1YVWA

Crystal structure of phosphoribosyl-atp pyrophosphohydrolase from bacillus cereus. nesgc target bcr13.
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
92
structure length
92
Chain Sequence
AFKLLYKTIEERKGSPLPESYTNYLFSKGEDKILKKIGEECAEVIIACKNNDKEEVVKEMVDVFYHCFVLLAEKNIALEDVMREVKERNGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Phosphoribosyl-ATP pyrophosphohydrolase from Bacillus cereus at 2.6 A resolution.
rcsb
source organism Bacillus cereus
molecule tags Hydrolase
molecule keywords Phosphoribosyl-ATP pyrophosphatase
total genus 34
structure length 92
sequence length 92
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.31: Phosphoribosyl-ATP diphosphatase.
pdb deposition date 2005-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01503 PRA-PH Phosphoribosyl-ATP pyrophosphohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1080 Mainly Alpha Orthogonal Bundle Helix Hairpins MazG-like 1yvwA00
3CRAA 2Q73A 1YVWA 2Q9LA 2OIGA 2A3QA 1Y6XA 2OIEA 2YXHA 2Q5ZA 3C90A 1VMGA 2Q4PA 5IE9A 3CRCA 2GTAA 4QGPA 2P06A 2A7WA 1YXBA
chains in the Genus database with same CATH superfamily
3S3WA 4WFEA 4LFAO 1U96A 2R9IA 1P7BA 3OEHG 1AJPA 2XAJA 1Q5OA 5JVDA 4PA4A 1FJGO 4LCUC 3OGIB 2ZIOA 2KKWA 3LSSA 3Q4HB 1S77D 3IC7A 1HNXO 3RGBA 3P3NA 4MTXA 5IJ0A 2P5OA 5LMNB 5H9CA 1D2DA 1AR1B 5L3FA 4O2AA 3SGIA 3C3SA 2OT5A 1IURA 1VQ6V 4FK5C 2OCCB 3A2FA 5CBFA 3AG7A 3OR7C 1R3KC 4I50A 4CS2A 2QEXV 1EZVH 2N74A 2WLIA 2W6IG 3IC9A 1Q82W 1CPYA 1SQQH 5FNVA 1SESA 4B3SO 3O9OA 4B3RO 4LFBB 3L74H 3CC4V 5B1NA 1WB8A 4FFBA 4X88A 2YI8A 5B1BC 1FD9A 1KKDA 4LFBO 2R70A 4GX0A 2DYSB 4JV5B 1XMQB 3AG1C 4RAIA 2HG5C 3K03A 3OMIB 4IIJB 4BIUA 3BCCH 4JYAO 3MAQA 4DR3B 2ADQB 2ETNA 5C93A 1B04A 3U10A 3A0HZ 2CE4A 1NTZH 1QBZA 2OIGA 1LUVA 3F5TA 3RYCA 2GSMB 1YTFD 1TGOA 1M4UA 3T1YB 3ZRWB 1VQKV 1W0JG 4NTWA 1Q6IA 2YIAA 1JMKC 3OMAB 1KECA 3LSQA 4DR6O 2EZOA 4GZRB 1G4YB 1OCOC 1XQ8A 1S3JA 1IBMO 3RYHB 4TOIA 2P6JA 1QR8A 2QKCA 4H33A 1KKCA 2QGNA 4UVBA 4I4TB 4CH6A 2GUZB 1VF5B 4UXNA 3CCRV 3W7UA 5LMUB 1VIBA 4GX1A 2MK3A 3D36A 5EYPA 2EIMB 2IM9A 1CXZB 1WLEA 1F51A 4DV7O 4FLVA 3ABUA 4DV1B 2PTMA 3K57A 3ASNB 4X1KA 5H2FZ 3D3IA 5B1BB 1SA0B 2X6CA 2EIJC 3H01A 4J7ZA 3HKEA 3OE7G 2JEUA 2EJRA 1GAXA 4G2KA 5E79Z 5KUMA 2VRZA 1H2LA 3NXSA 4LWSB 4F6RA 3JD0A 1RM1B 2LFSA 3IGAC 1OCCB 2ZE5A 2YDEA 3AG2C 4I9QA 1N32B 3TJTA 2R9AA 4K0KB 3QO5A 1TUEB 5K1PA 3K5NA 1AI6A 4PI0A 3TCUA 1W2BU 3E2EA 2OCCC 4H13B 1YJWV 1K7DA 2RJZA 1L0LH 2XNDG 2YC0A 1Q81W 2ZD9A 4X66O 2HVJC 2JEXA 4DV3O 2H3OA 3W7WA 4LNUB 4JI1B 1UFIA 1NQTA 1F4NA 2FKXA 2V7QG 2DYRB 1E1QG 2EJ7A 1OZ0A 1N32O 4RQEA 1Q6UA 4WFBV 4LFCB 4H37A 4WBNA 5FPRA 1RP3B 1S5HC 3OAAG 2L6LA 3UT5A 3CMAV 4Z1MG 4DR5O 2LW7A 2UXXA 5KHIA 5EZYB 4KHPB 1HDJA 1AP6A 1ZLZA 4TSFG 3CSXA 4QPJA 4Q6GA 5DM6V 2A0LA 4XBFA 3RYIB 3JAWB 4JPRA 5IYBO 3JD1A 1QHTA 2LFRA 4JI3B 2VWJA 4LNUA 4DV7B 4HBNA 4ZIBA 3L71H 4BW9A 2DQ0A 3DXRB 3L75H 1L1FA 3ASOC 1BGYH 2HVKC 5HFLA 3VQXA 4DRXA 3AG3B 3AG4C 3CYOA 2CTQA 3H9VA 4DR3O 4NTYA 1G6UA 5B1AC 4UCVA 4UB6Z 2KQXA 2HP8A 2GV9A 4FLYA 5FPOA 2F95B 2YICA 3EVKA 4DV2O 2WA3A 1XMQO 1VQLV 2AW9A 2BTQA 4DUYB 3R65A 3WG7B 4MVOA 2QM4A 4W4KA 4LR3A 1XNQO 4JI1O 2HHHB 4Q20A 3AG1B 1NKDA 4I55B 3QVNA 4EEQA 3JCZA 1QNMA 4FLUA 3CP1A 1XHZA 2GTAA 2KG7A 3CCEV 2UUCB 2UUBO 3MHSC 4J80A 2Q8VA 1IBLO 3IAYA 3CHXA 3LDCA 1VARA 2DW4A 4X1YB 5D5PA 2GDSA 4FFBB 4GT1A 1PL0A 2A7WA 2EIJB 2JVDA 4NR1A 4JYAB 4UV8A 2DN9A 3PJSK 2WLKA 2LQTA 4CC5A 2P4VA 4TUYA 2H8PC 1XNRB 3BA8A 3RYFB 3RYCB 2NLJC 2DYRC 5CA1A 2F1MA 3CXHF 2OCHA 4K8ZA 3RYIA 3ZRWA 3I56V 1DF5A 2UUAB 1M56B 2YIBD 5KMGA 3VOUA 4LH6A 2CUGA 1R73A 4O4LA 1SC5B 3J7AU 5H6RA 1GRJA 5EK0A 5KLVH 1Q8IA 4JYYA 4U3FH 1OCRB 3ZMSA 1ZWIC 3JAKB 1MZEA 2YXYA 3J80N 5F2VO 2Q7EA 2HEPA 3E35A 3E83A 2QM8A 3HKDB 3GB7C 1D5AA 3P32A 1QR9A 5CA0A 3SPGA 4MW3A 3P30A 3STZC 1IBMB 4TV9B 1Z5VA 1MA1A 4UCTA 3H1JH 1V55C 2EIKB 5FNVB 5LMNO 5DEDA 3RVZA 1B3QA 1E1RG 1I5YA 4AQYB 2B5UA 4PDMA 2GTSA 5IY5C 1TUBA 1IVSA 3OEEG 3K59A 4UCOA 4TV8A 2EIMC 1ORQC 3F5WC 2YXLA 4EKWA 4XDJA 3SYPA 3KCXA 4KHPO 1LR1A 2EINB 2RCVA 4G28B 4D7TA 3SPJA 5IE9A 2UU9O 2UXCB 4B3TB 2ZNIA 1KBHA 2VQFB 3FKSG 4PDLA 3CWBH 2LJ2A 2QWQB 1IXBA 2WPDG 3SR2C 4OPAA 4I0XB 2QWNB 4TQFA 1BCCH 1W59A 4DK0A 4KL1A 2IH3C 3SPHA 5JQGB 2HR3A 3VQYA 3B2EE 4MS2A 5KA6A 2OYQA 3LUTB 4YY3B 4UV9A 1Q86W 4B3SB 1D5NA 4FFKA 2XUMA 2Y69C 1HP8A 3THOA 4X89A 1Q90D 4LF6O 2EULA 4NXNB 5IYCO 2IJKA 4L87A 2LO1A 1L0NH 3GWKC 3FAVA 3EXAA 3JARB 2DQ3A 2UU9B 2DWEC 4BW5A 1TVKA 5EBMC 2V1DA 4U3JA 4ZOLB 3ZEDA 3ASNC 4NXMO 5IWAO 1NTMH 4E2LA 1WNSA 2RDCA 3WB2A 1FXKB 1RFYA 2OTLV 4MVZA 2ZR2A 3J81N 3CPWU 5JVDB 2BOBC 1GH6A 1QQCA 4RUEA 2X6AA 1RSOA 3QF7A 4KUMA 4WFHA 3CRAA 2A79B 1UJWB 3FYIB 2ZKOA 2Y4TA 4LFAB 5LP6A 3CJHA 2F93B 2P22C 4UVAA 3FB6C 4U7NA 4OGQB 3ZCCA 4FM2A 3N2KA 4J7JA 4DR5B 4I7ZB 2QWOB 1FFTB 4GKJO 2Y0PA 4X1IA 4WFAV 4IHJB 3I5DA 2QTOA 3UO2A 4QNHB 2D3OW 2B1IA 1N0JA 5KHKA 3SPIA 3FB5C 1M90W 5CA3A 3ZN1A 4JI2O 2P90A 1O9HA 4X64O 3OW2U 3K5MA 4X66B 1PKXA 3BVOA 3H1KH 2YI9A 2A06H 1XL4A 1XHXA 4Z2WA 1Y74A 2ZXWC 1JFFA 4A5UB 2DOSA 3H1IH 3UT5B 2F4VO 3O65A 3G71V 3K04A 1XL6A 3OTFA 2VQEB 2P06A 1DK1A 3DGEA 4CH3A 3K79A 5J2TB 1NVPD 1FXHA 4F6EA 1QVFU 4TWKA 1GMGA 1VP7A 3K5OA 1YHQV 5EZYA 2WWWA 4DUZB 1XUQA 2Q73A 4ZKIA 4OPHA 1PP9H 3W7SA 2PUSA 1MZFA 3E86A 5KAFZ 2XHBA 1ZUQA 1MG1A 2PY5A 2LP7A 1K33A 3DXRA 2EINC 1SZTA 3CRRA 3L70H 2X7RB 4J7KA 3ICXA 1R6KA 5KX5B 3CD6V 1CEZA 1NVPB 3U0ZA 4GUNA 4X65B 2EX3A 4HYOA 5JH7B 3JSLA 4FZ0A 1JX9A 3ZRVA 5JCOA 4JZ2A 2ATKC 3BA9A 2JS5A 2NNUA 1XOUA 2CH7A 4F4LA 5GW7A 3D3QA 3ZMUA 1SQBH 5B1AB 3BABA 4P9OA 4BIOA 2M6YA 4O4HB 5BR8O 1AR5A 1VF6A 1VQOV 2E76B 5C8YB 2X0LA 3ASOB 1VQMV 1AILA 4B7EA 4AI8A 2VS0A 4JI3O 4FLWA 5EBWC 4JI4O 2A9HA 1WP7A 5AG2A 4JI6O 1SQVH 3JD4A 1WAZA 1OCRC 2ZINA 4DV0O 4PV1B 4P30A 1NU1H 4K35A 1NH2D 3E8BA 1KP2A 5GONA 1DF4A 4JZGA 3HKBA 2G38A 4O2BB 3SYAA 5KA5A 4YJ2A 2P4KA 2ZM6B 1K34A 3B77A 4PELA 3JD2A 1R6NA 2QR4A 5LXTB 3B8NA 2Q6AA 4X1KB 2HKOA 3BRCA 1SA0A 3ZHQA 5E1AC 1X4TA 4MT8A 2E3CA 2CTWA 3IJ4A 2AHYA 1JR9A 2QTSA 4O4IA 4LWSA 5LHHA 2JGUA 2R72A 4YIOA 4J42A 4QE7A 2LGWA 3CCJV 1YXBA 5IYDO 2JK5C 5TISZ 1MMMA 1OHHG 1YEWA 5LA6A 3N2GB 3JYCA 4FVMA 1K92A 3UQ8A 2QA4V 4X8AA 2VWKA 3I55V 3ZHTA 1Z2GA 1H2KA 1Q6HA 2R9RB 4LF4O 1XILA 1YCIA 1V55B 2EIKC 3CRQA 3GWOA 5DECA 4I4TA 4FLXA 4KXRA 4B7KA 2YEVA 2K9PA 1HWYA 1NS1A 4GKKB 2DE0X 5FL7G 1Y67A 3QO8A 4X1IB 4LF8B 4BWAA 3A0RA 4WBNB 1N0NA 1R3LC 4MTGA 2CTPA 1DTOA 4MTFA 4JAVA 4JI8B 4O4HA 1TVKB 2ZE8A 5DN6G 1FFXB 3WG7C 4DV4B 1JA8A 3L73H 1HNXB 1H2NA 3X2QC 4LF9O 1FJGB 3RFRA 4LF6B 2PZSA 1ZX3A 1BT8A 3QTCA 5KHGA 1JFFB 1EBOA 4XDKA 2W0FC 3FD9A 1OCOB 1DGSA 4WCEV 4JI0O 4JYBA 2QSAA 4D6TH 4DR4O 4OX9O 2CGNA 3T4DA 3CCSV 3QO7A 3DSQA 2Q4PA 1N34O 1GM8A 1M57B 1URFA 1M1KW 4HNAA 2ZIMA 1VQ7V 1GN6A 4J11A 3CS5A 2Y69B 1VF7A 2CTRA 1I94O 4DR7B 4QIWF 2W6JG 4DR2O 3DC5A 3JD3A 3NR7A 1RPOA 3JSNA 2P67A 4LF5B 2UXBB 1XMOO 4DR1O 3EFFK 4UUJC 2FTKA 4IL6Z 2UXDO 3K9SA 4AILC 1SS3A 4GX2A 4FLTA 1U97A 3SPCA 4L8JA 2QE7G 4GYCB 2ZXWB 4JTDB 5LHGA 2Q9LA 3DC6A 2QWPB 4X62O 5LGTA 1WA8A 4LC1A 4AQYO 1SQGA 1XMOB 1SQPH 3FB8C 3ABMC 2Z5UA 4JI4B 3CCLV 4I55A 2DYSC 2RN9A 3VBBA 1R3IC 4RO2A 2WA4A 2RMKB 1SZXA 4PDRA 1GN3A 2B1GA 1N33B 1R6TA 3VQVA 3JALA 1THZA 4F6RB 3M7MX 3RYFA 3KKYA 3APQA 1AI5A 1NZ6A 4JASA 4JV5O 1FFXA 2WLJA 1YSCA 2F66C 2XTAA 2BSKA 1HR0B 1BHAA 1FXKA 4OXSA 1WP8A 4DRXB 4J9YB 1YVWA 5L3BA 4DR4B 3CX5F 1K5SA 2JIZG 4MVSA 3ZHRA 4CS3A 4OX9B 4LH7A 4DW1A 2KB1A 2OTJV 5B1OA 3CRMA 5JCOC 1S5JA 4NVPA 1KUQA 4FM1A 1GKFA 4TT3G 5BXZA 1YDXA 3T1HB 3BAAA 1LUWA 5LGNA 5KUKA 4N21A 1JCHA 4JI5B 1GM7A 2Q68A 1KP3A 4LBEC 4ZI7B 5CA0B 4JAAA 5D5QA 4CH5A 3MD0A 3BEHA 4B3MO 4UCRA 1EFRG 2B9ZA 4NTXA 1AB3A 4I5SA 2DJVA 1V54B 4W4LA 3OR6C 1P7GA 4TV8B 2FL4A 4HAMA 1MSDA 4FLZA 1H38A 3ZS8C 1UPGA 1NTKH 4CC6A 1I08A 5KHHA 4I50B 3BPZA 1KMIZ 4KP4A 5LP6C 5J9PC 1BQ0A 2IU0A 3OUFA 1PNKA 4IYHA 3RBZA 4TUYB 3CE2A 1PPJH 2YXHA 4WFGA 3G67A 4ZHQB 2JJ2G 4ASUG 3ZRSA 1P4RA 1VQ9V 1TUBB 4U7OA 4PA9A 4O4JA 3OT7A 1PM9A 1ZSPA 2D2CB 3AK1A 2EILC 4PDVA 3WU2Z 1B06A 4B3TO 4J9ZB 2NN4A 2GHYA 5EIBC 1I5XA 2JGDB 1Y76B 2XAHA 2RQ6A 3JATB 2PYLA 1XREA 4YJ3B 4FPPA 1OV9A 1BSMA 1QLEB 4GX5A 5IY5B 3HKCB 3ZHVA 1AROP 1Z5WA 1BZKA 3HKDA 1G1XB 3WB0A 1FS0G 1VQ5V 1YF2A 1KD1W 4JGSA 1YITV 4ZBMA 2IJHA 5CBGA 5LA6B 3K06A 2YEVB 2Q7HA 3ABLB 3JASA 4NYKA 4UB8Z 3OM3B 2LGQA 1B6QA 1ZAUA 3OFNG 1K4CC 5B3SC 4PI2A 1NR1A 3K5LA 3AEIA 4JYCA 3H1HH 3LDEA 3ABKB 2ZDIA 1H8HG 1P84F 2Q67A 3L9DA 1BQZA 1SETA 1N34B 2XOKG 4MVUA 2YSUB 4P2ZA 1IZ3A 2XT9A 4DV5O 1GK9A 1GTOA 2BE3A 4PJ0Z 4RWUA 3UO3A 2BCCH 4G27B 4UVCA 3HKBB 5FLXN 4MSWC 5J2UB 1KC8W 3M99B 5EIBD 4LF9B 3ZN0A 3VQWA 3AG3C 2AZ0A 1I0HA 2QWRB 4EB6B 2E5LO 2Y0IA 2KSDA 3K0GA 3RT3C 1KQSU 1GM9A 1EN6A 1N33O 4IHJA 1XBLA 1Y6XA 2KG7B 2BTOA 3K58A 5KHJA 4GLXA 1OJHA 3B8MA 1EM1A 3HKEB 2FB5A 1V9PA 3ZIAG 2ZDIC 3MDSA 4AHCA 3N2GA 1J5EB 3QNEA 1CP9A 3R66A 2LW1A 4R8CA 1AI4A 3ZRXA 4E4EA 1N8RW 2F4VB 4GCZA 2UUCO 4JTAB 4U3JB 4ZOLA 5B3SB 1SQFA 5LYJB 3WFVA 2OIEA 1H2GA 3TK1A 4QE9A 3ZBHA 1VQNV 5C8YA 4LF5O 3CC7V 3CXCU 1K3EA 4H44B 4R6ZA 3X2QB 3WB1A 1Q3EA 4FZ1A 4YJ2B 1EN5A 2AXTZ 2E5LB 1K5QA 3ABMB 1BL8A 4IYIA 2IH1C 4X20A 1JVMA 3N27A 4YIPA 5L3EA 1J95A 2CGOA 5KMGB 1F4MA 3E8HA 1QVGU 1QLEC 5A2QN 2EZPA 1HNWO 1DLBA 4ICGA 1Y4MA 4HZ3A 4JI0B 3N2KB 3SJQC 4DR6B 1ZL8B 5KX5A 4LF7O 3C3TA 4MW8A 2UUAO 4XDLA 5LYJA 3IFXA 1SQXH 3ZHSA 5GTIZ 1N36O 5B66Z 3G6BA 1H2MA 2QKAA 3RN4A 2CH7B 3E22A 4ZHQA 4JI8O 2L35A 5A9GA 4CZZA 1GN4A 5JH7A 1K9MW 2XAQA 3SJCC 4LF8O 1JQ0A 1Y74B 4GKKO 4DV6B 4UCSA 1K8AW 3K08A 3JATA 3HPLC 1N36B 4NXNO 1KB9F 3KZIZ 4EFEA 1SF9A 3BHPA 1WPBA 1EN4A 2UXDB 1BHBA 1FAFA 3TETA 3LNMB 1ENVA 4JI7B 2IBZH 5CBHA 1AJNA 4YXWG 5K1XA 1Q7YW 1PD3A 1AVMA 3L72H 1W0KG 3F7YC 1MSWD 4QPKA 4RQFA 2QKSA 2PGGA 5LGUA 1XNQB 1IX9A 3JASB 2Y4UA 1HR0O 3G4SV 1NI8A 3AG4B 4CH4A 3ZMTA 1RSOB 4ABMA 4IIJA 3U11A 3UKMA 1WN7A 2Q5ZA 4CBCA 1T5EA 1OCCC 1US6A 2ZM6O 4FMTA 3CCVV 3RWRD 3CCQV 4MVMA 2UXCO 3JCUZ 3DTUB 1S0VA 3E8FA 2WLHA 2IJIA 5EC2C 5CB4A 2XASA 2XAFA 2HJFC 2OWOA 4JI7O 4WFFA 1H8EG 3TGUH 4X62B 3BY6A 2O57A 2H94A 4O2AB 4KFMA 2CAZC 2ITDC 2V4DA 4QGPA 1AP5A 1R1BA 4D7SA 5IT9N 4DV1O 3ZMZA 3OTOB 2UXBO 1OCZB 2IU3A 4DR2B 3LSUA 3W7TA 3RYHA 2Q69A 5BMVA 1S76D 5EBLC 1E79G 1SKVA 3E8GA 1Q43A 2Q7GA 1S72V 1PNMA 3ETEA 5LOVA 2PI5A 1BMFG 3T1HO 2WLIB 4JTCB 3F7VC 5KAIZ 4GKJB 1GN2A 2GUZA 5EC1C 5BY1A 3A0BZ 4YHHO 5CB4B 2DWDC 2ZE7A 3OD4A 3BFRA 2P7TC 4LF7B 1X59A 4DO2A 2JRIA 4UCUA 4DV5B 1FXKC 4DV3B 1MABG 1FKAO 4NKGB 1HNWB 2K1EA 5JJNB 3K9AA 5LL6Y 1QLNA 3Q4HA 1NR7A 2PF4E 2Q0OC 1VQPV 3ABLC 5LBQA 2WAMA 4BR6A 2A3QA 3HR0A 2VQFO 5IWAB 1SERA 1IXMA 5IJ0B 2QM7A 3W7XA 3ABKC 1OCZC 3QG5A 3OTOO 3AK3A 1WB7A 5L3GA 4K8XA 3LDDA 3GVMA 1WA8B 3H1LH 3CMEV 1QCEA 2YS8A 4JI6B 5CA1B 3LNNA 2E75B 2ILMA 3JAKA 1LNQA 4FIPC 1Y66A 5IYZB 2WLMA 1WJZA 1YJ9V 1JOYA 2ZQMA 2ZCEA 1I94B 3CC2V 3E22B 4DYLA 4TV9A 1ZTEA 3CCMV 2ZR3A 4LP8A 3SYCA 3T4ZA 3ZMVA 2ARHA 4MTOA 4J41A 1FYJA 4R7CA 2E74B 1FPOA 3SJAC 5LOVB 4X20B 2M7WA 4IGGA 4O2BA 4JF3A 2ADPA 3FX7A 2ZNJA 3JALB 1V54C 4J10A 3D36C 1PNLA 1WPXA 4EFBA 3JAWA 1HW7A 2Y48A 1G8MA 4BIZA 1MNGA 3A8TA 5ITZB 3OMNB 2N04A 2EBOA 3HKCA 4O4IB 1YJNV 1JJ2U 1XEQA 1KYOF 4DV4O 5IJ9A 3T1YO 3T1CA 4DV6O 1K4DC 4WF9V 1FXVA 4DUZO 4MVQA 2PI4A 3P3PA 4B3MB 2UXNA 1ZL8A 2ZE6A 4TQDA 4FM0A 3FB7C 4NXMB 1L8DA 2HJDA 4PD4F 1MOFA 2IJJA 4JI5O 2JS3A 4FJCC 4O4LB 2F43G 4MVRA 5GONB 3ZJZA 3ML0A 1AJQA 1M9NA 1P49A 2UUBB 1AI7A 1GO3F 1M57C 4LF4B 2CDYA 5EYPB 5LXTA 4B08A 3B09A 4H0LB 4YY3O 2YUAA 2WLNA 3FYEB 1IDSA 2MW2B 2HHHO 4DW0A 4QJFB 5IJ9B 3KG2A 2AGAA 5BMVB 1O9GA 4DUYO 1TAEA 1HNZB 4K0KO 3E89A 4I9WA 3ETDA 4NB5A 1YI2V 2CK3G 1NH2B 1F23A 1BS3A 4JAUA 2C2AA 2WLLA 3ZHUA 3SJBC 1QU7A 1I7FA 1M93A 2BOCC 3OUSA 3APOA 1PV0A 3ETQA 2ODMA 2JGDA 1AR4A 4DV0B 3M8AA 2QDOA 4K3AA 4EB6A 1YZBA 1IBLB 5JJJB 2X6BA 4R50A 3RW0A 3CEIA 5ITZA 3AK2A 1J5EO 1N4CA 3G80A 2Q0AA 2BTQB 1NJIW 4C7UA 4DR7O 2HFEC 3UM7A 2F23A 5BR8B 2HLDG 1XDCA 1M56C 1BE3H 3K3WA 5B5EZ 5JJEB 5LMUO 1XI1A 2PYJA 1VQ8V 4PA6A 3MHHC 3HB3B 3KCYA 1YTFB 5GTHZ 3TXSA 1SRYA 1VMGA 4Z1VA 3AG2B 2ITCC 3FFQA 1YIJV 3CB2A 2WSSG 4X65O 3JAMN 5J2UA 2YIDA 3ZX6A 1VEWA 4HNAB 4PA7A 5J2TA 1K73W 3PN1A 2YIBA 4DXWA 2BSKB 2Z0AA 1XNRO 3C90A 1IBKO 4I0XA 2Z3YA 4X1YA 1COWG 3CCUV 3OGCC 5H6QA 1R3JC 1TA8A 1Y76A 3ABTA 2GBOA 4YJ3A 1VQ4V 3STLC 1M5IA 1NBMG 1S5LZ 2AZ2A 4CS4A 1EZJA 3B4SA 3RVYA 4IT5A 3EHBB 2WLLB 2NR5A 5L3DA 2VQEO 1JPXA 3T2MA 4PA3A 2FMLA 5CN0A 4P9PA 4LFCO 5HFMA 3B40A 1PL4A 5JQGA 1HNZO 1IBKB 3D8CA 4BAYA 4N23A 4X9QA 4ZI7A 1H2SB 2JDIG 4DR1B 1ROPA 3SYOA 4JI2B 2ZT9B 4X64B 5CMUA 2FYUH 2XAGA 5BZBA 4B3RB 4DK1A 2EILB 4UFZA 1NT2B 5L3CA 3CRCA 2AHZA 3K0DA 2W0XA 2N05A 5IDJA 4YHHB 1RM1C 1F7YA 4RUFA 2IW5A 3FAVB 3JARA 2DMXA 3ETGA 1JJOA 4DV2B 4PHZA 2QJ1A 5IYZA 4O4JB 3UCSC 3SDLA 5JWPA 1VF6C 1K97A 5LHIA 1RPRA 3SYQA 3S3XA 1A32A 1KU9A 2JJ1G 3G6EV 5LP6B 3CJHB 5H5NA 2RNBA 3TXQA
chains in the Genus database with same CATH topology
3CRAA 2Q73A 1YVWA 2Q9LA 2OIGA 2A3QA 1Y6XA 2OIEA 2YXHA 2Q5ZA 3C90A 1VMGA 2Q4PA 5IE9A 3CRCA 2GTAA 4QGPA 2P06A 2A7WA 1YXBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CRA A;  2Q73 A;  1YVW A;  2Q9L A;  2OIG A;  2A3Q A;  1Y6X A;  2OIE A;  2YXH A;  2Q5Z A;  3C90 A;  1VMG A;  2Q4P A;  5IE9 A;  3CRC A;  2GTA A;  4QGP A;  2P06 A;  2A7W A;  1YXB A; 
#chains in the Genus database with same CATH topology
 3S3W A;  4WFE A;  4LFA O;  1U96 A;  2R9I A;  1P7B A;  3OEH G;  1AJP A;  2XAJ A;  1Q5O A;  5JVD A;  4PA4 A;  1FJG O;  4LCU C;  3OGI B;  2ZIO A;  2KKW A;  3LSS A;  3Q4H B;  1S77 D;  3IC7 A;  1HNX O;  3RGB A;  3P3N A;  4MTX A;  5IJ0 A;  2P5O A;  5LMN B;  5H9C A;  1D2D A;  1AR1 B;  5L3F A;  4O2A A;  3SGI A;  3C3S A;  2OT5 A;  1IUR A;  1VQ6 V;  4FK5 C;  2OCC B;  3A2F A;  5CBF A;  3AG7 A;  3OR7 C;  1R3K C;  4I50 A;  4CS2 A;  2QEX V;  1EZV H;  2N74 A;  2WLI A;  2W6I G;  3IC9 A;  1Q82 W;  1CPY A;  1SQQ H;  5FNV A;  1SES A;  4B3S O;  3O9O A;  4B3R O;  4LFB B;  3L74 H;  3CC4 V;  5B1N A;  1WB8 A;  4FFB A;  4X88 A;  2YI8 A;  5B1B C;  1FD9 A;  1KKD A;  4LFB O;  2R70 A;  4GX0 A;  2DYS B;  4JV5 B;  1XMQ B;  3AG1 C;  4RAI A;  2HG5 C;  3K03 A;  3OMI B;  4IIJ B;  4BIU A;  3BCC H;  4JYA O;  3MAQ A;  4DR3 B;  2ADQ B;  2ETN A;  5C93 A;  1B04 A;  3U10 A;  3A0H Z;  2CE4 A;  1NTZ H;  1QBZ A;  2OIG A;  1LUV A;  3F5T A;  3RYC A;  2GSM B;  1YTF D;  1TGO A;  1M4U A;  3T1Y B;  3ZRW B;  1VQK V;  1W0J G;  4NTW A;  1Q6I A;  2YIA A;  1JMK C;  3OMA B;  1KEC A;  3LSQ A;  4DR6 O;  2EZO A;  4GZR B;  1G4Y B;  1OCO C;  1XQ8 A;  1S3J A;  1IBM O;  3RYH B;  4TOI A;  2P6J A;  1QR8 A;  2QKC A;  4H33 A;  1KKC A;  2QGN A;  4UVB A;  4I4T B;  4CH6 A;  2GUZ B;  1VF5 B;  4UXN A;  3CCR V;  3W7U A;  5LMU B;  1VIB A;  4GX1 A;  2MK3 A;  3D36 A;  5EYP A;  2EIM B;  2IM9 A;  1CXZ B;  1WLE A;  1F51 A;  4DV7 O;  4FLV A;  3ABU A;  4DV1 B;  2PTM A;  3K57 A;  3ASN B;  4X1K A;  5H2F Z;  3D3I A;  5B1B B;  1SA0 B;  2X6C A;  2EIJ C;  3H01 A;  4J7Z A;  3HKE A;  3OE7 G;  2JEU A;  2EJR A;  1GAX A;  4G2K A;  5E79 Z;  5KUM A;  2VRZ A;  1H2L A;  3NXS A;  4LWS B;  4F6R A;  3JD0 A;  1RM1 B;  2LFS A;  3IGA C;  1OCC B;  2ZE5 A;  2YDE A;  3AG2 C;  4I9Q A;  1N32 B;  3TJT A;  2R9A A;  4K0K B;  3QO5 A;  1TUE B;  5K1P A;  3K5N A;  1AI6 A;  4PI0 A;  3TCU A;  1W2B U;  3E2E A;  2OCC C;  4H13 B;  1YJW V;  1K7D A;  2RJZ A;  1L0L H;  2XND G;  2YC0 A;  1Q81 W;  2ZD9 A;  4X66 O;  2HVJ C;  2JEX A;  4DV3 O;  2H3O A;  3W7W A;  4LNU B;  4JI1 B;  1UFI A;  1NQT A;  1F4N A;  2FKX A;  2V7Q G;  2DYR B;  1E1Q G;  2EJ7 A;  1OZ0 A;  1N32 O;  4RQE A;  1Q6U A;  4WFB V;  4LFC B;  4H37 A;  4WBN A;  5FPR A;  1RP3 B;  1S5H C;  3OAA G;  2L6L A;  3UT5 A;  3CMA V;  4Z1M G;  4DR5 O;  2LW7 A;  2UXX A;  5KHI A;  5EZY B;  4KHP B;  1HDJ A;  1AP6 A;  1ZLZ A;  4TSF G;  3CSX A;  4QPJ A;  4Q6G A;  5DM6 V;  2A0L A;  4XBF A;  3RYI B;  3JAW B;  4JPR A;  5IYB O;  3JD1 A;  1QHT A;  2LFR A;  4JI3 B;  2VWJ A;  4LNU A;  4DV7 B;  4HBN A;  4ZIB A;  3L71 H;  4BW9 A;  2DQ0 A;  3DXR B;  3L75 H;  1L1F A;  3ASO C;  1BGY H;  2HVK C;  5HFL A;  3VQX A;  4DRX A;  3AG3 B;  3AG4 C;  3CYO A;  2CTQ A;  3H9V A;  4DR3 O;  4NTY A;  1G6U A;  5B1A C;  4UCV A;  4UB6 Z;  2KQX A;  2HP8 A;  2GV9 A;  4FLY A;  5FPO A;  2F95 B;  2YIC A;  3EVK A;  4DV2 O;  2WA3 A;  1XMQ O;  1VQL V;  2AW9 A;  2BTQ A;  4DUY B;  3R65 A;  3WG7 B;  4MVO A;  2QM4 A;  4W4K A;  4LR3 A;  1XNQ O;  4JI1 O;  2HHH B;  4Q20 A;  3AG1 B;  1NKD A;  4I55 B;  3QVN A;  4EEQ A;  3JCZ A;  1QNM A;  4FLU A;  3CP1 A;  1XHZ A;  2GTA A;  2KG7 A;  3CCE V;  2UUC B;  2UUB O;  3MHS C;  4J80 A;  2Q8V A;  1IBL O;  3IAY A;  3CHX A;  3LDC A;  1VAR A;  2DW4 A;  4X1Y B;  5D5P A;  2GDS A;  4FFB B;  4GT1 A;  1PL0 A;  2A7W A;  2EIJ B;  2JVD A;  4NR1 A;  4JYA B;  4UV8 A;  2DN9 A;  3PJS K;  2WLK A;  2LQT A;  4CC5 A;  2P4V A;  4TUY A;  2H8P C;  1XNR B;  3BA8 A;  3RYF B;  3RYC B;  2NLJ C;  2DYR C;  5CA1 A;  2F1M A;  3CXH F;  2OCH A;  4K8Z A;  3RYI A;  3ZRW A;  3I56 V;  1DF5 A;  2UUA B;  1M56 B;  2YIB D;  5KMG A;  3VOU A;  4LH6 A;  2CUG A;  1R73 A;  4O4L A;  1SC5 B;  3J7A U;  5H6R A;  1GRJ A;  5EK0 A;  5KLV H;  1Q8I A;  4JYY A;  4U3F H;  1OCR B;  3ZMS A;  1ZWI C;  3JAK B;  1MZE A;  2YXY A;  3J80 N;  5F2V O;  2Q7E A;  2HEP A;  3E35 A;  3E83 A;  2QM8 A;  3HKD B;  3GB7 C;  1D5A A;  3P32 A;  1QR9 A;  5CA0 A;  3SPG A;  4MW3 A;  3P30 A;  3STZ C;  1IBM B;  4TV9 B;  1Z5V A;  1MA1 A;  4UCT A;  3H1J H;  1V55 C;  2EIK B;  5FNV B;  5LMN O;  5DED A;  3RVZ A;  1B3Q A;  1E1R G;  1I5Y A;  4AQY B;  2B5U A;  4PDM A;  2GTS A;  5IY5 C;  1TUB A;  1IVS A;  3OEE G;  3K59 A;  4UCO A;  4TV8 A;  2EIM C;  1ORQ C;  3F5W C;  2YXL A;  4EKW A;  4XDJ A;  3SYP A;  3KCX A;  4KHP O;  1LR1 A;  2EIN B;  2RCV A;  4G28 B;  4D7T A;  3SPJ A;  5IE9 A;  2UU9 O;  2UXC B;  4B3T B;  2ZNI A;  1KBH A;  2VQF B;  3FKS G;  4PDL A;  3CWB H;  2LJ2 A;  2QWQ B;  1IXB A;  2WPD G;  3SR2 C;  4OPA A;  4I0X B;  2QWN B;  4TQF A;  1BCC H;  1W59 A;  4DK0 A;  4KL1 A;  2IH3 C;  3SPH A;  5JQG B;  2HR3 A;  3VQY A;  3B2E E;  4MS2 A;  5KA6 A;  2OYQ A;  3LUT B;  4YY3 B;  4UV9 A;  1Q86 W;  4B3S B;  1D5N A;  4FFK A;  2XUM A;  2Y69 C;  1HP8 A;  3THO A;  4X89 A;  1Q90 D;  4LF6 O;  2EUL A;  4NXN B;  5IYC O;  2IJK A;  4L87 A;  2LO1 A;  1L0N H;  3GWK C;  3FAV A;  3EXA A;  3JAR B;  2DQ3 A;  2UU9 B;  2DWE C;  4BW5 A;  1TVK A;  5EBM C;  2V1D A;  4U3J A;  4ZOL B;  3ZED A;  3ASN C;  4NXM O;  5IWA O;  1NTM H;  4E2L A;  1WNS A;  2RDC A;  3WB2 A;  1FXK B;  1RFY A;  2OTL V;  4MVZ A;  2ZR2 A;  3J81 N;  3CPW U;  5JVD B;  2BOB C;  1GH6 A;  1QQC A;  4RUE A;  2X6A A;  1RSO A;  3QF7 A;  4KUM A;  4WFH A;  3CRA A;  2A79 B;  1UJW B;  3FYI B;  2ZKO A;  2Y4T A;  4LFA B;  5LP6 A;  3CJH A;  2F93 B;  2P22 C;  4UVA A;  3FB6 C;  4U7N A;  4OGQ B;  3ZCC A;  4FM2 A;  3N2K A;  4J7J A;  4DR5 B;  4I7Z B;  2QWO B;  1FFT B;  4GKJ O;  2Y0P A;  4X1I A;  4WFA V;  4IHJ B;  3I5D A;  2QTO A;  3UO2 A;  4QNH B;  2D3O W;  2B1I A;  1N0J A;  5KHK A;  3SPI A;  3FB5 C;  1M90 W;  5CA3 A;  3ZN1 A;  4JI2 O;  2P90 A;  1O9H A;  4X64 O;  3OW2 U;  3K5M A;  4X66 B;  1PKX A;  3BVO A;  3H1K H;  2YI9 A;  2A06 H;  1XL4 A;  1XHX A;  4Z2W A;  1Y74 A;  2ZXW C;  1JFF A;  4A5U B;  2DOS A;  3H1I H;  3UT5 B;  2F4V O;  3O65 A;  3G71 V;  3K04 A;  1XL6 A;  3OTF A;  2VQE B;  2P06 A;  1DK1 A;  3DGE A;  4CH3 A;  3K79 A;  5J2T B;  1NVP D;  1FXH A;  4F6E A;  1QVF U;  4TWK A;  1GMG A;  1VP7 A;  3K5O A;  1YHQ V;  5EZY A;  2WWW A;  4DUZ B;  1XUQ A;  2Q73 A;  4ZKI A;  4OPH A;  1PP9 H;  3W7S A;  2PUS A;  1MZF A;  3E86 A;  5KAF Z;  2XHB A;  1ZUQ A;  1MG1 A;  2PY5 A;  2LP7 A;  1K33 A;  3DXR A;  2EIN C;  1SZT A;  3CRR A;  3L70 H;  2X7R B;  4J7K A;  3ICX A;  1R6K A;  5KX5 B;  3CD6 V;  1CEZ A;  1NVP B;  3U0Z A;  4GUN A;  4X65 B;  2EX3 A;  4HYO A;  5JH7 B;  3JSL A;  4FZ0 A;  1JX9 A;  3ZRV A;  5JCO A;  4JZ2 A;  2ATK C;  3BA9 A;  2JS5 A;  2NNU A;  1XOU A;  2CH7 A;  4F4L A;  5GW7 A;  3D3Q A;  3ZMU A;  1SQB H;  5B1A B;  3BAB A;  4P9O A;  4BIO A;  2M6Y A;  4O4H B;  5BR8 O;  1AR5 A;  1VF6 A;  1VQO V;  2E76 B;  5C8Y B;  2X0L A;  3ASO B;  1VQM V;  1AIL A;  4B7E A;  4AI8 A;  2VS0 A;  4JI3 O;  4FLW A;  5EBW C;  4JI4 O;  2A9H A;  1WP7 A;  5AG2 A;  4JI6 O;  1SQV H;  3JD4 A;  1WAZ A;  1OCR C;  2ZIN A;  4DV0 O;  4PV1 B;  4P30 A;  1NU1 H;  4K35 A;  1NH2 D;  3E8B A;  1KP2 A;  5GON A;  1DF4 A;  4JZG A;  3HKB A;  2G38 A;  4O2B B;  3SYA A;  5KA5 A;  4YJ2 A;  2P4K A;  2ZM6 B;  1K34 A;  3B77 A;  4PEL A;  3JD2 A;  1R6N A;  2QR4 A;  5LXT B;  3B8N A;  2Q6A A;  4X1K B;  2HKO A;  3BRC A;  1SA0 A;  3ZHQ A;  5E1A C;  1X4T A;  4MT8 A;  2E3C A;  2CTW A;  3IJ4 A;  2AHY A;  1JR9 A;  2QTS A;  4O4I A;  4LWS A;  5LHH A;  2JGU A;  2R72 A;  4YIO A;  4J42 A;  4QE7 A;  2LGW A;  3CCJ V;  1YXB A;  5IYD O;  2JK5 C;  5TIS Z;  1MMM A;  1OHH G;  1YEW A;  5LA6 A;  3N2G B;  3JYC A;  4FVM A;  1K92 A;  3UQ8 A;  2QA4 V;  4X8A A;  2VWK A;  3I55 V;  3ZHT A;  1Z2G A;  1H2K A;  1Q6H A;  2R9R B;  4LF4 O;  1XIL A;  1YCI A;  1V55 B;  2EIK C;  3CRQ A;  3GWO A;  5DEC A;  4I4T A;  4FLX A;  4KXR A;  4B7K A;  2YEV A;  2K9P A;  1HWY A;  1NS1 A;  4GKK B;  2DE0 X;  5FL7 G;  1Y67 A;  3QO8 A;  4X1I B;  4LF8 B;  4BWA A;  3A0R A;  4WBN B;  1N0N A;  1R3L C;  4MTG A;  2CTP A;  1DTO A;  4MTF A;  4JAV A;  4JI8 B;  4O4H A;  1TVK B;  2ZE8 A;  5DN6 G;  1FFX B;  3WG7 C;  4DV4 B;  1JA8 A;  3L73 H;  1HNX B;  1H2N A;  3X2Q C;  4LF9 O;  1FJG B;  3RFR A;  4LF6 B;  2PZS A;  1ZX3 A;  1BT8 A;  3QTC A;  5KHG A;  1JFF B;  1EBO A;  4XDK A;  2W0F C;  3FD9 A;  1OCO B;  1DGS A;  4WCE V;  4JI0 O;  4JYB A;  2QSA A;  4D6T H;  4DR4 O;  4OX9 O;  2CGN A;  3T4D A;  3CCS V;  3QO7 A;  3DSQ A;  2Q4P A;  1N34 O;  1GM8 A;  1M57 B;  1URF A;  1M1K W;  4HNA A;  2ZIM A;  1VQ7 V;  1GN6 A;  4J11 A;  3CS5 A;  2Y69 B;  1VF7 A;  2CTR A;  1I94 O;  4DR7 B;  4QIW F;  2W6J G;  4DR2 O;  3DC5 A;  3JD3 A;  3NR7 A;  1RPO A;  3JSN A;  2P67 A;  4LF5 B;  2UXB B;  1XMO O;  4DR1 O;  3EFF K;  4UUJ C;  2FTK A;  4IL6 Z;  2UXD O;  3K9S A;  4AIL C;  1SS3 A;  4GX2 A;  4FLT A;  1U97 A;  3SPC A;  4L8J A;  2QE7 G;  4GYC B;  2ZXW B;  4JTD B;  5LHG A;  2Q9L A;  3DC6 A;  2QWP B;  4X62 O;  5LGT A;  1WA8 A;  4LC1 A;  4AQY O;  1SQG A;  1XMO B;  1SQP H;  3FB8 C;  3ABM C;  2Z5U A;  4JI4 B;  3CCL V;  4I55 A;  2DYS C;  2RN9 A;  3VBB A;  1R3I C;  4RO2 A;  2WA4 A;  2RMK B;  1SZX A;  4PDR A;  1GN3 A;  2B1G A;  1N33 B;  1R6T A;  3VQV A;  3JAL A;  1THZ A;  4F6R B;  3M7M X;  3RYF A;  3KKY A;  3APQ A;  1AI5 A;  1NZ6 A;  4JAS A;  4JV5 O;  1FFX A;  2WLJ A;  1YSC A;  2F66 C;  2XTA A;  2BSK A;  1HR0 B;  1BHA A;  1FXK A;  4OXS A;  1WP8 A;  4DRX B;  4J9Y B;  1YVW A;  5L3B A;  4DR4 B;  3CX5 F;  1K5S A;  2JIZ G;  4MVS A;  3ZHR A;  4CS3 A;  4OX9 B;  4LH7 A;  4DW1 A;  2KB1 A;  2OTJ V;  5B1O A;  3CRM A;  5JCO C;  1S5J A;  4NVP A;  1KUQ A;  4FM1 A;  1GKF A;  4TT3 G;  5BXZ A;  1YDX A;  3T1H B;  3BAA A;  1LUW A;  5LGN A;  5KUK A;  4N21 A;  1JCH A;  4JI5 B;  1GM7 A;  2Q68 A;  1KP3 A;  4LBE C;  4ZI7 B;  5CA0 B;  4JAA A;  5D5Q A;  4CH5 A;  3MD0 A;  3BEH A;  4B3M O;  4UCR A;  1EFR G;  2B9Z A;  4NTX A;  1AB3 A;  4I5S A;  2DJV A;  1V54 B;  4W4L A;  3OR6 C;  1P7G A;  4TV8 B;  2FL4 A;  4HAM A;  1MSD A;  4FLZ A;  1H38 A;  3ZS8 C;  1UPG A;  1NTK H;  4CC6 A;  1I08 A;  5KHH A;  4I50 B;  3BPZ A;  1KMI Z;  4KP4 A;  5LP6 C;  5J9P C;  1BQ0 A;  2IU0 A;  3OUF A;  1PNK A;  4IYH A;  3RBZ A;  4TUY B;  3CE2 A;  1PPJ H;  2YXH A;  4WFG A;  3G67 A;  4ZHQ B;  2JJ2 G;  4ASU G;  3ZRS A;  1P4R A;  1VQ9 V;  1TUB B;  4U7O A;  4PA9 A;  4O4J A;  3OT7 A;  1PM9 A;  1ZSP A;  2D2C B;  3AK1 A;  2EIL C;  4PDV A;  3WU2 Z;  1B06 A;  4B3T O;  4J9Z B;  2NN4 A;  2GHY A;  5EIB C;  1I5X A;  2JGD B;  1Y76 B;  2XAH A;  2RQ6 A;  3JAT B;  2PYL A;  1XRE A;  4YJ3 B;  4FPP A;  1OV9 A;  1BSM A;  1QLE B;  4GX5 A;  5IY5 B;  3HKC B;  3ZHV A;  1ARO P;  1Z5W A;  1BZK A;  3HKD A;  1G1X B;  3WB0 A;  1FS0 G;  1VQ5 V;  1YF2 A;  1KD1 W;  4JGS A;  1YIT V;  4ZBM A;  2IJH A;  5CBG A;  5LA6 B;  3K06 A;  2YEV B;  2Q7H A;  3ABL B;  3JAS A;  4NYK A;  4UB8 Z;  3OM3 B;  2LGQ A;  1B6Q A;  1ZAU A;  3OFN G;  1K4C C;  5B3S C;  4PI2 A;  1NR1 A;  3K5L A;  3AEI A;  4JYC A;  3H1H H;  3LDE A;  3ABK B;  2ZDI A;  1H8H G;  1P84 F;  2Q67 A;  3L9D A;  1BQZ A;  1SET A;  1N34 B;  2XOK G;  4MVU A;  2YSU B;  4P2Z A;  1IZ3 A;  2XT9 A;  4DV5 O;  1GK9 A;  1GTO A;  2BE3 A;  4PJ0 Z;  4RWU A;  3UO3 A;  2BCC H;  4G27 B;  4UVC A;  3HKB B;  5FLX N;  4MSW C;  5J2U B;  1KC8 W;  3M99 B;  5EIB D;  4LF9 B;  3ZN0 A;  3VQW A;  3AG3 C;  2AZ0 A;  1I0H A;  2QWR B;  4EB6 B;  2E5L O;  2Y0I A;  2KSD A;  3K0G A;  3RT3 C;  1KQS U;  1GM9 A;  1EN6 A;  1N33 O;  4IHJ A;  1XBL A;  1Y6X A;  2KG7 B;  2BTO A;  3K58 A;  5KHJ A;  4GLX A;  1OJH A;  3B8M A;  1EM1 A;  3HKE B;  2FB5 A;  1V9P A;  3ZIA G;  2ZDI C;  3MDS A;  4AHC A;  3N2G A;  1J5E B;  3QNE A;  1CP9 A;  3R66 A;  2LW1 A;  4R8C A;  1AI4 A;  3ZRX A;  4E4E A;  1N8R W;  2F4V B;  4GCZ A;  2UUC O;  4JTA B;  4U3J B;  4ZOL A;  5B3S B;  1SQF A;  5LYJ B;  3WFV A;  2OIE A;  1H2G A;  3TK1 A;  4QE9 A;  3ZBH A;  1VQN V;  5C8Y A;  4LF5 O;  3CC7 V;  3CXC U;  1K3E A;  4H44 B;  4R6Z A;  3X2Q B;  3WB1 A;  1Q3E A;  4FZ1 A;  4YJ2 B;  1EN5 A;  2AXT Z;  2E5L B;  1K5Q A;  3ABM B;  1BL8 A;  4IYI A;  2IH1 C;  4X20 A;  1JVM A;  3N27 A;  4YIP A;  5L3E A;  1J95 A;  2CGO A;  5KMG B;  1F4M A;  3E8H A;  1QVG U;  1QLE C;  5A2Q N;  2EZP A;  1HNW O;  1DLB A;  4ICG A;  1Y4M A;  4HZ3 A;  4JI0 B;  3N2K B;  3SJQ C;  4DR6 B;  1ZL8 B;  5KX5 A;  4LF7 O;  3C3T A;  4MW8 A;  2UUA O;  4XDL A;  5LYJ A;  3IFX A;  1SQX H;  3ZHS A;  5GTI Z;  1N36 O;  5B66 Z;  3G6B A;  1H2M A;  2QKA A;  3RN4 A;  2CH7 B;  3E22 A;  4ZHQ A;  4JI8 O;  2L35 A;  5A9G A;  4CZZ A;  1GN4 A;  5JH7 A;  1K9M W;  2XAQ A;  3SJC C;  4LF8 O;  1JQ0 A;  1Y74 B;  4GKK O;  4DV6 B;  4UCS A;  1K8A W;  3K08 A;  3JAT A;  3HPL C;  1N36 B;  4NXN O;  1KB9 F;  3KZI Z;  4EFE A;  1SF9 A;  3BHP A;  1WPB A;  1EN4 A;  2UXD B;  1BHB A;  1FAF A;  3TET A;  3LNM B;  1ENV A;  4JI7 B;  2IBZ H;  5CBH A;  1AJN A;  4YXW G;  5K1X A;  1Q7Y W;  1PD3 A;  1AVM A;  3L72 H;  1W0K G;  3F7Y C;  1MSW D;  4QPK A;  4RQF A;  2QKS A;  2PGG A;  5LGU A;  1XNQ B;  1IX9 A;  3JAS B;  2Y4U A;  1HR0 O;  3G4S V;  1NI8 A;  3AG4 B;  4CH4 A;  3ZMT A;  1RSO B;  4ABM A;  4IIJ A;  3U11 A;  3UKM A;  1WN7 A;  2Q5Z A;  4CBC A;  1T5E A;  1OCC C;  1US6 A;  2ZM6 O;  4FMT A;  3CCV V;  3RWR D;  3CCQ V;  4MVM A;  2UXC O;  3JCU Z;  3DTU B;  1S0V A;  3E8F A;  2WLH A;  2IJI A;  5EC2 C;  5CB4 A;  2XAS A;  2XAF A;  2HJF C;  2OWO A;  4JI7 O;  4WFF A;  1H8E G;  3TGU H;  4X62 B;  3BY6 A;  2O57 A;  2H94 A;  4O2A B;  4KFM A;  2CAZ C;  2ITD C;  2V4D A;  4QGP A;  1AP5 A;  1R1B A;  4D7S A;  5IT9 N;  4DV1 O;  3ZMZ A;  3OTO B;  2UXB O;  1OCZ B;  2IU3 A;  4DR2 B;  3LSU A;  3W7T A;  3RYH A;  2Q69 A;  5BMV A;  1S76 D;  5EBL C;  1E79 G;  1SKV A;  3E8G A;  1Q43 A;  2Q7G A;  1S72 V;  1PNM A;  3ETE A;  5LOV A;  2PI5 A;  1BMF G;  3T1H O;  2WLI B;  4JTC B;  3F7V C;  5KAI Z;  4GKJ B;  1GN2 A;  2GUZ A;  5EC1 C;  5BY1 A;  3A0B Z;  4YHH O;  5CB4 B;  2DWD C;  2ZE7 A;  3OD4 A;  3BFR A;  2P7T C;  4LF7 B;  1X59 A;  4DO2 A;  2JRI A;  4UCU A;  4DV5 B;  1FXK C;  4DV3 B;  1MAB G;  1FKA O;  4NKG B;  1HNW B;  2K1E A;  5JJN B;  3K9A A;  5LL6 Y;  1QLN A;  3Q4H A;  1NR7 A;  2PF4 E;  2Q0O C;  1VQP V;  3ABL C;  5LBQ A;  2WAM A;  4BR6 A;  2A3Q A;  3HR0 A;  2VQF O;  5IWA B;  1SER A;  1IXM A;  5IJ0 B;  2QM7 A;  3W7X A;  3ABK C;  1OCZ C;  3QG5 A;  3OTO O;  3AK3 A;  1WB7 A;  5L3G A;  4K8X A;  3LDD A;  3GVM A;  1WA8 B;  3H1L H;  3CME V;  1QCE A;  2YS8 A;  4JI6 B;  5CA1 B;  3LNN A;  2E75 B;  2ILM A;  3JAK A;  1LNQ A;  4FIP C;  1Y66 A;  5IYZ B;  2WLM A;  1WJZ A;  1YJ9 V;  1JOY A;  2ZQM A;  2ZCE A;  1I94 B;  3CC2 V;  3E22 B;  4DYL A;  4TV9 A;  1ZTE A;  3CCM V;  2ZR3 A;  4LP8 A;  3SYC A;  3T4Z A;  3ZMV A;  2ARH A;  4MTO A;  4J41 A;  1FYJ A;  4R7C A;  2E74 B;  1FPO A;  3SJA C;  5LOV B;  4X20 B;  2M7W A;  4IGG A;  4O2B A;  4JF3 A;  2ADP A;  3FX7 A;  2ZNJ A;  3JAL B;  1V54 C;  4J10 A;  3D36 C;  1PNL A;  1WPX A;  4EFB A;  3JAW A;  1HW7 A;  2Y48 A;  1G8M A;  4BIZ A;  1MNG A;  3A8T A;  5ITZ B;  3OMN B;  2N04 A;  2EBO A;  3HKC A;  4O4I B;  1YJN V;  1JJ2 U;  1XEQ A;  1KYO F;  4DV4 O;  5IJ9 A;  3T1Y O;  3T1C A;  4DV6 O;  1K4D C;  4WF9 V;  1FXV A;  4DUZ O;  4MVQ A;  2PI4 A;  3P3P A;  4B3M B;  2UXN A;  1ZL8 A;  2ZE6 A;  4TQD A;  4FM0 A;  3FB7 C;  4NXM B;  1L8D A;  2HJD A;  4PD4 F;  1MOF A;  2IJJ A;  4JI5 O;  2JS3 A;  4FJC C;  4O4L B;  2F43 G;  4MVR A;  5GON B;  3ZJZ A;  3ML0 A;  1AJQ A;  1M9N A;  1P49 A;  2UUB B;  1AI7 A;  1GO3 F;  1M57 C;  4LF4 B;  2CDY A;  5EYP B;  5LXT A;  4B08 A;  3B09 A;  4H0L B;  4YY3 O;  2YUA A;  2WLN A;  3FYE B;  1IDS A;  2MW2 B;  2HHH O;  4DW0 A;  4QJF B;  5IJ9 B;  3KG2 A;  2AGA A;  5BMV B;  1O9G A;  4DUY O;  1TAE A;  1HNZ B;  4K0K O;  3E89 A;  4I9W A;  3ETD A;  4NB5 A;  1YI2 V;  2CK3 G;  1NH2 B;  1F23 A;  1BS3 A;  4JAU A;  2C2A A;  2WLL A;  3ZHU A;  3SJB C;  1QU7 A;  1I7F A;  1M93 A;  2BOC C;  3OUS A;  3APO A;  1PV0 A;  3ETQ A;  2ODM A;  2JGD A;  1AR4 A;  4DV0 B;  3M8A A;  2QDO A;  4K3A A;  4EB6 A;  1YZB A;  1IBL B;  5JJJ B;  2X6B A;  4R50 A;  3RW0 A;  3CEI A;  5ITZ A;  3AK2 A;  1J5E O;  1N4C A;  3G80 A;  2Q0A A;  2BTQ B;  1NJI W;  4C7U A;  4DR7 O;  2HFE C;  3UM7 A;  2F23 A;  5BR8 B;  2HLD G;  1XDC A;  1M56 C;  1BE3 H;  3K3W A;  5B5E Z;  5JJE B;  5LMU O;  1XI1 A;  2PYJ A;  1VQ8 V;  4PA6 A;  3MHH C;  3HB3 B;  3KCY A;  1YTF B;  5GTH Z;  3TXS A;  1SRY A;  1VMG A;  4Z1V A;  3AG2 B;  2ITC C;  3FFQ A;  1YIJ V;  3CB2 A;  2WSS G;  4X65 O;  3JAM N;  5J2U A;  2YID A;  3ZX6 A;  1VEW A;  4HNA B;  4PA7 A;  5J2T A;  1K73 W;  3PN1 A;  2YIB A;  4DXW A;  2BSK B;  2Z0A A;  1XNR O;  3C90 A;  1IBK O;  4I0X A;  2Z3Y A;  4X1Y A;  1COW G;  3CCU V;  3OGC C;  5H6Q A;  1R3J C;  1TA8 A;  1Y76 A;  3ABT A;  2GBO A;  4YJ3 A;  1VQ4 V;  3STL C;  1M5I A;  1NBM G;  1S5L Z;  2AZ2 A;  4CS4 A;  1EZJ A;  3B4S A;  3RVY A;  4IT5 A;  3EHB B;  2WLL B;  2NR5 A;  5L3D A;  2VQE O;  1JPX A;  3T2M A;  4PA3 A;  2FML A;  5CN0 A;  4P9P A;  4LFC O;  5HFM A;  3B40 A;  1PL4 A;  5JQG A;  1HNZ O;  1IBK B;  3D8C A;  4BAY A;  4N23 A;  4X9Q A;  4ZI7 A;  1H2S B;  2JDI G;  4DR1 B;  1ROP A;  3SYO A;  4JI2 B;  2ZT9 B;  4X64 B;  5CMU A;  2FYU H;  2XAG A;  5BZB A;  4B3R B;  4DK1 A;  2EIL B;  4UFZ A;  1NT2 B;  5L3C A;  3CRC A;  2AHZ A;  3K0D A;  2W0X A;  2N05 A;  5IDJ A;  4YHH B;  1RM1 C;  1F7Y A;  4RUF A;  2IW5 A;  3FAV B;  3JAR A;  2DMX A;  3ETG A;  1JJO A;  4DV2 B;  4PHZ A;  2QJ1 A;  5IYZ A;  4O4J B;  3UCS C;  3SDL A;  5JWP A;  1VF6 C;  1K97 A;  5LHI A;  1RPR A;  3SYQ A;  3S3X A;  1A32 A;  1KU9 A;  2JJ1 G;  3G6E V;  5LP6 B;  3CJH B;  5H5N A;  2RNB A;  3TXQ A; 
#chains in the Genus database with same CATH homology
 3CRA A;  2Q73 A;  1YVW A;  2Q9L A;  2OIG A;  2A3Q A;  1Y6X A;  2OIE A;  2YXH A;  2Q5Z A;  3C90 A;  1VMG A;  2Q4P A;  5IE9 A;  3CRC A;  2GTA A;  4QGP A;  2P06 A;  2A7W A;  1YXB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...