1YVWA

Crystal structure of phosphoribosyl-atp pyrophosphohydrolase from bacillus cereus. nesgc target bcr13.
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
92
structure length
92
Chain Sequence
AFKLLYKTIEERKGSPLPESYTNYLFSKGEDKILKKIGEECAEVIIACKNNDKEEVVKEMVDVFYHCFVLLAEKNIALEDVMREVKERNGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosyl-ATP pyrophosphatase
publication title Crystal structure of Phosphoribosyl-ATP pyrophosphohydrolase from Bacillus cereus at 2.6 A resolution.
rcsb
source organism Bacillus cereus
molecule tags Hydrolase
total genus 34
structure length 92
sequence length 92
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.31: Phosphoribosyl-ATP diphosphatase.
pdb deposition date 2005-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01503 PRA-PH Phosphoribosyl-ATP pyrophosphohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1080 Mainly Alpha Orthogonal Bundle Helix Hairpins MazG-like 1yvwA00
3CRAA 2YXHA 2A3QA 1YXBA 2Q9LA 5IE9A 2P06A 1VMGA 2Q5ZA 2Q73A 2OIGA 2A7WA 3CRCA 1YVWA 2GTAA 2Q4PA 1Y6XA 2OIEA 3C90A 4QGPA
chains in the Genus database with same CATH superfamily
3F5TA 3ZRXA 4E2LA 1XL6A 2RMKB 2RJZA 1R3JC 3K9AA 2AGAA 5L3BA 1JJ2U 1I7FA 2XASA 1Q82W 5AG2A 1IBLB 2A0LA 3K03A 3CCSV 1AI7A 1E79G 4TV8B 3I56V 4IYIA 2F43G 2MK3A 4I50B 2Q0AA 3RYFA 3ZMUA 2UXBO 1D2DA 1GN3A 2UU9B 4DR4B 3QF7A 5FPRA 1XREA 5IJ0B 1G1XB 3RYIA 1X4TA 3J81N 5KAIZ 2W0XA 4TV9B 2UUAO 1H8EG 4P9PA 4X62O 2N04A 5LMUB 5EZYB 4UCVA 3OW2U 1BCCH 3AG3C 1Y4MA 3LSUA 2LW7A 1AI5A 5GONB 5KX5B 2V7QG 1Z5WA 4PDLA 1ZTEA 4B7EA 1ROPA 1K5QA 1NR1A 5EC2C 3ZRVA 4YHHO 2QTSA 3ETEA 2MW2B 2XNDG 3D8CA 4LNUB 4J42A 1YJ9V 3QO7A 4DW1A 4K8XA 4GCZA 4DV4B 3NXSA 4DRXB 4CS2A 3ASOC 1JR9A 2EIJB 3UCSC 1I08A 3ZRSA 5EBLC 4C7UA 4KP4A 3CRRA 1WA8B 3W7WA 4JI7O 2YXYA 4FPPA 2P4VA 1MA1A 4LFBO 1GN4A 1JPXA 3JAMN 2R9AA 5D5QA 3QNEA 3OE7G 3T1HB 1AR5A 2Z3YA 1VQPV 2JS3A 4X8AA 5KMGA 1VEWA 3FYEB 3P32A 1UJWB 2W6JG 2Y48A 4DUZO 5F2VO 4JTAB 4PA7A 3C3SA 3LUTB 2LJ2A 4MVSA 5LGUA 1XBLA 3G71V 3B4SA 3THOA 3A0HZ 2IM9A 2DQ0A 4LF6B 1VF6C 2H8PC 2RNBA 5FLXN 3ABMB 4WF9V 3MAQA 2LO1A 4O4HB 1JCHA 3JD2A 3HKEA 4X64O 4G2KA 1YXBA 1IBMO 3K79A 4JI3O 1H38A 1AP5A 4LBEC 1QR9A 1L8DA 4CH4A 3M8AA 1BS3A 5CB4A 4CZZA 3G6EV 1MMMA 5KAFZ 4PA9A 4MSWC 2CTRA 4LF4O 5LHGA 4B3RB 3SPHA 3J80N 3OT7A 2GHYA 1XL4A 3T4ZA 1HNZO 5JJNB 2M6YA 4HNAB 2F95B 5EC1C 2W6IG 1OV9A 1WN7A 4IIJB 5ITZB 1WPXA 1PKXA 2YIDA 4UFZA 5KA6A 1R6KA 4JZ2A 1DF4A 3K06A 3K5OA 3OTOO 2DYSC 1XUQA 3SGIA 5LA6B 3K04A 5LYJB 1FPOA 2DE0X 1K4CC 5KHKA 2B1IA 4DR5O 1NZ6A 2ATKC 3AEIA 4FIPC 3VOUA 3ZMVA 1Y66A 4DV2O 4GX1A 2X6CA 3VQYA 2XUMA 4UVBA 3H9VA 4X1YA 1XOUA 1H2SB 5L3CA 1XEQA 2VWKA 3AG7A 4DUYB 1JA8A 4CC5A 1G8MA 2E75B 2LGQA 4MVOA 1M56C 3B77A 4NTYA 1H2KA 3LNNA 3SPGA 3D36A 2V1DA 4X88A 1FJGB 5IYBO 4JI4O 1YIJV 3E8GA 4R7CA 3WU2Z 2WA4A 4Q20A 1R3LC 2DWEC 3DGEA 4DR6B 4EB6A 1V54B 1H2MA 3AG2C 1WNSA 1F4MA 5GW7A 2PGGA 1ZSPA 4X1KA 4QPJA 4WFEA 1GTOA 4GKKB 3LDCA 1KECA 4MVZA 3ZHTA 3IFXA 5CBHA 3ZN1A 3ZHUA 1HNWB 2VQEB 1HP8A 3CJHA 1O9HA 3K9SA 2ZE8A 3EVKA 2AHYA 5J2UB 4MT8A 5JVDB 1TGOA 1RPOA 4QJFB 3ETGA 2OCCB 2AW9A 1IBLO 3DC6A 3W7UA 2XT9A 1DK1A 3CC2V 4MTGA 1WLEA 3SYPA 3RT3C 1FFXA 3UM7A 5B1OA 4QNHB 4DR4O 1CXZB 1H2GA 2F66C 2PYLA 5LP6A 4P2ZA 1TVKB 4NYKA 4DR3B 4L87A 2ILMA 3BEHA 3BA9A 1NT2B 1FXHA 3TCUA 2GUZA 1I5XA 3CC4V 1WP8A 3ZHSA 4YJ2A 1FXKC 4U3JB 5DM6V 4CH3A 2YIBA 2B5UA 3RVZA 3JATA 3Q4HB 2OCHA 2IJKA 5EYPB 3CB2A 4F6RB 1IBKB 2Q6AA 2CE4A 1S5LZ 3W7SA 3CXHF 1MSDA 1M93A 2CTPA 1UFIA 1B04A 3L75H 2NN4A 5KHGA 1SKVA 5LOVB 5E1AC 3HPLC 5J2TB 1OCZC 4JV5B 5JJEB 5LXTA 2QA4V 1U97A 1P7GA 2KG7B 4TV8A 2YUAA 4X66O 1QNMA 4LF5B 2QKAA 2UUAB 1V55C 2DYRB 3JASB 1R6NA 4I50A 3CC7V 2ZCEA 4X89A 3FYIB 4FLXA 4TV9A 2FL4A 3VQXA 3CCUV 1JFFB 2JRIA 3QTCA 2QSAA 5EZYA 1PNKA 3X2QB 2F93B 2OIGA 4YHHB 3T1HO 3E8HA 1EN6A 5GONA 2BCCH 1FAFA 4QIWF 5CBGA 3RFRA 4FM0A 1XILA 4WBNA 4TSFG 3C3TA 3SYOA 3CCMV 2A9HA 1AROP 3QO8A 3F7VC 3FB5C 3TXSA 1U96A 4DXWA 4MTOA 3CCJV 3B09A 4JI7B 4DRXA 3WG7B 3HKBA 5L3EA 2NLJC 2ZE7A 4K3AA 1AJPA 1N34O 5B5EZ 2OIEA 3D36C 2QKCA 2XAGA 1HNXO 3EXAA 2XAHA 1WA8A 1MZEA 4B3RO 3B2EE 1K7DA 3ABUA 5FL7G 1OCOB 4F4LA 3M99B 4XDLA 3E89A 5B3SC 4FLZA 2X6AA 1N33B 3B8MA 3ZHQA 2QJ1A 2EJRA 1XNRO 3AG4C 3NR7A 1Z5VA 3DXRB 1JVMA 2ZNJA 4JAUA 2G38A 2RN9A 1SQGA 3OTFA 5BR8B 3CHXA 3B40A 2E5LO 4JI5O 4JI3B 2N05A 3ETDA 3WB0A 4MTXA 4GZRB 2R72A 1RSOB 4LH7A 4UCUA 3RWRD 4E4EA 5B1AC 2QR4A 4DUYO 2QKSA 2P4KA 4J7ZA 4LF9B 1K4DC 4WFHA 4RO2A 4Z1MG 5LGNA 2HKOA 2YIAA 4P30A 5LP6C 4DR6O 1EN4A 2HHHB 4UB8Z 4LFAB 1GKFA 4KHPB 4UV8A 3AK1A 3U11A 1NJIW 4OX9O 4MVQA 2P90A 3ABKC 4DR7B 4GKKO 4IIJA 3FB8C 4OXSA 4DV3B 1NTMH 3FFQA 2ZR3A 3CCLV 2CTWA 4R6ZA 1TUEB 3BPZA 4O4JB 1M57C 1ZWIC 2EX3A 1XNQO 1HNWO 1NU1H 5LA6A 3K0GA 2VQEO 3CX5F 5KLVH 5K1PA 4FLUA 1NVPD 3ASNB 4IHJB 3SPJA 1NQTA 4FZ1A 5CA0B 1JJOA 2EULA 3K59A 2QGNA 2H94A 4FLYA 2PI5A 4GX5A 4HZ3A 1I94B 4X20B 4FLTA 4N23A 4G28B 4JI0B 3WB1A 1GM9A 3T1YB 2GSMB 1BHBA 4J7KA 1OZ0A 5IT9N 2ZINA 2XAFA 1K9MW 4JI6B 2LP7A 2WA3A 5CA1B 3UKMA 4AHCA 5EIBC 2UXXA 5BMVB 1SZTA 1GAXA 3H1HH 1N32B 2PZSA 2DN9A 3IC9A 4CH6A 1IBKO 3TXQA 2YXHA 1IXBA 2Q9LA 4Z1VA 1YEWA 4BR6A 5J2UA 5B1NA 4QE7A 1QHTA 2WLMA 3SR2C 4JV5O 1JOYA 5B1BB 4JZGA 4H44B 2YSUB 2JEXA 2OTLV 1GM8A 5J9PC 4LF5O 2GBOA 4YJ3B 4I0XA 1UPGA 3CSXA 3K0DA 4CS3A 3PN1A 2XOKG 4GT1A 3AG1C 1BHAA 3SJBC 3ZCCA 1GMGA 4O4LB 1AR4A 2LGWA 4PDRA 1S0VA 3SDLA 2UXCB 1QR8A 4H0LB 3AK2A 5LMNO 2ZNIA 2ZR2A 3H1JH 2H3OA 1THZA 1M9NA 3L73H 3Q4HA 1FKAO 1BQ0A 1F23A 1EM1A 3K58A 1KYOF 1Q8IA 1YCIA 4TQFA 4RWUA 2ZIMA 1ORQC 4GUNA 4TWKA 4X66B 1SS3A 2ZQMA 5JH7B 3SJQC 2YS8A 3P30A 5D5PA 1EN5A 2ADQB 1HWYA 5J2TA 1H8HG 4FFBA 3WB2A 1NKDA 3JASA 3J7AU 4B3TO 4ASUG 1R3IC 5CA3A 2ZIOA 4NTWA 5JCOC 3AG3B 2CUGA 3E8FA 2QWNB 2JDIG 4GX0A 1S72V 1EZVH 4DV7B 1PPJH 2PF4E 4U7NA 1JFFA 2WLKA 2JIZG 5IE9A 3LNMB 1Q81W 2DQ3A 1VMGA 2AZ0A 5K1XA 4J9ZB 2BTOA 1V9PA 4KL1A 1VQOV 3CRCA 1N33O 1CP9A 3LDDA 4UVCA 3HKCB 2F23A 2ETNA 2CH7B 1QLNA 1BT8A 3H01A 3JYCA 4LWSB 5L3DA 4PA4A 1MZFA 2P67A 1VARA 3EHBB 2IH1C 1N4CA 1VQLV 4AI8A 3CRAA 5BR8O 4HBNA 3H1KH 4DV6B 4O4IB 3ASOB 3BY6A 1AR1B 1GN6A 1FXVA 1N34B 1OHHG 1R73A 4IYHA 5HFLA 2DWDC 1HNXB 2IU0A 1NTKH 3JSNA 5KHJA 3RYCB 1AVMA 2X0LA 4LF9O 3N2KA 4BW9A 3JD0A 1OJHA 1ZL8B 3OR7C 3TGUH 5IYZA 1P84F 4DR1B 1F7YA 4H13B 2YDEA 1IX9A 2HHHO 1XNRB 4LFAO 3UT5A 1NH2B 4KHPO 2P22C 1L0LH 2BTQB 4JF3A 5IJ9B 4FFKA 4DR7O 3G80A 4DV3O 3CRMA 3DSQA 2E5LB 2P7TC 4JI5B 3CD6V 3ZN0A 4I9QA 2IU3A 5B66Z 3RYHB 2Y69C 1TA8A 3LDEA 1RFYA 1LUWA 4D7SA 4DV0B 4Z2WA 2HR3A 3R66A 1SA0B 4ABMA 4FK5C 4AILC 1Y74B 1RSOA 4ZKIA 2BSKA 4J41A 1K33A 5CBFA 1ZUQA 4O2BB 3APQA 1PL4A 4BAYA 5EBMC 3G4SV 4O2AA 2GV9A 2RDCA 2UUBB 4OX9B 1NH2D 3LSSA 4GX2A 5JQGA 2EILC 1I94O 3JALA 2HVJC 1VQ7V 4D7TA 4JI0O 3CXCU 1SESA 3T1YO 2CDYA 1OCRB 3E8BA 1VQKV 2ZT9B 3S3XA 1LR1A 2Q0OC 4I9WA 1XNQB 1SQXH 4JI6O 4PI2A 2Q7HA 2DYSB 4I4TB 3SPCA 2QWRB 1OCCC 2HJFC 3OFNG 3CWBH 1M4UA 4KUMA 3ZIAG 1N32O 1DF5A 1Q3EA 4H37A 5EK0A 3RVYA 3PJSK 4O4JA 2WWWA 3CCRV 2VWJA 3E2EA 3L72H 5DECA 3HR0A 2WLIA 1QVGU 1KB9F 3K5LA 2RCVA 2EINC 4L8JA 1MNGA 1K34A 1VQ6V 4WFGA 2KB1A 3ZHRA 1O9GA 4HYOA 1RM1C 1VF5B 3ZMSA 4IHJA 2ZD9A 5C8YB 2P6JA 3RGBA 3T4DA 1URFA 1D5AA 3KKYA 1I0HA 2DJVA 3TK1A 2ZDIA 2QEXV 2DYRC 3SYCA 3JARB 4X20A 4NB5A 5LGTA 2ZXWC 4HAMA 3BABA 3STZC 4JAVA 2E3CA 1ZAUA 2ZE6A 2K1EA 2Q5ZA 2UXCO 2YI9A 3JCZA 4X65B 5GTHZ 3TETA 2BE3A 2F4VO 2RQ6A 2F1MA 3GWOA 1K97A 2JEUA 4ZIBA 4OGQB 1KMIZ 2QM4A 4PELA 1JQ0A 3OGIB 3ABLC 2JK5C 1N0NA 3MDSA 4RQEA 1VQNV 4XDKA 3A2FA 5EBWC 3W7XA 3CE2A 4QPKA 2WAMA 5GTIZ 2D3OW 3LSQA 3G6BA 1MOFA 1S5HC 4W4KA 2JS5A 3SPIA 4X1IB 2L35A 3JCUZ 1HR0B 1GK9A 3UO3A 4KFMA 1J95A 4RUEA 5IJ0A 1XI1A 4R8CA 1R6TA 1TUBB 2QWPB 4YJ3A 5LMNB 2OWOA 2IH3C 1R1BA 4NTXA 1YJWV 3KCYA 2HJDA 3BRCA 2ADPA 1FXKB 4GKJO 5KX5A 4O4LA 3FX7A 4DV7O 4J80A 4LR3A 1CEZA 1VQ4V 5KMGB 4Q6GA 5H5NA 3F7YC 2EIMC 2FB5A 4A5UB 4XDJA 4LNUA 4UB6Z 5C93A 3IAYA 2A7WA 2HLDG 2B1GA 2EIKB 3D3QA 2QWOB 4JYAB 1YSCA 4MS2A 4LF7B 4DV6O 4MVUA 3MHHC 2GTSA 1DGSA 1NBMG 4B3TB 3C90A 1B06A 2YICA 1AI4A 1WP7A 1W0JG 4NXNB 3JAKB 2XAQA 2JGUA 4ZHQB 3O9OA 4B3MB 4DV1B 1BQZA 1N36B 1NI8A 3H1LH 4DR1O 1Z2GA 5E79Z 4PDVA 4GLXA 3OR6C 1YJNV 5LBQA 1PV0A 5IY5C 2PTMA 4LFCB 2HP8A 3OMAB 1SQPH 4JTDB 1BMFG 3ML0A 3IGAC 3U0ZA 1JMKC 1QLEC 3HKCA 1KP2A 4YIPA 1W59A 3A0BZ 2CH7A 4OPAA 2LW1A 1SQFA 5A9GA 1BGYH 1Q6IA 2YEVB 4LWSA 3CRQA 2IJIA 3A8TA 4J9YB 1E1RG 4O4HA 3I55V 4K0KO 3ZS8C 4B3SO 4DV0O 1NVPB 1VIBA 2KSDA 4EKWA 4UCSA 5L3GA 1QBZA 3ZMZA 5BXZA 5A2QN 4J10A 3RYCA 4UCRA 1I5YA 4JI2B 1Q90D 3OUSA 2UUBO 2N74A 4EB6B 4WFBV 4I55B 4HNAA 4TUYB 3E22B 4X1KB 5ITZA 4UXNA 3P3NA 2W0FC 1KQSU 3AG4B 1Q86W 2BTQA 5KA5A 5BZBA 1Y76B 4FLVA 1EFRG 2QDOA 1K73W 4XBFA 4PI0A 5LYJA 2PI4A 2LFSA 3VBBA 2V4DA 1ZX3A 2EZOA 3HB3B 3CJHB 1S5JA 3L70H 3ETQA 3RYHA 1F51A 3OM3B 2IBZH 3L71H 5B1AB 2QM8A 3HKDB 2VQFB 2Q4PA 2WLLB 1FFXB 3DC5A 1DTOA 1GM7A 2OYQA 5LP6B 4O2BA 1GO3F 4DV5B 3JD3A 3QG5A 3ABTA 4ZBMA 3QO5A 1FFTB 3QVNA 3P3PA 2Y4UA 2FKXA 4YJ2B 1K92A 4BWAA 5JWPA 4X65O 2VRZA 2Q69A 5LL6Y 4UVAA 1M57B 3CPWU 3OUFA 2FMLA 1GRJA 4I4TA 5BY1A 2Q73A 4FJCC 4FMTA 4EFEA 1XHXA 5CMUA 5JVDA 4MW3A 3H1IH 2VS0A 1H2NA 1SC5B 4N21A 1WPBA 1WB7A 1SERA 5LXTB 2E76B 4DK1A 2EIJC 3JAWB 4IL6Z 1VQMV 1GN2A 4JYBA 1HR0O 5C8YA 1TVKA 4IT5A 5H2FZ 1S76D 2YC0A 2DMXA 3BFRA 2L6LA 3VQWA 1AJNA 2YIBD 3JARA 2KQXA 1XQ8A 3ZX6A 2F4VB 4PJ0Z 4U3JA 3FAVB 3AK3A 4JPRA 2P06A 1JX9A 2OT5A 5EYPA 1M90W 3B8NA 3KZIZ 2UUCB 3MD0A 1Q7YW 4BIOA 2ZM6B 3ZEDA 2PYJA 4F6RA 2LQTA 2ZE5A 1W0KG 4JGSA 2JJ2G 4WBNB 1Q6HA 3N2GB 1TAEA 1AP6A 4U7OA 2Q68A 5LOVA 4JTCB 3ABMC 4JYAO 4LF7O 3FB6C 1AJQA 1G6UA 1MABG 2KG7A 1IVSA 3BHPA 1WJZA 5H6QA 3L74H 3SJCC 3HKBB 4G27B 3OMIB 3CCVV 2BOBC 3CMAV 4X1IA 3A0RA 4GKJB 4NXNO 3AG1B 4QGPA 4ZI7B 4B3MO 1KP3A 4MTFA 4DV1O 2HFEC 1TUBA 4I5SA 1N36O 5EIBD 3S3WA 1AI6A 3BCCH 4RUFA 3K5MA 1XHZA 2HVKC 3UO2A 2IJJA 3STLC 1FXKA 2UXDB 1SZXA 4JYYA 1KKDA 4LFCO 4LC1A 4LCUC 1K8AW 4NXMB 4UCOA 3RW0A 1YI2V 1RPRA 1ZLZA 3CS5A 3CCQV 1P7BA 2O57A 1IZ3A 5IWAB 3GB7C 3M7MX 2YXLA 2GTAA 2ITDC 4H33A 3E86A 3N27A 2M7WA 2HG5C 2CGNA 5FNVB 1PL0A 1WB8A 3IC7A 1BE3H 1VP7A 4CBCA 1N0JA 1XMOB 3RBZA 2OTJV 4TOIA 4JI2O 1T5EA 3JAKA 3OAAG 1MSWD 4ZHQA 1V54C 3APOA 1FD9A 1XMQB 1D5NA 2R9IA 2IJHA 1YTFB 3JSLA 2JGDB 1Y67A 4PA6A 5JJJB 3GVMA 1AB3A 1OCRC 5TISZ 4YY3B 5KUMA 1XDCA 2NR5A 2QE7G 4OPHA 2Y0PA 1IDSA 4K8ZA 3DXRA 2Q8VA 5H9CA 2Z0AA 4K0KB 1PNLA 1US6A 3MHSC 4B3SB 4ZOLB 1YVWA 5HFMA 2WPDG 4PD4F 4F6EA 4FM2A 2YEVA 1K3EA 2OCCC 5KHHA 1KUQA 4J11A 4JI1B 1P49A 2D2CB 4MVRA 1YDXA 3SYQA 2VQFO 3O65A 5IYCO 4KXRA 1IURA 3CEIA 1PD3A 4JI8B 3ZRWB 4PV1B 1YTFD 4DV5O 1J5EB 3T2MA 5DN6G 1PM9A 2JVDA 4DK0A 4TQDA 4EEQA 2X7RB 1PNMA 4PHZA 4I55A 4TUYA 3E22A 5CN0A 1BZKA 3EFFK 2ITCC 3E35A 1BSMA 4DR2B 1R3KC 2R70A 4AQYB 4YXWG 1G4YB 1NTZH 1Y76A 2WLNA 1YHQV 2Y69B 1QU7A 4LF8B 1L1FA 4D6TH 1M56B 2XHBA 3RYFB 2XAJA 4J7JA 4YIOA 2LFRA 5CA0A 3ICXA 4EFBA 3CP1A 1VF7A 3RYIB 3HKDA 3KG2A 4PA3A 3AG2B 2WLLA 4K35A 1L0NH 4FVMA 2EILB 4I0XB 2UU9O 2K9PA 4X9QA 4CS4A 4WFFA 4WCEV 2NNUA 4TT3G 4RAIA 4NKGB 1SQQH 4RQFA 4UCTA 3K3WA 5IYDO 1VQ5V 4LP8A 3I5DA 5CA1A 3X2QC 5LMUO 2CAZC 3FB7C 1OCCB 1F4NA 1NR7A 5BMVA 2UUCO 2ZM6O 3JD1A 2ARHA 2EBOA 1LNQA 2EINB 2B9ZA 3BA8A 2CK3G 2DOSA 1LUVA 1RM1B 2UXBB 2EIKC 1Y6XA 2GDSA 4JYCA 2AZ2A 4DO2A 4IGGA 2WSSG 3WG7C 4DV4O 2A3QA 4FFBB 4UUJC 2AXTZ 4FLWA 2BOCC 1SF9A 1EZJA 2Y4TA 5LHIA 2FYUH 3W7TA 3JAWA 3K57A 1Q43A 1HW7A 1Q6UA 4CH5A 4PDMA 4X62B 1W2BU 1SQBH 1B6QA 5LHHA 2ZXWB 3ZHVA 1P4RA 1OCOC 1KKCA 1QCEA 4BW5A 5KHIA 4ICGA 1S3JA 3FAVA 2UXDO 1VQ8V 3VQVA 4NR1A 3ABLB 2EJ7A 1OCZB 4MVMA 4NXMO 3UQ8A 3N2GA 5DEDA 3HKEB 3CMEV 1VQ9V 1E1QG 1WAZA 5JH7A 1M5IA 5IWAO 1B3QA 1V55B 1K5SA 4BIZA 4LF6O 1QQCA 2Q7GA 3G67A 5CB4B 5FPOA 1KBHA 1DLBA 4JAAA 4I7ZB 2Z5UA 2R9RB 3N2KB 3E83A 3K08A 4LFBB 1XMOO 1Q5OA 5H6RA 5IYZB 4ZI7A 1EBOA 1KC8W 3KCXA 3FD9A 4GYCB 3UT5B 1X59A 1YZBA 1ENVA 1XMQO 1SETA 3CCEV 2AHZA 4DYLA 2KKWA 4B7KA 2QWQB 4DUZB 4WFAV 3L9DA 3RN4A 3ZBHA 2WLJA 3TJTA 2EIMB 4YY3O 4B08A 3T1CA 2PY5A 4DW0A 1YF2A 1A32A 4X1YB 4O4IA 4X64B 1S77D 3BAAA 1IBMB 1IXMA 2UXNA 3ASNC 2CGOA 3JD4A 4JI1O 3F5WC 3OEEG 1NS1A 2HEPA 2BSKB 2X6BA 1RP3B 5FNVA 3ZJZA 4LF4B 3IJ4A 4JASA 1QVFU 2ZDIC 1ZL8A 2QM7A 2Q7EA 4O2AB 2YI8A 5B3SB 3OGCC 4MW8A 5KUKA 4FZ0A 1M1KW 1HNZB 1FJGO 1PP9H 5JQGB 4U3FH 3JALB 4JI8O 3OEHG 1J5EO 1SRYA 4NVPA 5JCOA 2C2AA 4UV9A 2PUSA 1MG1A 2IW5A 5IJ9A 5IY5B 3R65A 4LH6A 3FKSG 4QE9A 2QTOA 3OD4A 1FS0G 3OTOB 4DR2O 1H2LA 1HDJA 2JGDA 2ZKOA 4AQYO 2CTQA 1SQVH 1FYJA 1QLEB 3BVOA 4DR5B 3DTUB 2FTKA 1BL8A 1VF6A 3K5NA 5L3FA 2Q67A 4BIUA 2DW4A 3SYAA 1AILA 4DV2B 4W4LA 1KU9A 2ODMA 4ZOLA 5IDJA 3OMNB 4LF8O 4CC6A 1SA0A 1CPYA 2WLIB 3CYOA 4FM1A 1COWG 1Y74A 4P9OA 2XTAA 2P5OA 5B1BC 2WLHA 1YITV 1GH6A 3U10A 4JI4B 4R50A 2A79B 2E74B 1N8RW 2A06H 2GUZB 3ABKB 3ZMTA 2EZPA 2Y0IA 3D3IA 3ZRWA 3SJAC 1KD1W 3GWKC 3WFVA 2JJ1G 3JATB 4DR3O
chains in the Genus database with same CATH topology
3CRAA 2YXHA 2A3QA 1YXBA 2Q9LA 5IE9A 2P06A 1VMGA 2Q5ZA 2Q73A 2OIGA 2A7WA 3CRCA 1YVWA 2GTAA 2Q4PA 1Y6XA 2OIEA 3C90A 4QGPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CRA A;  2YXH A;  2A3Q A;  1YXB A;  2Q9L A;  5IE9 A;  2P06 A;  1VMG A;  2Q5Z A;  2Q73 A;  2OIG A;  2A7W A;  3CRC A;  1YVW A;  2GTA A;  2Q4P A;  1Y6X A;  2OIE A;  3C90 A;  4QGP A; 
#chains in the Genus database with same CATH topology
 3F5T A;  3ZRX A;  4E2L A;  1XL6 A;  2RMK B;  2RJZ A;  1R3J C;  3K9A A;  2AGA A;  5L3B A;  1JJ2 U;  1I7F A;  2XAS A;  1Q82 W;  5AG2 A;  1IBL B;  2A0L A;  3K03 A;  3CCS V;  1AI7 A;  1E79 G;  4TV8 B;  3I56 V;  4IYI A;  2F43 G;  2MK3 A;  4I50 B;  2Q0A A;  3RYF A;  3ZMU A;  2UXB O;  1D2D A;  1GN3 A;  2UU9 B;  4DR4 B;  3QF7 A;  5FPR A;  1XRE A;  5IJ0 B;  1G1X B;  3RYI A;  1X4T A;  3J81 N;  5KAI Z;  2W0X A;  4TV9 B;  2UUA O;  1H8E G;  4P9P A;  4X62 O;  2N04 A;  5LMU B;  5EZY B;  4UCV A;  3OW2 U;  1BCC H;  3AG3 C;  1Y4M A;  3LSU A;  2LW7 A;  1AI5 A;  5GON B;  5KX5 B;  2V7Q G;  1Z5W A;  4PDL A;  1ZTE A;  4B7E A;  1ROP A;  1K5Q A;  1NR1 A;  5EC2 C;  3ZRV A;  4YHH O;  2QTS A;  3ETE A;  2MW2 B;  2XND G;  3D8C A;  4LNU B;  4J42 A;  1YJ9 V;  3QO7 A;  4DW1 A;  4K8X A;  4GCZ A;  4DV4 B;  3NXS A;  4DRX B;  4CS2 A;  3ASO C;  1JR9 A;  2EIJ B;  3UCS C;  1I08 A;  3ZRS A;  5EBL C;  4C7U A;  4KP4 A;  3CRR A;  1WA8 B;  3W7W A;  4JI7 O;  2YXY A;  4FPP A;  2P4V A;  1MA1 A;  4LFB O;  1GN4 A;  1JPX A;  3JAM N;  2R9A A;  5D5Q A;  3QNE A;  3OE7 G;  3T1H B;  1AR5 A;  2Z3Y A;  1VQP V;  2JS3 A;  4X8A A;  5KMG A;  1VEW A;  3FYE B;  3P32 A;  1UJW B;  2W6J G;  2Y48 A;  4DUZ O;  5F2V O;  4JTA B;  4PA7 A;  3C3S A;  3LUT B;  2LJ2 A;  4MVS A;  5LGU A;  1XBL A;  3G71 V;  3B4S A;  3THO A;  3A0H Z;  2IM9 A;  2DQ0 A;  4LF6 B;  1VF6 C;  2H8P C;  2RNB A;  5FLX N;  3ABM B;  4WF9 V;  3MAQ A;  2LO1 A;  4O4H B;  1JCH A;  3JD2 A;  3HKE A;  4X64 O;  4G2K A;  1YXB A;  1IBM O;  3K79 A;  4JI3 O;  1H38 A;  1AP5 A;  4LBE C;  1QR9 A;  1L8D A;  4CH4 A;  3M8A A;  1BS3 A;  5CB4 A;  4CZZ A;  3G6E V;  1MMM A;  5KAF Z;  4PA9 A;  4MSW C;  2CTR A;  4LF4 O;  5LHG A;  4B3R B;  3SPH A;  3J80 N;  3OT7 A;  2GHY A;  1XL4 A;  3T4Z A;  1HNZ O;  5JJN B;  2M6Y A;  4HNA B;  2F95 B;  5EC1 C;  2W6I G;  1OV9 A;  1WN7 A;  4IIJ B;  5ITZ B;  1WPX A;  1PKX A;  2YID A;  4UFZ A;  5KA6 A;  1R6K A;  4JZ2 A;  1DF4 A;  3K06 A;  3K5O A;  3OTO O;  2DYS C;  1XUQ A;  3SGI A;  5LA6 B;  3K04 A;  5LYJ B;  1FPO A;  2DE0 X;  1K4C C;  5KHK A;  2B1I A;  4DR5 O;  1NZ6 A;  2ATK C;  3AEI A;  4FIP C;  3VOU A;  3ZMV A;  1Y66 A;  4DV2 O;  4GX1 A;  2X6C A;  3VQY A;  2XUM A;  4UVB A;  3H9V A;  4X1Y A;  1XOU A;  1H2S B;  5L3C A;  1XEQ A;  2VWK A;  3AG7 A;  4DUY B;  1JA8 A;  4CC5 A;  1G8M A;  2E75 B;  2LGQ A;  4MVO A;  1M56 C;  3B77 A;  4NTY A;  1H2K A;  3LNN A;  3SPG A;  3D36 A;  2V1D A;  4X88 A;  1FJG B;  5IYB O;  4JI4 O;  1YIJ V;  3E8G A;  4R7C A;  3WU2 Z;  2WA4 A;  4Q20 A;  1R3L C;  2DWE C;  3DGE A;  4DR6 B;  4EB6 A;  1V54 B;  1H2M A;  3AG2 C;  1WNS A;  1F4M A;  5GW7 A;  2PGG A;  1ZSP A;  4X1K A;  4QPJ A;  4WFE A;  1GTO A;  4GKK B;  3LDC A;  1KEC A;  4MVZ A;  3ZHT A;  3IFX A;  5CBH A;  3ZN1 A;  3ZHU A;  1HNW B;  2VQE B;  1HP8 A;  3CJH A;  1O9H A;  3K9S A;  2ZE8 A;  3EVK A;  2AHY A;  5J2U B;  4MT8 A;  5JVD B;  1TGO A;  1RPO A;  4QJF B;  3ETG A;  2OCC B;  2AW9 A;  1IBL O;  3DC6 A;  3W7U A;  2XT9 A;  1DK1 A;  3CC2 V;  4MTG A;  1WLE A;  3SYP A;  3RT3 C;  1FFX A;  3UM7 A;  5B1O A;  4QNH B;  4DR4 O;  1CXZ B;  1H2G A;  2F66 C;  2PYL A;  5LP6 A;  4P2Z A;  1TVK B;  4NYK A;  4DR3 B;  4L87 A;  2ILM A;  3BEH A;  3BA9 A;  1NT2 B;  1FXH A;  3TCU A;  2GUZ A;  1I5X A;  3CC4 V;  1WP8 A;  3ZHS A;  4YJ2 A;  1FXK C;  4U3J B;  5DM6 V;  4CH3 A;  2YIB A;  2B5U A;  3RVZ A;  3JAT A;  3Q4H B;  2OCH A;  2IJK A;  5EYP B;  3CB2 A;  4F6R B;  1IBK B;  2Q6A A;  2CE4 A;  1S5L Z;  3W7S A;  3CXH F;  1MSD A;  1M93 A;  2CTP A;  1UFI A;  1B04 A;  3L75 H;  2NN4 A;  5KHG A;  1SKV A;  5LOV B;  5E1A C;  3HPL C;  5J2T B;  1OCZ C;  4JV5 B;  5JJE B;  5LXT A;  2QA4 V;  1U97 A;  1P7G A;  2KG7 B;  4TV8 A;  2YUA A;  4X66 O;  1QNM A;  4LF5 B;  2QKA A;  2UUA B;  1V55 C;  2DYR B;  3JAS B;  1R6N A;  4I50 A;  3CC7 V;  2ZCE A;  4X89 A;  3FYI B;  4FLX A;  4TV9 A;  2FL4 A;  3VQX A;  3CCU V;  1JFF B;  2JRI A;  3QTC A;  2QSA A;  5EZY A;  1PNK A;  3X2Q B;  2F93 B;  2OIG A;  4YHH B;  3T1H O;  3E8H A;  1EN6 A;  5GON A;  2BCC H;  1FAF A;  4QIW F;  5CBG A;  3RFR A;  4FM0 A;  1XIL A;  4WBN A;  4TSF G;  3C3T A;  3SYO A;  3CCM V;  2A9H A;  1ARO P;  3QO8 A;  3F7V C;  3FB5 C;  3TXS A;  1U96 A;  4DXW A;  4MTO A;  3CCJ V;  3B09 A;  4JI7 B;  4DRX A;  3WG7 B;  3HKB A;  5L3E A;  2NLJ C;  2ZE7 A;  4K3A A;  1AJP A;  1N34 O;  5B5E Z;  2OIE A;  3D36 C;  2QKC A;  2XAG A;  1HNX O;  3EXA A;  2XAH A;  1WA8 A;  1MZE A;  4B3R O;  3B2E E;  1K7D A;  3ABU A;  5FL7 G;  1OCO B;  4F4L A;  3M99 B;  4XDL A;  3E89 A;  5B3S C;  4FLZ A;  2X6A A;  1N33 B;  3B8M A;  3ZHQ A;  2QJ1 A;  2EJR A;  1XNR O;  3AG4 C;  3NR7 A;  1Z5V A;  3DXR B;  1JVM A;  2ZNJ A;  4JAU A;  2G38 A;  2RN9 A;  1SQG A;  3OTF A;  5BR8 B;  3CHX A;  3B40 A;  2E5L O;  4JI5 O;  4JI3 B;  2N05 A;  3ETD A;  3WB0 A;  4MTX A;  4GZR B;  2R72 A;  1RSO B;  4LH7 A;  4UCU A;  3RWR D;  4E4E A;  5B1A C;  2QR4 A;  4DUY O;  2QKS A;  2P4K A;  4J7Z A;  4LF9 B;  1K4D C;  4WFH A;  4RO2 A;  4Z1M G;  5LGN A;  2HKO A;  2YIA A;  4P30 A;  5LP6 C;  4DR6 O;  1EN4 A;  2HHH B;  4UB8 Z;  4LFA B;  1GKF A;  4KHP B;  4UV8 A;  3AK1 A;  3U11 A;  1NJI W;  4OX9 O;  4MVQ A;  2P90 A;  3ABK C;  4DR7 B;  4GKK O;  4IIJ A;  3FB8 C;  4OXS A;  4DV3 B;  1NTM H;  3FFQ A;  2ZR3 A;  3CCL V;  2CTW A;  4R6Z A;  1TUE B;  3BPZ A;  4O4J B;  1M57 C;  1ZWI C;  2EX3 A;  1XNQ O;  1HNW O;  1NU1 H;  5LA6 A;  3K0G A;  2VQE O;  3CX5 F;  5KLV H;  5K1P A;  4FLU A;  1NVP D;  3ASN B;  4IHJ B;  3SPJ A;  1NQT A;  4FZ1 A;  5CA0 B;  1JJO A;  2EUL A;  3K59 A;  2QGN A;  2H94 A;  4FLY A;  2PI5 A;  4GX5 A;  4HZ3 A;  1I94 B;  4X20 B;  4FLT A;  4N23 A;  4G28 B;  4JI0 B;  3WB1 A;  1GM9 A;  3T1Y B;  2GSM B;  1BHB A;  4J7K A;  1OZ0 A;  5IT9 N;  2ZIN A;  2XAF A;  1K9M W;  4JI6 B;  2LP7 A;  2WA3 A;  5CA1 B;  3UKM A;  4AHC A;  5EIB C;  2UXX A;  5BMV B;  1SZT A;  1GAX A;  3H1H H;  1N32 B;  2PZS A;  2DN9 A;  3IC9 A;  4CH6 A;  1IBK O;  3TXQ A;  2YXH A;  1IXB A;  2Q9L A;  4Z1V A;  1YEW A;  4BR6 A;  5J2U A;  5B1N A;  4QE7 A;  1QHT A;  2WLM A;  3SR2 C;  4JV5 O;  1JOY A;  5B1B B;  4JZG A;  4H44 B;  2YSU B;  2JEX A;  2OTL V;  1GM8 A;  5J9P C;  4LF5 O;  2GBO A;  4YJ3 B;  4I0X A;  1UPG A;  3CSX A;  3K0D A;  4CS3 A;  3PN1 A;  2XOK G;  4GT1 A;  3AG1 C;  1BHA A;  3SJB C;  3ZCC A;  1GMG A;  4O4L B;  1AR4 A;  2LGW A;  4PDR A;  1S0V A;  3SDL A;  2UXC B;  1QR8 A;  4H0L B;  3AK2 A;  5LMN O;  2ZNI A;  2ZR2 A;  3H1J H;  2H3O A;  1THZ A;  1M9N A;  3L73 H;  3Q4H A;  1FKA O;  1BQ0 A;  1F23 A;  1EM1 A;  3K58 A;  1KYO F;  1Q8I A;  1YCI A;  4TQF A;  4RWU A;  2ZIM A;  1ORQ C;  4GUN A;  4TWK A;  4X66 B;  1SS3 A;  2ZQM A;  5JH7 B;  3SJQ C;  2YS8 A;  3P30 A;  5D5P A;  1EN5 A;  2ADQ B;  1HWY A;  5J2T A;  1H8H G;  4FFB A;  3WB2 A;  1NKD A;  3JAS A;  3J7A U;  4B3T O;  4ASU G;  1R3I C;  5CA3 A;  2ZIO A;  4NTW A;  5JCO C;  3AG3 B;  2CUG A;  3E8F A;  2QWN B;  2JDI G;  4GX0 A;  1S72 V;  1EZV H;  4DV7 B;  1PPJ H;  2PF4 E;  4U7N A;  1JFF A;  2WLK A;  2JIZ G;  5IE9 A;  3LNM B;  1Q81 W;  2DQ3 A;  1VMG A;  2AZ0 A;  5K1X A;  4J9Z B;  2BTO A;  1V9P A;  4KL1 A;  1VQO V;  3CRC A;  1N33 O;  1CP9 A;  3LDD A;  4UVC A;  3HKC B;  2F23 A;  2ETN A;  2CH7 B;  1QLN A;  1BT8 A;  3H01 A;  3JYC A;  4LWS B;  5L3D A;  4PA4 A;  1MZF A;  2P67 A;  1VAR A;  3EHB B;  2IH1 C;  1N4C A;  1VQL V;  4AI8 A;  3CRA A;  5BR8 O;  4HBN A;  3H1K H;  4DV6 B;  4O4I B;  3ASO B;  3BY6 A;  1AR1 B;  1GN6 A;  1FXV A;  1N34 B;  1OHH G;  1R73 A;  4IYH A;  5HFL A;  2DWD C;  1HNX B;  2IU0 A;  1NTK H;  3JSN A;  5KHJ A;  3RYC B;  1AVM A;  2X0L A;  4LF9 O;  3N2K A;  4BW9 A;  3JD0 A;  1OJH A;  1ZL8 B;  3OR7 C;  3TGU H;  5IYZ A;  1P84 F;  4DR1 B;  1F7Y A;  4H13 B;  2YDE A;  1IX9 A;  2HHH O;  1XNR B;  4LFA O;  3UT5 A;  1NH2 B;  4KHP O;  2P22 C;  1L0L H;  2BTQ B;  4JF3 A;  5IJ9 B;  4FFK A;  4DR7 O;  3G80 A;  4DV3 O;  3CRM A;  3DSQ A;  2E5L B;  2P7T C;  4JI5 B;  3CD6 V;  3ZN0 A;  4I9Q A;  2IU3 A;  5B66 Z;  3RYH B;  2Y69 C;  1TA8 A;  3LDE A;  1RFY A;  1LUW A;  4D7S A;  4DV0 B;  4Z2W A;  2HR3 A;  3R66 A;  1SA0 B;  4ABM A;  4FK5 C;  4AIL C;  1Y74 B;  1RSO A;  4ZKI A;  2BSK A;  4J41 A;  1K33 A;  5CBF A;  1ZUQ A;  4O2B B;  3APQ A;  1PL4 A;  4BAY A;  5EBM C;  3G4S V;  4O2A A;  2GV9 A;  2RDC A;  2UUB B;  4OX9 B;  1NH2 D;  3LSS A;  4GX2 A;  5JQG A;  2EIL C;  1I94 O;  3JAL A;  2HVJ C;  1VQ7 V;  4D7T A;  4JI0 O;  3CXC U;  1SES A;  3T1Y O;  2CDY A;  1OCR B;  3E8B A;  1VQK V;  2ZT9 B;  3S3X A;  1LR1 A;  2Q0O C;  4I9W A;  1XNQ B;  1SQX H;  4JI6 O;  4PI2 A;  2Q7H A;  2DYS B;  4I4T B;  3SPC A;  2QWR B;  1OCC C;  2HJF C;  3OFN G;  3CWB H;  1M4U A;  4KUM A;  3ZIA G;  1N32 O;  1DF5 A;  1Q3E A;  4H37 A;  5EK0 A;  3RVY A;  3PJS K;  4O4J A;  2WWW A;  3CCR V;  2VWJ A;  3E2E A;  3L72 H;  5DEC A;  3HR0 A;  2WLI A;  1QVG U;  1KB9 F;  3K5L A;  2RCV A;  2EIN C;  4L8J A;  1MNG A;  1K34 A;  1VQ6 V;  4WFG A;  2KB1 A;  3ZHR A;  1O9G A;  4HYO A;  1RM1 C;  1VF5 B;  3ZMS A;  4IHJ A;  2ZD9 A;  5C8Y B;  2P6J A;  3RGB A;  3T4D A;  1URF A;  1D5A A;  3KKY A;  1I0H A;  2DJV A;  3TK1 A;  2ZDI A;  2QEX V;  2DYR C;  3SYC A;  3JAR B;  4X20 A;  4NB5 A;  5LGT A;  2ZXW C;  4HAM A;  3BAB A;  3STZ C;  4JAV A;  2E3C A;  1ZAU A;  2ZE6 A;  2K1E A;  2Q5Z A;  2UXC O;  2YI9 A;  3JCZ A;  4X65 B;  5GTH Z;  3TET A;  2BE3 A;  2F4V O;  2RQ6 A;  2F1M A;  3GWO A;  1K97 A;  2JEU A;  4ZIB A;  4OGQ B;  1KMI Z;  2QM4 A;  4PEL A;  1JQ0 A;  3OGI B;  3ABL C;  2JK5 C;  1N0N A;  3MDS A;  4RQE A;  1VQN V;  4XDK A;  3A2F A;  5EBW C;  3W7X A;  3CE2 A;  4QPK A;  2WAM A;  5GTI Z;  2D3O W;  3LSQ A;  3G6B A;  1MOF A;  1S5H C;  4W4K A;  2JS5 A;  3SPI A;  4X1I B;  2L35 A;  3JCU Z;  1HR0 B;  1GK9 A;  3UO3 A;  4KFM A;  1J95 A;  4RUE A;  5IJ0 A;  1XI1 A;  4R8C A;  1R6T A;  1TUB B;  2QWP B;  4YJ3 A;  5LMN B;  2OWO A;  2IH3 C;  1R1B A;  4NTX A;  1YJW V;  3KCY A;  2HJD A;  3BRC A;  2ADP A;  1FXK B;  4GKJ O;  5KX5 A;  4O4L A;  3FX7 A;  4DV7 O;  4J80 A;  4LR3 A;  1CEZ A;  1VQ4 V;  5KMG B;  4Q6G A;  5H5N A;  3F7Y C;  2EIM C;  2FB5 A;  4A5U B;  4XDJ A;  4LNU A;  4UB6 Z;  5C93 A;  3IAY A;  2A7W A;  2HLD G;  2B1G A;  2EIK B;  3D3Q A;  2QWO B;  4JYA B;  1YSC A;  4MS2 A;  4LF7 B;  4DV6 O;  4MVU A;  3MHH C;  2GTS A;  1DGS A;  1NBM G;  4B3T B;  3C90 A;  1B06 A;  2YIC A;  1AI4 A;  1WP7 A;  1W0J G;  4NXN B;  3JAK B;  2XAQ A;  2JGU A;  4ZHQ B;  3O9O A;  4B3M B;  4DV1 B;  1BQZ A;  1N36 B;  1NI8 A;  3H1L H;  4DR1 O;  1Z2G A;  5E79 Z;  4PDV A;  4GLX A;  3OR6 C;  1YJN V;  5LBQ A;  1PV0 A;  5IY5 C;  2PTM A;  4LFC B;  2HP8 A;  3OMA B;  1SQP H;  4JTD B;  1BMF G;  3ML0 A;  3IGA C;  3U0Z A;  1JMK C;  1QLE C;  3HKC A;  1KP2 A;  4YIP A;  1W59 A;  3A0B Z;  2CH7 A;  4OPA A;  2LW1 A;  1SQF A;  5A9G A;  1BGY H;  1Q6I A;  2YEV B;  4LWS A;  3CRQ A;  2IJI A;  3A8T A;  4J9Y B;  1E1R G;  4O4H A;  3I55 V;  4K0K O;  3ZS8 C;  4B3S O;  4DV0 O;  1NVP B;  1VIB A;  2KSD A;  4EKW A;  4UCS A;  5L3G A;  1QBZ A;  3ZMZ A;  5BXZ A;  5A2Q N;  4J10 A;  3RYC A;  4UCR A;  1I5Y A;  4JI2 B;  1Q90 D;  3OUS A;  2UUB O;  2N74 A;  4EB6 B;  4WFB V;  4I55 B;  4HNA A;  4TUY B;  3E22 B;  4X1K B;  5ITZ A;  4UXN A;  3P3N A;  2W0F C;  1KQS U;  3AG4 B;  1Q86 W;  2BTQ A;  5KA5 A;  5BZB A;  1Y76 B;  4FLV A;  1EFR G;  2QDO A;  1K73 W;  4XBF A;  4PI0 A;  5LYJ A;  2PI4 A;  2LFS A;  3VBB A;  2V4D A;  1ZX3 A;  2EZO A;  3HB3 B;  3CJH B;  1S5J A;  3L70 H;  3ETQ A;  3RYH A;  1F51 A;  3OM3 B;  2IBZ H;  3L71 H;  5B1A B;  2QM8 A;  3HKD B;  2VQF B;  2Q4P A;  2WLL B;  1FFX B;  3DC5 A;  1DTO A;  1GM7 A;  2OYQ A;  5LP6 B;  4O2B A;  1GO3 F;  4DV5 B;  3JD3 A;  3QG5 A;  3ABT A;  4ZBM A;  3QO5 A;  1FFT B;  3QVN A;  3P3P A;  2Y4U A;  2FKX A;  4YJ2 B;  1K92 A;  4BWA A;  5JWP A;  4X65 O;  2VRZ A;  2Q69 A;  5LL6 Y;  4UVA A;  1M57 B;  3CPW U;  3OUF A;  2FML A;  1GRJ A;  4I4T A;  5BY1 A;  2Q73 A;  4FJC C;  4FMT A;  4EFE A;  1XHX A;  5CMU A;  5JVD A;  4MW3 A;  3H1I H;  2VS0 A;  1H2N A;  1SC5 B;  4N21 A;  1WPB A;  1WB7 A;  1SER A;  5LXT B;  2E76 B;  4DK1 A;  2EIJ C;  3JAW B;  4IL6 Z;  1VQM V;  1GN2 A;  4JYB A;  1HR0 O;  5C8Y A;  1TVK A;  4IT5 A;  5H2F Z;  1S76 D;  2YC0 A;  2DMX A;  3BFR A;  2L6L A;  3VQW A;  1AJN A;  2YIB D;  3JAR A;  2KQX A;  1XQ8 A;  3ZX6 A;  2F4V B;  4PJ0 Z;  4U3J A;  3FAV B;  3AK3 A;  4JPR A;  2P06 A;  1JX9 A;  2OT5 A;  5EYP A;  1M90 W;  3B8N A;  3KZI Z;  2UUC B;  3MD0 A;  1Q7Y W;  4BIO A;  2ZM6 B;  3ZED A;  2PYJ A;  4F6R A;  2LQT A;  2ZE5 A;  1W0K G;  4JGS A;  2JJ2 G;  4WBN B;  1Q6H A;  3N2G B;  1TAE A;  1AP6 A;  4U7O A;  2Q68 A;  5LOV A;  4JTC B;  3ABM C;  4JYA O;  4LF7 O;  3FB6 C;  1AJQ A;  1G6U A;  1MAB G;  2KG7 A;  1IVS A;  3BHP A;  1WJZ A;  5H6Q A;  3L74 H;  3SJC C;  3HKB B;  4G27 B;  3OMI B;  3CCV V;  2BOB C;  3CMA V;  4X1I A;  3A0R A;  4GKJ B;  4NXN O;  3AG1 B;  4QGP A;  4ZI7 B;  4B3M O;  1KP3 A;  4MTF A;  4DV1 O;  2HFE C;  1TUB A;  4I5S A;  1N36 O;  5EIB D;  3S3W A;  1AI6 A;  3BCC H;  4RUF A;  3K5M A;  1XHZ A;  2HVK C;  3UO2 A;  2IJJ A;  3STL C;  1FXK A;  2UXD B;  1SZX A;  4JYY A;  1KKD A;  4LFC O;  4LC1 A;  4LCU C;  1K8A W;  4NXM B;  4UCO A;  3RW0 A;  1YI2 V;  1RPR A;  1ZLZ A;  3CS5 A;  3CCQ V;  1P7B A;  2O57 A;  1IZ3 A;  5IWA B;  3GB7 C;  3M7M X;  2YXL A;  2GTA A;  2ITD C;  4H33 A;  3E86 A;  3N27 A;  2M7W A;  2HG5 C;  2CGN A;  5FNV B;  1PL0 A;  1WB8 A;  3IC7 A;  1BE3 H;  1VP7 A;  4CBC A;  1N0J A;  1XMO B;  3RBZ A;  2OTJ V;  4TOI A;  4JI2 O;  1T5E A;  3JAK A;  3OAA G;  1MSW D;  4ZHQ A;  1V54 C;  3APO A;  1FD9 A;  1XMQ B;  1D5N A;  2R9I A;  2IJH A;  1YTF B;  3JSL A;  2JGD B;  1Y67 A;  4PA6 A;  5JJJ B;  3GVM A;  1AB3 A;  1OCR C;  5TIS Z;  4YY3 B;  5KUM A;  1XDC A;  2NR5 A;  2QE7 G;  4OPH A;  2Y0P A;  1IDS A;  4K8Z A;  3DXR A;  2Q8V A;  5H9C A;  2Z0A A;  4K0K B;  1PNL A;  1US6 A;  3MHS C;  4B3S B;  4ZOL B;  1YVW A;  5HFM A;  2WPD G;  4PD4 F;  4F6E A;  4FM2 A;  2YEV A;  1K3E A;  2OCC C;  5KHH A;  1KUQ A;  4J11 A;  4JI1 B;  1P49 A;  2D2C B;  4MVR A;  1YDX A;  3SYQ A;  2VQF O;  3O65 A;  5IYC O;  4KXR A;  1IUR A;  3CEI A;  1PD3 A;  4JI8 B;  3ZRW B;  4PV1 B;  1YTF D;  4DV5 O;  1J5E B;  3T2M A;  5DN6 G;  1PM9 A;  2JVD A;  4DK0 A;  4TQD A;  4EEQ A;  2X7R B;  1PNM A;  4PHZ A;  4I55 A;  4TUY A;  3E22 A;  5CN0 A;  1BZK A;  3EFF K;  2ITC C;  3E35 A;  1BSM A;  4DR2 B;  1R3K C;  2R70 A;  4AQY B;  4YXW G;  1G4Y B;  1NTZ H;  1Y76 A;  2WLN A;  1YHQ V;  2Y69 B;  1QU7 A;  4LF8 B;  1L1F A;  4D6T H;  1M56 B;  2XHB A;  3RYF B;  2XAJ A;  4J7J A;  4YIO A;  2LFR A;  5CA0 A;  3ICX A;  4EFB A;  3CP1 A;  1VF7 A;  3RYI B;  3HKD A;  3KG2 A;  4PA3 A;  3AG2 B;  2WLL A;  4K35 A;  1L0N H;  4FVM A;  2EIL B;  4I0X B;  2UU9 O;  2K9P A;  4X9Q A;  4CS4 A;  4WFF A;  4WCE V;  2NNU A;  4TT3 G;  4RAI A;  4NKG B;  1SQQ H;  4RQF A;  4UCT A;  3K3W A;  5IYD O;  1VQ5 V;  4LP8 A;  3I5D A;  5CA1 A;  3X2Q C;  5LMU O;  2CAZ C;  3FB7 C;  1OCC B;  1F4N A;  1NR7 A;  5BMV A;  2UUC O;  2ZM6 O;  3JD1 A;  2ARH A;  2EBO A;  1LNQ A;  2EIN B;  2B9Z A;  3BA8 A;  2CK3 G;  2DOS A;  1LUV A;  1RM1 B;  2UXB B;  2EIK C;  1Y6X A;  2GDS A;  4JYC A;  2AZ2 A;  4DO2 A;  4IGG A;  2WSS G;  3WG7 C;  4DV4 O;  2A3Q A;  4FFB B;  4UUJ C;  2AXT Z;  4FLW A;  2BOC C;  1SF9 A;  1EZJ A;  2Y4T A;  5LHI A;  2FYU H;  3W7T A;  3JAW A;  3K57 A;  1Q43 A;  1HW7 A;  1Q6U A;  4CH5 A;  4PDM A;  4X62 B;  1W2B U;  1SQB H;  1B6Q A;  5LHH A;  2ZXW B;  3ZHV A;  1P4R A;  1OCO C;  1KKC A;  1QCE A;  4BW5 A;  5KHI A;  4ICG A;  1S3J A;  3FAV A;  2UXD O;  1VQ8 V;  3VQV A;  4NR1 A;  3ABL B;  2EJ7 A;  1OCZ B;  4MVM A;  4NXM O;  3UQ8 A;  3N2G A;  5DED A;  3HKE B;  3CME V;  1VQ9 V;  1E1Q G;  1WAZ A;  5JH7 A;  1M5I A;  5IWA O;  1B3Q A;  1V55 B;  1K5S A;  4BIZ A;  4LF6 O;  1QQC A;  2Q7G A;  3G67 A;  5CB4 B;  5FPO A;  1KBH A;  1DLB A;  4JAA A;  4I7Z B;  2Z5U A;  2R9R B;  3N2K B;  3E83 A;  3K08 A;  4LFB B;  1XMO O;  1Q5O A;  5H6R A;  5IYZ B;  4ZI7 A;  1EBO A;  1KC8 W;  3KCX A;  3FD9 A;  4GYC B;  3UT5 B;  1X59 A;  1YZB A;  1ENV A;  1XMQ O;  1SET A;  3CCE V;  2AHZ A;  4DYL A;  2KKW A;  4B7K A;  2QWQ B;  4DUZ B;  4WFA V;  3L9D A;  3RN4 A;  3ZBH A;  2WLJ A;  3TJT A;  2EIM B;  4YY3 O;  4B08 A;  3T1C A;  2PY5 A;  4DW0 A;  1YF2 A;  1A32 A;  4X1Y B;  4O4I A;  4X64 B;  1S77 D;  3BAA A;  1IBM B;  1IXM A;  2UXN A;  3ASN C;  2CGO A;  3JD4 A;  4JI1 O;  3F5W C;  3OEE G;  1NS1 A;  2HEP A;  2BSK B;  2X6B A;  1RP3 B;  5FNV A;  3ZJZ A;  4LF4 B;  3IJ4 A;  4JAS A;  1QVF U;  2ZDI C;  1ZL8 A;  2QM7 A;  2Q7E A;  4O2A B;  2YI8 A;  5B3S B;  3OGC C;  4MW8 A;  5KUK A;  4FZ0 A;  1M1K W;  1HNZ B;  1FJG O;  1PP9 H;  5JQG B;  4U3F H;  3JAL B;  4JI8 O;  3OEH G;  1J5E O;  1SRY A;  4NVP A;  5JCO A;  2C2A A;  4UV9 A;  2PUS A;  1MG1 A;  2IW5 A;  5IJ9 A;  5IY5 B;  3R65 A;  4LH6 A;  3FKS G;  4QE9 A;  2QTO A;  3OD4 A;  1FS0 G;  3OTO B;  4DR2 O;  1H2L A;  1HDJ A;  2JGD A;  2ZKO A;  4AQY O;  2CTQ A;  1SQV H;  1FYJ A;  1QLE B;  3BVO A;  4DR5 B;  3DTU B;  2FTK A;  1BL8 A;  1VF6 A;  3K5N A;  5L3F A;  2Q67 A;  4BIU A;  2DW4 A;  3SYA A;  1AIL A;  4DV2 B;  4W4L A;  1KU9 A;  2ODM A;  4ZOL A;  5IDJ A;  3OMN B;  4LF8 O;  4CC6 A;  1SA0 A;  1CPY A;  2WLI B;  3CYO A;  4FM1 A;  1COW G;  1Y74 A;  4P9O A;  2XTA A;  2P5O A;  5B1B C;  2WLH A;  1YIT V;  1GH6 A;  3U10 A;  4JI4 B;  4R50 A;  2A79 B;  2E74 B;  1N8R W;  2A06 H;  2GUZ B;  3ABK B;  3ZMT A;  2EZP A;  2Y0I A;  3D3I A;  3ZRW A;  3SJA C;  1KD1 W;  3GWK C;  3WFV A;  2JJ1 G;  3JAT B;  4DR3 O; 
#chains in the Genus database with same CATH homology
 3CRA A;  2YXH A;  2A3Q A;  1YXB A;  2Q9L A;  5IE9 A;  2P06 A;  1VMG A;  2Q5Z A;  2Q73 A;  2OIG A;  2A7W A;  3CRC A;  1YVW A;  2GTA A;  2Q4P A;  1Y6X A;  2OIE A;  3C90 A;  4QGP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...