1L7C A;  1TWC A;  4EUK B;  2J9B A;  2IM8 A;  4CDV A; 
#chains in the Genus database with same CATH homology
 1A0B A;  1SR2 A;  4PAC A;  2LD6 A;  3MYF A;  1BDJ B;  3KYI A;  2Q4F A;  3U3B A;  1TQG A;  4G78 A;  1Y6D A;  1I5N A;  1WN0 A;  2OOC A;  3IQT A;  1YVI A;  3KYJ A;  1C03 A;  1QSP A;  2LP4 A;  2A0B A;  2R25 A;  1FR0 A;  1OXK A;  4EUK B;  1C02 A;  2LCH A;  1OXB A;  3US6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...