1YVNG

The yeast actin val 159 asn mutant complex with human gelsolin segment 1.
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
125
structure length
125
Chain Sequence
MVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of yeast actin V159N mutant
rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords PROTEIN (ACTIN)
total genus 39
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 1999-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00626 Gelsolin Gelsolin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 1yvnG00
1UDMA 1M4JA 1Q8XA 2NUPB 2FH2A 3EFOA 5KYUA 4KEFA 1KCQA 1MDUA 1M2VA 5HVKB 2MV2A 1COFA 2FH3A 5FAFA 1C0FS 5IVUA 2KVKA 1X67A 2LXXA 5KYXA 1QPVA 1AK7A 1Q8GA 1SVRA 1WFSA 5KYNA 2D8BA 3FG7A 1PD1A 1T3YA 2FF3A 5DD2A 1NM1G 5KYWB 3TU5B 3FFKA 2FGHA 2NUPA 3EFOB 1YVNG 1RGIG 2NUTB 4CBWG 3EG9A 1AK6A 2LJ8A 2LLFA 3L50A 5FAEA 3EH1A 5HVKD 1CNUA 2VILA 1PD0A 2FF6G 1HQZ1 2MP4A 1F7SA 4PKHB 2FH1A 3EGDB 1T3XA 1SVYA 3A5LS 1DEJS 1JHWA 3A5MS 1YAGG 3CI5G 3EGXB 3Q2BA 1ESVS 4JD2H 1VKKA 3A5NS 5KYWA 3FFNA 3CIPG 3FG6A 3EG9B 1P8XA 1J72A 2HD7A 1TMWA 5KYYA 3EH2A 1PCXA 1H1VG 1V6FA 2XFAA 1NLVG 1M2VB 5L6WC 3EGDA 2I2QA 3CJCG 1D4XG 5KYUB 1T44G 1M2OA 2XF1A 5KYXB 1VFQA 1SVQA 2VACA 2L72A 4PKIG 5A1MA 2QTVA 1P8ZG 1CFYA 2W0IA 1T2LA 2VIKA 1WM4A 3DAWB 4KEDA 1C0GS 4S10C 3EGXA 2FH4A 4Z94G 4CBUG 1AHQA 3CJBG 1EQYS 4BEX1 1WNJA 4CBXG 2MOTA 4KEEA 4LIZA 2NUTA 1NMDG 1TVJA 1NPHA 3A5OS 5KYYB 1D0NA 4PKGG
chains in the Genus database with same CATH superfamily
1UDMA 1M4JA 1Q8XA 3DA7A 2NUPB 2FH2A 3EFOA 5KYUA 4KEFA 1KCQA 1MDUA 1M2VA 5HVKB 2MV2A 1COFA 2FH3A 5FAFA 1C0FS 5IVUA 2KVKA 1X67A 2LXXA 5KYXA 1QPVA 1AK7A 1Q8GA 1SVRA 1WFSA 5KYNA 2D8BA 3FG7A 1PD1A 1T3YA 2FF3A 5DD2A 1NM1G 5KYWB 3TU5B 3FFKA 2FGHA 2NUPA 3EFOB 1YVNG 1RGIG 2NUTB 4CBWG 3EG9A 1AK6A 2LJ8A 2LLFA 3L50A 5FAEA 3EH1A 5HVKD 1CNUA 2VILA 1PD0A 2FF6G 1HQZ1 2MP4A 1F7SA 4PKHB 2FH1A 3EGDB 1T3XA 1SVYA 3A5LS 1DEJS 1JHWA 3A5MS 1YAGG 3CI5G 3EGXB 3Q2BA 1ESVS 4JD2H 1VKKA 3A5NS 5KYWA 3FFNA 3CIPG 3FG6A 3EG9B 1P8XA 1J72A 2HD7A 1TMWA 5KYYA 3EH2A 1PCXA 1H1VG 1V6FA 2XFAA 1NLVG 1M2VB 5L6WC 3EGDA 2I2QA 3CJCG 1D4XG 5KYUB 1T44G 1M2OA 2XF1A 5KYXB 1VFQA 1SVQA 2VACA 2L72A 4PKIG 5A1MA 2QTVA 1P8ZG 1CFYA 2W0IA 1T2LA 2VIKA 1WM4A 3DAWB 4KEDA 1C0GS 4S10C 3EGXA 2FH4A 4Z94G 4CBUG 1AHQA 3CJBG 1EQYS 4BEX1 1WNJA 4CBXG 2MOTA 4KEEA 4LIZA 2NUTA 1NMDG 1TVJA 1NPHA 3A5OS 5KYYB 1D0NA 4PKGG
chains in the Genus database with same CATH topology
1UDMA 1M4JA 1Q8XA 3DA7A 2NUPB 2FH2A 3EFOA 5KYUA 4KEFA 1KCQA 1MDUA 1M2VA 5HVKB 2MV2A 1COFA 2FH3A 5FAFA 1C0FS 5IVUA 2KVKA 1X67A 2LXXA 5KYXA 1QPVA 1AK7A 1Q8GA 1SVRA 1WFSA 5KYNA 2D8BA 3FG7A 1PD1A 1T3YA 2FF3A 5DD2A 1NM1G 5KYWB 3TU5B 3FFKA 2FGHA 2NUPA 3EFOB 1YVNG 1RGIG 2NUTB 4CBWG 3EG9A 1AK6A 2LJ8A 2LLFA 3L50A 5FAEA 3EH1A 5HVKD 1CNUA 2VILA 1PD0A 2FF6G 1HQZ1 2MP4A 1F7SA 4PKHB 2FH1A 3EGDB 1T3XA 1SVYA 3A5LS 1DEJS 1JHWA 3A5MS 1YAGG 3CI5G 3EGXB 3Q2BA 1ESVS 4JD2H 1VKKA 3A5NS 5KYWA 3FFNA 3CIPG 3FG6A 3EG9B 1P8XA 1J72A 2HD7A 1TMWA 5KYYA 3EH2A 1PCXA 1H1VG 1V6FA 2XFAA 1NLVG 1M2VB 5L6WC 3EGDA 2I2QA 3CJCG 1D4XG 5KYUB 1T44G 1M2OA 2XF1A 5KYXB 1VFQA 1SVQA 2VACA 2L72A 4PKIG 5A1MA 2QTVA 1P8ZG 1CFYA 2W0IA 1T2LA 2VIKA 1WM4A 3DAWB 4KEDA 1C0GS 4S10C 3EGXA 2FH4A 4Z94G 4CBUG 1AHQA 3CJBG 1EQYS 4BEX1 1WNJA 4CBXG 2MOTA 4KEEA 4LIZA 2NUTA 1NMDG 1TVJA 1NPHA 3A5OS 5KYYB 1D0NA 4PKGG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UDM A;  1M4J A;  1Q8X A;  2NUP B;  2FH2 A;  3EFO A;  5KYU A;  4KEF A;  1KCQ A;  1MDU A;  1M2V A;  5HVK B;  2MV2 A;  1COF A;  2FH3 A;  5FAF A;  1C0F S;  5IVU A;  2KVK A;  1X67 A;  2LXX A;  5KYX A;  1QPV A;  1AK7 A;  1Q8G A;  1SVR A;  1WFS A;  5KYN A;  2D8B A;  3FG7 A;  1PD1 A;  1T3Y A;  2FF3 A;  5DD2 A;  1NM1 G;  5KYW B;  3TU5 B;  3FFK A;  2FGH A;  2NUP A;  3EFO B;  1YVN G;  1RGI G;  2NUT B;  4CBW G;  3EG9 A;  1AK6 A;  2LJ8 A;  2LLF A;  3L50 A;  5FAE A;  3EH1 A;  5HVK D;  1CNU A;  2VIL A;  1PD0 A;  2FF6 G;  1HQZ 1;  2MP4 A;  1F7S A;  4PKH B;  2FH1 A;  3EGD B;  1T3X A;  1SVY A;  3A5L S;  1DEJ S;  1JHW A;  3A5M S;  1YAG G;  3CI5 G;  3EGX B;  3Q2B A;  1ESV S;  4JD2 H;  1VKK A;  3A5N S;  5KYW A;  3FFN A;  3CIP G;  3FG6 A;  3EG9 B;  1P8X A;  1J72 A;  2HD7 A;  1TMW A;  5KYY A;  3EH2 A;  1PCX A;  1H1V G;  1V6F A;  2XFA A;  1NLV G;  1M2V B;  5L6W C;  3EGD A;  2I2Q A;  3CJC G;  1D4X G;  5KYU B;  1T44 G;  1M2O A;  2XF1 A;  5KYX B;  1VFQ A;  1SVQ A;  2VAC A;  2L72 A;  4PKI G;  5A1M A;  2QTV A;  1P8Z G;  1CFY A;  2W0I A;  1T2L A;  2VIK A;  1WM4 A;  3DAW B;  4KED A;  1C0G S;  4S10 C;  3EGX A;  2FH4 A;  4Z94 G;  4CBU G;  1AHQ A;  3CJB G;  1EQY S;  4BEX 1;  1WNJ A;  4CBX G;  2MOT A;  4KEE A;  4LIZ A;  2NUT A;  1NMD G;  1TVJ A;  1NPH A;  3A5O S;  5KYY B;  1D0N A;  4PKG G; 
#chains in the Genus database with same CATH topology
 1UDM A;  1M4J A;  1Q8X A;  3DA7 A;  2NUP B;  2FH2 A;  3EFO A;  5KYU A;  4KEF A;  1KCQ A;  1MDU A;  1M2V A;  5HVK B;  2MV2 A;  1COF A;  2FH3 A;  5FAF A;  1C0F S;  5IVU A;  2KVK A;  1X67 A;  2LXX A;  5KYX A;  1QPV A;  1AK7 A;  1Q8G A;  1SVR A;  1WFS A;  5KYN A;  2D8B A;  3FG7 A;  1PD1 A;  1T3Y A;  2FF3 A;  5DD2 A;  1NM1 G;  5KYW B;  3TU5 B;  3FFK A;  2FGH A;  2NUP A;  3EFO B;  1YVN G;  1RGI G;  2NUT B;  4CBW G;  3EG9 A;  1AK6 A;  2LJ8 A;  2LLF A;  3L50 A;  5FAE A;  3EH1 A;  5HVK D;  1CNU A;  2VIL A;  1PD0 A;  2FF6 G;  1HQZ 1;  2MP4 A;  1F7S A;  4PKH B;  2FH1 A;  3EGD B;  1T3X A;  1SVY A;  3A5L S;  1DEJ S;  1JHW A;  3A5M S;  1YAG G;  3CI5 G;  3EGX B;  3Q2B A;  1ESV S;  4JD2 H;  1VKK A;  3A5N S;  5KYW A;  3FFN A;  3CIP G;  3FG6 A;  3EG9 B;  1P8X A;  1J72 A;  2HD7 A;  1TMW A;  5KYY A;  3EH2 A;  1PCX A;  1H1V G;  1V6F A;  2XFA A;  1NLV G;  1M2V B;  5L6W C;  3EGD A;  2I2Q A;  3CJC G;  1D4X G;  5KYU B;  1T44 G;  1M2O A;  2XF1 A;  5KYX B;  1VFQ A;  1SVQ A;  2VAC A;  2L72 A;  4PKI G;  5A1M A;  2QTV A;  1P8Z G;  1CFY A;  2W0I A;  1T2L A;  2VIK A;  1WM4 A;  3DAW B;  4KED A;  1C0G S;  4S10 C;  3EGX A;  2FH4 A;  4Z94 G;  4CBU G;  1AHQ A;  3CJB G;  1EQY S;  4BEX 1;  1WNJ A;  4CBX G;  2MOT A;  4KEE A;  4LIZ A;  2NUT A;  1NMD G;  1TVJ A;  1NPH A;  3A5O S;  5KYY B;  1D0N A;  4PKG G; 
#chains in the Genus database with same CATH homology
 1UDM A;  1M4J A;  1Q8X A;  3DA7 A;  2NUP B;  2FH2 A;  3EFO A;  5KYU A;  4KEF A;  1KCQ A;  1MDU A;  1M2V A;  5HVK B;  2MV2 A;  1COF A;  2FH3 A;  5FAF A;  1C0F S;  5IVU A;  2KVK A;  1X67 A;  2LXX A;  5KYX A;  1QPV A;  1AK7 A;  1Q8G A;  1SVR A;  1WFS A;  5KYN A;  2D8B A;  3FG7 A;  1PD1 A;  1T3Y A;  2FF3 A;  5DD2 A;  1NM1 G;  5KYW B;  3TU5 B;  3FFK A;  2FGH A;  2NUP A;  3EFO B;  1YVN G;  1RGI G;  2NUT B;  4CBW G;  3EG9 A;  1AK6 A;  2LJ8 A;  2LLF A;  3L50 A;  5FAE A;  3EH1 A;  5HVK D;  1CNU A;  2VIL A;  1PD0 A;  2FF6 G;  1HQZ 1;  2MP4 A;  1F7S A;  4PKH B;  2FH1 A;  3EGD B;  1T3X A;  1SVY A;  3A5L S;  1DEJ S;  1JHW A;  3A5M S;  1YAG G;  3CI5 G;  3EGX B;  3Q2B A;  1ESV S;  4JD2 H;  1VKK A;  3A5N S;  5KYW A;  3FFN A;  3CIP G;  3FG6 A;  3EG9 B;  1P8X A;  1J72 A;  2HD7 A;  1TMW A;  5KYY A;  3EH2 A;  1PCX A;  1H1V G;  1V6F A;  2XFA A;  1NLV G;  1M2V B;  5L6W C;  3EGD A;  2I2Q A;  3CJC G;  1D4X G;  5KYU B;  1T44 G;  1M2O A;  2XF1 A;  5KYX B;  1VFQ A;  1SVQ A;  2VAC A;  2L72 A;  4PKI G;  5A1M A;  2QTV A;  1P8Z G;  1CFY A;  2W0I A;  1T2L A;  2VIK A;  1WM4 A;  3DAW B;  4KED A;  1C0G S;  4S10 C;  3EGX A;  2FH4 A;  4Z94 G;  4CBU G;  1AHQ A;  3CJB G;  1EQY S;  4BEX 1;  1WNJ A;  4CBX G;  2MOT A;  4KEE A;  4LIZ A;  2NUT A;  1NMD G;  1TVJ A;  1NPH A;  3A5O S;  5KYY B;  1D0N A;  4PKG G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...