1YW2A

Mutated mus musculus p38 kinase (mp38)
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
350
structure length
341
Chain Sequence
b'ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGARHVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Mitogen-activated protein kinase 14
publication title The development of new isoxazolone based inhibitors of tumor necrosis factor-alpha (TNF-alpha) production.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 102
structure length 341
sequence length 350
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2005-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1yw2A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1yw2A01
2W99B 5CY3A 4O96A 3FZ1A 1BX6A 3GENA 1W7HA 4IACA 4H3BA 4XV3A 3ZC6A 3HAVA 2DUVA 1PF8A 3PTGA 2WOTA 4V05A 4L42A 1XJDA 5TE0A 4XRLA 5IG1A 3SGCA 3KMMA 2BAJA 3QX4A 1OIUA 3FPMA 3JS2A 2J0MB 3KXZA 4FYOA 4EQMA 3TNIA 3OBJA 2B9IA 2Y4IB 3UBDA 2J90A 4FTTA 3MB7A 3V51A 3R71A 2GS6A 1J91A 2UZVA 3PIXA 4NIFB 4ENXA 1U4DA 3F2RA 1KE5A 1OPJA 4NJDA 3IK3A 3MTFA 3W1FA 3GEQA 3R2BA 1DAYA 3LM0A 4JLCA 5DR9A 5L2QA 2W5HA 4CZUA 4QTEA 3TM0A 5M53A 1WBWA 3N4VA 3QTIA 1PMNA 4RVLA 4LYNA 3I1AA 3A60A 2R7IA 3IDCA 1OL6A 3QX2A 3DZQA 3FMEA 4U80A 2HWPA 2ZM4A 3QZIA 4OT5A 4FNXA 5DPVA 5D9HA 4I41A 2W05A 3SW4A 1PXNA 3LM5A 3LCKA 4KSQA 4AWIA 2O2UA 5AP6A 3EZRA 4JDHA 4AU8A 2B1PA 4IX6A 3DT1A 2QODA 3QA0A 5EYMA 2H8HA 3LFEA 1MUOA 3ANRA 3PY0A 4EI4A 2OH0E 4F6WA 4DGMA 3JVRA 4NTTA 1KE6A 1EH4A 3EKNA 3EB0A 1Q99A 2R2PA 4IH8A 4CFXA 4IADA 1PY5A 1ZZ2A 4KAOA 5HG9A 2BCJA 2PVHA 3VIDA 1XH7A 2XIXA 4IEBA 1YHVA 4F9CA 4BCNA 4EJNA 4RGJA 3S1HA 3ATTA 4MXOA 5HU3A 4W4VA 3BU5A 3MWUA 3RPYA 2PWLA 3LQ8A 4D5KA 2ZMCA 2ZB0A 2I0EA 1BL7A 2QVSE 3I4BA 2Z8CA 3QWJA 3CKXA 4NM0A 5EYDA 5D11A 1OIQA 2WHBA 1M2QA 5M55A 3CQWA 5LMKA 1IEPA 3SC1A 3I60A 3TZ9A 3PPJA 4FKQA 4USFA 1YXXA 2PVLA 5CXHA 3SKCA 5BUIA 4FIGA 5EKNA 4QMVA 2PMLX 3NRMA 4FZDB 4QRCA 2CNQA 3P08A 2HW7A 1G8AA 3LMIA 4D4VA 1H1QA 3VULA 4AGCA 3QGYA 2RFDA 3S95A 5CVFA 4PMPA 2YM4A 4UZDA 2XBJA 3DB8A 3OY3A 2WTCA 1UVRA 2GU8A 4YNEA 3RZBA 4BY9E 3RM6A 1G5SA 2ESMA 4X2JA 4RZWA 3BV3A 4ASEA 4QP7A 2XZSA 3EQPA 2BRMA 3A8WA 2R3KA 3LCDA 4U41A 2UZEA 2XNMA 3JUHA 4CLIA 5HQ0A 1XH6A 5ITAA 5EDPA 3A99A 2QOFA 2JLDA 3EQBA 4E3CA 2HW6A 1Q8TA 3ZXTA 4K0YA 5HTBA 3TN8A 2XK7A 3HRBA 2G2FA 4CCUA 1H25A 4Z55A 3U6JA 4FGBA 3GU8A 4BIBA 3QQFA 3LFSA 5IQHA 2OO8X 2X8IA 4KIKA 3WF8A 3TUBA 2RFNA 3WOWA 4AW2A 4YZDA 5K4JA 4EKLA 3RAHA 3OMVA 4D4YA 3OCGA 3GU4A 3DNDA 3ZSHA 2CCHA 3GOKA 4ZY6A 3NVMB 5M07A 2GNFA 2YM7A 3IW7A 4E6DA 4ERKA 1V1KA 1YXSA 3PA4A 4ANNA 5EG3A 3TUCA 3NNVA 2YIXA 4FTIA 3MJ2A 4TN6A 5DGZA 4JG7A 2BROA 4UALA 4W4YA 4IAFA 4NKSA 5CASA 4O0RA 1K2PA 2OGVA 4TW9A 4EYJA 4UN0C 5I9YA 4TPTA 2Z7LA 1UKHA 5A46A 2Y0AA 3ZEPA 2I0VA 2W1HA 4KRCA 5M09A 4AX8A 5CANA 4TYIA 2YM8A 1HOWA 5C8MA 4EK3A 4JQ8A 4AT3A 1PXPA 4FNWA 3RAWA 4AA4A 4BTJA 4YBJA 2O65A 5TKDA 3HDNA 1MRUA 4BKYA 1XH8A 3OXTA 5CQUA 4ORKA 3E62A 2QC6A 4ZOGA 1ZOHA 2ITTA 3UIXA 3W2PA 5HLNA 5JFWA 2WIHA 4G3GA 3ZC5A 3L9NA 3II5A 1GZNA 1OMWA 4QNYA 3GCPA 4JI9A 4FA2A 2EU9A 5LMBA 2E9PA 3R7IA 4DH8A 4IZ7A 3AC8A 2ZM1A 4XCUA 5DNRA 3SDJA 2PUUA 4F9YA 2WTWA 4GT4A 4TZRA 4A06A 4WNKA 5HX8A 3BHVA 4BR3A 3IG7A 4MAOA 1S9IA 3O8TA 3PP0A 2CN5A 3N4UA 4BCHA 1FGKA 2OIDA 3GNIB 3MFTA 4RIYB 2FSOX 4S32A 3Q9YA 4Y5HA 5CU6A 5H8BA 4O7WA 2NNWB 4IWQA 3QQLA 4YLKA 4GVJA 4YGAA 3TKUA 3I79A 4E73A 1HCKA 2WMQA 3GP0A 3GBZA 2IWIA 4X3JA 5AUUA 2YZLA 1IASA 2CGUA 5AM6A 4E6CA 4YTCA 1GY3A 2ONLA 4GUEA 5BX0A 3PLAE 3OUKA 4L3JA 3ZBFA 4EH3A 4IC8A 4P90A 2P3GX 2ZV8A 1BMKA 4BCQA 4LV5A 5BVFA 2C68A 4U45A 4DC2A 4AGWA 4A4XA 1B38A 2BDWA 2UZNA 5LARA 4DEGA 4WOVA 3P0MA 5DIAA 3SXRA 1T45A 2P2IA 2YA9A 4HPTE 4NL0A 1OUYA 4G34A 4ZSJA 2YDJA 2VGPA 4O0WA 5ACBC 2C6KA 1RDQE 1V0OA 2DQ7X 4RJ7A 4RVKA 3TV4A 4AAAA 4BBMA 4WG3A 2OJIA 5BMMA 3VBXA 1JWHA 3JYAA 2PZIA 5DBXA 5EM5A 5L8KA 4E5BA 3ELJA 3WF9A 5CAQA 1FINA 2WQEA 4ANLA 5HTCA 5DG5A 3CY3A 5LMAA 3LXKA 5AR7A 5JEBA 4U97A 4E1ZA 3V5JA 5FDPA 3BKBA 4Y83A 4XP0A 1REJA 3A8XA 2QU6A 3C5UA 3R00A 5A4EA 1M7QA 3UIMA 3BLHA 3EWHA 3O23A 1LR4A 5E8XA 1W84A 3DKOA 1URCA 2G1TA 5D41A 3GXLA 4ZLOA 4FBXA 2F2CB 3A4PA 3PY1A 2W17A 3KRLA 2Z60A 3DBFA 5KMKA 4FTRA 2C69A 4BDEA 3DTWA 3HLLA 2W06A 3KXMA 4XLVA 5GIOE 3DBDA 4FGRA 1SMHA 2JIUA 2C5VA 1H0WA 3FC2A 4V0GB 3ZLSA 3QRKA 3W55A 2PE0A 4FZ7A 1ZZLA 3A7HA 2C5XA 3MN3A 4G6OA 3EHAA 3HGKA 3HV3A 4I5CA 3S4QA 4AOIA 4E4XA 3BEAA 2X7OA 3OXIA 3C5IA 3RINA 3REPA 2WMXA 2JFMA 3VUKA 2BZIB 3VRZA 3OD6X 2WQMA 2P0CA 2YITA 5B0XA 2WKMA 4MK0A 5ICPA 2B52A 1X8BA 2QKRA 5DT3A 4C37A 5AAGA 5L6PA 4DFYA 3DAJA 3AQVA 4IW0A 2KULA 5FQDC 3CJGA 4FTAA 3RGFA 2UZDA 3Q52A 5LMKC 1VYZA 3W2OA 2OJ9A 3MIYA 2CKQA 3QZFA 3W10A 4E6QA 3D5VA 3KULB 4P5QA 3FI3A 3FZPA 2OIBA 3FJQE 3QCSA 4QYYA 3R8MA 2GFCA 2YDKA 1RE8A 2OU7A 3NYVA 3NIZA 3K5UA 4H36A 4KA3A 3HYHA 4XG9A 1E1XA 3UE4A 1QPCA 3WIKA 4BZDA 4C33A 3QXOA 4J97A 4FYNA 3ZOSA 2V7AA 1PXJA 4DEIA 4EOOA 4HVSA 1PXOA 5AWMA 3E87A 3WYYA 2F7XE 4GW8A 4IB3A 4FV2A 1YXVA 2XMYA 2J5FA 3I7BA 3PXRA 3TXOA 2XYNA 3EL7A 1XBCA 5M08A 2R3QA 1JKTA 5DLSA 4TTHB 2IW8A 3CCNA 4R1YA 4RZVA 3GUBA 5HE2A 1KV1A 3IONA 3R28A 3VVHA 2BKKA 3U6IA 3PPZA 3I6UA 4L67A 3PXFA 4BCJA 2C0OA 2GQRA 4O7NA 1MRYA 1VR2A 2YERA 4MCVA 5M4CA 3NAXA 5FTGA 2WGJA 3JXWA 3H9FA 4E4MA 4J96A 4E93A 5IUGA 1YRPA 5AP0A 2J7TA 4BGQA 2XA4A 3TDVA 5HKMA 2XM9A 3QCQA 3W8QA 5HTIA 4DFZE 4D55A 4EOSA 3IW6A 2OXDA 5IA5A 5A4LA 2B0QA 3HP2A 4XV1A 5H2UA 4BKZA 3ZRMA 5IQCA 4FOCA 4X21A 3PLSA 1NVRA 1O6KA 2R3GA 2RSVA 3GQIA 5FGKA 4ITIA 4QMUA 3RVGA 1JKKA 4L01A 2EXCX 2FVDA 2PE2A 3DS6A 4FTQA 5HESA 5L2WA 4OTHA 2C6EA 1YVJA 1ZAOA 4OTQA 4RIWB 4BWKA 1JLUE 5KMNA 2R3IA 2UZUE 2VGOA 4RA4A 5DRDA 4FV6A 2VN9A 4UMRA 1GAGA 4W4XA 1KWPA 1TVOA 2OZAA 2XUUA 5EOLA 1G8SA 1ZLTA 4IX4A 3W32A 3IQ7A 4C4HA 4L68A 3VF8A 4OT6A 5G6VA 3CBLA 5CU2A 3PVUA 3C0HA 4XOYA 4F4PA 5I9ZA 4YUQA 1AD5A 3E8DA 3UYSA 1YKRA 4NEUA 1FVVA 1NVSA 4ZK5A 4BDHA 4IIRA 3R7OA 1Q5KA 4RJ8A 5IA4A 1OI9A 5DFPA 4FKGA 4I22A 3V8TA 5I3OA 4FKJA 4J8MA 4Y85A 3MFSA 2ITOA 3QTRA 3KL8A 3UG1A 5J1VA 2XNGA 4IC7A 1CMKE 3DPKA 1Q61A 4F70A 5B2LA 1ZYDA 3TCPA 4CD0A 2HWOA 4QMMA 1WBVA 5DVRA 2J0KA 1MQBA 4I4FA 4QMQA 4ALVA 5I9VA 4JAIA 1CKPA 4BDAA 3C1XA 4OUCA 3W16A 4RWIA 3D15A 4I5PA 3M1SA 1MQ4A 1WAKA 4WD5A 3UJGA 4EJ7A 3OWPA 5FBNC 3RPSA 4D1ZA 4O2PA 3AOXA 2JGZA 1WFCA 3AMYA 4G3FA 3IS5A 4X2KA 3PWDA 2XCKA 1WBOA 4RC4A 5EKOA 4ZTQA 1R0PA 3M2WA 3SXFA 4EK4A 4RIXA 4JQ7A 3AD4A 3W2RA 1WVWA 2YWVA 1OBGA 1AGWA 2I6LA 4WSYA 2QOLA 3CGFA 2ONLC 3BWJA 4F9AA 4R5SA 4TWCA 5ANDA 3DXQA 5J7BA 2CGXA 4FTCA 4MD9E 3EQIA 5DR6A 5IA2A 3MA6A 4AOJA 2CGWA 3E63A 3MH0A 2G01A 3PG3A 3PXZA 4DH1A 2B7AA 5C8NA 2XEYA 3BIZA 4NU1A 4NSTA 3G5DA 2V0DA 1U54A 1PRYA 3FE3A 2JBPA 2VTHA 3AT2A 3SOCA 4BWPA 2QR7A 2W4OA 3R7GA 5CEPA 4UXQA 3SD0A 5E4HA 3NUYA 3FMHA 4PMMA 4O7TA 2X2KA 3KKVA 3MIAA 3TZ8A 3CEKA 4NW6A 4O0XA 3CR0A 5H3QA 1M2PA 4NH1A 2ZMDA 5CEQA 2WQBA 4NZWB 2WTVA 1VYWA 5HVKA 2X8EA 4GH2A 4YPSA 2PVMA 4EHEA 3VBVA 2LGCA 4O38A 2BFXA 3Q60A 2ITUA 2OK1A 3EQGA 5FEDA 2UW7A 3LJ1A 3IPHA 3LCOA 5CNNA 4TWPA 4U6RA 2ACXA 4U3ZA 3UO6A 4DEHA 2HCKA 2QLQA 1H00A 3NW7A 5JKGA 2VTQA 3F66A 4PV0A 3QCXA 3ETAA 4ZAUA 3BYSA 2PK9A 3N9XA 1RW8A 3ZUUA 4QMYA 1JSUA 4O6LA 5FP5A 3ZEWA 4FSQA 4KABA 4U5JA 3PP1A 4MH7A 3MH1A 5CVGA 5AP7A 4IAZA 3H4JA 2C6IA 5BUEA 3PXKA 3RAKA 4O1PA 5CS6A 5HE0A 1R39A 2A1AB 3OOMA 3FL5A 1I09A 5A4CA 4D1XA 4UB7A 2OKRA 1LEWA 3IDBA 5AV3A 5AUZA 3QFVA 3ZUTA 2XNPA 2JKQA 4JIAA 4P7EA 1BYGA 4QYFA 2XH5A 4FZFB 4XUFA 4GT3A 3ITZA 3PJ8A 4KIKB 4PQNA 3IGGA 3UZPA 2YEXA 3FMNA 3UZRA 2UW5A 3RCDA 3ET7A 3R73A 3C7QA 4QQCA 4K18A 3AC2A 4N4SA 3ZLWA 3DK3A 2R3HA 4HVHA 4YBKA 3QHWA 3G15A 3OROA 3CSVA 2ITZA 3CKWA 3OWJA 4M0YA 5C8KA 5HIEA 4AW1A 2ZOQA 3OEZA 3NWWA 1GJOA 5CNOA 4IXPA 5LQFA 3MGYA 2BRGA 3NLBA 3S0OA 4GS6A 4AZWA 1H24A 4IMYA 5CX9A 1K3AA 2FGIA 5TF9A 4B8MA 4F7SA 4MBLA 4M8TA 3UZTA 3ORMA 2AC5A 4I5HA 4K11A 3M11A 3OCTA 4DT8A 2B4SB 2RFEA 3EZVA 4YHFA 2RG5A 2I40A 3D7TB 3L8SA 3PG1A 3UYTA 3ZO4A 4ALWA 4AN2A 3FHIA 4S2ZA 5CAUA 3DA6A 4XBUA 1FPUA 4JJRA 4N6ZA 2VTOA 1FMKA 3FMDA 4AZVA 4EC8A 4PDYA 5K5NA 2IPXA 3CE3A 5AUXA 2WD1A 4S34A 3MVHA 4TXCA 4XBRA 2LAVA 1U59A 4EBVA 4FMQA 1U5QA 4JL9A 4R7HA 4OW8A 3LIJA 4F0GA 4ITJA 3TIYA 4FEUA 4I6QA 3W2CA 4F64A 4XRJA 3ALNA 3SHEA 2WTDA 4FKLA 3UDBA 4OTFA 5F4NA 5AP1A 4FEWA 2W4KA 4FSZA 4UWCA 3FEGA 3FZTA 3OUNB 2WMTA 1HCLA 4AFEA 2R4BA 3TZ7A 3VS3A 5LJJA 5M4UA 4QPMA 2EB2A 1NXKA 2QOHA 1YW2A 3GC7A 4YO6A 3OCBA 4O0TA 5CF5A 5L8LA 4RBLA 5KMLA 3I6WA 2BKZA 3P23A 4G6LA 2PYWA 4FI1A 2JAMA 4RA5A 4IQ6A 3IKAA 3U54A 2YACA 5EM6A 4AE9A 3UIBA 3RBWA 3PFQA 5IQEA 4LRKA 4A9TA 4FVQA 5FM2A 3UP7A 4D5HA 4IVDA 3IW8A 3ACJA 4EWQA 4DA5A 5DR2A 3CTHA 3GC9A 3QQUA 3DXPA 4GV1A 4DH3A 3FL4A 3QUEA 1WMKA 4BI1A 3DTCA 4FSMA 3BRBA 4OTGA 3LE6A 5G1XA 2W1GA 1Z57A 5EW3A 3ZBXA 3NSZA 3QZHA 3DQWA 1OVEA 2A19B 2RKUA 3DFAA 3RZFA 4C4JA 4WHZA 4FKWA 1PJKA 4ZMFA 1YWVA 2WMVA 3BGPA 4NJ3A 1SM2A 4EHZA 4ASXA 2BZJA 5CENA 4UX9A 2WMWA 2WU7A 3VUTA 2FB8A 4MF0A 4NM5A 4FSRA 5HZNA 3NW5A 1TQIA 4DHFA 3EOCA 3MV5A 4ANBA 2XF0A 3F6XA 2XP2A 2CSNA 2B53A 5E91A 2GPHA 3VBWA 2O3PA 3G9NA 4X2FA 3RNIA 4KKHA 5AP3A 3O2MA 3IECA 4YTFA 4CMTA 3P5KA 5KBRA 4NM7A 4KBKA 4IWOA 2BZHB 4U8ZA 4HCUA 3DY7A 1A06A 4DINA 5E8YA 4JRVA 4A07A 1O9UA 1Q8WA 2ITNA 4QTAA 5AP4A 5IISA 2R9SA 4XG6A 5LVPA 2QOOA 3CXWA 1GZ8A 4FE2A 5HBHA 3QF9A 4TWOA 3TV6A 4UXLA 3EQHA 5B2KA 4MQ1A 2C6MA 3NCGA 3QUPA 4HVDA 1PKDA 2IZRA 3D5XA 4MXAA 5CVHA 4R8QA 4WKQA 4L44A 3VHEA 5AUVA 3Q4UA 1E9HA 4PUZA 5IMXA 2OW3A 5HIBA 4I24A 5CU0A 5CSPA 2R3FA 2X7FA 3PY3A 4E4LA 1UU7A 3F88A 4D0WA 3R63A 1ZYCA 3B8RA 3I0OA 4YPDA 5EYKA 3ZTXA 2CDZA 3QCYA 1P14A 2WTIA 2PVNA 3DLSA 4M84A 3RALA 3HA6A 5M57A 5D7AA 2GTMA 3P4KA 3LFAA 1CDKA 2XKEA 3DBQA 3WE4A 5K9IA 5CQWA 2HOGA 4J1RA 4I0RA 4J71A 5BYYA 4AZTA 4EQUA 3AXWA 1UA2A 4MXYA 2E2BA 3SOAA 4EORA 4U43A 3PVWA 1J1CA 3EFJA 3C0GA 3BU3A 3ZFXA 4DGGA 2ZV7A 4U81A 3SXSA 4F9WA 3KGAA 4KB8A 1ZY5A 4YO4A 4CFVA 3PIZA 2O5KA 4FZAB 3UQFA 2F7ZE 2QQ7A 4Z3VA 3FI8A 3KN6A 5A4TA 2ITQA 5IUIA 3D14A 3NUNA 3Q9WA 2V62A 1Q3WA 3DNEA 3LXLA 2VD5A 3PZEA 5A9UA 1WBSA 2P4IA 1KE7A 1XKKA 2C6DA 2VWYA 3EQRA 4LI5A 4M69B 3VAPA 2VTPA 3VS5A 3UGCA 2QKWB 4QTCA 4AW5A 4WO5A 4RFMA 3UP2A 3ZO1A 4G9RA 4QYEA 4XEYA 5HNGA 3CPBA 1OECA 2C5YA 3KMWA 1ZMUA 4XYFA 2QOCA 2UW0A 3NYOA 4HYIA 4O27B 2X6EA 4YJNA 1SZMA 4DTKA 4J99A 4YZNA 4USDA 3DGKA 4ZZMA 3OP5A 3QA8A 4PWNA 5K0KA 4FEQA 4KBAA 4ZSAA 5J87A 4O7RA 3A2CA 3RPRA 2C3IB 1KOBA 3FI4A 3QL8A 4GU6A 4IDVA 2BRBA 4RQVA 4XX9A 4Z9LA 4WBBB 5A4QA 1GIHA 4CSVA 3OHTA 4NCTA 2WTKC 4PP9A 3LW0A 4U40A 2WNTA 4BIEA 3R1QA 3ZCLA 1PMEA 3LFNA 1H08A 2VO0A 2PULA 4DTAA 2IVSA 4S31A 5F94A 4DCEA 3HV4A 5HOAA 2OZAB 3ZSIA 3VF9A 2Y8OA 3DJ6A 4R1VA 1Q97A 4PMTA 5M4IA 2B55A 4KD1A 4O0VA 5E8SA 1Y6BA 2YCRA 4DGNA 2O8YA 5C27A 3COIA 3BI6A 3LFDA 4HJOA 4MX9A 4C7TA 4LM5A 3KB7A 2G2IA 3RPVA 3SW7A 4ZMEA 1XR1A 1WBPA 5DT4A 5HD4A 2VTJA 4IVAA 4U79A 5FD2A 3L9LA 5BYLA 3Q4TA 4RRVA 1YWRA 3C9WA 5E7RA 3F82A 4XNEA 3OOGA 4BI2A 2OF4A 1E1VA 4EH2A 2WMSA 1ZOGA 4R3RA 3ZU7A 4I6FA 4EOQA 3CLYA 4C62A 2R3MA 4CFNA 2BFYA 3R01A 4U3YA 3C51A 3E93A 3IOKA 3PUPA 3RKBA 3E7VA 4BYJA 4MNEA 1LPUA 4EK5A 5I5ZA 4XP3A 2JKMA 2EVAA 3EN6A 4YJTA 4EOKA 3ZZWA 3E8NA 4YTHA 2IVVA 5A3XA 1YDTE 4C34A 2C4GA 3SVVA 1UU9A 4CG8A 3RM7A 5DHJA 2EWAA 3RMFA 5CZHA 3BYMA 4BDDA 4EH5A 1VEBA 5HBEA 3FY2A 4II5A 1YXUA 5IPJA 3OCSA 5GZ9A 3EQFA 4L7SA 4AE6A 4RIXB 3C4CA 5IQIA 4YLJA 5E8UA 3BHHA 4JQEA 3KEXA 3KRJA 2C0TA 2VTLA 4OTDA 3H9OA 3UODA 3EQCA 2EXEA 2ZM3A 3LLTA 5H9BA 4BDBA 4RC2A 4DGLC 4CKRA 1OL5A 3SQQA 3VO3A 4D28A 3ORNA 4H1MA 3FXZA 4GYGA 4DLJA 5J5SA 2W96B 3BHUA 1YXTA 5BVDA 1U54B 4FT7A 4EH8A 3UPZA 2R3PA 2BDJA 4ASZA 4IAIA 1OKZA 3HMOA 4YHJA 4XS2A 5M06A 3H0YA 4G9CA 5JH6A 4O7ZA 3POOA 3HNGA 3C0IA 1XHAA 4GFGA 3H30A 3QD4A 2ZDTA 2QOBA 4L9IA 4ANOA 1OPKA 1PYXA 1W82A 2P2HA 3PA3A 2R3RA 3QD3A 2NP8A 2WB8A 3ORLA 1YOMA 2C1AA 3V5LA 4FG8A 2I0YA 3OTUA 4IBMA 4IANA 4PTCA 4UMTA 3F61A 5CZIA 5FBOA 4MHAA 3O8PA 3RNYA 3VW8A 3R1NA 4RPVA 2FH9A 4H58A 2WEVA 5AP5A 5HVJA 4LOPA 5C26A 4FZ6A 4FICA 3BE2A 2ERZE 2ETMA 1SYKA 3BGQA 2W1DA 3NDMA 3ORIA 1VJYA 3MW1A 3P78A 2IJMA 5M51A 2F7EE 5C1QB 4XG3A 3HMMA 3SA0A 4FKRA 3R7VA 4RVTA 3IO7A 4IWPA 4O91A 4AF3A 5BUJA 3R0TA 4I21A 3JVSA 5C4LA 2X7GA 3W8LA 2PVFA 5LVLA 4FSTA 2XS0A 1V0PA 3KK8A 4LL0A 2GFSA 3NS9A 3V5TA 5IUHA 4BVUA 4DFLA 5EI2A 4ZS4A 5GZAA 1OIYA 5KMOA 1WVYA 3QKLA 2JBOA 1OL2A 4PY1A 3F7ZA 1H1RA 2YJSA 2HXLA 5ETIA 3V8WA 3LKMA 4RFYA 3R2YA 4QP1A 4YC8A 3KRXA 4R7BA 3Q96A 4J8NA 3AT4A 5H8GA 1QMZA 2OXXA 4QD6A 3FPQA 3VW6A 4EQCA 4FV4A 4NTSA 4NFMA 4ONAA 4IVCA 4R6VA 2YIRA 2B9HA 3UG2A 2Z02A 1O6LA 4TYHA 4ANSA 4IFCA 5CYIA 5E1SA 3TG1A 4M67A 5HE3A 3PSCA 4EK6A 5ANIA 1YDRE 2VWBA 5KHWA 3JPVA 4TYEA 4N6YA 4RWLA 4ARKA 2JDVA 4C3PA 3VQHA 4F09A 3HUBA 3PRIA 3ZH8A 3BEGA 2R3JA 4FNZA 4G3DA 4CMOA 3KVWA 4PP7A 4W8DA 3OBGA 3GU5A 3MJ1A 4O22A 5IF1A 4CTBA 3DZOA 5BVEA 4QMTA 4JX3A 4K2RA 3HP5A 3OTVA 3UO4A 4FL1A 3WE8A 4GJ2A 3LOKA 3A7JA 3I7CA 3FC1X 3PVBA 4Y46A 4FG9A 4FEVA 1UV5A 3KXHA 1P5EA 4JDIA 3Q5IA 4LMNA 5KMJA 2YJRA 5DEWA 2E9VA 4H1JA 4EH4A 5JSMA 4GEOA 4TYGA 2PVRA 4YJQA 2VV9A 4IM0A 4ZLZA 4AUAA 2UW4A 5IQGA 3MVLA 4HNIA 2JC6A 5GINE 2OF2A 3FBVA 4LOQA 4X2NA 4HW7A 5M4FA 3HRCA 4P5ZA 4U44A 3L8VA 3ZMMA 4AN3A 4BCMA 1ND4A 5ANGA 3QU0A 4TKSA 2BTRA 2PE1A 4FIEA 4NCTC 1JKSA 3LFQA 2OFVA 3SRVA 3R04A 4MXCA 4O0UA 5JK3A 2QOQA 4CYIA 3LHJA 3R9NA 2XJ0A 2RG6A 5TT7A 5CEMA 2YCFA 4ZS0A 4JNWA 2I7QA 2PSQA 2YCSA 4KSPA 3W2SA 1IA8A 3NUUA 4IB0A 4IB1A 4E5AX 2HYYA 3GU6A 4P4CA 3RJCA 3KQ7A 2WMRA 3MTLA 5GJGA 5IA0A 3GCUA 3BLRA 5AV4A 2VTIA 4GRBA 1OPLA 1UNHA 4MKCA 4M14A 1W8CA 2GNHA 4L3LA 5HCYA 4DAWA 2BHEA 4LGGA 3QTSA 4FTKA 5EOBA 1ZMVA 5AR3A 4QMPA 5HG5A 2OZOA 4CT1A 1PYEA 4J52A 4ACMA 1ZYJA 2OJFE 3KN5A 2FSTX 4LGHA 4RC3A 4BZNA 4HPUE 4ZLYA 4BDFA 1J7LA 5M44A 5FXQA 3D0EA 4B4LA 3IDPA 5HLPA 5JGAA 2WIPA 3VWAA 3TNHA 3O7LD 3EFLA 3TJDA 4MXXA 4NIFA 3QYWA 4F08A 4FUXA 5L3AA 2Z7QA 2G9XA 4QP3A 3G90X 4ZIMA 3KXXA 2HELA 4FOBA 4AP7A 4UWBA 4IM2A 5HORA 3KVXA 3EN9A 5IU2A 3HMNA 5HVYA 2J2IB 4HNFA 4G3CA 3P1AA 5HIDA 5J1WA 1WZYA 4FV0A 3I0QA 1F5QA 2NO3A 3O96A 3PJCA 3DV3A 3QAME 5IKWA 3WF7A 5EYCA 3FWQA 3TNQB 3VUMA 4KIPA 4BICA 5BVOA 2JD5A 4M68A 3DFCB 3ZLYA 3O7LB 4ANQA 4U0IA 4GG5A 4F99A 2BR1A 5IA1A 1IA9A 5FG8A 3Q9XA 3QZGA 2JAVA 1XH4A 4EOPA 2BZKB 2J5EA 3MY1A 3ODZX 4FIHA 4RX8A 4N0SA 4EHGA 4HVIA 4QMNA 3F3TA 3O0GA 4QOXA 3ZZEA 3MESA 4O83A 5IDNA 2R5TA 2JDSA 4CRSA 5HO7A 3IGOA 3NEWA 3QTXA 4AA5A 4NKAA 4GJ3A 5DYJA 2P33A 3QYZA 5LVMA 1YI6A 4YZBA 3QTZA 2YABA 4USEA 2YAAA 3QXPA 2XYUA 5BVWA 1FMOE 4A4OA 3DJ7A 1PXIA 4FT3A 5ANKA 1WVXA 5BYZA 2GQSA 3LFFA 4FV7A 4C4IA 3RCJA 3VC4A 4DEEA 1RQQA 3V3VA 1SNXA 4BGHA 3KREA 3WIGA 2E9UA 4JAJA 1QL6A 3KFAA 4YHTA 5AR4A 2YIWA 3NNWA 4RX7A 4HYHA 4JBVA 4PMSA 3DXNA 4F9BA 3G6GA 3AC1A 3FDNA 4EUTA 1GOLA 2CKPA 5E9EA 5C4KA 4FV3A 2VWWA 4I0SA 2QHMA 3L9MA 4WUNA 5AMNA 3UNZA 5ETAA 4A9YA 4ZZOA 3EQDA 4EK8A 1IRKA 2C5NA 2ZDUA 1KE8A 2J51A 2AUHA 4JDKA 4LUEA 5ETFA 5FUTA 1CKJA 2QD9A 4I4EA 1GNGA 4IZ5A 1H26A 2JITA 4BTMA 3LCTA 4O1OA 1OKVA 2Y6OA 4OTIA 4D58A 4BWXA 4LG4A 5H8EA 3CQEA 2YM5A 4RJ5A 4ZJIA 5K4IA 4JIKA 3NUPA 3T8OA 1OKYA 3EL8A 4YSJA 2WTJA 2XIRA 3E5AA 2IZUA 4FUYA 1XH5A 5JFXA 2CCIA 3FAAA 3F3ZA 4I3ZA 4M7IA 4YP8A 3IOPA 3GU7A 1UWHA 3MY0A 1GZOA 5AAFA 3ATSA 4DTBA 3D7ZA 4XG7A 5AV2A 4KIQA 1ATPE 3F5GA 4TY1A 3NR9A 4BKJA 5AR8A 3OXZA 4RMZA 4PF4A 1FVTA 4A9SA 4F6UA 4HCVA 3R7YA 3HEGA 4MQ2A 3TEIA 5E8TA 4Z16A 3OT8A 4FT5A 3PA5A 3EN4A 5F9EA 1NY3A 4XV9A 3C4FA 3GT8A 3HRFA 5I4NA 3TNPC 2CMWA 4RWKA 4MYGA 2CKOA 3MYGA 4DT9A 3R1SA 4O82A 5J9LA 3W18A 4BTFA 2W7XA 5L6WL 3DBEA 4JG8A 3AC4A 5HU9A 3S3IA 2BUJA 4L3PA 4BB4A 1JSTA 3ZUVA 4LMUA 3HAMA 3QLFA 4UZHA 3UOKA 3P86A 3GOPA 4YTIA 3ACKA 4RLLA 4EBWA 5A6OA 4O86A 4BHZA 2XCHA 2O63A 3WZJA 4CFWA 2R3LA 5JQ5A 2BTSA 2A0CX 5A54A 4RSSA 1A48A 2IG7A 3KA0A 2X6DA 3JY0A 5JRQA 2RFSA 1APME 4D1SA 3N4TA 4FR4A 3QTQA 2OJJA 5J9ZA 3V01A 2W4JA 2XNNA 5C01A 3VS4A 3FMKA 2XRWA 2EB3A 5JQ8A 4QP8A 3PSBA 5IEXA 2IZSA 4LV8A 5CSVA 3ZM4A 2VTAA 1XWSA 5FEEA 1BLXA 1ERKA 2Y7JA 2CN8A 3OFMA 4JRNA 4BCIA 4YMJA 4HZRA 5HCXA 3COMA 4OTPA 4RWJA 5FRIA 5J8IA 5CAVA 1DI8A 4MNEB 1O6YA 3Q2MA 4QQ5A 1GIJA 2UW9A 4BYIA 3E8CA 4EONA 3S00A 2VO6A 3NYXA 1Z5MA 4G2FA 2GNLA 4FV5A 3B8QA 3PDTA 4CEGA 4CCBA 5L2SA 3QD2B 3WI6A 3K3JA 4B7TA 5I0BA 2VU3A 4RX5A 4R7IA 4MF1A 3ZYAA 5JT2A 4I1ZA 5KZIA 3NIEA 3U51A 5EQEA 1ZWSA 2YM6A 2ITXA 2GCDA 5HEZA 5IH4A 1KOAA 4MD7E 3VBYA 5CSHA 2QURA 2BAKA 4ZTSA 5CI6A 2VWIA 4CMUA 1RJBA 3LJ2A 3QRUA 4AZFA 4DH5A 3EFWA 2PMIA 3F2AA 4G6NA 4C2WA 3TDWA 2YLEA 4WRSA 1Q62A 3DLZA 4J98A 5L4QA 4FIIA 4O84A 5EQPA 3PJ3A 2F4JA 3BPRA 5AIKA 1G3NA 2YISA 4FKVA 1PW2A 1M2RA 2CHLA 4EZ3A 4BFMA 3MI9A 3FV8A 4DF3A 2PMNX 4YURA 3H9RA 4I92A 5AAEA 4G17A 1OUKA 4Q5HA 1H1WA 4YJPA 4UEUA 4AT5A 4EOMA 3QWKA 2W1ZA 4WA9A 4AS0A 3QQKA 4OTRA 4DEDA 4UMPA 1STCE 3TWJA 3R6XA 2CPKE 3D5UA 5FXRA 4DFUA 1I44A 4EH9A 4HYSA 3SAYA 2ITYA 4X3FA 4FKOA 2XBAA 3Q9ZA 5EI6A 3G0FA 4ZTRA 2XK3A 4JX7A 4Q9SA 3PSDA 3UIUA 4CXAA 4IX5A 4D2TA 3FYJX 4J95A 5DT0A 4XG2A 3ZDIA 2YCQA 1BL6A 2FSMX 3G33A 4ITHA 2IVTA 2W1CA 3DBCA 5AR2A 3OW3A 4LOOA 4Q2AA 4XOZA 4G3EA 4QT1A 3TUDA 4O2ZA 1A9UA 4EOLA 4BDIA 2X39A 4IX3A 4FSUA 1Q4LA 3D9VA 3LFCA 1FQ1B 4GCJA 4XMOA 3UMXA 3V6SA 1OL7A 4FC0A 3FSKA 1UWJA 4MWHA 4QP2A 1TQPA 4M13A 1DI9A 3PVGA 2HIWA 2JIVA 4G5PA 2OSCA 3B2WA 3D94A 5BNJA 4K8AA 3HDMA 3NAYA 3UPXA 3ZRKA 3O17A 3AD6A 3R7EA 3ZSGA 2BRNA 4IFGA 4FKSA 5DI1A 4TNBA 4CLJA 5JGDA 3MFUA 3DAEA 4FSYA 4F6SA 2C30A 2QNJA 2WMBA 3FQEA 4X2GA 5ETCA 3PZHA 4KBCA 5CEIA 3ZONA 3ZXZA 4AA0A 3PWYA 3BV2A 2FO0A 2VZ6A 3OZ6A 4ZJJA 4K1BA 1ZY4A 3UOHA 5LWNA 5AA9A 2GHMA 4D2SA 1JQHA 5EW9A 4D2VA 3D83A 3OWLA 4GFMA 4QMOA 4FKPA 4BN1A 2SRCA 1BI7A 2VO7A 3TI1A 4H05A 1XO2B 2WU6A 1QCFA 3UMWA 2PVJA 3FZOA 3I81A 1FOTA 2WMAA 4BZOA 4TYHB 1YHSA 3AGLA 5HNBA 4X7QA 4TT7A 1OITA 2OI4X 3MS9A 4AACA 2VWVA 4ZJVA 4EEVA 3U55A 3EN5A 3QKKA 5J7HA 1UU3A 4KUJA 4UV0A 2C0IA 4ZXTA 4GT5A 4C02A 3F5UA 1ZYSA 2GNJA 1F0QA 3OG7A 2OWBA 5CI7A 5LOHA 2QU5A 2J4ZA 4BI0A 4NW5A 1NW1A 3DB6A 2WPAA 3Q3BA 2OH4A 3BWFA 5FWKK 5FXSA 4UYNA 2VNWA 3RHXA 4BDGA 3KF4A 2ETKA 4FEXA 2V22A 1R1WA 2VO3A 4Y95A 3L1SA 4A7CA 2W1FA 2UVZA 1Q41A 1TKIA 3KC3A 4HGEA 4JT3A 3BLQA 3OEFX 4O7YA 5AFVA 2VX0A 4E5WA 2PUPA 4IDTA 2F49A 4C58A 1XH9A 4R78A 3FMMA 1QPEA 4KKEA 2VTNA 3SV0A 5FEQA 2PVYA 4GK3A 4C8BA 1W98A 5IEVA 5A6NA 4DG3E 4A9UA 3WZDA 1Q24A 3V5QA 4CFFA 5JN2A 2BDFA 4C3RA 5EK7A 3BZ3A 5KMMA 3SRVB 4CRLA 5DRBA 4I6HA 4BDCA 4B8LA 5I9XA 2XIYA 2XNEA 4DLIA 4AN9A 3DK7A 2CGVA 2ZV9A 4H3QA 3ULIA 4FIJA 5CTPA 4DE4A 4HVGA 1M14A 4H3PA 3BQCA 3E88A 5L2IA 4Y73A 2C5OA 3MA3A 5GNKA 4O21A 2UW6A 4FTOA 3W33A 3DK6A 5AADA 3MDYA 4F7LA 2RGPA 5BQ0A 5KX8A 4ALUA 4Y72A 4OAVB 2I0HA 2Z2WA 4O6EA 5ACKA 1Y8YA 5E8ZA 5TOZA 3F7WA 2R0UA 4GG7A 1ZXEA 4DYMA 4FV1A 3THBA 2VWZA 2E9OA 3BELA 3QQHA 4ZSLA 4AZEA 4E20A 2VTMA 1OGUA 2VAGA 4QQJA 4BL1A 3FHRA 5CLPA 4HYUA 4HGSA 5KUPA 3HVCA 4N70A 3NVKI 3E3PA 4DFBA 3WYXA 2G15A 4CT2A 4GUBA 3UVRA 4A4LA 1JBPE 3OVVA 1JNKA 3WILA 2C47A 4IWDA 4NM3A 3QQGA 3P79A 4IAYA 3TIZA 1FVRA 4YC3A 5IDPA 5AEPA 1QPJA 2W0JA 4XH6A 2BAQA 2UZTA 2EXMA 2KTYA 4KIOA 1Y91A 2X8DA 3UVPA 4QMZA 3FQHA 2CLXA 5LVNA 3VN9A 3FQSA 5LCJA 3WARA 4QP9A 1J7IA 3VHKA 2BHHA 4MNFA 2OJGA 2WELA 1SVHA 4LRJA 4IZAA 3BBTB 4GVAA 2X4FA 4P2KA 3NCZA 5T68A 2C1BA 1FBNA 1LP4A 3DQXA 1TQMA 3CD8A 5KKRC 4KNBA 4B9DA 1B39A 4XLIA 3LZBA 4JR3A 4QNAA 3ZM9A 2W9ZB 4LUDA 1UU8A 2F9GA 4FODA 4O7VA 5D7VA 3HMIA 5DE2A 5L8JA 4FSWA 4GL9A 4N57A 1JSVA 1CM8A 4EOIA 3AGMA 3DKFA 2OFUA 4YNOA 4FVPA 4HOKA 4L8MA 3RK5A 4C61A 4FTUA 2HY0A 2GDOA 4KRDA 2UZBA 4RX9A 1KV2A 2GMXA 3C4ZA 3COHA 2H9VA 2UZOA 5CU3A 3RTPA 5AM7A 4ACDA 4A9RA 2C3KA 2UZLA 5FDXA 5CU4A 3WBLA 1K9AA 5E1EA 3H0ZA 4CKIA 3PJ2A 5CF6A 3OC1A 3GFEA 4L6QA 4R3CA 5GJFA 3HMPA 5BVNA 2BMCA 3BU6A 2QI8A 4X3FC 3TZMA 3VS0A 4ZTMA 3GCQA 4FNYA 4LL5A 2BIYA 3GQLA 4YZMA 5GJDA 5C9CA 3TNWA 2ITVA 2H96A 2R0IA 3F3UA 1WBNA 5CT7A 4NWMA 4WG5A 2BIKB 4FT0A 2B54A 4K33A 2VNYA 4W8EA 4BBFA 2Q0BA 2YZAA 4FV8A 3ULZA 4FTJA 5JRSA 2W1EA 2W5BA 2JIIA 4PPCA 4UY9A 5AV0A 4K6ZA 1J3HA 4TWNA 2XEZA 5EM7A 4BCKA 5JFVA 5HICA 2A2AA 1H01A 3AT3A 5T3QA 4EYMA 2CLQA 4DCAA 1XBAA 2YN8A 2ERKA 2XB7A 5HLWA 4AGDA 2A4LA 3GCSA 2PMOX 3L9PA 2VTSA 2VX3A 3R1YA 1JKLA 3GFWA 4IHPA 4OAUC 5HBJA 4FL2A 3TT0A 2PVKA 4O7SA 2OIQA 4QYHA 4F1OA 4F0IA 2BRHA 3NX8A 4C3FA 2QG5A 2E9NA 5EQYA 5IQBA 1GZKA 3AC5A 4U7ZA 4DN5A 4FIFA 2F57A 3DU8A 3ORXA 4YJUA 1H4LA 5DEYA 1YOLA 3OS3A 3P7BA 5CF4A 2QO2A 4L00A 2X2MA 1NA7A 3HV5A 3CD3A 3CIKA 1XBBA 4HGLA 4Q5EA 3FLSA 3QRIA 3KXGA 4OR5A 2PPQA 2B9FA 4UMUA 3NUXA 3A4OX 3MVMA 5KBQA 3NNXA 3R8ZA 5DOSA 3TACA 5GHVA 5AJQA 5I9WA 4OGRA 3P9JA 4QMWA 4IE9A 4DITA 2DS1A 3QTWA 3ORZA 3AD5A 3WZKA 4BTKA 4DG2E 1OB3A 1BKXA 5IZFA 2Q0NA 4R77A 2YAKA 4PL5A 3K2LA 4BHNA 4B99A 1OM1A 3R22A 2ZV2A 4PX6A 3KRRA 3VUIA 3D7TA 4D2WA 1WBTA 3ZS5A 2VWUA 1DAWA 5BPYA 4I5MA 3QC9A 5IQFA 1IAJA 3IW4A 4E4NA 5CF8A 3GB2A 2OG8A 2YIYA 4ENYA 4DBXA 3MPMA 2XNOA 4J7BA 4L43A 3TTIA 2UW8A 3COKA 4Y5QA 5EHOA 2UVYA 3EN7A 1SVGA 4F7NA 4E6AA 2X81A 5CXZA 4QPAA 1OBDA 2ZVAA 5HO8A 2HZ4A 3FKOA 3Q5ZA 4D9TA 1KE9A 4FTLA 3CQUA 4G5JA 4ZZNA 4PRJA 5CEOA 3AC3A 3QUDA 3QBNA 4MTAA 1PKGA 1ZARA 2GQGA 4CV8A 3R83A 3S2PA 4EOJA 3FUPA 3DKCA 2Y6MA 2WQOA 4RVMA 4F65A 3RHKA 3G6HA 5J95A 3RWPA 3HUCA 4JOAA 2PZRA 3ODYX 2BVAA 3ID6C 2WAJA 5BMSA 3BYOA 2XIZA 2Y4PA 4YSMA 2HXQA 3U9NA 3Q53A 1M17A 4RJ3A 3A7GA 3SLSA 4C57A 5IQDA 3HZTA 2HENA 3UTOA 5AA8A 5KO1A 3A62A 4IJ9A 5IMEA 3UNJA 1V0BA 2H6DA 4NK9A 3T9TA 2QO9A 3EYHA 3O71A 2VTRA 4JDJA 4AGUA 4C59A 4CQGA 2PUNA 2WTKB 4I23A 3KCKA 2BALA 4M12A 4JR7A 4C36A 2IO6A 3V5PA 5KMIA 3ENMA 2EUFB 2F2UA 2VTTA 4AXAA 1R78A 5KKRB 3ROYA 1L8TA 1H0VA 1PXKA 4ERWA 4YR8A 1PMUA 1H1PA 4FV9A 3KF7A 4NT4A 4JXFA 4UBAA 3OWKA 3DKGA 5HG8A 4D4RA 5HX6A 1S9JA 3R30A 1M52A 3BYUA 3FLQA 2Z7RA 4I0TA 3QQJA 3CGOA 4RG0A 4C0TA 4DEBA 4YJOA 2XIKA 1IAHA 4DFNA 4DEAA 2FA2A 4H39A 3R21A 3VS1A 5J79A 1JOWB 4I20A 3Q4ZA 4YZCA 5AP2A 3DDQA 5DA3A 1UKIA 3G0EA 4C35A 2QLUA 2XJ2A 4LGDA 4CTCA 4CV9A 4KWPA 4M97A 2YHVA 3E3BX 4IB5A 3ZLXA 3C13A 3TKHA 1H27A 1Y57A 3PRFA 2R3OA 1WCCA 2RIOA 4RQKA 4X3FB 5DWRA 5E92A 4EKKA 3BBWA 5I9UA 5FM3A 3ENHA 4QO9A 3R9OA 3RAIA 1AQ1A 3ORKA 2QCSA 3KRWA 4YJSA 5D10A 5HNIX 1KSWA 4MBJA 5CEKA 4JBQA 5JZJA 2WQNA 2PL0A 3CTQA 3FMLA 1P2AA 2ZB1A 3FLZA 4FKIA 2JDOA 5LXMA 5IQAA 3O50A 2XVDA 5AV1A 2FUMA 5TR6A 4PNIA 5T6KA 4CGAA 1GIIA 3V5WA 3E7OA 4NUSA 4AZSA 2V55A 3I5ZA 3CP9A 4UWYA 3A61A 4EZ5A 3RPOA 1CSNA 4F1MA 1LUFA 2GNGA 3F3WA 3ROCA 3PXYA 4MBIA 1KUTA 2X9EA 2IW9A 2VUWA 1Q8ZA 4WRGA 4QMSA 1ZOEA 1IR3A 5DN3A 2C6TA 3Q2JA 4PDPA 1R0EA 1UNLA 3FKLA 4CNHA 4X6QC 3DCVA 3LFBA 3RI1A 3VUDA 2XJ1A 3D2IA 3FLWA 4GK2A 2VX1A 3EYGA 3MH2A 5TO8A 3RWQA 3Q04A 4B0GA 4J53A 1YWNA 3V8SA 2W5AA 1PHKA 3NW6A 4F1TA 3VBTA 5J5TA 2Q83A 3P7CA 4X0MA 4BDJA 3VS6A 4V01A 4ZTHA 3F5XA 4FVRA 3FMJA 4L7FA 5F20A 4BCGA 2X2LA 3NZ0A 2XRUA 3FY0A 3MPAA 5CSWA 4PL4A 2ZYBA 3PIYA 3QTUA 4EUUA 5E8VA 2WOUA 3BCEA 5AX9A 4Z7HA 4E7WA 4MVFA 3TV7A 4D9UA 4RIOA 3BGZA 1SVEA 3KY2A 4YLLA 3D4QA 3ZFMA 2QOKA 1NVQA 5EI8A 5HD7A 5L6OA 4YJVA 3Q4CA 4M69A 2HAKA 5JFSA 3LLAA 2ETRA 4GSBA 3TJCA 4WG4A 3MSSA 4TRLA 4AOTA 3U4UA 2UUEA 2CKEA 3UO5A 3FLNC 4C4GA 4KS8A 3V04A 4O0YA 3P7AA 2OBJA 3VBQA 3UC3A 5BVKA 2QO7A 4Q9ZA 4WNMA 5HG7A 3U4WA 2C6LA 4GYIA 2XK9A 3BX5A 4ZTNA 3GVUA 3R8LA 3V6RA 3ZDUA 4BDKA 4R3PA 5B7VA 4FSNA 3QKMA 2J0IA 4GKHA 4QMXA 1FGIA 1JPAA 3K54A 4QTDA 2YIQA 3LQ5A 2C6OA 2AYPA 4EC9A 3ZFYA 5HCZA 5FTOA 3MVJA 5ANEA 3ZO2A 2BILB 4YJRA 2V7OA 2X0GA 4DH7A 3LQ3A 4APCA 2REIA 4FG7A 5AR5A 4U42A 4GK4A 3M42A 2X9FA 4TYJA 3A7IA 3E8EA 4I6BA 3TKIA 4DG0E 5CWZA 3MH3A 3R02A 5EHLA 4CKJA 3NNUA 3JY9A 4JBPA 1B6CB 4O7LA 2J50A 4GFOA 5DH3A 2YFXA 4IAAA 4OBQA 1URWA 4FX3A 3NMUF 4GKIA 5K3YA 3GGFA 4CFUA 1UNGA 3CJFA 3AG9A 4G31A 4K77A 1Q3DA 3BHYA 2DWBA 4I94A 1J7UA 4ASDA 3PE2A 1CTPE 5GIPE 5K5XA 2R7BA 3GCVA 1OIRA 1DM2A 3UNKA 3EMGA 3K3IA 4CFMA 5KCVA 4ZEGA 4DGOA 1L3RE 3O51A 4PL3A 1QPDA 2IW6A 5EM8A 5D1JA 4G16A 1PXMA 4APPA 1YI4A 2HZ0A 4FL3A 4W4WA 4F63A 4HCTA 5AIRA 4BRXA 2PTKA 3L8PA 2XK4A 3R7UA 4OBOA 2YM3A 3E64A 1J1BA 3WZEA 3UOJA 2B9JA 2XK8A 2P55A 2A27A 2GHLA 2YLFA 4E26A 3DJ5A 3ANQA 4CVAA 1Y6AA 2JKKA 5M56A 3FZRA 1M7NA 4ACGA 2J0JA 2J9MA 3BYVA 3EJ1A 3NPCA 5AUWA 3POZA 3NGAA 1IG1A 3GI3A 3O8UA 3MY5A 4WNOA 5FP6A 4NYEA 2XKDA 4XV2A 2CJMA 3BQRA 3CS9A 3G2FA 5HI2A 5IH6A 3H3CA 5KZ0A 2RL5A 1U46A 3FZSA 4ID7A 4V04A 4F0FA 4RLKA 4EZ7A 1F3MC 2OLCA 1DS5A 5I3RA 1T46A 2QG7A 3TTJA 4GIHA 4M15A 2Y9QA 1BI8A 1OKWA 2FSLX 3HV7A 2JDRA 5AUYA 2IN6A 3R9RA 1YOJA 3LXNA 5J9YA 3FSFA 3LVPA 4GU9A 3QALE 3C4WA 2YDIA 3ZHPC 3A7FA 3LMHA 1H28A 5KHXA 4W9WA 1OZ1A 2J6MA 2QONA 3EH9A 2Z7SA 3MBLA 4K9YA 4XG8A 3VRYA 1YDSE 3AMAA 4S30A 3DAKA 3W2QA 3VS2A 3R9HA 3EFKA 4ZSEA 3F2NA 3R9DA 4WNPA 3U9CA 4UMQA 4C2VA 4E8AA 3UQGA 1H1SA 4TL0A 4LRMA 5JGBA 4HGTA 2JFLA 3MFRA 1REKA 2QHNA 4M66A 3IW5A 5JMSA 4RT7A 2HZIA 4Z7GA 3PE1A 5F1ZA 1JAMA 4MXZA 3OY1A 4I93A 4MEDA 5D12A 3ZRLA 5CT0A 2JKOA 5CAPA 2W9FB 4L53A 2GTNA 2PZYA 2UW3A 4JBOA 4RIYA 2O0UA 3HL7A 3LMGA 2GS2A 4C4FA 4FT9A 3UVQA 1YI3A 2PHKA 3VJNA 3OF0A 3C50A 2JEDA 2UV2A 3F9NA 4QMLA 4PPAA 3HECA 4FTNA 3SG8A 3FXWA 3F3VA 2GS7A 4WBOA 4RJ6A 4FKUA 4D4SA 4ZP5A 2RF9A 5KNJA 5CSXA 5LCKA 4PNKA 3KXNA 4LFIA 4S33A 3R8VA 5FLFA 3MB6A 4RJ4A 3VQUA 4BCFA 3RK9A 4QTBA 5LVOA 3C4EA 2PZ5A 5AUTA 4IZYA 3E92A 1W0XC 3F5PA 4QP4A 3HX4A 2CNUA 5GZ8A 3PJ1A 1R3CA 4GMYA 3F69A 3QC4A 4MD8E 3LPBA 4EWHA 3HV6A 4C4EA 1MP8A 1YQJA 5C03A 4ZTLA 3VUHA 3I5NA 3Q32A 3LJ0A 2OXYA 4HZSA 1VZOA 2Y4IC 3LAUA 4PTGA 2DYLA 3T3UA 1LEZA 4M0ZA 1Z9XA 2WZJA 4QPSA 5LWMA 3TL8A 5CALA 4QQTA 4AFJA 2X4ZA 2PUIA 3ORPA 2R64A 3KCFA 3EKKA 3QRJA 3ORTA 5E90A 3CC6A 4JS8A 4M3QA 2I1MA 4WIHA 2NPQA 3FI2A 4BC6A 3Q6UA 2YWPA 4FK3A 4O81A 3Q6WA 2FYSA 2G2HA 4IM3A 4NFNA 5EDRA 4AT4A 3SG9A 1PXLA 4DBNA 2IVUA 3D5WA 2UVXA 4GIIA 2XK6A 3UOLA 4ACHA 3VS7A 3PPKA 4AG8A 5E8WA 4PTEA 4BBEA 4C38A 3FLYA 5K0XA 2JDTA 1CKIA 4QYGA 4WT6A 4EL9A 4U9AA 1JVPP 2C3LA 4AQCA 4XG4A 4V0GA 4EH6A 3NUSA 2VWXA 3SX9A 5EH0A 4D0XA 4CZTA 2GSFA 3N51A 3U87A 3ZO3A 2XKCA 2QR8A 3UQCA 2J0LA 2O64A 2C3JA 2XM8A 3C4XA 2ITPA 3OT3A 5DMZA 5FTQA 5EW8A 3QHRA 2R3NA 4WSQA 3VNTA 4ZY4A 4ACCA 5HHWA 3L8XA 5ANJA 2NRYA 2PY3A 3CTJA 4FKTA 4OTWA 4QP6A 2PZPA 2UZWE 4TNDA 4G1WA 1P4OA 3KU2A 1ZRZA 4AW0A 3BE9A 4YU2A 4L52A 4KS7A 1H07A 2VRXA 2HY81 3KK9A 4MWIA 4JG6A 5HO6A 2XKFA 2WO6A 2X1NA 5ANOA 3VJOA 2ITWA 3G51A 3PXQA 1H8FA 2GHGA 3QLGA 3OW4A 3HKOA 3KULA 4FF8A 2HK5A 4EHVA 1U5RA 5L2TA 4FK6A 3UC4A 3H10A 5EFQA 2WMUA 4Y8DA 4IVBA 3DDPA 3QRTA 3QGWA 3T9IA 4IAKA 2XNBA 4XP2A 4YZ9A 4EH7A 2BPMA 4CYJA 2AC3A 1NT2A 4R5YA 3BHTA 3FKNA 4DFXE 4OLIA 5IA3A 3NUAA 5B2MA 4XJ0A 3GC0A 1Q8YA 3T3VA 4BCPA 3ERKA 3KMUA 4OBPA 3CY2A 4BGGA 3EIDA 4ZSGA 3WF6A 1OL1A 4BCOA 3HA8A 4W9XA 3WF5A 3RP9A 2QOIA 3LXPA 4RFZA 1YHWA 2NRUA 4L46A 3K5VA 2HZNA 2OICA 3MPTA 4B6LA 4CZYB 4KINA 5F95A 3PYYA 4BIDA 5IEYA 4D2RA 1SNUA 1ZMWA 4O0SA 1P4FA 4IJPA 4XHKB 3LCSA 4UYAA 4F7JA 3D2KA 1ZYLA 3CPCA 5EDQA 4D2PA 3FYKX 4LQMA 5A14A 3JR1A 5HGIA 2WFYA 2GNIA 3U6HA 3WZUA 1BUHA 3NYNA 4CQEA 2CNVA 4ZY5A 1W83A 1XQZA 5JZNA 4YC6A 4L45A 4X6RA 5HE1A 2V5QA 3R8PA 2IZTA 2W1IA 3DOGA 3GC8A 2WEIA 3RK7A 3QD0A 3VUGA 5CAOA 4RIWA 3G9LX 1PMVA 5AX3A 4WUAA 3R8UA 3U8WA 3AMBA 3FXXA 2WXVA 4PPBA 2PU8A 4KKGA 1Y8GA 4PDSA 5EHYA 2H34A 3B2TA 4CG9A 5KE0A 5IH5A 1MRVA 2ZJWA 4FTMA 4BF2A 1Q8UA 2ZAZA 4JVGA 4PDOA 3ALOA 4ANMA
chains in the Genus database with same CATH superfamily
2W99B 5CY3A 4O96A 3FZ1A 1BX6A 3GENA 1W7HA 4IACA 4H3BA 4XV3A 3ZC6A 3HAVA 2DUVA 1PF8A 3PTGA 2WOTA 4V05A 4L42A 1XJDA 5TE0A 4XRLA 5IG1A 3SGCA 3KMMA 2BAJA 3QX4A 1OIUA 3FPMA 3JS2A 2J0MB 3KXZA 4FYOA 4EQMA 3TNIA 3OBJA 2B9IA 2Y4IB 3UBDA 2J90A 4FTTA 3MB7A 3V51A 3R71A 2GS6A 1J91A 2UZVA 3PIXA 4NIFB 4ENXA 1U4DA 3F2RA 1KE5A 1OPJA 4NJDA 3IK3A 3MTFA 3W1FA 3GEQA 3R2BA 1DAYA 3LM0A 4JLCA 5DR9A 5L2QA 2W5HA 4CZUA 4QTEA 3TM0A 5M53A 1WBWA 3N4VA 3QTIA 1PMNA 4RVLA 4LYNA 3I1AA 3A60A 2R7IA 3IDCA 1OL6A 3QX2A 3DZQA 3FMEA 4U80A 2HWPA 2ZM4A 3QZIA 4OT5A 4FNXA 5DPVA 5D9HA 4I41A 2W05A 3SW4A 1PXNA 3LM5A 3LCKA 4KSQA 4AWIA 2O2UA 5AP6A 3EZRA 4JDHA 4AU8A 2B1PA 4IX6A 3DT1A 2QODA 3QA0A 5EYMA 2H8HA 3LFEA 1MUOA 3ANRA 3PY0A 4EI4A 3W0NA 2OH0E 4F6WA 4DGMA 4O4BB 3JVRA 4NTTA 1KE6A 1EH4A 3EKNA 3EB0A 1Q99A 2R2PA 4IH8A 4CFXA 4IADA 1PY5A 1ZZ2A 4KAOA 5HG9A 2BCJA 2PVHA 3VIDA 1XH7A 2XIXA 4IEBA 1YHVA 4F9CA 4BCNA 4EJNA 4RGJA 3S1HA 3ATTA 4MXOA 5HU3A 4W4VA 3BU5A 3MWUA 3RPYA 2PWLA 3LQ8A 4D5KA 2ZMCA 2ZB0A 2I0EA 1BL7A 2QVSE 3I4BA 2Z8CA 3QWJA 3CKXA 4NM0A 5EYDA 5D11A 1OIQA 2WHBA 1M2QA 5M55A 3CQWA 5LMKA 4QDVA 1IEPA 3SC1A 3I60A 3TZ9A 3PPJA 4FKQA 4USFA 1YXXA 2PVLA 5CXHA 3SKCA 5BUIA 4FIGA 5EKNA 4QMVA 2PMLX 3NRMA 4FZDB 4QRCA 2CNQA 3P08A 2HW7A 1G8AA 3LMIA 4D4VA 1H1QA 3VULA 4AGCA 3QGYA 2RFDA 3S95A 5CVFA 4PMPA 2YM4A 4UZDA 2XBJA 3DB8A 3OY3A 2WTCA 1UVRA 2GU8A 4YNEA 3RZBA 4BY9E 3RM6A 1G5SA 2ESMA 4X2JA 4RZWA 3BV3A 4ASEA 4QP7A 2XZSA 3EQPA 2BRMA 3A8WA 2R3KA 3LCDA 4U41A 2UZEA 2XNMA 3JUHA 4CLIA 5HQ0A 1XH6A 5ITAA 5EDPA 3A99A 2QOFA 2JLDA 3EQBA 4E3CA 2HW6A 1Q8TA 3ZXTA 4K0YA 5HTBA 3TN8A 2XK7A 3HRBA 2G2FA 4CCUA 1H25A 4Z55A 3U6JA 4FGBA 3GU8A 4BIBA 3QQFA 3LFSA 3P5JC 2OO8X 5IQHA 2X8IA 4KIKA 3WF8A 3TUBA 2RFNA 3WOWA 4AW2A 4YZDA 3W0QA 5K4JA 4EKLA 3RAHA 3OMVA 4D4YA 3OCGA 3GU4A 3DNDA 3ZSHA 2CCHA 3GOKA 4ZY6A 3NVMB 5M07A 2GNFA 2YM7A 3IW7A 4E6DA 4ERKA 1V1KA 1YXSA 3PA4A 4ANNA 5EG3A 3TUCA 3NNVA 2YIXA 4FTIA 3MJ2A 4TN6A 5DGZA 4JG7A 2BROA 4UALA 4W4YA 4IAFA 4NKSA 5CASA 4O0RA 1K2PA 2OGVA 4TW9A 4EYJA 4UN0C 5I9YA 4TPTA 2Z7LA 1UKHA 5A46A 2Y0AA 3ZEPA 2I0VA 2W1HA 4KRCA 5M09A 4AX8A 5CANA 4TYIA 2YM8A 1HOWA 5C8MA 4EK3A 4JQ8A 4AT3A 1PXPA 4FNWA 3RAWA 4AA4A 4BTJA 4YBJA 2O65A 5TKDA 3HDNA 1MRUA 4BKYA 1XH8A 3OXTA 5CQUA 4ORKA 3E62A 2QC6A 4ZOGA 1ZOHA 2ITTA 3UIXA 3W2PA 5HLNA 5JFWA 2WIHA 4G3GA 3ZC5A 3L9NA 3II5A 1GZNA 1OMWA 4QNYA 3GCPA 4JI9A 4FA2A 2EU9A 5LMBA 2E9PA 3R7IA 4DH8A 4IZ7A 3AC8A 2ZM1A 4XCUA 5DNRA 3SDJA 2PUUA 4F9YA 2WTWA 4GT4A 4TZRA 4A06A 4WNKA 5HX8A 3BHVA 4BR3A 3IG7A 4MAOA 1S9IA 3O8TA 3PP0A 2CN5A 3N4UA 4BCHA 1FGKA 2OIDA 3GNIB 3MFTA 4RIYB 2FSOX 4S32A 3Q9YA 4Y5HA 5CU6A 5H8BA 4O7WA 2NNWB 4IWQA 3QQLA 4YLKA 4GVJA 4YGAA 3TKUA 3I79A 4E73A 1HCKA 2WMQA 3GP0A 3GBZA 2IWIA 4X3JA 5AUUA 2YZLA 1IASA 2CGUA 5AM6A 4E6CA 4YTCA 1GY3A 2ONLA 4GUEA 5BX0A 3PLAE 3OUKA 4L3JA 3ZBFA 4EH3A 4IC8A 4P90A 2P3GX 2ZV8A 1BMKA 4BCQA 4LV5A 5BVFA 4AXEA 2C68A 4U45A 4DC2A 4AGWA 4A4XA 1B38A 2BDWA 2UZNA 5LARA 4DEGA 4WOVA 3P0MA 5DIAA 3SXRA 1T45A 2P2IA 2YA9A 4HPTE 4NL0A 1OUYA 4G34A 4ZSJA 2YDJA 2VGPA 4O0WA 5ACBC 2C6KA 1RDQE 1V0OA 2DQ7X 4RJ7A 4RVKA 3TV4A 4AAAA 4BBMA 4WG3A 4AQKA 2OJIA 5BMMA 3VBXA 1JWHA 3JYAA 2PZIA 5DBXA 5EM5A 5L8KA 4E5BA 3ELJA 3WF9A 5CAQA 1FINA 2WQEA 4ANLA 5HTCA 5DG5A 3CY3A 5LMAA 3LXKA 5AR7A 5JEBA 4U97A 4E1ZA 3V5JA 5FDPA 3BKBA 4Y83A 4XP0A 1REJA 3A8XA 2QU6A 3C5UA 3R00A 5A4EA 1M7QA 3UIMA 3BLHA 3EWHA 3O23A 1LR4A 5E8XA 1W84A 3DKOA 1URCA 2G1TA 5D41A 3GXLA 4ZLOA 4FBXA 2F2CB 3A4PA 3PY1A 2W17A 3KRLA 2XAOA 2Z60A 3DBFA 5KMKA 4FTRA 2C69A 4BDEA 3DTWA 3HLLA 2W06A 3KXMA 4XLVA 5GIOE 3DBDA 4FGRA 1TFFA 1SMHA 2JIUA 2C5VA 1H0WA 3FC2A 4V0GB 3ZLSA 3QRKA 3W55A 2PE0A 4FZ7A 1ZZLA 3A7HA 2C5XA 3MN3A 4G6OA 3EHAA 3HGKA 3HV3A 4I5CA 3S4QA 4AOIA 4E4XA 3BEAA 2X7OA 3OXIA 3C5IA 3RINA 3REPA 2WMXA 2JFMA 3VUKA 2BZIB 3VRZA 3OD6X 2WQMA 2P0CA 2YITA 5B0XA 2WKMA 4MK0A 5ICPA 2B52A 1X8BA 2QKRA 5DT3A 4C37A 5AAGA 5L6PA 4DFYA 3DAJA 3AQVA 4IW0A 2KULA 5FQDC 3CJGA 4FTAA 3RGFA 2UZDA 3Q52A 5LMKC 1VYZA 3W2OA 2OJ9A 3MIYA 2CKQA 3QZFA 3W10A 4E6QA 3D5VA 3KULB 4P5QA 3FI3A 3FZPA 2OIBA 2X0OA 3FJQE 3QCSA 4QYYA 2GFCA 3R8MA 2YDKA 1RE8A 2OU7A 3NYVA 3NIZA 3K5UA 4H36A 4KA3A 3HYHA 4XG9A 1E1XA 3UE4A 1QPCA 3WIKA 4BZDA 4C33A 3QXOA 4J97A 4FYNA 3ZOSA 2V7AA 1PXJA 4DEIA 4EOOA 4HVSA 1PXOA 5AWMA 3E87A 3WYYA 2F7XE 4GW8A 4IB3A 4FV2A 1YXVA 2XMYA 2J5FA 3I7BA 3PXRA 3TXOA 2XYNA 3EL7A 1XBCA 5M08A 2R3QA 1JKTA 5DLSA 4TTHB 2IW8A 3CCNA 4R1YA 4RZVA 3GUBA 5HE2A 1KV1A 3IONA 3R28A 3VVHA 2BKKA 3U6IA 3PPZA 3I6UA 4L67A 3PXFA 4BCJA 2C0OA 2GQRA 4O7NA 1MRYA 1VR2A 2YERA 4MCVA 5M4CA 3NAXA 5FTGA 2WGJA 3JXWA 3H9FA 4E4MA 4J96A 4E93A 5IUGA 1YRPA 5AP0A 2J7TA 4BGQA 2XA4A 3TDVA 5HKMA 2XM9A 3QCQA 3W8QA 5HTIA 4DFZE 4D55A 4EOSA 3IW6A 2OXDA 5IA5A 5A4LA 2B0QA 3HP2A 4XV1A 5H2UA 4BKZA 3ZRMA 5IQCA 4FOCA 4X21A 3PLSA 1NVRA 1O6KA 2R3GA 2RSVA 3GQIA 5FGKA 4ITIA 4QMUA 3RVGA 3UDTA 1JKKA 4L01A 2EXCX 2FVDA 2PE2A 3DS6A 4FTQA 5HESA 5L2WA 4OTHA 2C6EA 1YVJA 1ZAOA 4OTQA 4RIWB 4BWKA 1JLUE 5KMNA 2R3IA 2UZUE 2VGOA 4RA4A 5DRDA 4FV6A 2VN9A 4UMRA 1GAGA 4W4XA 1KWPA 1TVOA 2OZAA 2XUUA 5EOLA 1G8SA 4DHZA 1ZLTA 4IX4A 3W32A 3IQ7A 4C4HA 4L68A 3VF8A 4OT6A 5G6VA 3CBLA 5CU2A 3PVUA 3C0HA 4XOYA 4F4PA 5I9ZA 4YUQA 1AD5A 3E8DA 3UYSA 1YKRA 4NEUA 1FVVA 1NVSA 4ZK5A 4BDHA 4IIRA 3R7OA 1Q5KA 4RJ8A 5IA4A 1OI9A 5DFPA 4FKGA 4I22A 3V8TA 5I3OA 4FKJA 4J8MA 4Y85A 3MFSA 2ITOA 3QTRA 3KL8A 3UG1A 5J1VA 2XNGA 4IC7A 1CMKE 3DPKA 1Q61A 4F70A 5B2LA 1ZYDA 3TCPA 4CD0A 2HWOA 4QMMA 1WBVA 5DVRA 2J0KA 1MQBA 4I4FA 4QMQA 4ALVA 5I9VA 4JAIA 1CKPA 4BDAA 3C1XA 4OUCA 3W16A 4RWIA 3D15A 4I5PA 1G8KA 3M1SA 1MQ4A 1WAKA 4WD5A 3UJGA 4EJ7A 3OWPA 5FBNC 3RPSA 4D1ZA 4O2PA 3AOXA 2JGZA 1WFCA 3AMYA 4G3FA 3IS5A 4X2KA 3PWDA 2AQXA 1WBOA 2XCKA 4RC4A 5EKOA 1R0PA 3M2WA 4ZTQA 3SXFA 4EK4A 4RIXA 4JQ7A 3AD4A 3W2RA 1WVWA 2YWVA 1OBGA 1AGWA 2I6LA 4WSYA 2QOLA 3CGFA 2ONLC 3BWJA 4F9AA 4R5SA 4TWCA 5ANDA 3DXQA 5J7BA 2CGXA 4FTCA 4MD9E 3EQIA 5DR6A 5IA2A 3MA6A 4AOJA 2CGWA 3E63A 3MH0A 2G01A 3PG3A 3PXZA 4DH1A 2B7AA 5C8NA 2XEYA 3BIZA 4NU1A 4NSTA 3G5DA 2V0DA 1U54A 1PRYA 3FE3A 2JBPA 2VTHA 3AT2A 3SOCA 4BWPA 2QR7A 2W4OA 3R7GA 5CEPA 4UXQA 3SD0A 5E4HA 3NUYA 3FMHA 4PMMA 4O7TA 2X2KA 3KKVA 3MIAA 3TZ8A 3CEKA 5BV3A 4NW6A 4O0XA 3CR0A 5H3QA 1M2PA 4NH1A 2ZMDA 5CEQA 2WQBA 4NZWB 4DHIB 2WTVA 1VYWA 5HVKA 2X8EA 4GH2A 4YPSA 2PVMA 4EHEA 3VBVA 2LGCA 4O38A 2BFXA 3Q60A 2ITUA 2OK1A 3EQGA 5FEDA 2UW7A 3LJ1A 3IPHA 3LCOA 5CNNA 4TWPA 4U6RA 2ACXA 4U3ZA 3UO6A 4DEHA 2HCKA 2QLQA 1H00A 3NW7A 5JKGA 2VTQA 3F66A 4PV0A 3QCXA 3O5AA 3ETAA 4ZAUA 3BYSA 2PK9A 3N9XA 1RW8A 3ZUUA 4QMYA 1JSUA 4O6LA 5FP5A 3ZEWA 4FSQA 4KABA 4U5JA 3PP1A 4MH7A 3MH1A 5CVGA 5AP7A 4IAZA 3H4JA 2C6IA 5BUEA 3PXKA 3RAKA 4O1PA 5CS6A 5HE0A 1R39A 2A1AB 3OOMA 3FL5A 1I09A 5A4CA 4D1XA 4UB7A 2OKRA 1LEWA 3IDBA 5AV3A 5AUZA 3QFVA 3ZUTA 2XNPA 2JKQA 4JIAA 4P7EA 1BYGA 4QYFA 2XH5A 4FZFB 4XUFA 4GT3A 3ITZA 3PJ8A 4KIKB 4PQNA 3IGGA 3UZPA 2YEXA 3AKKA 3FMNA 3UZRA 2UW5A 3RCDA 3ET7A 3R73A 3C7QA 4QQCA 4K18A 3AC2A 4N4SA 3ZLWA 3DK3A 2R3HA 4HVHA 4YBKA 3QHWA 3G15A 3OROA 3CSVA 2ITZA 3CKWA 3OWJA 4M0YA 5C8KA 5HIEA 4AW1A 2ZOQA 3OEZA 3NWWA 1GJOA 5CNOA 4IXPA 5LQFA 3MGYA 2BRGA 3NLBA 3S0OA 4GS6A 4AZWA 1H24A 4IMYA 5CX9A 1K3AA 2FGIA 5TF9A 4B8MA 4F7SA 4MBLA 4M8TA 3UZTA 3ORMA 2AC5A 4I5HA 4K11A 3M11A 3OCTA 4DT8A 2B4SB 2RFEA 3EZVA 4YHFA 2RG5A 2I40A 3D7TB 3L8SA 3PG1A 3UYTA 3ZO4A 4ALWA 4AN2A 4AXDA 3FHIA 4S2ZA 5CAUA 3DA6A 4XBUA 1FPUA 4JJRA 4N6ZA 2VTOA 1FMKA 3FMDA 4AZVA 4EC8A 4PDYA 5K5NA 2IPXA 3CE3A 5AUXA 2WD1A 4S34A 3MVHA 4TXCA 4XBRA 2LAVA 1U59A 4EBVA 4FMQA 1U5QA 4JL9A 4R7HA 4OW8A 3LIJA 4F0GA 4ITJA 3TIYA 4FEUA 4I6QA 3W2CA 4F64A 4XRJA 3ALNA 3SHEA 2WTDA 4FKLA 3UDBA 4OTFA 5F4NA 5AP1A 4FEWA 2W4KA 4FSZA 4UWCA 3FEGA 3FZTA 3OUNB 2WMTA 1HCLA 4AFEA 2R4BA 3TZ7A 3VS3A 5LJJA 5M4UA 4QPMA 2EB2A 1NXKA 2QOHA 1YW2A 3GC7A 4YO6A 3OCBA 4O0TA 5CF5A 5L8LA 4RBLA 5KMLA 3I6WA 2BKZA 3P23A 4G6LA 2PYWA 4FI1A 2JAMA 4RA5A 4IQ6A 3IKAA 3U54A 2YACA 5EM6A 4AE9A 3UIBA 3RBWA 3PFQA 5IQEA 4LRKA 4A9TA 4FVQA 5FM2A 3UP7A 4D5HA 4IVDA 3IW8A 3ACJA 4EWQA 4DA5A 5DR2A 3CTHA 3GC9A 3QQUA 3DXPA 4GV1A 4DH3A 3FL4A 3QUEA 1WMKA 4BI1A 3DTCA 4FSMA 3BRBA 4OTGA 3LE6A 5G1XA 2W1GA 1Z57A 5EW3A 3ZBXA 3NSZA 3QZHA 3DQWA 1OVEA 2A19B 2RKUA 3DFAA 3RZFA 4C4JA 4WHZA 4FKWA 1PJKA 4ZMFA 1YWVA 2WMVA 3BGPA 4NJ3A 1SM2A 4EHZA 4ASXA 2BZJA 5CENA 4UX9A 2WMWA 2WU7A 3VUTA 2FB8A 4MF0A 4NM5A 4JMQA 4FSRA 5HZNA 3NW5A 1TQIA 4DHFA 3EOCA 3MV5A 4ANBA 2XF0A 3F6XA 2XP2A 2CSNA 2B53A 5E91A 2GPHA 3VBWA 2O3PA 3G9NA 4X2FA 3RNIA 4KKHA 5AP3A 3O2MA 3IECA 4YTFA 4CMTA 3P5KA 5KBRA 4NM7A 4KBKA 4IWOA 2BZHB 4U8ZA 4HCUA 3DY7A 1A06A 4DINA 5E8YA 1XMLA 4JRVA 4A07A 1O9UA 1Q8WA 2ITNA 4QTAA 5AP4A 5IISA 2R9SA 4XG6A 5LVPA 2QOOA 3CXWA 1GZ8A 4FE2A 5HBHA 3QF9A 4TWOA 3TV6A 4UXLA 3EQHA 5B2KA 4MQ1A 2C6MA 3NCGA 3QUPA 4HVDA 1PKDA 2IZRA 3D5XA 4MXAA 5CVHA 4R8QA 4WKQA 4L44A 3VHEA 5AUVA 3Q4UA 1E9HA 4PUZA 5IMXA 2OW3A 3PFYA 5HIBA 4I24A 5CU0A 5CSPA 2R3FA 2X7FA 3PY3A 4E4LA 1UU7A 3F88A 4D0WA 3R63A 1ZYCA 3B8RA 3I0OA 4YPDA 5EYKA 3ZTXA 2CDZA 3QCYA 1P14A 2WTIA 2PVNA 3DLSA 4M84A 3RALA 3HA6A 5M57A 5D7AA 2GTMA 3P4KA 3LFAA 1CDKA 2XKEA 3DBQA 3WE4A 5K9IA 1VLRA 5CQWA 2HOGA 4J1RA 4I0RA 4J71A 5BYYA 4AZTA 4EQUA 3AXWA 1UA2A 4MXYA 2E2BA 3SOAA 4EORA 4U43A 3PVWA 1J1CA 3EFJA 3C0GA 3BU3A 3ZFXA 4DGGA 2ZV7A 4U81A 3SXSA 4F9WA 3KGAA 4KB8A 1ZY5A 4YO4A 4CFVA 3PIZA 2O5KA 4FZAB 3UQFA 2F7ZE 2QQ7A 4Z3VA 3FI8A 3KN6A 5A4TA 2ITQA 5IUIA 3D14A 3NUNA 3Q9WA 2V62A 1Q3WA 3DNEA 3LXLA 2VD5A 3PZEA 5A9UA 1WBSA 2P4IA 1KE7A 1XKKA 2C6DA 2VWYA 3EQRA 4LI5A 4M69B 3VAPA 2VTPA 3VS5A 3UGCA 2QKWB 4QTCA 4AW5A 4WO5A 4RFMA 3UP2A 3ZO1A 4G9RA 4QYEA 4XEYA 5HNGA 3CPBA 1OECA 2C5YA 3KMWA 1ZMUA 4XYFA 2QOCA 2UW0A 3NYOA 4HYIA 4O27B 2X6EA 4YJNA 1SZMA 4DTKA 4J99A 4YZNA 4USDA 3DGKA 4ZZMA 3OP5A 3QA8A 4PWNA 5K0KA 4FEQA 4KBAA 4ZSAA 5J87A 4O7RA 3A2CA 3RPRA 2C3IB 1KOBA 3FI4A 3QL8A 4GU6A 4IDVA 2BRBA 4RQVA 4XX9A 4Z9LA 4WBBB 5A4QA 1GIHA 4CSVA 3OHTA 4NCTA 2WTKC 4PP9A 3LW0A 4U40A 2WNTA 4BIEA 3R1QA 3ZCLA 1PMEA 3LFNA 1H08A 3PUFC 2VO0A 2PULA 4DTAA 2IVSA 4S31A 5F94A 4DCEA 3HV4A 5HOAA 2OZAB 3ZSIA 4QEBA 3VF9A 2Y8OA 3DJ6A 4R1VA 1Q97A 4PMTA 5M4IA 2B55A 4KD1A 4O0VA 5E8SA 1Y6BA 4LDTA 2YCRA 4DGNA 2O8YA 5C27A 3COIA 3BI6A 3LFDA 4HJOA 4MX9A 4C7TA 4LM5A 3KB7A 2G2IA 3RPVA 3SW7A 4ZMEA 1XR1A 1WBPA 5DT4A 5HD4A 2VTJA 4IVAA 4U79A 5FD2A 3L9LA 5BYLA 3Q4TA 4RRVA 1YWRA 3C9WA 5E7RA 3UDZA 3F82A 4XNEA 3OOGA 4BI2A 4BJJA 2OF4A 1E1VA 4EH2A 2WMSA 1ZOGA 4R3RA 3ZU7A 4I6FA 4EOQA 3CLYA 4C62A 2R3MA 4CFNA 2BFYA 3R01A 4U3YA 3C51A 3E93A 3IOKA 3PUPA 3RKBA 3E7VA 4BYJA 4MNEA 3NFGB 1LPUA 4EK5A 5I5ZA 4XP3A 2JKMA 2EVAA 3EN6A 4YJTA 4EOKA 3ZZWA 3E8NA 4YTHA 2IVVA 5A3XA 1YDTE 4C34A 2C4GA 3SVVA 1UU9A 4CG8A 3RM7A 5DHJA 2EWAA 3RMFA 5CZHA 3BYMA 4BDDA 4EH5A 1VEBA 5HBEA 3FY2A 4II5A 1YXUA 5IPJA 3OCSA 5GZ9A 3EQFA 4L7SA 4AE6A 4RIXB 3C4CA 5IQIA 4YLJA 5E8UA 3BHHA 4JQEA 3KEXA 3KRJA 2C0TA 2VTLA 4OTDA 3H9OA 3UODA 3EQCA 2EXEA 2ZM3A 3LLTA 5H9BA 4BDBA 4RC2A 4DGLC 4CKRA 1OL5A 3SQQA 3VO3A 4D28A 3ORNA 4H1MA 3FXZA 4GYGA 4DLJA 5J5SA 2W96B 3BHUA 1YXTA 5BVDA 1U54B 4FT7A 4EH8A 3UPZA 3W0SA 2R3PA 2BDJA 4ASZA 4IAIA 1OKZA 3HMOA 4YHJA 4XS2A 5M06A 3H0YA 4G9CA 5JH6A 4O7ZA 3POOA 3HNGA 3C0IA 1XHAA 4GFGA 3H30A 3QD4A 2ZDTA 2QOBA 4L9IA 4ANOA 1OPKA 1PYXA 1W82A 2P2HA 3PA3A 2R3RA 3QD3A 2NP8A 2WB8A 3ORLA 1YOMA 2C1AA 3V5LA 4FG8A 2I0YA 3OTUA 4IBMA 4IANA 4PTCA 4UMTA 3F61A 5CZIA 5FBOA 4MHAA 3O8PA 3RNYA 3VW8A 3R1NA 4RPVA 2FH9A 4H58A 2WEVA 5AP5A 5HVJA 4LOPA 5C26A 4FZ6A 4FICA 3BE2A 2ERZE 2ETMA 1SYKA 3BGQA 2W1DA 3NDMA 3ORIA 1VJYA 3MW1A 3P78A 2IJMA 5M51A 2F7EE 5C1QB 4XG3A 3HMMA 3SA0A 4FKRA 3R7VA 4RVTA 3IO7A 4IWPA 4O91A 4AF3A 5BUJA 3R0TA 4I21A 3JVSA 5C4LA 2X7GA 3W8LA 2PVFA 5LVLA 4FSTA 2XS0A 1V0PA 3KK8A 4LL0A 2GFSA 3NS9A 3V5TA 5IUHA 4BVUA 4DFLA 5EI2A 4ZS4A 5GZAA 1OIYA 5KMOA 1WVYA 3QKLA 2JBOA 1OL2A 4PY1A 3F7ZA 1H1RA 2YJSA 2HXLA 5ETIA 3V8WA 3LKMA 4RFYA 4I6LA 3R2YA 4QP1A 4YC8A 3KRXA 4R7BA 3Q96A 4J8NA 3AT4A 5H8GA 1QMZA 2OXXA 4QD6A 3FPQA 3VW6A 4EQCA 3W0PA 4FV4A 4NTSA 4QDEA 4NFMA 4ONAA 4IVCA 4R6VA 2YIRA 3SG9A 2B9HA 3UG2A 2Z02A 1O6LA 4TYHA 4ANSA 4IFCA 5CYIA 5E1SA 3TG1A 4M67A 5HE3A 3PSCA 4EK6A 5ANIA 1YDRE 2VWBA 5KHWA 4O4FA 3JPVA 4TYEA 4N6YA 4RWLA 4ARKA 2JDVA 4C3PA 3VQHA 4F09A 3HUBA 3PRIA 3ZH8A 3BEGA 2R3JA 3BL7A 4FNZA 4G3DA 4CMOA 3KVWA 4PP7A 4W8DA 3OBGA 3GU5A 3MJ1A 4O22A 5IF1A 4CTBA 3DZOA 5BVEA 4QMTA 4JX3A 4K2RA 3HP5A 3OTVA 3UO4A 4FL1A 3WE8A 4GJ2A 3LOKA 3A7JA 3I7CA 3FC1X 3PVBA 4Y46A 4FG9A 4FEVA 1UV5A 3KXHA 1P5EA 4JDIA 3Q5IA 4LMNA 5KMJA 2YJRA 5DEWA 2E9VA 4H1JA 4EH4A 5JSMA 4GEOA 4TYGA 2PVRA 4YJQA 2VV9A 4IM0A 4ZLZA 4AUAA 2UW4A 5IQGA 3MVLA 4HNIA 2JC6A 5GINE 2OF2A 3FBVA 4LOQA 4X2NA 4HW7A 5M4FA 3HRCA 4P5ZA 4U44A 3L8VA 3ZMMA 4AN3A 4BCMA 1ND4A 5ANGA 3QU0A 4TKSA 2BTRA 2PE1A 4FIEA 4NCTC 1JKSA 3LFQA 2OFVA 3SRVA 3R04A 4MXCA 4O0UA 5JK3A 2QOQA 4CYIA 3LHJA 3R9NA 2XJ0A 2RG6A 5TT7A 5CEMA 2YCFA 4ZS0A 4JNWA 2I7QA 2PSQA 2YCSA 4KSPA 3W2SA 1IA8A 3NUUA 4IB0A 4IB1A 4E5AX 2HYYA 3GU6A 4P4CA 3RJCA 3KQ7A 2WMRA 3MTLA 5GJGA 5IA0A 3GCUA 3BLRA 5AV4A 2VTIA 4GRBA 1OPLA 1UNHA 4MKCA 4M14A 1W8CA 2GNHA 4L3LA 5HCYA 4DAWA 1ST0A 2BHEA 4LGGA 3QTSA 4FTKA 5EOBA 1ZMVA 5AR3A 4QMPA 5HG5A 2OZOA 4CT1A 1PYEA 4J52A 4ACMA 1ZYJA 2OJFE 3KN5A 2FSTX 4LGHA 4RC3A 4BZNA 4HPUE 4ZLYA 4BDFA 1J7LA 5M44A 5FXQA 3D0EA 4FJVA 4B4LA 3IDPA 5HLPA 5JGAA 2WIPA 3VWAA 3TNHA 3O7LD 3EFLA 3TJDA 4MXXA 4NIFA 3QYWA 4F08A 4FUXA 5L3AA 2Z7QA 2G9XA 4QP3A 3G90X 4O4CA 4ZIMA 3KXXA 2HELA 4FOBA 4AP7A 4UWBA 4IM2A 5HORA 3KVXA 3EN9A 5IU2A 3HMNA 5HVYA 2J2IB 4HNFA 4G3CA 3P1AA 5HIDA 5J1WA 1WZYA 4FV0A 3I0QA 1F5QA 2NO3A 3O96A 3PJCA 3DV3A 3QAME 5IKWA 3WF7A 5EYCA 3FWQA 3TNQB 3VUMA 4KIPA 4BICA 5BVOA 2JD5A 4M68A 3DFCB 3ZLYA 3O7LB 4ANQA 4U0IA 4GG5A 4F99A 2BR1A 5IA1A 1IA9A 5FG8A 3Q9XA 3QZGA 2JAVA 1XH4A 4EOPA 2BZKB 2J5EA 3MY1A 3ODZX 4FIHA 4RX8A 4N0SA 4EHGA 4HVIA 4QMNA 3F3TA 3O0GA