1YVNG

The yeast actin val 159 asn mutant complex with human gelsolin segment 1.
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
125
structure length
125
Chain Sequence
MVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of yeast actin V159N mutant
rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords PROTEIN (ACTIN)
total genus 39
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 1999-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00626 Gelsolin Gelsolin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 1yvnG00
2NUPA 4S10C 2FH3A 3A5NS 3CJBG 2L72A 1T44G 1PD0A 1DEJS 2MOTA 2VILA 5IVUA 3Q2BA 1CFYA 1Q8GA 1HQZ1 5KYYB 2MV2A 3FG7A 5KYNA 2LLFA 3EH2A 2FH4A 1P8ZG 5A1MA 1AHQA 1RGIG 2FH1A 4PKHB 3EH1A 1P8XA 2HD7A 4JD2H 1ESVS 1NLVG 2W0IA 2LJ8A 2KVKA 1UDMA 4CBXG 1T2LA 3CJCG 5FAEA 3EGXA 5HVKB 1MDUA 1WM4A 3EGDB 2NUTA 3EFOB 1M2OA 3CIPG 5KYWA 1COFA 1SVYA 1H1VG 2FH2A 4KEEA 3EG9B 1AK6A 2VACA 1X67A 3EG9A 1D4XG 5KYXA 5KYWB 1F7SA 3EFOA 2VIKA 4KEDA 1YAGG 1KCQA 3EGXB 5FAFA 1WFSA 2NUPB 4KEFA 5L6WC 5KYXB 5KYUB 2XF1A 1JHWA 2QTVA 1C0FS 1NMDG 5KYYA 2I2QA 3FFNA 5HVKD 3A5MS 1J72A 3FFKA 1SVQA 2FF6G 2NUTB 3A5OS 1TVJA 2MP4A 1SVRA 1PD1A 4CBUG 2FGHA 4PKIG 1T3YA 3DAWB 1Q8XA 3L50A 1V6FA 1WNJA 2D8BA 1NPHA 3A5LS 1D0NA 4PKGG 3FG6A 3EGDA 4LIZA 1TMWA 1M2VA 2LXXA 1T3XA 5DD2A 1AK7A 2FF3A 1M2VB 3CI5G 1YVNG 1VFQA 2XFAA 4Z94G 1EQYS 4CBWG 1CNUA 1M4JA 4BEX1 1QPVA 1PCXA 3TU5B 1VKKA 5KYUA 1NM1G 1C0GS
chains in the Genus database with same CATH superfamily
2NUPA 4S10C 2FH3A 3A5NS 3CJBG 2L72A 1T44G 1PD0A 1DEJS 2MOTA 2VILA 5IVUA 3Q2BA 1CFYA 1Q8GA 1HQZ1 5KYYB 2MV2A 3FG7A 5KYNA 2LLFA 3EH2A 2FH4A 1P8ZG 5A1MA 1AHQA 1RGIG 2FH1A 4PKHB 3EH1A 1P8XA 2HD7A 4JD2H 1ESVS 1NLVG 2W0IA 2LJ8A 2KVKA 1UDMA 4CBXG 1T2LA 3CJCG 3DA7A 5FAEA 3EGXA 5HVKB 1MDUA 1WM4A 3EGDB 2NUTA 3EFOB 1M2OA 3CIPG 5KYWA 1COFA 1SVYA 1H1VG 2FH2A 4KEEA 3EG9B 1AK6A 2VACA 1X67A 3EG9A 1D4XG 5KYXA 5KYWB 1F7SA 3EFOA 2VIKA 4KEDA 1YAGG 1KCQA 3EGXB 5FAFA 1WFSA 2NUPB 4KEFA 5L6WC 5KYXB 5KYUB 2XF1A 1JHWA 2QTVA 1C0FS 1NMDG 5KYYA 2I2QA 3FFNA 5HVKD 3A5MS 1J72A 3FFKA 1SVQA 2FF6G 2NUTB 3A5OS 1TVJA 2MP4A 1SVRA 1PD1A 4CBUG 2FGHA 4PKIG 1T3YA 3DAWB 1Q8XA 3L50A 1V6FA 1WNJA 2D8BA 1NPHA 3A5LS 1D0NA 4PKGG 3FG6A 3EGDA 4LIZA 1TMWA 1M2VA 2LXXA 1T3XA 5DD2A 1AK7A 2FF3A 1M2VB 3CI5G 1YVNG 1VFQA 2XFAA 4Z94G 1EQYS 4CBWG 1CNUA 1M4JA 4BEX1 1QPVA 1PCXA 3TU5B 1VKKA 5KYUA 1NM1G 1C0GS
chains in the Genus database with same CATH topology
2NUPA 4S10C 2FH3A 3A5NS 3CJBG 2L72A 1T44G 1PD0A 1DEJS 2MOTA 2VILA 5IVUA 3Q2BA 1CFYA 1Q8GA 1HQZ1 5KYYB 2MV2A 3FG7A 5KYNA 2LLFA 3EH2A 2FH4A 1P8ZG 5A1MA 1AHQA 1RGIG 2FH1A 4PKHB 3EH1A 1P8XA 2HD7A 4JD2H 1ESVS 1NLVG 2W0IA 2LJ8A 2KVKA 1UDMA 4CBXG 1T2LA 3CJCG 3DA7A 5FAEA 3EGXA 5HVKB 1MDUA 1WM4A 3EGDB 2NUTA 3EFOB 1M2OA 3CIPG 5KYWA 1COFA 1SVYA 1H1VG 2FH2A 4KEEA 3EG9B 1AK6A 2VACA 1X67A 3EG9A 1D4XG 5KYXA 5KYWB 1F7SA 3EFOA 2VIKA 4KEDA 1YAGG 1KCQA 3EGXB 5FAFA 1WFSA 2NUPB 4KEFA 5L6WC 5KYXB 5KYUB 2XF1A 1JHWA 2QTVA 1C0FS 1NMDG 5KYYA 2I2QA 3FFNA 5HVKD 3A5MS 1J72A 3FFKA 1SVQA 2FF6G 2NUTB 3A5OS 1TVJA 2MP4A 1SVRA 1PD1A 4CBUG 2FGHA 4PKIG 1T3YA 3DAWB 1Q8XA 3L50A 1V6FA 1WNJA 2D8BA 1NPHA 3A5LS 1D0NA 4PKGG 3FG6A 3EGDA 4LIZA 1TMWA 1M2VA 2LXXA 1T3XA 5DD2A 1AK7A 2FF3A 1M2VB 3CI5G 1YVNG 1VFQA 2XFAA 4Z94G 1EQYS 4CBWG 1CNUA 1M4JA 4BEX1 1QPVA 1PCXA 3TU5B 1VKKA 5KYUA 1NM1G 1C0GS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NUP A;  4S10 C;  2FH3 A;  3A5N S;  3CJB G;  2L72 A;  1T44 G;  1PD0 A;  1DEJ S;  2MOT A;  2VIL A;  5IVU A;  3Q2B A;  1CFY A;  1Q8G A;  1HQZ 1;  5KYY B;  2MV2 A;  3FG7 A;  5KYN A;  2LLF A;  3EH2 A;  2FH4 A;  1P8Z G;  5A1M A;  1AHQ A;  1RGI G;  2FH1 A;  4PKH B;  3EH1 A;  1P8X A;  2HD7 A;  4JD2 H;  1ESV S;  1NLV G;  2W0I A;  2LJ8 A;  2KVK A;  1UDM A;  4CBX G;  1T2L A;  3CJC G;  5FAE A;  3EGX A;  5HVK B;  1MDU A;  1WM4 A;  3EGD B;  2NUT A;  3EFO B;  1M2O A;  3CIP G;  5KYW A;  1COF A;  1SVY A;  1H1V G;  2FH2 A;  4KEE A;  3EG9 B;  1AK6 A;  2VAC A;  1X67 A;  3EG9 A;  1D4X G;  5KYX A;  5KYW B;  1F7S A;  3EFO A;  2VIK A;  4KED A;  1YAG G;  1KCQ A;  3EGX B;  5FAF A;  1WFS A;  2NUP B;  4KEF A;  5L6W C;  5KYX B;  5KYU B;  2XF1 A;  1JHW A;  2QTV A;  1C0F S;  1NMD G;  5KYY A;  2I2Q A;  3FFN A;  5HVK D;  3A5M S;  1J72 A;  3FFK A;  1SVQ A;  2FF6 G;  2NUT B;  3A5O S;  1TVJ A;  2MP4 A;  1SVR A;  1PD1 A;  4CBU G;  2FGH A;  4PKI G;  1T3Y A;  3DAW B;  1Q8X A;  3L50 A;  1V6F A;  1WNJ A;  2D8B A;  1NPH A;  3A5L S;  1D0N A;  4PKG G;  3FG6 A;  3EGD A;  4LIZ A;  1TMW A;  1M2V A;  2LXX A;  1T3X A;  5DD2 A;  1AK7 A;  2FF3 A;  1M2V B;  3CI5 G;  1YVN G;  1VFQ A;  2XFA A;  4Z94 G;  1EQY S;  4CBW G;  1CNU A;  1M4J A;  4BEX 1;  1QPV A;  1PCX A;  3TU5 B;  1VKK A;  5KYU A;  1NM1 G;  1C0G S; 
#chains in the Genus database with same CATH topology
 2NUP A;  4S10 C;  2FH3 A;  3A5N S;  3CJB G;  2L72 A;  1T44 G;  1PD0 A;  1DEJ S;  2MOT A;  2VIL A;  5IVU A;  3Q2B A;  1CFY A;  1Q8G A;  1HQZ 1;  5KYY B;  2MV2 A;  3FG7 A;  5KYN A;  2LLF A;  3EH2 A;  2FH4 A;  1P8Z G;  5A1M A;  1AHQ A;  1RGI G;  2FH1 A;  4PKH B;  3EH1 A;  1P8X A;  2HD7 A;  4JD2 H;  1ESV S;  1NLV G;  2W0I A;  2LJ8 A;  2KVK A;  1UDM A;  4CBX G;  1T2L A;  3CJC G;  3DA7 A;  5FAE A;  3EGX A;  5HVK B;  1MDU A;  1WM4 A;  3EGD B;  2NUT A;  3EFO B;  1M2O A;  3CIP G;  5KYW A;  1COF A;  1SVY A;  1H1V G;  2FH2 A;  4KEE A;  3EG9 B;  1AK6 A;  2VAC A;  1X67 A;  3EG9 A;  1D4X G;  5KYX A;  5KYW B;  1F7S A;  3EFO A;  2VIK A;  4KED A;  1YAG G;  1KCQ A;  3EGX B;  5FAF A;  1WFS A;  2NUP B;  4KEF A;  5L6W C;  5KYX B;  5KYU B;  2XF1 A;  1JHW A;  2QTV A;  1C0F S;  1NMD G;  5KYY A;  2I2Q A;  3FFN A;  5HVK D;  3A5M S;  1J72 A;  3FFK A;  1SVQ A;  2FF6 G;  2NUT B;  3A5O S;  1TVJ A;  2MP4 A;  1SVR A;  1PD1 A;  4CBU G;  2FGH A;  4PKI G;  1T3Y A;  3DAW B;  1Q8X A;  3L50 A;  1V6F A;  1WNJ A;  2D8B A;  1NPH A;  3A5L S;  1D0N A;  4PKG G;  3FG6 A;  3EGD A;  4LIZ A;  1TMW A;  1M2V A;  2LXX A;  1T3X A;  5DD2 A;  1AK7 A;  2FF3 A;  1M2V B;  3CI5 G;  1YVN G;  1VFQ A;  2XFA A;  4Z94 G;  1EQY S;  4CBW G;  1CNU A;  1M4J A;  4BEX 1;  1QPV A;  1PCX A;  3TU5 B;  1VKK A;  5KYU A;  1NM1 G;  1C0G S; 
#chains in the Genus database with same CATH homology
 2NUP A;  4S10 C;  2FH3 A;  3A5N S;  3CJB G;  2L72 A;  1T44 G;  1PD0 A;  1DEJ S;  2MOT A;  2VIL A;  5IVU A;  3Q2B A;  1CFY A;  1Q8G A;  1HQZ 1;  5KYY B;  2MV2 A;  3FG7 A;  5KYN A;  2LLF A;  3EH2 A;  2FH4 A;  1P8Z G;  5A1M A;  1AHQ A;  1RGI G;  2FH1 A;  4PKH B;  3EH1 A;  1P8X A;  2HD7 A;  4JD2 H;  1ESV S;  1NLV G;  2W0I A;  2LJ8 A;  2KVK A;  1UDM A;  4CBX G;  1T2L A;  3CJC G;  3DA7 A;  5FAE A;  3EGX A;  5HVK B;  1MDU A;  1WM4 A;  3EGD B;  2NUT A;  3EFO B;  1M2O A;  3CIP G;  5KYW A;  1COF A;  1SVY A;  1H1V G;  2FH2 A;  4KEE A;  3EG9 B;  1AK6 A;  2VAC A;  1X67 A;  3EG9 A;  1D4X G;  5KYX A;  5KYW B;  1F7S A;  3EFO A;  2VIK A;  4KED A;  1YAG G;  1KCQ A;  3EGX B;  5FAF A;  1WFS A;  2NUP B;  4KEF A;  5L6W C;  5KYX B;  5KYU B;  2XF1 A;  1JHW A;  2QTV A;  1C0F S;  1NMD G;  5KYY A;  2I2Q A;  3FFN A;  5HVK D;  3A5M S;  1J72 A;  3FFK A;  1SVQ A;  2FF6 G;  2NUT B;  3A5O S;  1TVJ A;  2MP4 A;  1SVR A;  1PD1 A;  4CBU G;  2FGH A;  4PKI G;  1T3Y A;  3DAW B;  1Q8X A;  3L50 A;  1V6F A;  1WNJ A;  2D8B A;  1NPH A;  3A5L S;  1D0N A;  4PKG G;  3FG6 A;  3EGD A;  4LIZ A;  1TMW A;  1M2V A;  2LXX A;  1T3X A;  5DD2 A;  1AK7 A;  2FF3 A;  1M2V B;  3CI5 G;  1YVN G;  1VFQ A;  2XFA A;  4Z94 G;  1EQY S;  4CBW G;  1CNU A;  1M4J A;  4BEX 1;  1QPV A;  1PCX A;  3TU5 B;  1VKK A;  5KYU A;  1NM1 G;  1C0G S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...