1YVWA

Crystal structure of phosphoribosyl-atp pyrophosphohydrolase from bacillus cereus. nesgc target bcr13.
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
92
structure length
92
Chain Sequence
AFKLLYKTIEERKGSPLPESYTNYLFSKGEDKILKKIGEECAEVIIACKNNDKEEVVKEMVDVFYHCFVLLAEKNIALEDVMREVKERNGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Phosphoribosyl-ATP pyrophosphohydrolase from Bacillus cereus at 2.6 A resolution.
rcsb
source organism Bacillus cereus
molecule tags Hydrolase
molecule keywords Phosphoribosyl-ATP pyrophosphatase
total genus 34
structure length 92
sequence length 92
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.31: Phosphoribosyl-ATP diphosphatase.
pdb deposition date 2005-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01503 PRA-PH Phosphoribosyl-ATP pyrophosphohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1080 Mainly Alpha Orthogonal Bundle Helix Hairpins MazG-like 1yvwA00
2YXHA 2Q5ZA 2A7WA 1VMGA 4QGPA 3CRAA 2GTAA 3CRCA 2A3QA 1YVWA 2Q9LA 1Y6XA 2OIEA 2OIGA 2Q73A 2Q4PA 5IE9A 1YXBA 3C90A 2P06A
chains in the Genus database with same CATH superfamily
2YIBD 3EXAA 5LA6B 2DYRC 2BSKB 1HR0B 1Q3EA 3STLC 1KUQA 4X62O 4UV8A 4MTFA 1M57C 4PJ0Z 4IL6Z 5KAFZ 5LXTB 5LP6B 1Y66A 2ARHA 1BHBA 4JAVA 3SDLA 2YI8A 2XUMA 1OJHA 5LYJB 2WLJA 3OUSA 1F51A 3VBBA 4MTOA 5L3DA 2E5LB 1IDSA 3BRCA 4LF6B 3IC7A 3QF7A 4X62B 2H3OA 4P2ZA 3K08A 2IM9A 1Z5WA 4ZKIA 1PKXA 3ABTA 1AJPA 1YJNV 3JD3A 4QE9A 4RAIA 4R6ZA 2PGGA 4PDRA 2YSUB 4MSWC 1VIBA 3SJQC 1BCCH 2IJJA 5J2UA 1HP8A 3JCZA 5CBFA 1Y76B 4LF7O 1KYOF 2ETNA 4JASA 3BVOA 1BZKA 4DR4B 1QU7A 3AEIA 2X6AA 3N27A 1J5EO 1EZVH 3T1HB 3OMIB 3LUTB 2JGDA 3APQA 1BE3H 5JJNB 2A3QA 1RPOA 2V4DA 2WLNA 1VQ5V 1YZBA 2ZE7A 3TGUH 5CB4B 3H1LH 5LGUA 4JI3O 5EBLC 2AZ2A 1JFFA 1SQBH 4QJFB 3ABKC 4F4LA 3NXSA 2FL4A 4DUZB 4I7ZB 1VF7A 1EN6A 2B5UA 3CB2A 2BE3A 4K35A 3UKMA 3K9AA 5B66Z 1R73A 1RPRA 2Q73A 2WLIB 3JALA 4LFCO 4YJ2A 1A32A 1AR4A 2LW7A 1VEWA 4Z1MG 2ZDIC 3GB7C 3HKDA 1TA8A 2YC0A 3CCQV 2ZD9A 1BGYH 4G2KA 1RM1C 4DW0A 4J11A 4X89A 2KB1A 2EIJC 4DV2O 2ITCC 1NTMH 4FLYA 4YJ3B 4MVOA 1AP6A 1ZAUA 1WN7A 5KMGA 4JI8B 1UPGA 4ZHQB 5DM6V 3C90A 1B06A 2EJ7A 4E2LA 4JI2B 3F7YC 1HNWB 3JCUZ 4ZIBA 2QWNB 4DXWA 1K33A 4X1YB 5L3BA 3KG2A 5B1BB 1BQ0A 3E8GA 1US6A 2R9IA 2JEXA 1KP3A 1IBLB 1P4RA 1XNRB 4TOIA 2EIMC 5EC2C 4IIJB 3SR2C 2Y4UA 3CEIA 2CH7A 2CTQA 1QR9A 1CPYA 1H2LA 4Z2WA 3JATB 3P32A 5J2UB 1IBMO 3LNMB 1WP8A 5BY1A 2P22C 1VQLV 3CRAA 4ZI7B 3L74H 5EYPA 2YICA 2R70A 3ZN1A 1AJQA 1WB8A 1FS0G 1VQOV 2P90A 2Y69B 5AG2A 5IT9N 4J7KA 1XBLA 5F2VO 4R7CA 3ZRVA 1M1KW 4RUFA 4WFEA 5LHIA 1NH2D 2RCVA 1YHQV 3RYCB 2UXDB 2UXBO 3BEHA 4PA7A 2QDOA 1NR1A 1XQ8A 1W2BU 4LF6O 2CUGA 3E35A 1VARA 2HJDA 2CH7B 1GN2A 1KQSU 1XILA 2EINC 1YXBA 3CYOA 4WCEV 1JFFB 4XDLA 2HR3A 2WA4A 5CMUA 2B1IA 1NVPB 3E86A 2WAMA 4X1YA 4XBFA 1I0HA 4BAYA 4J42A 2PYJA 2Q7HA 4K0KB 3FYEB 4H0LB 3JD4A 4XDJA 1YITV 2Q4PA 3CMAV 2W6JG 3LDEA 1Q86W 3H1HH 3OEHG 1RM1B 3ZCCA 1K4DC 2ZCEA 1NU1H 2F93B 3SPHA 2JEUA 3ZIAG 1JPXA 4K0KO 2XAGA 4JYYA 4CS3A 4FMTA 4O2BB 4LF9O 5ITZB 5J9PC 3TCUA 4CH5A 4UXNA 1VQKV 5CN0A 3E2EA 4I55A 4DV6O 2AHZA 3H1JH 2YUAA 1NT2B 3LSSA 3CD6V 1J5EB 2MK3A 2VQEO 1IXMA 2QR4A 4ZBMA 2JK5C 2IJIA 2EBOA 1KMIZ 1FFTB 4KHPB 3OD4A 3JD0A 3K58A 3TXQA 4LF7B 3G6BA 3MHHC 1X4TA 1MA1A 1K5QA 4BW9A 4MVZA 4LF5O 1D5NA 3H1IH 3AG3B 1BS3A 5IJ0A 1IBKB 1WP7A 3WB1A 3BA9A 4DR2O 4NXMB 1ORQC 2ATKC 5KA5A 2OCHA 2EZOA 4KHPO 4DV3O 4JI4O 2ZIMA 1AJNA 1EFRG 1O9GA 1P84F 5IY5B 1MSWD 1OCCC 4GX2A 2F4VB 3TXSA 4I50B 1H2KA 1GM7A 3OMAB 1HNXO 1V54B 4DO2A 2WWWA 5H5NA 5FLXN 1Q6HA 1H2SB 3MDSA 2GV9A 5HFMA 2CDYA 5E1AC 3HKEA 3JSLA 5IJ9B 2EINB 5H9CA 2EIKB 4L87A 4LH7A 1Y6XA 3ZMTA 1OCRB 3JD2A 4PDVA 2OTLV 4PA6A 4FLVA 3ABKB 2Q69A 1H2GA 4I55B 2HKOA 2KG7B 1N4CA 4CC6A 4X1IA 4DR5O 1YDXA 1RFYA 3CCJV 3CP1A 4UB6Z 3LNNA 4LNUB 5FPRA 3ETEA 3JASA 3CX5F 3SYQA 1XOUA 3CXCU 4H13B 2E75B 4H37A 2JRIA 3GVMA 5KHGA 1FXVA 2FB5A 4I9WA 1JX9A 1ZTEA 3PJSK 1S5HC 1BMFG 3B4SA 2CTPA 4DV2B 3OUFA 4JYBA 4DV1B 4HNAA 4HNAB 2LP7A 3THOA 1VQ8V 3E22A 5L3FA 1JR9A 4J7JA 4LF9B 2NR5A 3RWRD 1XUQA 1XMQB 1COWG 2WLKA 4UVCA 3R65A 1RSOA 3CWBH 1HNZB 1GMGA 4WFFA 3Q4HA 2QA4V 1MABG 4TT3G 4B3MO 3B8NA 2ADPA 1WJZA 2FTKA 2PUSA 4WBNA 4WBNB 5KX5A 3OGCC 3ASNB 4CZZA 3E8HA 1AILA 2AHYA 3IJ4A 2H94A 3N2GA 4JV5O 4JYAB 4GZRB 2V1DA 4FLZA 4I4TA 1GO3F 4JI0O 3P30A 1IBMB 1WB7A 3RN4A 3G6EV 1XEQA 4XDKA 4X9QA 3KCYA 3X2QC 3SJAC 3HKBB 4O4LB 3WU2Z 2F4VO 2WLHA 2BTQB 1XDCA 3D8CA 3OR7C 2F1MA 2HLDG 3CCVV 1OCZB 2YDEA 2L6LA 4FZ0A 4JI8O 2EZPA 1FJGO 5JWPA 1DLBA 1VF5B 2PF4E 2MW2B 4IIJA 1VQPV 4QE7A 2QM8A 5LMUB 4U3FH 4GYCB 4CS4A 4LNUA 3DC6A 4X65O 1GH6A 3M8AA 1S0VA 3K03A 2IU0A 4X1IB 5KX5B 2UUAB 1N33B 3FB6C 4DV4O 5TISZ 1XL6A 3UQ8A 1SQXH 4MVMA 3J80N 4JI3B 4NR1A 2HHHB 1NZ6A 4KP4A 3CRCA 3ZHVA 4YY3O 3B2EE 2QTSA 1VF6C 5B3SC 4BIUA 2WA3A 4BR6A 3W7WA 2DYSC 3OW2U 3CRMA 1BQZA 1QBZA 1QHTA 3SPGA 3DXRB 4X1KA 2E74B 2DYSB 1D5AA 3UO2A 3ZHQA 5E79Z 4IGGA 1OCOC 4DV0B 4B3RO 2XAJA 4O4JB 4LFBB 1TUEB 4H44B 1TUBB 4HAMA 2ZKOA 1YF2A 1NTZH 2ZINA 2UXXA 4L8JA 1N34B 3T1YO 3ZX6A 4GT1A 4PA3A 3APOA 5C8YA 3ZHUA 1S5LZ 3KCXA 4E4EA 2JJ2G 2GTSA 2VWKA 3LDCA 4RQEA 2B9ZA 4DR5B 1PP9H 5CBGA 1Q8IA 3CXHF 4LFBO 3JAWB 4TUYB 4X66O 3ZMVA 4RQFA 3CC2V 3CCMV 1GN4A 2EILB 1WNSA 1S72V 3A0BZ 2F43G 1I94O 4X1KB 4PDMA 4U7NA 4UCVA 2D3OW 3RYCA 3K0GA 3C3TA 1P7GA 3U10A 2ODMA 4DR1O 3ABLC 3AG4B 3W7XA 5FNVA 3RW0A 1U97A 1BT8A 4UV9A 3ASOC 2A79B 1GN3A 3B09A 1X59A 3ZEDA 2P5OA 3IC9A 2UU9B 5EIBD 1AVMA 3IGAC 5EK0A 3JAMN 5LMNB 1R6NA 1SETA 2ZIOA 1IZ3A 2F66C 1VMGA 2OYQA 1R6KA 1Y4MA 5KHJA 4B3SB 4HBNA 1JJOA 4Q6GA 2R72A 4JV5B 1N32O 4IHJA 2PI4A 1QR8A 2GSMB 3B8MA 5JVDB 1Y76A 4JYAO 5JH7B 5KHIA 4J80A 5K1PA 1NI8A 2E5LO 1M5IA 1KU9A 2Y0IA 2KKWA 2P7TC 4DRXA 3LSUA 1N0JA 1OV9A 3OEEG 5BR8B 1HNWO 2P67A 5GONB 3B40A 4NYKA 1SQFA 5CA0B 4FLWA 1S3JA 4HYOA 1EZJA 2UXDO 2YXHA 2ZE8A 4JAAA 2FMLA 4WFHA 1F7YA 4X20B 2GHYA 3FAVA 3HKDB 3CRRA 1PD3A 1S5JA 5B1AB 2QWRB 5IDJA 1IVSA 2UUAO 1O9HA 4PV1B 1W0JG 1AR5A 1UJWB 2ZQMA 4J7ZA 1K73W 3CSXA 1G8MA 4K3AA 3VQWA 2UXCO 4ASUG 2ZDIA 2O57A 1K9MW 5B3SB 1F23A 3A8TA 3RYIB 3K59A 1SQPH 4JI5O 4TUYA 3JAWA 1TGOA 1PL4A 1TVKB 1EBOA 4I0XB 1JVMA 1YSCA 2EX3A 3ML0A 2B1GA 3H1KH 1PM9A 3X2QB 4KXRA 4ZHQA 2QGNA 3AG4C 4MW3A 1Q7YW 5K1XA 2EIMB 2DQ3A 4I9QA 4DR4O 1GKFA 1MZEA 3FAVB 2UXCB 3ASOB 2DMXA 1DTOA 2BOBC 3HKEB 5IJ9A 3E83A 2E3CA 2A7WA 1JJ2U 4R50A 2CAZC 2LO1A 2L35A 2NN4A 3E89A 1EM1A 3M7MX 4CH3A 2WSSG 1XMOO 2CK3G 3K04A 3M99B 5JJEB 4H33A 3HPLC 5EC1C 4LF4O 1PNKA 2VQFB 4NXMO 2JDIG 1HNXB 1AB3A 4OX9B 3KKYA 4RUEA 5BMVA 5KAIZ 4JI4B 1CXZB 2ZR3A 3CRQA 1VF6A 3L73H 2YEVA 4MVSA 5H6QA 1BSMA 4GKKO 5CB4A 3D3IA 4F6RA 3L70H 2P06A 4PI0A 1H2NA 1M56C 1K34A 2ILMA 2XOKG 2WPDG 1ZUQA 2EIKC 2C2AA 1AI4A 3WG7C 4DV6B 4NKGB 5IYCO 4CC5A 4LF8B 4FPPA 2IJKA 1W59A 1L1FA 3SPIA 2F95B 1H8EG 3SYCA 2F23A 2A06H 1SF9A 2DE0X 3QTCA 5D5PA 4RWUA 5H2FZ 1R3JC 2UXBB 2E76B 1G1XB 1VQMV 2JGUA 3JALB 2M7WA 1XL4A 4LF5B 2M6YA 3MAQA 1Q82W 5CA3A 2AGAA 3IAYA 4QIWF 3P3NA 3FYIB 4O4HB 2CTWA 3QO7A 2XHBA 3HR0A 1I5XA 1GAXA 4FJCC 4W4KA 4DUYB 1PL0A 4FFKA 2ZXWB 3ETGA 4JF3A 4FM0A 2Z5UA 5IWAO 4JYCA 4O2BA 1OCCB 1NVPD 4DRXB 3JSNA 5LP6C 1OCZC 3ZS8C 4EFEA 4AILC 1YJWV 4PI2A 1TVKA 4DK0A 3G4SV 4X66B 1XREA 1GM8A 1L0NH 4UUJC 1F4NA 1TUBA 4X64O 1N33O 2BOCC 4WFBV 4FFBA 4GX1A 4X88A 3SGIA 1IXBA 2LFSA 1NTKH 4O4IA 2R9AA 3AG1B 1AR1B 1NS1A 1EN4A 4OXSA 4DK1A 4TQFA 1Z5VA 3FD9A 4C7UA 2HJFC 1XHZA 2PZSA 2QSAA 4AQYB 2VRZA 4UCTA 2N74A 3E8BA 1AROP 1K3EA 1R3IC 1K92A 2XNDG 1B3QA 1VQ9V 4JI1B 1ENVA 1VQ4V 3G71V 1KECA 3SPJA 5JJJB 3SJBC 3SYAA 3WB2A 5LXTA 4TQDA 1URFA 5A9GA 1V54C 4ZOLB 1ZSPA 3QO5A 5GTIZ 1WA8A 4NVPA 1IBLO 3G80A 1SQVH 2HVKC 1HWYA 1YVWA 4CBCA 5KUKA 2QWPB 2Q8VA 4YY3B 4MW8A 4J41A 4LBEC 3BHPA 1G4YB 3E8FA 1VQ6V 2DJVA 3N2KA 1MOFA 5C8YB 4UCUA 2QJ1A 2DYRB 4N21A 1LUVA 4DUZO 4D7SA 5HFLA 1ZLZA 1N36O 4J9YB 3AK1A 3BABA 2X6CA 4DR7O 2N04A 2UUCB 4EEQA 1KKCA 2QKAA 4JTAB 3CJHA 4DV0O 3ZRWA 5IJ0B 4B7KA 3RYFB 5IYZA 1PPJH 1E1QG 2ZXWC 3JARB 5J2TB 2QEXV 4TV8B 1DF5A 2Q0OC 5EZYA 1SQGA 3JAKA 4O2AA 4FLTA 3GWKC 2XAQA 5KMGB 5JQGB 4JI6B 3OTOO 2PI5A 4JI2O 1N36B 3TJTA 4QPJA 1M56B 2HP8A 2DWDC 1B6QA 3LSQA 3FB5C 1JQ0A 1H38A 2YI9A 2ZT9B 3WG7B 1S76D 4GKJO 4O2AB 1NJIW 5LL6Y 1I7FA 1YI2V 3GWOA 4YJ2B 1HR0O 4UB8Z 3K57A 2AW9A 2HEPA 4UFZA 1XMOB 4ABMA 2JGDB 4DV1O 3FX7A 3U11A 4O4IB 4I5SA 1DF4A 2JJ1G 4CH6A 1RP3B 3TETA 5LBQA 2ZE5A 4GUNA 2DWEC 4JI7O 3AG3C 1QNMA 2ZNIA 3OMNB 1FXHA 5KLVH 3OGIB 1L0LH 1E79G 3A2FA 2Q7EA 1AI6A 3J7AU 3UM7A 2H8PC 1YIJV 5A2QN 3H01A 2IH3C 4TSFG 3DGEA 3K79A 3CC4V 4U7OA 3T4ZA 5KUMA 3OR6C 2X6BA 2LGQA 4RO2A 1FJGB 1WA8B 5B1BC 3ZRXA 3VQYA 4NTYA 3OTFA 2WLLB 5CA1B 1SC5B 5L3GA 1WLEA 1Q43A 4UCRA 1LR1A 1XI1A 3K0DA 3O9OA 3CPWU 3EVKA 3P3PA 1ZWIC 3WB0A 1H8HG 4GX5A 3DTUB 5LA6A 2CTRA 2GDSA 1XHXA 3L9DA 4DR6B 4TWKA 5IWAB 3RFRA 2QKSA 2Q5ZA 3HB3B 1NQTA 3JYCA 2ADQB 2LGWA 2BTQA 3G67A 4MT8A 1MG1A 4UVAA 1MSDA 3QVNA 3SPCA 5LP6A 2OTJV 3RYHB 2RNBA 5JCOA 5LOVA 2G38A 3K5OA 4DR6O 4KUMA 1JCHA 1I08A 1OCOB 3OTOB 1OHHG 4GCZA 2PY5A 1KD1W 4PHZA 1H2MA 2Y48A 1IBKO 1JA8A 3T2MA 2X7RB 1MMMA 5B1OA 3LDDA 4JI7B 2KG7A 1R1BA 4BIOA 2YS8A 4CS2A 3TK1A 3J81N 1PNMA 1U96A 4DUYO 2UUCO 3ETDA 1W0KG 2JS5A 3EFFK 4NXNB 5IE9A 4G28B 4LF4B 4TV9A 3CCSV 1SRYA 2DOSA 1Q5OA 2IU3A 3O65A 1AI5A 1Q90D 1IX9A 4J10A 4I50A 2YXYA 2HVJC 3HKCA 2EJRA 4DV7O 4LFAO 2DQ0A 4B3MB 3ZRSA 4X65B 4GLXA 3RVZA 3VOUA 2QWQB 4JGSA 3H9VA 2QWOB 3AG2B 2AZ0A 4IT5A 2RDCA 3D36A 4KFMA 4JTCB 1Q6UA 1TAEA 1FXKC 1SZXA 2CE4A 3T1CA 3BPZA 5BXZA 5KA6A 3JASB 4P9OA 1SKVA 3JD1A 2P4KA 3CCLV 3A0RA 3EHBB 3I5DA 4DV5B 1FXKB 1OZ0A 4FK5C 2KSDA 4F6RB 3I56V 3ABMC 3MD0A 4QPKA 1P49A 3ASNC 2YXLA 3F5TA 1V9PA 2UUBB 5EBWC 1DGSA 3L72H 2JS3A 4TV9B 2EILC 4UCSA 5H6RA 4O4HA 5BMVB 2VQEB 4EB6B 3SJCC 2GTAA 2WLMA 1XMQO 1LNQA 1Q81W 5LGNA 4LH6A 4JAUA 4BW5A 1N8RW 3K5MA 4DR3B 4JTDB 1YJ9V 1WAZA 3BA8A 2RN9A 5GONA 2UUBO 3MHSC 4LCUC 1K5SA 3ABLB 1T5EA 4D7TA 1M90W 4Q20A 4F6EA 1OCRC 1BHAA 4CH4A 1V55C 3ZHSA 3VQXA 4MVRA 2P4VA 4DV4B 2VWJA 4MTXA 4JZ2A 4NTWA 2CGNA 5L3CA 3OAAG 2XT9A 2VQFO 3RT3C 4A5UB 3UO3A 1S77D 2BCCH 4K8ZA 2BSKA 3SYOA 1SS3A 3C3SA 3RYIA 1PNLA 3T4DA 1HDJA 1SESA 3BY6A 4PA4A 3ZBHA 4JZGA 4GX0A 4FM2A 4JI1O 2Q6AA 3STZC 4JI5B 1Y67A 2CGOA 3ZMZA 4NB5A 5FNVB 3W7SA 4N23A 3HKCB 5ITZA 3WFVA 5IY5C 1ZX3A 4UVBA 2QM7A 3ZMSA 4WFGA 2VS0A 4B3RB 4IYIA 2IBZH 4NTXA 1K97A 4EB6A 2W6IG 3OE7G 1GM9A 2PYLA 2YIDA 4PD4F 1JOYA 2LJ2A 2Y0PA 3CHXA 2EULA 5JQGA 1KKDA 4WF9V 3U0ZA 5DN6G 1AP5A 3IFXA 3VQVA 1YTFB 4ZI7A 3DSQA 4YHHB 2BTOA 3ABMB 1N34O 4FLXA 4UCOA 4LWSB 2NNUA 5JVDA 3RYFA 1G6UA 2HFEC 3CCUV 1I94B 2IH1C 3QO8A 1ROPA 3BCCH 1B04A 2JVDA 3BFRA 1Z2GA 4IHJB 1ZL8A 2ZR2A 1FFXB 1LUWA 4LR3A 2UU9O 5IYDO 3RBZA 4DR1B 3RGBA 4FM1A 3RYHA 4AHCA 3ICXA 2QTOA 2GUZB 5JCOC 4FVMA 4IYHA 3FKSG 3AG2C 2YIBA 3ABUA 2FYUH 3OM3B 2RJZA 4YJ3A 3CC7V 1CP9A 1V55B 2P6JA 5GW7A 5CA0A 1MZFA 2KQXA 1N0NA 4ZOLA 4G27B 5FPOA 2N05A 4B7EA 2LW1A 3JAKB 2K1EA 2WLIA 4P9PA 2RQ6A 3ZMUA 1FXKA 4BWAA 1QLNA 1NBMG 1JMKC 3AG1C 2Q9LA 3JATA 4WFAV 2OCCB 3K5NA 2PTMA 1ZL8B 1F4MA 3CCEV 2X0LA 3RVYA 2LFRA 1Q6IA 3W7TA 3BAAA 2Y69C 4JPRA 1WPXA 3SYPA 3AG7A 1PV0A 1FAFA 4ICGA 2LQTA 2R9RB 4X8AA 4MVQA 4W4LA 2XAFA 1YCIA 1GRJA 3CCRV 2GUZA 4O4LA 3HKBA 2XAHA 2FKXA 3ZHRA 2OWOA 1UFIA 4JI0B 4QNHB 4MVUA 3K5LA 5B1NA 2OIEA 4EKWA 2HHHO 1QLEC 4FFBB 5D5QA 4GKJB 3D36C 4BIZA 1IURA 1QVFU 2OCCC 1THZA 2Z0AA 1I5YA 2DW4A 3N2GB 4PELA 2A0LA 1P7BA 1FPOA 2Q68A 1EN5A 2ITDC 2AXTZ 4B3TO 3I55V 5KHHA 1YTFD 1XNQO 3T1YB 4AI8A 4LF8O 1SA0A 2IJHA 3UT5A 1NR7A 5LHGA 1N32B 4EFBA 4P30A 1GTOA 5LGTA 1XNRO 4B3SO 1RSOB 5EIBC 2A9HA 3W7UA 5CBHA 4DV5O 2W0XA 5LOVB 3JARA 4B08A 5J2TA 1R3LC 2Q7GA 4PA9A 1VQ7V 1MNGA 1SQQH 2ZM6O 3OFNG 2D2CB 3S3WA 1QQCA 2QM4A 1VP7A 3A0HZ 3KZIZ 3K9SA 2XASA 4MTGA 4O4JA 5GTHZ 1KP2A 1NH2B 1K8AW 1Y74B 4J9ZB 3DXRA 5KHKA 2GBOA 2Z3YA 4GKKB 3F5WC 1GN6A 1L8DA 2Q0AA 3PN1A 1KB9F 3R66A 4U3JA 4YIPA 1K4CC 3L75H 1NKDA 1WPBA 4K8XA 3CE2A 3ZHTA 2OIGA 4OPHA 2WLLA 5EBMC 5CA1A 3DC5A 4Z1VA 5LMUO 4YHHO 2YEVB 1R3KC 3AK3A 3NR7A 5LHHA 1QCEA 1GK9A 1FKAO 4DR7B 5BR8O 1SA0B 5LYJA 3UT5B 1SERA 5B5EZ 5EZYB 3K3WA 1CEZA 4AQYO 4LC1A 1DK1A 1FD9A 3AK2A 5DECA 5IYZB 3QNEA 3FB7C 3ETQA 3CJHB 4MS2A 2RMKB 5BZBA 4DR3O 3Q4HB 1K7DA 1R6TA 4R8CA 2QE7G 1XNQB 4PDLA 5C93A 2Q67A 4LP8A 1VQNV 3FB8C 3F7VC 2EIJB 3OT7A 5B1AC 1FFXA 2K9PA 3K06A 4OPAA 1D2DA 1M93A 4I4TB 3T1HO 2OT5A 3ZN0A 4OX9O 2NLJC 2ZM6B 1SZTA 1M9NA 2IW5A 2ZE6A 3CS5A 4JI6O 4DV3B 4LWSA 1YEWA 1FYJA 2V7QG 4DV7B 4LFAB 5FL7G 4NXNO 4YXWG 1AI7A 4YIOA 1HNZO 3UCSC 4TV8A 1M4UA 4KL1A 4D6TH 3ZJZA 4HZ3A 2UXNA 4DR2B 4DW1A 5LMNO 1J95A 1KC8W 2YIAA 1M57B 1QLEB 2ZNJA 3ZRWB 4X20A 4FIPC 4FZ1A 3D3QA 2Y4TA 4DYLA 5L3EA 4X64B 1QVGU 3B77A 3CMEV 1E1RG 5DEDA 4QGPA 3E22B 1KBHA 4U3JB 4B3TB 4OGQB 4LFCB 2HG5C 2W0FC 5EYPB 2QKCA 1BL8A 3N2KB 3FFQA 4FLUA 2JIZG 2XTAA 4I0XA 3S3XA 5JH7A 3QG5A 3L71H 5IYBO 2DN9A 1Y74A 1HW7A
chains in the Genus database with same CATH topology
2YXHA 2Q5ZA 2A7WA 1VMGA 4QGPA 3CRAA 2GTAA 3CRCA 2A3QA 1YVWA 2Q9LA 1Y6XA 2OIEA 2OIGA 2Q73A 2Q4PA 5IE9A 1YXBA 3C90A 2P06A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YXH A;  2Q5Z A;  2A7W A;  1VMG A;  4QGP A;  3CRA A;  2GTA A;  3CRC A;  2A3Q A;  1YVW A;  2Q9L A;  1Y6X A;  2OIE A;  2OIG A;  2Q73 A;  2Q4P A;  5IE9 A;  1YXB A;  3C90 A;  2P06 A; 
#chains in the Genus database with same CATH topology
 2YIB D;  3EXA A;  5LA6 B;  2DYR C;  2BSK B;  1HR0 B;  1Q3E A;  3STL C;  1KUQ A;  4X62 O;  4UV8 A;  4MTF A;  1M57 C;  4PJ0 Z;  4IL6 Z;  5KAF Z;  5LXT B;  5LP6 B;  1Y66 A;  2ARH A;  1BHB A;  4JAV A;  3SDL A;  2YI8 A;  2XUM A;  1OJH A;  5LYJ B;  2WLJ A;  3OUS A;  1F51 A;  3VBB A;  4MTO A;  5L3D A;  2E5L B;  1IDS A;  3BRC A;  4LF6 B;  3IC7 A;  3QF7 A;  4X62 B;  2H3O A;  4P2Z A;  3K08 A;  2IM9 A;  1Z5W A;  4ZKI A;  1PKX A;  3ABT A;  1AJP A;  1YJN V;  3JD3 A;  4QE9 A;  4RAI A;  4R6Z A;  2PGG A;  4PDR A;  2YSU B;  4MSW C;  1VIB A;  3SJQ C;  1BCC H;  2IJJ A;  5J2U A;  1HP8 A;  3JCZ A;  5CBF A;  1Y76 B;  4LF7 O;  1KYO F;  2ETN A;  4JAS A;  3BVO A;  1BZK A;  4DR4 B;  1QU7 A;  3AEI A;  2X6A A;  3N27 A;  1J5E O;  1EZV H;  3T1H B;  3OMI B;  3LUT B;  2JGD A;  3APQ A;  1BE3 H;  5JJN B;  2A3Q A;  1RPO A;  2V4D A;  2WLN A;  1VQ5 V;  1YZB A;  2ZE7 A;  3TGU H;  5CB4 B;  3H1L H;  5LGU A;  4JI3 O;  5EBL C;  2AZ2 A;  1JFF A;  1SQB H;  4QJF B;  3ABK C;  4F4L A;  3NXS A;  2FL4 A;  4DUZ B;  4I7Z B;  1VF7 A;  1EN6 A;  2B5U A;  3CB2 A;  2BE3 A;  4K35 A;  3UKM A;  3K9A A;  5B66 Z;  1R73 A;  1RPR A;  2Q73 A;  2WLI B;  3JAL A;  4LFC O;  4YJ2 A;  1A32 A;  1AR4 A;  2LW7 A;  1VEW A;  4Z1M G;  2ZDI C;  3GB7 C;  3HKD A;  1TA8 A;  2YC0 A;  3CCQ V;  2ZD9 A;  1BGY H;  4G2K A;  1RM1 C;  4DW0 A;  4J11 A;  4X89 A;  2KB1 A;  2EIJ C;  4DV2 O;  2ITC C;  1NTM H;  4FLY A;  4YJ3 B;  4MVO A;  1AP6 A;  1ZAU A;  1WN7 A;  5KMG A;  4JI8 B;  1UPG A;  4ZHQ B;  5DM6 V;  3C90 A;  1B06 A;  2EJ7 A;  4E2L A;  4JI2 B;  3F7Y C;  1HNW B;  3JCU Z;  4ZIB A;  2QWN B;  4DXW A;  1K33 A;  4X1Y B;  5L3B A;  3KG2 A;  5B1B B;  1BQ0 A;  3E8G A;  1US6 A;  2R9I A;  2JEX A;  1KP3 A;  1IBL B;  1P4R A;  1XNR B;  4TOI A;  2EIM C;  5EC2 C;  4IIJ B;  3SR2 C;  2Y4U A;  3CEI A;  2CH7 A;  2CTQ A;  1QR9 A;  1CPY A;  1H2L A;  4Z2W A;  3JAT B;  3P32 A;  5J2U B;  1IBM O;  3LNM B;  1WP8 A;  5BY1 A;  2P22 C;  1VQL V;  3CRA A;  4ZI7 B;  3L74 H;  5EYP A;  2YIC A;  2R70 A;  3ZN1 A;  1AJQ A;  1WB8 A;  1FS0 G;  1VQO V;  2P90 A;  2Y69 B;  5AG2 A;  5IT9 N;  4J7K A;  1XBL A;  5F2V O;  4R7C A;  3ZRV A;  1M1K W;  4RUF A;  4WFE A;  5LHI A;  1NH2 D;  2RCV A;  1YHQ V;  3RYC B;  2UXD B;  2UXB O;  3BEH A;  4PA7 A;  2QDO A;  1NR1 A;  1XQ8 A;  1W2B U;  4LF6 O;  2CUG A;  3E35 A;  1VAR A;  2HJD A;  2CH7 B;  1GN2 A;  1KQS U;  1XIL A;  2EIN C;  1YXB A;  3CYO A;  4WCE V;  1JFF B;  4XDL A;  2HR3 A;  2WA4 A;  5CMU A;  2B1I A;  1NVP B;  3E86 A;  2WAM A;  4X1Y A;  4XBF A;  1I0H A;  4BAY A;  4J42 A;  2PYJ A;  2Q7H A;  4K0K B;  3FYE B;  4H0L B;  3JD4 A;  4XDJ A;  1YIT V;  2Q4P A;  3CMA V;  2W6J G;  3LDE A;  1Q86 W;  3H1H H;  3OEH G;  1RM1 B;  3ZCC A;  1K4D C;  2ZCE A;  1NU1 H;  2F93 B;  3SPH A;  2JEU A;  3ZIA G;  1JPX A;  4K0K O;  2XAG A;  4JYY A;  4CS3 A;  4FMT A;  4O2B B;  4LF9 O;  5ITZ B;  5J9P C;  3TCU A;  4CH5 A;  4UXN A;  1VQK V;  5CN0 A;  3E2E A;  4I55 A;  4DV6 O;  2AHZ A;  3H1J H;  2YUA A;  1NT2 B;  3LSS A;  3CD6 V;  1J5E B;  2MK3 A;  2VQE O;  1IXM A;  2QR4 A;  4ZBM A;  2JK5 C;  2IJI A;  2EBO A;  1KMI Z;  1FFT B;  4KHP B;  3OD4 A;  3JD0 A;  3K58 A;  3TXQ A;  4LF7 B;  3G6B A;  3MHH C;  1X4T A;  1MA1 A;  1K5Q A;  4BW9 A;  4MVZ A;  4LF5 O;  1D5N A;  3H1I H;  3AG3 B;  1BS3 A;  5IJ0 A;  1IBK B;  1WP7 A;  3WB1 A;  3BA9 A;  4DR2 O;  4NXM B;  1ORQ C;  2ATK C;  5KA5 A;  2OCH A;  2EZO A;  4KHP O;  4DV3 O;  4JI4 O;  2ZIM A;  1AJN A;  1EFR G;  1O9G A;  1P84 F;  5IY5 B;  1MSW D;  1OCC C;  4GX2 A;  2F4V B;  3TXS A;  4I50 B;  1H2K A;  1GM7 A;  3OMA B;  1HNX O;  1V54 B;  4DO2 A;  2WWW A;  5H5N A;  5FLX N;  1Q6H A;  1H2S B;  3MDS A;  2GV9 A;  5HFM A;  2CDY A;  5E1A C;  3HKE A;  3JSL A;  5IJ9 B;  2EIN B;  5H9C A;  2EIK B;  4L87 A;  4LH7 A;  1Y6X A;  3ZMT A;  1OCR B;  3JD2 A;  4PDV A;  2OTL V;  4PA6 A;  4FLV A;  3ABK B;  2Q69 A;  1H2G A;  4I55 B;  2HKO A;  2KG7 B;  1N4C A;  4CC6 A;  4X1I A;  4DR5 O;  1YDX A;  1RFY A;  3CCJ V;  3CP1 A;  4UB6 Z;  3LNN A;  4LNU B;  5FPR A;  3ETE A;  3JAS A;  3CX5 F;  3SYQ A;  1XOU A;  3CXC U;  4H13 B;  2E75 B;  4H37 A;  2JRI A;  3GVM A;  5KHG A;  1FXV A;  2FB5 A;  4I9W A;  1JX9 A;  1ZTE A;  3PJS K;  1S5H C;  1BMF G;  3B4S A;  2CTP A;  4DV2 B;  3OUF A;  4JYB A;  4DV1 B;  4HNA A;  4HNA B;  2LP7 A;  3THO A;  1VQ8 V;  3E22 A;  5L3F A;  1JR9 A;  4J7J A;  4LF9 B;  2NR5 A;  3RWR D;  1XUQ A;  1XMQ B;  1COW G;  2WLK A;  4UVC A;  3R65 A;  1RSO A;  3CWB H;  1HNZ B;  1GMG A;  4WFF A;  3Q4H A;  2QA4 V;  1MAB G;  4TT3 G;  4B3M O;  3B8N A;  2ADP A;  1WJZ A;  2FTK A;  2PUS A;  4WBN A;  4WBN B;  5KX5 A;  3OGC C;  3ASN B;  4CZZ A;  3E8H A;  1AIL A;  2AHY A;  3IJ4 A;  2H94 A;  3N2G A;  4JV5 O;  4JYA B;  4GZR B;  2V1D A;  4FLZ A;  4I4T A;  1GO3 F;  4JI0 O;  3P30 A;  1IBM B;  1WB7 A;  3RN4 A;  3G6E V;  1XEQ A;  4XDK A;  4X9Q A;  3KCY A;  3X2Q C;  3SJA C;  3HKB B;  4O4L B;  3WU2 Z;  2F4V O;  2WLH A;  2BTQ B;  1XDC A;  3D8C A;  3OR7 C;  2F1M A;  2HLD G;  3CCV V;  1OCZ B;  2YDE A;  2L6L A;  4FZ0 A;  4JI8 O;  2EZP A;  1FJG O;  5JWP A;  1DLB A;  1VF5 B;  2PF4 E;  2MW2 B;  4IIJ A;  1VQP V;  4QE7 A;  2QM8 A;  5LMU B;  4U3F H;  4GYC B;  4CS4 A;  4LNU A;  3DC6 A;  4X65 O;  1GH6 A;  3M8A A;  1S0V A;  3K03 A;  2IU0 A;  4X1I B;  5KX5 B;  2UUA B;  1N33 B;  3FB6 C;  4DV4 O;  5TIS Z;  1XL6 A;  3UQ8 A;  1SQX H;  4MVM A;  3J80 N;  4JI3 B;  4NR1 A;  2HHH B;  1NZ6 A;  4KP4 A;  3CRC A;  3ZHV A;  4YY3 O;  3B2E E;  2QTS A;  1VF6 C;  5B3S C;  4BIU A;  2WA3 A;  4BR6 A;  3W7W A;  2DYS C;  3OW2 U;  3CRM A;  1BQZ A;  1QBZ A;  1QHT A;  3SPG A;  3DXR B;  4X1K A;  2E74 B;  2DYS B;  1D5A A;  3UO2 A;  3ZHQ A;  5E79 Z;  4IGG A;  1OCO C;  4DV0 B;  4B3R O;  2XAJ A;  4O4J B;  4LFB B;  1TUE B;  4H44 B;  1TUB B;  4HAM A;  2ZKO A;  1YF2 A;  1NTZ H;  2ZIN A;  2UXX A;  4L8J A;  1N34 B;  3T1Y O;  3ZX6 A;  4GT1 A;  4PA3 A;  3APO A;  5C8Y A;  3ZHU A;  1S5L Z;  3KCX A;  4E4E A;  2JJ2 G;  2GTS A;  2VWK A;  3LDC A;  4RQE A;  2B9Z A;  4DR5 B;  1PP9 H;  5CBG A;  1Q8I A;  3CXH F;  4LFB O;  3JAW B;  4TUY B;  4X66 O;  3ZMV A;  4RQF A;  3CC2 V;  3CCM V;  1GN4 A;  2EIL B;  1WNS A;  1S72 V;  3A0B Z;  2F43 G;  1I94 O;  4X1K B;  4PDM A;  4U7N A;  4UCV A;  2D3O W;  3RYC A;  3K0G A;  3C3T A;  1P7G A;  3U10 A;  2ODM A;  4DR1 O;  3ABL C;  3AG4 B;  3W7X A;  5FNV A;  3RW0 A;  1U97 A;  1BT8 A;  4UV9 A;  3ASO C;  2A79 B;  1GN3 A;  3B09 A;  1X59 A;  3ZED A;  2P5O A;  3IC9 A;  2UU9 B;  5EIB D;  1AVM A;  3IGA C;  5EK0 A;  3JAM N;  5LMN B;  1R6N A;  1SET A;  2ZIO A;  1IZ3 A;  2F66 C;  1VMG A;  2OYQ A;  1R6K A;  1Y4M A;  5KHJ A;  4B3S B;  4HBN A;  1JJO A;  4Q6G A;  2R72 A;  4JV5 B;  1N32 O;  4IHJ A;  2PI4 A;  1QR8 A;  2GSM B;  3B8M A;  5JVD B;  1Y76 A;  4JYA O;  5JH7 B;  5KHI A;  4J80 A;  5K1P A;  1NI8 A;  2E5L O;  1M5I A;  1KU9 A;  2Y0I A;  2KKW A;  2P7T C;  4DRX A;  3LSU A;  1N0J A;  1OV9 A;  3OEE G;  5BR8 B;  1HNW O;  2P67 A;  5GON B;  3B40 A;  4NYK A;  1SQF A;  5CA0 B;  4FLW A;  1S3J A;  4HYO A;  1EZJ A;  2UXD O;  2YXH A;  2ZE8 A;  4JAA A;  2FML A;  4WFH A;  1F7Y A;  4X20 B;  2GHY A;  3FAV A;  3HKD B;  3CRR A;  1PD3 A;  1S5J A;  5B1A B;  2QWR B;  5IDJ A;  1IVS A;  2UUA O;  1O9H A;  4PV1 B;  1W0J G;  1AR5 A;  1UJW B;  2ZQM A;  4J7Z A;  1K73 W;  3CSX A;  1G8M A;  4K3A A;  3VQW A;  2UXC O;  4ASU G;  2ZDI A;  2O57 A;  1K9M W;  5B3S B;  1F23 A;  3A8T A;  3RYI B;  3K59 A;  1SQP H;  4JI5 O;  4TUY A;  3JAW A;  1TGO A;  1PL4 A;  1TVK B;  1EBO A;  4I0X B;  1JVM A;  1YSC A;  2EX3 A;  3ML0 A;  2B1G A;  3H1K H;  1PM9 A;  3X2Q B;  4KXR A;  4ZHQ A;  2QGN A;  3AG4 C;  4MW3 A;  1Q7Y W;  5K1X A;  2EIM B;  2DQ3 A;  4I9Q A;  4DR4 O;  1GKF A;  1MZE A;  3FAV B;  2UXC B;  3ASO B;  2DMX A;  1DTO A;  2BOB C;  3HKE B;  5IJ9 A;  3E83 A;  2E3C A;  2A7W A;  1JJ2 U;  4R50 A;  2CAZ C;  2LO1 A;  2L35 A;  2NN4 A;  3E89 A;  1EM1 A;  3M7M X;  4CH3 A;  2WSS G;  1XMO O;  2CK3 G;  3K04 A;  3M99 B;  5JJE B;  4H33 A;  3HPL C;  5EC1 C;  4LF4 O;  1PNK A;  2VQF B;  4NXM O;  2JDI G;  1HNX B;  1AB3 A;  4OX9 B;  3KKY A;  4RUE A;  5BMV A;  5KAI Z;  4JI4 B;  1CXZ B;  2ZR3 A;  3CRQ A;  1VF6 A;  3L73 H;  2YEV A;  4MVS A;  5H6Q A;  1BSM A;  4GKK O;  5CB4 A;  3D3I A;  4F6R A;  3L70 H;  2P06 A;  4PI0 A;  1H2N A;  1M56 C;  1K34 A;  2ILM A;  2XOK G;  2WPD G;  1ZUQ A;  2EIK C;  2C2A A;  1AI4 A;  3WG7 C;  4DV6 B;  4NKG B;  5IYC O;  4CC5 A;  4LF8 B;  4FPP A;  2IJK A;  1W59 A;  1L1F A;  3SPI A;  2F95 B;  1H8E G;  3SYC A;  2F23 A;  2A06 H;  1SF9 A;  2DE0 X;  3QTC A;  5D5P A;  4RWU A;  5H2F Z;  1R3J C;  2UXB B;  2E76 B;  1G1X B;  1VQM V;  2JGU A;  3JAL B;  2M7W A;  1XL4 A;  4LF5 B;  2M6Y A;  3MAQ A;  1Q82 W;  5CA3 A;  2AGA A;  3IAY A;  4QIW F;  3P3N A;  3FYI B;  4O4H B;  2CTW A;  3QO7 A;  2XHB A;  3HR0 A;  1I5X A;  1GAX A;  4FJC C;  4W4K A;  4DUY B;  1PL0 A;  4FFK A;  2ZXW B;  3ETG A;  4JF3 A;  4FM0 A;  2Z5U A;  5IWA O;  4JYC A;  4O2B A;  1OCC B;  1NVP D;  4DRX B;  3JSN A;  5LP6 C;  1OCZ C;  3ZS8 C;  4EFE A;  4AIL C;  1YJW V;  4PI2 A;  1TVK A;  4DK0 A;  3G4S V;  4X66 B;  1XRE A;  1GM8 A;  1L0N H;  4UUJ C;  1F4N A;  1TUB A;  4X64 O;  1N33 O;  2BOC C;  4WFB V;  4FFB A;  4GX1 A;  4X88 A;  3SGI A;  1IXB A;  2LFS A;  1NTK H;  4O4I A;  2R9A A;  3AG1 B;  1AR1 B;  1NS1 A;  1EN4 A;  4OXS A;  4DK1 A;  4TQF A;  1Z5V A;  3FD9 A;  4C7U A;  2HJF C;  1XHZ A;  2PZS A;  2QSA A;  4AQY B;  2VRZ A;  4UCT A;  2N74 A;  3E8B A;  1ARO P;  1K3E A;  1R3I C;  1K92 A;  2XND G;  1B3Q A;  1VQ9 V;  4JI1 B;  1ENV A;  1VQ4 V;  3G71 V;  1KEC A;  3SPJ A;  5JJJ B;  3SJB C;  3SYA A;  3WB2 A;  5LXT A;  4TQD A;  1URF A;  5A9G A;  1V54 C;  4ZOL B;  1ZSP A;  3QO5 A;  5GTI Z;  1WA8 A;  4NVP A;  1IBL O;  3G80 A;  1SQV H;  2HVK C;  1HWY A;  1YVW A;  4CBC A;  5KUK A;  2QWP B;  2Q8V A;  4YY3 B;  4MW8 A;  4J41 A;  4LBE C;  3BHP A;  1G4Y B;  3E8F A;  1VQ6 V;  2DJV A;  3N2K A;  1MOF A;  5C8Y B;  4UCU A;  2QJ1 A;  2DYR B;  4N21 A;  1LUV A;  4DUZ O;  4D7S A;  5HFL A;  1ZLZ A;  1N36 O;  4J9Y B;  3AK1 A;  3BAB A;  2X6C A;  4DR7 O;  2N04 A;  2UUC B;  4EEQ A;  1KKC A;  2QKA A;  4JTA B;  3CJH A;  4DV0 O;  3ZRW A;  5IJ0 B;  4B7K A;  3RYF B;  5IYZ A;  1PPJ H;  1E1Q G;  2ZXW C;  3JAR B;  5J2T B;  2QEX V;  4TV8 B;  1DF5 A;  2Q0O C;  5EZY A;  1SQG A;  3JAK A;  4O2A A;  4FLT A;  3GWK C;  2XAQ A;  5KMG B;  5JQG B;  4JI6 B;  3OTO O;  2PI5 A;  4JI2 O;  1N36 B;  3TJT A;  4QPJ A;  1M56 B;  2HP8 A;  2DWD C;  1B6Q A;  3LSQ A;  3FB5 C;  1JQ0 A;  1H38 A;  2YI9 A;  2ZT9 B;  3WG7 B;  1S76 D;  4GKJ O;  4O2A B;  1NJI W;  5LL6 Y;  1I7F A;  1YI2 V;  3GWO A;  4YJ2 B;  1HR0 O;  4UB8 Z;  3K57 A;  2AW9 A;  2HEP A;  4UFZ A;  1XMO B;  4ABM A;  2JGD B;  4DV1 O;  3FX7 A;  3U11 A;  4O4I B;  4I5S A;  1DF4 A;  2JJ1 G;  4CH6 A;  1RP3 B;  3TET A;  5LBQ A;  2ZE5 A;  4GUN A;  2DWE C;  4JI7 O;  3AG3 C;  1QNM A;  2ZNI A;  3OMN B;  1FXH A;  5KLV H;  3OGI B;  1L0L H;  1E79 G;  3A2F A;  2Q7E A;  1AI6 A;  3J7A U;  3UM7 A;  2H8P C;  1YIJ V;  5A2Q N;  3H01 A;  2IH3 C;  4TSF G;  3DGE A;  3K79 A;  3CC4 V;  4U7O A;  3T4Z A;  5KUM A;  3OR6 C;  2X6B A;  2LGQ A;  4RO2 A;  1FJG B;  1WA8 B;  5B1B C;  3ZRX A;  3VQY A;  4NTY A;  3OTF A;  2WLL B;  5CA1 B;  1SC5 B;  5L3G A;  1WLE A;  1Q43 A;  4UCR A;  1LR1 A;  1XI1 A;  3K0D A;  3O9O A;  3CPW U;  3EVK A;  3P3P A;  1ZWI C;  3WB0 A;  1H8H G;  4GX5 A;  3DTU B;  5LA6 A;  2CTR A;  2GDS A;  1XHX A;  3L9D A;  4DR6 B;  4TWK A;  5IWA B;  3RFR A;  2QKS A;  2Q5Z A;  3HB3 B;  1NQT A;  3JYC A;  2ADQ B;  2LGW A;  2BTQ A;  3G67 A;  4MT8 A;  1MG1 A;  4UVA A;  1MSD A;  3QVN A;  3SPC A;  5LP6 A;  2OTJ V;  3RYH B;  2RNB A;  5JCO A;  5LOV A;  2G38 A;  3K5O A;  4DR6 O;  4KUM A;  1JCH A;  1I08 A;  1OCO B;  3OTO B;  1OHH G;  4GCZ A;  2PY5 A;  1KD1 W;  4PHZ A;  1H2M A;  2Y48 A;  1IBK O;  1JA8 A;  3T2M A;  2X7R B;  1MMM A;  5B1O A;  3LDD A;  4JI7 B;  2KG7 A;  1R1B A;  4BIO A;  2YS8 A;  4CS2 A;  3TK1 A;  3J81 N;  1PNM A;  1U96 A;  4DUY O;  2UUC O;  3ETD A;  1W0K G;  2JS5 A;  3EFF K;  4NXN B;  5IE9 A;  4G28 B;  4LF4 B;  4TV9 A;  3CCS V;  1SRY A;  2DOS A;  1Q5O A;  2IU3 A;  3O65 A;  1AI5 A;  1Q90 D;  1IX9 A;  4J10 A;  4I50 A;  2YXY A;  2HVJ C;  3HKC A;  2EJR A;  4DV7 O;  4LFA O;  2DQ0 A;  4B3M B;  3ZRS A;  4X65 B;  4GLX A;  3RVZ A;  3VOU A;  2QWQ B;  4JGS A;  3H9V A;  2QWO B;  3AG2 B;  2AZ0 A;  4IT5 A;  2RDC A;  3D36 A;  4KFM A;  4JTC B;  1Q6U A;  1TAE A;  1FXK C;  1SZX A;  2CE4 A;  3T1C A;  3BPZ A;  5BXZ A;  5KA6 A;  3JAS B;  4P9O A;  1SKV A;  3JD1 A;  2P4K A;  3CCL V;  3A0R A;  3EHB B;  3I5D A;  4DV5 B;  1FXK B;  1OZ0 A;  4FK5 C;  2KSD A;  4F6R B;  3I56 V;  3ABM C;  3MD0 A;  4QPK A;  1P49 A;  3ASN C;  2YXL A;  3F5T A;  1V9P A;  2UUB B;  5EBW C;  1DGS A;  3L72 H;  2JS3 A;  4TV9 B;  2EIL C;  4UCS A;  5H6R A;  4O4H A;  5BMV B;  2VQE B;  4EB6 B;  3SJC C;  2GTA A;  2WLM A;  1XMQ O;  1LNQ A;  1Q81 W;  5LGN A;  4LH6 A;  4JAU A;  4BW5 A;  1N8R W;  3K5M A;  4DR3 B;  4JTD B;  1YJ9 V;  1WAZ A;  3BA8 A;  2RN9 A;  5GON A;  2UUB O;  3MHS C;  4LCU C;  1K5S A;  3ABL B;  1T5E A;  4D7T A;  1M90 W;  4Q20 A;  4F6E A;  1OCR C;  1BHA A;  4CH4 A;  1V55 C;  3ZHS A;  3VQX A;  4MVR A;  2P4V A;  4DV4 B;  2VWJ A;  4MTX A;  4JZ2 A;  4NTW A;  2CGN A;  5L3C A;  3OAA G;  2XT9 A;  2VQF O;  3RT3 C;  4A5U B;  3UO3 A;  1S77 D;  2BCC H;  4K8Z A;  2BSK A;  3SYO A;  1SS3 A;  3C3S A;  3RYI A;  1PNL A;  3T4D A;  1HDJ A;  1SES A;  3BY6 A;  4PA4 A;  3ZBH A;  4JZG A;  4GX0 A;  4FM2 A;  4JI1 O;  2Q6A A;  3STZ C;  4JI5 B;  1Y67 A;  2CGO A;  3ZMZ A;  4NB5 A;  5FNV B;  3W7S A;  4N23 A;  3HKC B;  5ITZ A;  3WFV A;  5IY5 C;  1ZX3 A;  4UVB A;  2QM7 A;  3ZMS A;  4WFG A;  2VS0 A;  4B3R B;  4IYI A;  2IBZ H;  4NTX A;  1K97 A;  4EB6 A;  2W6I G;  3OE7 G;  1GM9 A;  2PYL A;  2YID A;  4PD4 F;  1JOY A;  2LJ2 A;  2Y0P A;  3CHX A;  2EUL A;  5JQG A;  1KKD A;  4WF9 V;  3U0Z A;  5DN6 G;  1AP5 A;  3IFX A;  3VQV A;  1YTF B;  4ZI7 A;  3DSQ A;  4YHH B;  2BTO A;  3ABM B;  1N34 O;  4FLX A;  4UCO A;  4LWS B;  2NNU A;  5JVD A;  3RYF A;  1G6U A;  2HFE C;  3CCU V;  1I94 B;  2IH1 C;  3QO8 A;  1ROP A;  3BCC H;  1B04 A;  2JVD A;  3BFR A;  1Z2G A;  4IHJ B;  1ZL8 A;  2ZR2 A;  1FFX B;  1LUW A;  4LR3 A;  2UU9 O;  5IYD O;  3RBZ A;  4DR1 B;  3RGB A;  4FM1 A;  3RYH A;  4AHC A;  3ICX A;  2QTO A;  2GUZ B;  5JCO C;  4FVM A;  4IYH A;  3FKS G;  3AG2 C;  2YIB A;  3ABU A;  2FYU H;  3OM3 B;  2RJZ A;  4YJ3 A;  3CC7 V;  1CP9 A;  1V55 B;  2P6J A;  5GW7 A;  5CA0 A;  1MZF A;  2KQX A;  1N0N A;  4ZOL A;  4G27 B;  5FPO A;  2N05 A;  4B7E A;  2LW1 A;  3JAK B;  2K1E A;  2WLI A;  4P9P A;  2RQ6 A;  3ZMU A;  1FXK A;  4BWA A;  1QLN A;  1NBM G;  1JMK C;  3AG1 C;  2Q9L A;  3JAT A;  4WFA V;  2OCC B;  3K5N A;  2PTM A;  1ZL8 B;  1F4M A;  3CCE V;  2X0L A;  3RVY A;  2LFR A;  1Q6I A;  3W7T A;  3BAA A;  2Y69 C;  4JPR A;  1WPX A;  3SYP A;  3AG7 A;  1PV0 A;  1FAF A;  4ICG A;  2LQT A;  2R9R B;  4X8A A;  4MVQ A;  4W4L A;  2XAF A;  1YCI A;  1GRJ A;  3CCR V;  2GUZ A;  4O4L A;  3HKB A;  2XAH A;  2FKX A;  3ZHR A;  2OWO A;  1UFI A;  4JI0 B;  4QNH B;  4MVU A;  3K5L A;  5B1N A;  2OIE A;  4EKW A;  2HHH O;  1QLE C;  4FFB B;  5D5Q A;  4GKJ B;  3D36 C;  4BIZ A;  1IUR A;  1QVF U;  2OCC C;  1THZ A;  2Z0A A;  1I5Y A;  2DW4 A;  3N2G B;  4PEL A;  2A0L A;  1P7B A;  1FPO A;  2Q68 A;  1EN5 A;  2ITD C;  2AXT Z;  4B3T O;  3I55 V;  5KHH A;  1YTF D;  1XNQ O;  3T1Y B;  4AI8 A;  4LF8 O;  1SA0 A;  2IJH A;  3UT5 A;  1NR7 A;  5LHG A;  1N32 B;  4EFB A;  4P30 A;  1GTO A;  5LGT A;  1XNR O;  4B3S O;  1RSO B;  5EIB C;  2A9H A;  3W7U A;  5CBH A;  4DV5 O;  2W0X A;  5LOV B;  3JAR A;  4B08 A;  5J2T A;  1R3L C;  2Q7G A;  4PA9 A;  1VQ7 V;  1MNG A;  1SQQ H;  2ZM6 O;  3OFN G;  2D2C B;  3S3W A;  1QQC A;  2QM4 A;  1VP7 A;  3A0H Z;  3KZI Z;  3K9S A;  2XAS A;  4MTG A;  4O4J A;  5GTH Z;  1KP2 A;  1NH2 B;  1K8A W;  1Y74 B;  4J9Z B;  3DXR A;  5KHK A;  2GBO A;  2Z3Y A;  4GKK B;  3F5W C;  1GN6 A;  1L8D A;  2Q0A A;  3PN1 A;  1KB9 F;  3R66 A;  4U3J A;  4YIP A;  1K4C C;  3L75 H;  1NKD A;  1WPB A;  4K8X A;  3CE2 A;  3ZHT A;  2OIG A;  4OPH A;  2WLL A;  5EBM C;  5CA1 A;  3DC5 A;  4Z1V A;  5LMU O;  4YHH O;  2YEV B;  1R3K C;  3AK3 A;  3NR7 A;  5LHH A;  1QCE A;  1GK9 A;  1FKA O;  4DR7 B;  5BR8 O;  1SA0 B;  5LYJ A;  3UT5 B;  1SER A;  5B5E Z;  5EZY B;  3K3W A;  1CEZ A;  4AQY O;  4LC1 A;  1DK1 A;  1FD9 A;  3AK2 A;  5DEC A;  5IYZ B;  3QNE A;  3FB7 C;  3ETQ A;  3CJH B;  4MS2 A;  2RMK B;  5BZB A;  4DR3 O;  3Q4H B;  1K7D A;  1R6T A;  4R8C A;  2QE7 G;  1XNQ B;  4PDL A;  5C93 A;  2Q67 A;  4LP8 A;  1VQN V;  3FB8 C;  3F7V C;  2EIJ B;  3OT7 A;  5B1A C;  1FFX A;  2K9P A;  3K06 A;  4OPA A;  1D2D A;  1M93 A;  4I4T B;  3T1H O;  2OT5 A;  3ZN0 A;  4OX9 O;  2NLJ C;  2ZM6 B;  1SZT A;  1M9N A;  2IW5 A;  2ZE6 A;  3CS5 A;  4JI6 O;  4DV3 B;  4LWS A;  1YEW A;  1FYJ A;  2V7Q G;  4DV7 B;  4LFA B;  5FL7 G;  4NXN O;  4YXW G;  1AI7 A;  4YIO A;  1HNZ O;  3UCS C;  4TV8 A;  1M4U A;  4KL1 A;  4D6T H;  3ZJZ A;  4HZ3 A;  2UXN A;  4DR2 B;  4DW1 A;  5LMN O;  1J95 A;  1KC8 W;  2YIA A;  1M57 B;  1QLE B;  2ZNJ A;  3ZRW B;  4X20 A;  4FIP C;  4FZ1 A;  3D3Q A;  2Y4T A;  4DYL A;  5L3E A;  4X64 B;  1QVG U;  3B77 A;  3CME V;  1E1R G;  5DED A;  4QGP A;  3E22 B;  1KBH A;  4U3J B;  4B3T B;  4OGQ B;  4LFC B;  2HG5 C;  2W0F C;  5EYP B;  2QKC A;  1BL8 A;  3N2K B;  3FFQ A;  4FLU A;  2JIZ G;  2XTA A;  4I0X A;  3S3X A;  5JH7 A;  3QG5 A;  3L71 H;  5IYB O;  2DN9 A;  1Y74 A;  1HW7 A; 
#chains in the Genus database with same CATH homology
 2YXH A;  2Q5Z A;  2A7W A;  1VMG A;  4QGP A;  3CRA A;  2GTA A;  3CRC A;  2A3Q A;  1YVW A;  2Q9L A;  1Y6X A;  2OIE A;  2OIG A;  2Q73 A;  2Q4P A;  5IE9 A;  1YXB A;  3C90 A;  2P06 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...