1YWCA

Structure of the ferrous co complex of np4 from rhodnius prolixus at ph 7.0
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
184
structure length
184
Chain Sequence
ACTKNAIAQTGFNKDKYFNGDVWYVTDYLDLEPDDVPKRYCAALAAGTASGKLKEALYHYDPKTQDTFYDVSELQVESLGKYTANFKKVDKNGNVKVAVTAGNYYTFTVMYADDSSALIHTCLHKGNKDLGDLYAVLNRNKDAAAGDKVKSAVSAATLEFSKFISTKENNCAYDNDSLKSLLTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ultrahigh Resolution Structures of Nitrophorin 4: Heme Distortion in Ferrous CO and NO Complexes
pubmed doi rcsb
molecule keywords nitrophorin 4
molecule tags Ligand binding protein, blood clotting
source organism Rhodnius prolixus
total genus 49
structure length 184
sequence length 184
ec nomenclature ec 1.7.6.1: Nitrite dismutase.
pdb deposition date 2005-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02087 Nitrophorin Nitrophorin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 1ywcA00
3BSZE 2F73A 4NLIA 3EM0A 3FIQA 4Y0SA 1A18A 1CBIA 2NNDA 1FE3A 5IO7A 1ERBA 2CM4A 2ALLX 1ADLA 2FR3A 1GKAA 4EEJA 5F6BA 1IKJA 5EDBA 1BM5A 2QOSC 4TKJA 3P6EA 1CJ5A 1OPBA 2L5PA 4ZGUA 3U9PC 1MDCA 3APVA 4QGWA 5D8JA 2N93A 2AMMX 3VG5A 4OMWA 1LKEA 3NX1A 1BSYA 5F7GA 4DQ4A 1D2UA 1DC9A 5F6ZA 2AL0X 2AH7X 3FR2A 5IO5A 4A60A 3WXQA 4ZHDA 2HYSA 3KFHA 4Y0RA 1HMSA 2A2GA 4YCHA 2E4JA 1ZNHA 2WEXA 4ORUA 5LJBA 3PH6A 3WJDA 3HWGA 1I04A 1BSOA 1EW3A 1VPRA 2G79A 3BX7A 1CBSA 5KHPA 5HCCC 4YGGA 3HWFA 2Q2MA 5C0NA 2LBAA 4OS0A 4ALOA 5JR8A 3BU9A 4RUUA 5FENA 1B56A 2L67A 1U17A 1JZUA 2EU7X 4DQ3A 4NLJA 1QY1A 4YGHA 1TOWA 4YGZA 1YWCA 1SY2A 4XMCA 4ZHCA 2WQ9A 5LKFA 4A1YA 3NQ9A 1NP4A 5CE4A 1QWDA 4IBAA 3WJBA 1TVQA 3BU1A 4I3BA 1LIDA 4M6SA 3HWDA 3I17A 3RSWA 1BRPA 1SY0A 1OBQA 2FRSA 3AKNA 3FMZA 2R56A 4O9SA 2QO6A 3CR6A 3PPTA 1GT5A 2WEWA 3I0AA 1MVGA 1PEEA 4IB9A 2MO5A 2AT8X 1EUOA 2KT4B 1X8OA 3CQRA 3ZQ3A 4EFGA 4ZHGA 3FA7A 3STNA 1KOIA 2HZRA 2LKKA 1R0UA 1UZ2X 3Q6LA 1XCAA 4GETA 4IB6A 1E00A 4YH0A 4ZCBA 2WR6A 1EIOA 3FR5A 2NNEA 1DFVA 1NGLA 4NYRA 1EALA 1PBOA 4I9SA 3WVMA 3FELA 4N7DA 2WUTA 4D6AA 2OFRX 2QO5A 3SAOA 5LJCA 1LIFA 2JU7A 1T68X 3B2KA 1ML7A 5F58A 4N7CA 2MJIA 3FEKA 1AELA 1VYGA 4UU3A 4EXZA 3OJYC 5KICA 1LPJA 2W2BA 3AKMA 5L8NA 1U0XA 4KIIA 4GRJA 2YG2A 3APUA 3DTQA 2LB6A 1KZXA 1B8EA 1HN2A 3KQ0A 2Q9SA 5D48A 5HZ8A 1KT6A 3P6CA 2AKQA 5HBSA 3UEWA 2WQAE 1DF3A 1BJ7A 1O1UA 1S2PA 2HMBA 2OZQA 4YBPA 1I05A 4PSQA 1MUPA 5B27A 5LJDA 1DV9A 3TF6A 3NR3A 1KT7A 2OVEA 4TQ2A 3F8AA 2Q39A 2A13A 3IA8A 2CZUA 2K23A 5D45A 5H8TA 2P8GA 1QY0A 3B2LA 1N0SA 3TZSA 1BEBA 1GKAB 4OS3A 2X45A 2A3FX 3NX2A 4ORSA 3TGAA 3NPOA 5FAZA 4ZJ0A 2RCTA 1IIUA 4A8ZA 3T1DA 4AYHA 2NNQA 1QG5A 4TKBA 2OFMX 2MM3A 5LJEA 4QZUA 2ACOA 2HLVA 5EEEA 1YP7A 1OEJA 1RBPA 3NQ3A 5HTEA 1QABE 4WFVA 5HA1A 1OPAA 1GT4A 1B0OA 4AZNA 4AZOA 1U18A 2FT9A 4LZUA 2DM5A 4BVMA 5EEDA 3ZUOA 2CBRA 3MVFA 5HWZA 1KT4A 5LKEA 4GE1A 3P6FA 4YFPA 1HMRA 1O1VA 4ORYA 1OEKA 4QZTA 3STKA 1SXYA 1SY1A 5AQ6A 2W2AA 3CWKA 3STMX 4ZHFA 5HTDA 4I3DA 2QM9A 3P6GA 2G7BA 5D47A 4HPCA 1KQXA 4ORRA 1OBPA 3KFIA 1EPAA 1EQDA 1GXAA 2R74A 4XMHA 1FDQA 4ODDA 4AZRA 2FS7A 3GAQA 1VYFA 3KFFA 2RQ0A 4I3CA 4MVLA 3FENA 1BLRA 1RLBE 1SY3A 1X89A 1EPBA 4WBKA 3B2IA 1KT5A 3MBTA 1E02A 5KIDA 3ELXA 3APWA 4ORWA 4YDAA 1DZMA 4YMYA 3C76X 4YFRA 3ELZA 1JBHA 3O2YA 5HCDC 2ASNX 1BWYA 1HBPA 2JN3A 2XKLA 3U03A 3BDRA 3CBSA 4QYNA 3APXA 4YKOA 4AZQA 4IB7A 1CBQA 4ZH6A 3WJEA 2OVDA 3BX8A 1X8QA 1HMTA 3KZAA 1A2DA 1ACDA 4HPDA 1E5PA 5BVSA 4QYPA 4WFUA 1GX9A 3HK1A 1ZNKA 5HZ5A 4ARHA 3VG2A 1ZNDA 3CBCA 3WJFA 1E06A 1TXLA 1P6PA 4IMNA 4TKHA 1O8VA 2W2FA 1LIBA 2WWPA 1CBRA 2RD7C 5HA0A 5EZ2A 1X8PA 3WJCA 1YP6A 3WBGA 1HBQA 1Z24A 5F1EA 3BY0A 1QQSA 4NNTA 1YUPA 5DG4A 5EPQA 1ZNEA 3CMPA 2R73A 4XMGA 3L4RA 1BBPA 1B4MA 2HZQA 1GT1A 4M7MA 1S7DA 4GKCA 4HPAA 1HQPA 4IAXA 5FFHA 3C77X 4NP1A 2AT5X 3JS1A 2AT6X 3RZYA 4A1HA 1KZWA 3VG6A 1T0VA 1ICNA 4RUNA 2RA6A 2ACPX 3B2JA 1SA8A 1A3YA 2CM9A 5H9NA 2POAA 4I9RA 2JU8A 1FENA 1OEEA 4YBUA 3TGBA 3F9DA 4R0BA 3VG4A 1G5WA 2K62A 4YDBA 4NYQA 2FS6A 2PY1A 4YCEA 1YWAA 1LIEA 4TNNA 2JOZA 1EIIA 1S44A 3P6HA 5D4AA 3JSQA 1AB0A 3EMMA 1A57A 3D95A 4TLJA 1G85A 1AQBA 4GNYA 4IB8A 3UEXA 5K06A 1QY2A 3C78X 1IFCA 2A0AA 3EBKA 1JV4A 4AZMA 4LZVA 3O22A 4ZR2A 4ORXA 5HCEC 2GTFX 1OBUA 1QFVA 4LKTA 4ES7A 1L6MA 4YKMA 4HFOA 3EYCA 3P6DA 1SXXA 1QFTA 1X8NA 3HWEA 3FR4A 3O19A 1I4UA 5L8IA 3FW5A 2A2UA 1MX7A 3QKGA 1XKIA 3NADA 1LNMA 4HPBA 1X71A 1DZKA 2X46A 1KT3A 1TOUA 1IW2A 3VG3A 1PM1X 4YFQA 1AVGI 1KXOA 4MVKA 4GNWA 5HZ9A 1D3SA 1KGLA 4K19A 1YWBA 3BRNA 5LJGA 5HZ6A 2FTBA 5IO6A 3D96A 3S26A 1ZNGA 1JJXA 1PMPA 4UU2A 1CRBA 2GC9A 2ANSA 3G7XA 1FTPA 2GJ5A 2Q4NA 3WJGA 3FA9A 4Y0QA 4CK4A 3PH5A 3UEUA 3BS2A 4XMFA 2AT3X 1FEMA 2FWVA 1DZPA 3KFGA 3VG7A 1TW4A 1GM6A 3PEDA 1I06A 1JYDA 3DSZA 1MX8A 2AT0X 3FA8A 3IFBA 5H9AA 3U0DA 2Q2PA 4XMDA 1G74A 1X8UA 3EBWA 4MVIA 1JJJA 4ZH9A 5DPQA 1LFOA 1T8VA 5B29A 2O62A 1YWDA 2XSTA 1DZJA 4NNSA 2CBSA 3D97A 1IKEA 4IMOA 2BLGA 5LJKA 5BVTA 5BVQA 3FLLA 2L9CA 4QGVA 1LICA 2QO4A 4QAEA 1ZRYA 1SXUA 2G78A 3ZUIA 5H9LA 5EDCA 3BLGA 4EDEA 1FELA 1JYJA 2LBVA 1NP1A 1GX8A 4Y0PA 5HZQA 4BQUA 2RCQA 4BOEA 1G7NA 5H9KA 3CQNA 2FLJA 1KQWA 4TJZA 3FW4A 1BRQA 2JU3A 1YIVA 4D6BA 4AW8A 5LJHA 1ERXA 1ICMA 1ZNLA 2OVAA 3PECA 5HAEA 4QGXA 1H91A 1SXWA 4ALBA 4LKPA 3TGCA 3NP1A 3PP6A 1IFBA 2FR2A 4OMXA 4ZHHA 2KTDA 2LFOA 4AZPA 3K3LA 2HNXA 4IAWA 5L8OA 4GH7A 4ZFXA 1LF7A 4XMEA 1EXSA 1GT3A 1UREA 2L68A 3UEVA 3B2HA 4OS8A 1ALBA 2NP1A 2IFBA 2WSJA 3FA6A 3FEPA 1BSQA 1GGLA 2CZTA
chains in the Genus database with same CATH superfamily
3BSZE 2F73A 3T6LA 4NLIA 3EM0A 3FIQA 4Y0SA 1A18A 1CBIA 3VPJE 4U8UO 2NNDA 1FE3A 1SWBA 4I95A 5IO7A 1ERBA 2CM4A 4GGZA 5B11O 3N91A 2ALLX 1SMPI 4PJ2A 1ADLA 5AJBA 2FR3A 1GKAA 4CPEA 4EEJA 2HKDA 5F6BA 4BGFA 1IKJA 5EDBA 1BM5A 5BYPA 2QOSC 4TKJA 3P6EA 4I60A 1CJ5A 1OPBA 2L5PA 4ZGUA 3U9PC 1MDCA 3APVA 4QGWA 5D8JA 1GX3A 2AMMX 2N93A 4OMWA 4NV7A 5FQ6E 1LKEA 3NX1A 1BSYA 4NV8A 5F7GA 4DQ4A 2Y3FA 3RDSA 1W6FA 1D2UA 4BCSA 1DC9A 5F6ZA 4ZJ0A 2AL0X 2AH7X 1Y52X 3FR2A 5IO5A 4FBOA 4A60A 4O3XB 3WXQA 4ZHDA 2HYSA 3KFHA 4Y0RA 4Z6JA 1HMSA 2A2GA 4YCHA 2E4JA 1ZNHA 2WEXA 4ORUA 5LJBA 4ML7B 1SREA 3PH6A 3RWXA 3OE3A 3WJDA 3HWGA 1I04A 1BSOA 1EW3A 1VPRA 2G79A 3BX7A 1CBSA 4GD9A 5KHPA 5HCCC 4YGGA 1HXZA 2Q2MA 3HWFA 5C0NA 2LBAA 4OS0A 4ALOA 5JR8A 5IXGA 3BU9A 4RUUA 5FENA 1B56A 2L67A 1U17A 1JZUA 2DJFA 2EU7X 4GUZA 4NLJA 1QY1A 4DQ3A 1LCVA 4L3RA 4QNIA 3HOEA 4YGHA 1TOWA 2GTLM 4Z27A 4U8UN 4YGZA 1YWCA 1SY2A 4XMCA 4ZHCA 2WQ9A 2RTKA 3RDUA 4O49A 5LKFA 4A1YA 3NQ9A 3HOLA 1NP4A 2BC3A 5CE4A 1QWDA 2RTDB 4GDAA 4IBAA 3WJBA 4IABA 1TVQA 3BU1A 1SLGB 2JGSA 2RTCB 4I3BA 1LIDA 3RDXA 1MM9A 4M6SA 4O4UA 3HWDA 3I17A 3RSWA 1BRPA 1SY0A 1OBQA 1KL3A 2IZKA 2FRSA 3AKNA 3FMZA 2R56A 4O9SA 2DJGA 2QO6A 3CR6A 3PPTA 4U9CA 4L1NA 1GT5A 2WEWA 3I0AA 1HY2A 1MVGA 1SRIA 3P24A 4IB9A 1PEEA 2MO5A 2AT8X 1EUOA 1EALA 2KT4B 3E3CA 3OBLA 1SWJA 1X8OA 2BSZA 3CQRA 3ZQ3A 4EFGA 4ZHGA 2IZGB 3FA7A 3STNA 4GU8A 1KOIA 2HZRA 2LKKA 1R0UA 1UZ2X 3Q6LA 1SRFA 1XCAA 2KW1A 1E00A 4GETA 1VWKB 2WR6A 4IB6A 2C1SA 4ZCBA 1EIOA 1SWPA 1HQQA 1SWUA 3FR5A 5JD2A 1MEPA 1K3BA 2RTNB 1OSPO 1SLFB 2NNEA 3UAQA 1DFVA 1NGLA 1HXLA 4NYRA 2AF5A 1PBOA 4I9SA 3WVMA 3FELA 4GK9A 2WUTA 2F09A 4N7DA 4FQBB 4D6AA 2OFRX 2QO5A 3D4RA 4U46A 1KFFA 1Y55X 3SAOA 5LJCA 1LIFA 2JU7A 4O4XA 5B3MO 1T68X 3B2KA 1ML7A 1WUBA 4N7CA 2MJIA 5F58A 3FEKA 1AELA 1VYGA 4UU3A 4EXZA 3OJYC 5KICA 1LPJA 2W2BA 3AKMA 5L8NA 3ZI8A 2RTIB 1U0XA 4KIIA 1RXHA 4GRJA 2C1QA 1RSUB 2YG2A 3APUA 3NQKA 3DTQA 3X00A 2LB6A 4Z2VA 1KZXA 1B8EA 1HN2A 1VWRB 2BHVA 1SRGA 2QOMA 2Q9SA 3KQ0A 5D48A 5HZ8A 1KT6A 3P6CA 2AKQA 1MOYA 5HBSA 3UEWA 2WQAE 1DF3A 2G8CO 1STRB 2OF9A 4KC8A 2OY7A 1SWRA 1BJ7A 1KL5A 1O1UA 1S2PA 2HMBA 1AVDA 2OZQA 4GZVA 1I05A 4PSQA 4YBPA 1MUPA 1JIWI 5B27A 1PTSA 5LJDA 2OL8O 1DV9A 3TF6A 3WZOA 3NR3A 1VWQB 1KT7A 2MHDA 2OVEA 3QQ2A 4TQ2A 3RBYA 2BT9A 3VGWA 3FIDA 2IZIA 3F8AA 3NBXX 4KCAA 2X8TA 2Q39A 2A13A 3IA8A 4O4OA 2CZUA 2K23A 3GE2A 5D45A 5H8TA 4BX5B 1N43A 1QY0A 1SWSA 2P8GA 3B2LA 1N0SA 3MG5A 3TZSA 1BEBA 1GKAB 4DCBA 4OS3A 2X45A 4ON1A 4BX5A 4Z2PA 2A3FX 3NX2A 4ORSA 1STSB 3TGAA 3NPOA 5FAZA 4MISA 1SWHA 1I78A 1RAVA 2RCTA 4CDFA 1IIUA 1SWCA 1RXKA 2OL7A 5K67A 1EI5A 2A5CA 3PQUA 3T1DA 3SZJA 4A8ZA 4AYHA 4Z2OA 2NNQA 2KTSA 3VHMA 1QG5A 4TKBA 2OVSA 2OFMX 2MM3A 2OYBO 5LJEA 4QZUA 2ACOA 2HLVA 2RTFB 5EEEA 3SLJA 4CDCA 1SWLA 1VWBB 3JQOA 1YP7A 1OEJA 1SLEB 1RBPA 2OFAA 3NQ3A 3P02A 1SWAA 5HTEA 1QABE 2UYWA 4WFVA 1LUQA 5HA1A 1OPAA 1GT4A 1B0OA 1Y9TA 2FGSA 2I5VO 3LTWA 5K68A 1U18A 4AZOA 1JMZA 2IZEB 3RDOA 4AZNA 2FT9A 3S5VA 1UYOX 1VWIB 2OL6O 4OEMA 5F2BA 4LZUA 1Y9LA 4MVEA 5CSEA 3T6FA 2DM5A 4BVMA 5EEDA 3ZUOA 2CBRA 3MVFA 5HWZA 1KT4A 2RTBB 5LKEA 4GE1A 2GTLO 3P6FA 2LA7A 4YFPA 1SWKA 2BS5A 1HMRA 2RTMA 4BX7B 1O1VA 3D9WA 4ORYA 1OEKA 1VWDB 4QZTA 3STKA 3V8UA 1SXYA 4MEEA 2PI3O 1SY1A 5AQ6A 2W2AA 3CWKA 3STMX 4ZHFA 4BX7A 5HTDA 4I3DA 3AUMO 3T2WA 2QM9A 3P6GA 4OKAA 2G7BA 2Y32A 5D47A 4HPCA 2GH7A 1KQXA 4ORRA 1OBPA 3KFIA 1EPAA 1EQDA 1GXAA 2R74A 4XMHA 3SLOA 1FDQA 2FHLA 2Z4IA 2RTHB 3KVNA 4O3YA 4ODDA 4AZRA 2FS7A 3GAQA 1VYFA 3KFFA 2RQ0A 4I3CA 5CYBA 2M4LA 4MVLA 2FKGA 3HTYA 5AEOA 1SWNA 3FENA 1BLRA 1NDJA 1RLBE 1W4TA 1SY3A 4GGTA 1X89A 1EPBA 2X8SA 1SWFA 4WBKA 3B2IA 5FQ7E 1KT5A 3MBTA 1E02A 1SWEA 4YVBA 4GJSA 5KIDA 3VG5A 3ELXA 2Y3EA 3APWA 4ORWA 4YDAA 1DZMA 4YMYA 2KD2A 3C76X 3ELZA 4YFRA 1JBHA 3SZHA 2A5BA 3O2YA 3VE1A 2ASNX 2X56A 1HBPA 5HCDC 2JN3A 1SWOA 1BWYA 2XKLA 3U03A 3BDRA 3CBSA 2UZ2A 3APXA 4QYNA 4YKOA 4AZQA 2IZHB 4IB7A 1CBQA 4ZH6A 1N9YA 3WJEA 2OVDA 3BX8A 1X8QA 1HMTA 3KZAA 2IZDB 1A2DA 1ACDA 4HPDA 1W5RA 1E5PA 5BVSA 4QYPA 2GTLN 1JMXA 4WFUA 1VWFB 1GX9A 2X34A 3HK1A 1ZNKA 4B55A 2IZAA 4ARHA 1VWGB 1ZNDA 3VG2A 3CBCA 3WJFA 1E06A 1TXLA 5B2AO 4Z28A 1P6PA 3S5XA 1IJ8A 2X55A 4IMNA 4TKHA 3VHIA 1O8VA 4I6SA 2W2FA 1LIBA 2WWPA 1CBRA 2RD7C 2OFBA 5HA0A 2ZAGA 2Z4HA 5D4AA 5EZ2A 3SZIA 1X8PA 3WJCA 1YP6A 1VWJB 1VWHB 3WZPA 2JW1A 3WBGA 1HBQA 1Z24A 5F1EA 3BY0A 1QQSA 4NNTA 1YUPA 5DG4A 1N9MA 3RY1A 5IRAA 1K24A 1ZNEA 5EPQA 3CMPA 2R73A 2RTEB 4INNA 4XMGA 3L4RA 1BBPA 1B4MA 1VWLB 1GT1A 1LCWA 2HZQA 1S7DA 4GGRA 4GKCA 4M7MA 3RE6A 4HPAA 1HQPA 4IAXA 3WYPA 5FFHA 3C77X 3T2XA 4NP1A 2AT5X 5IRWA 3JS1A 2AT6X 1RSTB 3RZYA 4A1HA 2VFBA 3VG6A 1T0VA 1ICNA 3F6ZB 2RN4A 4ZGFA 4CV7A 1KZWA 4GJVA 2RA6A 2ACPX 3B2JA 4RUNA 1SA8A 2OF8A 2RTAA 1A3YA 2CM9A 4OELA 4KT5A 2POAA 4I9RA 5H9NA 4CSBA 4CDDA 3CKGA 2JU8A 1FENA 1OEEA 4YBUA 2QMIA 3WZQA 4EQAC 3TGBA 4LQZA 4NW4A 2C4IA 3F9DA 4R0BA 3VG4A 1G5WA 5IRUA 2K62A 3EW2A 4BX6A 4YDBA 3ZZVA 3RDQA 4NYQA 1RXJA 2FS6A 2PY1A 4C5PA 1SWDA 4YCEA 1YWAA 1LIEA 4TNNA 2JOZA 1EIIA 1S44A 1N4JA 2F01A 2G5LA 2ZAIA 3EW1A 1AB0A 3EMMA 3JSQA 3MX7A 3D95A 3P6HA 4IRWA 4TLJA 1A57A 1G85A 2RTRB 3RKGA 1AQBA 4GNYA 2X32A 4IB8A 3UEXA 1QY2A 3RDMA 5K06A 2VDFA 2AVIA 1IFCA 3C78X 2A0AA 2OY5O 3EBKA 1JV4A 1SWTA 2RTQB 4AZMA 4LZVA 3O22A 4ID2A 4ZR2A 4ORXA 5B5GA 4CDEA 5HCEC 2GTFX 1OBUA 1QFVA 1LDOA 4JNJA 4LKTA 4O3ZA 4GDZA 4ES7A 1L6MA 4YKMA 4HFOA 3EYCA 1LELA 4JHQA 3H3IA 3P6DA 1SXXA 1QFTA 1X8NA 2IZLB 3HWEA 3PQSA 1DF8A 3FR4A 1VWEB 3O19A 4U8UM 5HZ5A 1I4UA 3PDFA 3FW5A 2A2UA 1KL4A 1MX7A 1VWMB 2BS6A 5L8IA 4EKVA 3QKGA 1XKIA 1SRHA 3NADA 2MF6A 1LNMA 4HPBA 1X71A 1DZKA 1VWCB 1KT3A 1FJ1E 2X46A 3FDCA 3HPEA 1TOUA 1IW2A 3VG3A 1PM1X 4YFQA 1AVGI 1E2TA 1I9HA 1KXOA 3PK2A 4MVKA 1NQNA 4GNWA 4BJ8A 5HZ9A 4FGIB 1D3SA 1KGLA 1VWOB 1NBXA 1YWBA 2ZSCA 3BRNA 4K19A 5LJGA 5L3YA 2FKJA 1Y0GA 5HZ6A 2FTBA 5IO6A 3LHNA 2IZFB 3D96A 1SLDB 5CHKA 3S26A 1ZNGA 1JJXA 1PMPA 4UU2A 4FBVA 1CRBA 1NQMA 4BBOA 2GC9A 2IZJA 2RTGB 4Y59A 3ZW2A 3ZW1B 2ANSA 4YH0A 3G7XA 1FTPA 2QCBA 2GJ5A 5B10O 2Q4NA 3WJGA 3ZW1A 1VWPB 3FA9A 4Y0QA 3PH5A 3UEUA 3BS2A 4CK4A 4DNEA 4COTA 4XMFA 2AT3X 1FEMA 1UYNX 3ZW0B 2FWVA 1DZPA 3KFGA 3VG7A 4CPFA 1TW4A 1GM6A 3PEDA 1I06A 1JYDA 3ZW0A 3DSZA 1MX8A 2AT0X 3FA8A 1JJUA 3IFBA 4MIRA 5H9AA 4HWMA 1N7YA 3U0DA 2Q2PA 1MK5A 1NC9A 1G74A 1X8UA 2MWHA 3EBWA 4XMDA 4MVIA 3ZWEA 2IZCB 1JJJA 4ZH9A 5DPQA 1LFOA 3SLTA 1T8VA 5B29A 2O62A 1YWDA 3RY2A 2XSTA 3OD9A 1VYOA 1DZJA 4NNSA 2CBSA 3D97A 1IKEA 4IMOA 1VWAB 2BLGA 3RE5A 2X4MA 5LJKA 2OY8A 5BVTA 5BVQA 3FLLA 2L9CA 2VFCA 4QGVA 4O3WA 2I5ZO 1LICA 2QO4A 3VU1A 2A8GA 4QAEA 2JMBA 1PBYA 4JGLA 1ZRYA 1STPA 4BX6B 1SXUA 1SWGA 2G78A 4WHIA 2CAMA 3ZUIA 5H9LA 1SWQA 5EDCA 3BLGA 3VE2A 4EDEA 1FELA 1JYJA 2LBVA 1NP1A 1GX8A 2OY1O 4Y0PA 2YMSA 5HZQA 2RCQA 3SOTA 1G7NA 5H9KA 1VWNB 4BOEA 4BQUA 3CQNA 2WPUA 2FLJA 1KQWA 4TJZA 3WOVA 3FW4A 3EC5A 1BRQA 2JU3A 3WYQA 1YIVA 4D6BA 4AW8A 5LJHA 1ERXA 1ICMA 1JQPA 1ZNLA 2OVAA 3PECA 3WZNA 4QGXA 4KC7A 4CPIA 4Y5DA 5HAEA 2RTOB 2RTLA 2FHNX 3AEHA 3VHHA 1H91A 1SXWA 4U3QA 4ALBA 4FBRA 4LKPA 3FYFA 5B5FA 3TGCA 3NP1A 3PP6A 1IFBA 2FR2A 4OMXA 2IZBA 4ZHHA 2X8FA 2KTDA 4KH8A 2LFOA 4AZPA 4CPHB 3K3LA 2HNXA 4IAWA 2RTJA 4CPHA 5L8OA 1Y53X 4GH7A 5FQ8E 1WBIA 4ZFXA 1LF7A 4XMEA 3CKFA 1LCZA 1UREA 1EXSA 1GT3A 2L68A 3MM0A 5AJCA 1LDQA 3LV4A 3UEVA 3B2HA 4OS8A 1ALBA 1AVEA 1SRJA 2NP1A 2IFBA 3Q34A 4QRLA 4QQ1A 2WSJA 3FA6A 3FEPA 1BSQA 2RTPB 4JO6A 1GGLA 4O4SA 2CZTA 3S60A
chains in the Genus database with same CATH topology
3BSZE 2F73A 4NLIA 3EM0A 3FIQA 4Y0SA 1A18A 1CBIA 3VPJE 4U8UO 2NNDA 1FE3A 4I95A 5IO7A 1ERBA 2CM4A 3N91A 2ALLX 1SMPI 4PJ2A 1ADLA 5AJBA 2FR3A 1GKAA 4EEJA 5F6BA 1IKJA 5EDBA 1BM5A 5BYPA 2QOSC 4TKJA 3P6EA 1CJ5A 1OPBA 2L5PA 4ZGUA 3U9PC 1MDCA 3APVA 4QGWA 5D8JA 2N93A 2AMMX 3VG5A 4OMWA 5FQ6E 1LKEA 3NX1A 1BSYA 5F7GA 4DQ4A 1D2UA 1DC9A 5F6ZA 2AL0X 2AH7X 3FR2A 5IO5A 4FBOA 4A60A 4O3XB 3WXQA 4ZHDA 2HYSA 3KFHA 4Y0RA 1HMSA 2A2GA 4YCHA 2E4JA 1ZNHA 2WEXA 4ORUA 5LJBA 4ML7B 3PH6A 3RWXA 3OE3A 3WJDA 3HWGA 1I04A 1BSOA 1EW3A 1VPRA 2G79A 3BX7A 1CBSA 5KHPA 5HCCC 4YGGA 3HWFA 2Q2MA 5C0NA 2LBAA 4OS0A 4ALOA 5JR8A 3BU9A 4RUUA 5FENA 1B56A 2L67A 1U17A 1JZUA 2EU7X 4DQ3A 4NLJA 1QY1A 4L3RA 4QNIA 3HOEA 4YGHA 1TOWA 2GTLM 4U8UN 4YGZA 1YWCA 1SY2A 4XMCA 4ZHCA 2WQ9A 4O49A 5LKFA 4A1YA 3NQ9A 3HOLA 1NP4A 5CE4A 1QWDA 4IBAA 3WJBA 4IABA 1TVQA 3BU1A 4I3BA 1LIDA 4M6SA 4O4UA 3HWDA 3I17A 3RSWA 1BRPA 1SY0A 1OBQA 2FRSA 3AKNA 3FMZA 2R56A 4O9SA 2QO6A 3CR6A 3PPTA 4U9CA 4L1NA 1GT5A 2WEWA 3I0AA 3P24A 1MVGA 1PEEA 4IB9A 2MO5A 2AT8X 1EUOA 2KT4B 3E3CA 3OBLA 1X8OA 3CQRA 3ZQ3A 4EFGA 4ZHGA 3FA7A 3STNA 4GU8A 1KOIA 2HZRA 2LKKA 1R0UA 1UZ2X 3Q6LA 1XCAA 4GETA 2KW1A 1E00A 4IB6A 4ZCBA 2WR6A 1EIOA 3FR5A 2NNEA 3UAQA 1DFVA 1NGLA 4NYRA 1EALA 1PBOA 4I9SA 3WVMA 3FELA 4GK9A 2WUTA 2F09A 4N7DA 4FQBB 4D6AA 2OFRX 2QO5A 3D4RA 3SAOA 5LJCA 1LIFA 2JU7A 4O4XA 1T68X 3B2KA 1ML7A 5F58A 4N7CA 2MJIA 3FEKA 1AELA 1VYGA 4UU3A 4EXZA 3OJYC 5KICA 1LPJA 2W2BA 3AKMA 5L8NA 3ZI8A 1U0XA 4KIIA 4GRJA 2YG2A 3APUA 3NQKA 3DTQA 2LB6A 1KZXA 1B8EA 1HN2A 2BHVA 3KQ0A 2Q9SA 5D48A 5HZ8A 1KT6A 3P6CA 2AKQA 5HBSA 3UEWA 2WQAE 1DF3A 4KC8A 1BJ7A 1O1UA 1S2PA 2HMBA 2OZQA 4GZVA 4YBPA 1I05A 4PSQA 1MUPA 1JIWI 5B27A 5LJDA 1DV9A 3TF6A 3NR3A 1KT7A 2MHDA 2OVEA 4TQ2A 3RBYA 2BT9A 3F8AA 3NBXX 4KCAA 2X8TA 2Q39A 2A13A 3IA8A 4O4OA 2CZUA 2K23A 3GE2A 5D45A 5H8TA 2P8GA 1QY0A 3B2LA 1N0SA 3TZSA 1BEBA 1GKAB 4OS3A 2X45A 4ON1A 2A3FX 3NX2A 4ORSA 3TGAA 3NPOA 5FAZA 4MISA 2RCTA 4ZJ0A 1IIUA 1EI5A 3PQUA 4A8ZA 3T1DA 4AYHA 2NNQA 2KTSA 1QG5A 4TKBA 2OVSA 2OFMX 2MM3A 5LJEA 4QZUA 2ACOA 2HLVA 5EEEA 3JQOA 1YP7A 1OEJA 1RBPA 3NQ3A 3P02A 5HTEA 1QABE 4WFVA 5HA1A 1OPAA 1GT4A 1B0OA 1Y9TA 4AZNA 4AZOA 1U18A 2FT9A 3S5VA 4LZUA 1Y9LA 4MVEA 2DM5A 4BVMA 5EEDA 3ZUOA 2CBRA 3MVFA 5HWZA 1KT4A 5LKEA 4GE1A 2GTLO 3P6FA 2LA7A 4YFPA 2BS5A 1HMRA 1O1VA 4ORYA 1OEKA 4QZTA 3STKA 3V8UA 1SXYA 1SY1A 5AQ6A 2W2AA 3CWKA 3STMX 4ZHFA 5HTDA 4I3DA 2QM9A 3P6GA 2G7BA 5D47A 4HPCA 1KQXA 4ORRA 1OBPA 3KFIA 1EPAA 1EQDA 1GXAA 2R74A 4XMHA 1FDQA 2Z4IA 4O3YA 4ODDA 4AZRA 2FS7A 3GAQA 1VYFA 3KFFA 2RQ0A 4I3CA 5CYBA 2M4LA 4MVLA 3HTYA 5AEOA 3FENA 1BLRA 1RLBE 1SY3A 1X89A 1EPBA 2X8SA 4WBKA 3B2IA 5FQ7E 1KT5A 3MBTA 1E02A 5KIDA 3ELXA 3APWA 4ORWA 4YDAA 1DZMA 4YMYA 2KD2A 3C76X 3ELZA 4YFRA 1JBHA 3O2YA 3VE1A 5HCDC 2ASNX 1BWYA 1HBPA 2JN3A 2XKLA 3U03A 3BDRA 3CBSA 4QYNA 3APXA 4YKOA 4AZQA 4IB7A 1CBQA 4ZH6A 3WJEA 2OVDA 3BX8A 1X8QA 1HMTA 3KZAA 1A2DA 1ACDA 4HPDA 1E5PA 5BVSA 4QYPA 2GTLN 4WFUA 1GX9A 3HK1A 1ZNKA 5HZ5A 4ARHA 3VG2A 1ZNDA 3CBCA 3WJFA 1E06A 1TXLA 1P6PA 3S5XA 4IMNA 4TKHA 1O8VA 4I6SA 2W2FA 1LIBA 2WWPA 1CBRA 2RD7C 5HA0A 2ZAGA 2Z4HA 5EZ2A 1X8PA 3WJCA 1YP6A 2JW1A 3WBGA 1HBQA 1Z24A 5F1EA 3BY0A 1QQSA 4NNTA 1YUPA 5DG4A 5EPQA 1ZNEA 3CMPA 2R73A 4INNA 4XMGA 3L4RA 1BBPA 1B4MA 2HZQA 1GT1A 4M7MA 1S7DA 4GKCA 4HPAA 1HQPA 4IAXA 5FFHA 3C77X 4NP1A 2AT5X 3JS1A 2AT6X 3RZYA 4A1HA 1KZWA 3VG6A 1T0VA 1ICNA 3F6ZB 2RN4A 4ZGFA 4CV7A 4RUNA 2RA6A 2ACPX 3B2JA 1SA8A 1A3YA 2CM9A 4KT5A 2POAA 4I9RA 5H9NA 4CSBA 2JU8A 1FENA 1OEEA 4YBUA 2QMIA 4EQAC 3TGBA 4NW4A 3F9DA 4R0BA 3VG4A 1G5WA 2K62A 4YDBA 3ZZVA 4NYQA 2FS6A 2PY1A 4YCEA 1YWAA 1LIEA 4TNNA 2JOZA 1EIIA 1S44A 2ZAIA 3MX7A 3P6HA 5D4AA 3JSQA 1AB0A 3EMMA 1A57A 3D95A 4TLJA 1G85A 3RKGA 1AQBA 4GNYA 4IB8A 3UEXA 5K06A 1QY2A 3C78X 1IFCA 2A0AA 3EBKA 1JV4A 4AZMA 4LZVA 3O22A 4ID2A 4ZR2A 4ORXA 5HCEC 2GTFX 1OBUA 1QFVA 4LKTA 4O3ZA 4GDZA 4ES7A 1L6MA 4YKMA 4HFOA 3EYCA 3H3IA 3P6DA 1SXXA 1QFTA 1X8NA 3HWEA 3PQSA 3FR4A 3O19A 4U8UM 1I4UA 5L8IA 3FW5A 2A2UA 1MX7A 2BS6A 3QKGA 1XKIA 3NADA 4LQZA 1LNMA 4HPBA 1X71A 1DZKA 2X46A 1KT3A 1TOUA 1IW2A 3VG3A 1PM1X 4YFQA 1AVGI 1KXOA 4MVKA 4GNWA 5HZ9A 4FGIB 1D3SA 1KGLA 4K19A 1YWBA 3BRNA 5LJGA 5HZ6A 2FTBA 5IO6A 3LHNA 3D96A 3S26A 1ZNGA 1JJXA 1PMPA 4UU2A 4FBVA 1CRBA 2GC9A 3ZW2A 3ZW1B 2ANSA 4YH0A 3G7XA 1FTPA 2GJ5A 2Q4NA 3WJGA 3ZW1A 3FA9A 4Y0QA 4CK4A 3PH5A 3UEUA 3BS2A 4COTA 4XMFA 2AT3X 1FEMA 3ZW0B 2FWVA 1DZPA 3KFGA 3VG7A 1TW4A 1GM6A 3PEDA 1I06A 1JYDA 3ZW0A 3DSZA 1MX8A 2AT0X 3FA8A 3IFBA 4MIRA 5H9AA 4HWMA 3U0DA 2Q2PA 4XMDA 1G74A 1X8UA 2MWHA 3EBWA 4MVIA 3ZWEA 1JJJA 4ZH9A 5DPQA 1LFOA 1T8VA 5B29A 2O62A 1YWDA 2XSTA 3OD9A 1DZJA 4NNSA 2CBSA 3D97A 1IKEA 4IMOA 2BLGA 5LJKA 5BVTA 5BVQA 3FLLA 2L9CA 4QGVA 4O3WA 1LICA 2QO4A 3VU1A 4QAEA 2JMBA 4JGLA 1ZRYA 1SXUA 2G78A 4WHIA 3ZUIA 5H9LA 5EDCA 3BLGA 3VE2A 4EDEA 1FELA 1JYJA 2LBVA 1NP1A 1GX8A 4Y0PA 5HZQA 2YMSA 3SOTA 2RCQA 4BOEA 1G7NA 5H9KA 4BQUA 3CQNA 2FLJA 1KQWA 4TJZA 3WOVA 3FW4A 1BRQA 2JU3A 1YIVA 4D6BA 4AW8A 5LJHA 1ERXA 1ICMA 1ZNLA 2OVAA 3PECA 5HAEA 4QGXA 4KC7A 1H91A 1SXWA 4U3QA 4ALBA 4FBRA 4LKPA 3FYFA 3TGCA 3NP1A 3PP6A 1IFBA 2FR2A 4OMXA 4ZHHA 2X8FA 2KTDA 4KH8A 2LFOA 4AZPA 3K3LA 2HNXA 4IAWA 5L8OA 4GH7A 5FQ8E 4ZFXA 1LF7A 4XMEA 1EXSA 1GT3A 1UREA 2L68A 5AJCA 3LV4A 3UEVA 3B2HA 4OS8A 1ALBA 2NP1A 2IFBA 4QRLA 4QQ1A 2WSJA 3FA6A 3FEPA 1BSQA 3S60A 1GGLA 4O4SA 2CZTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BSZ E;  2F73 A;  4NLI A;  3EM0 A;  3FIQ A;  4Y0S A;  1A18 A;  1CBI A;  2NND A;  1FE3 A;  5IO7 A;  1ERB A;  2CM4 A;  2ALL X;  1ADL A;  2FR3 A;  1GKA A;  4EEJ A;  5F6B A;  1IKJ A;  5EDB A;  1BM5 A;  2QOS C;  4TKJ A;  3P6E A;  1CJ5 A;  1OPB A;  2L5P A;  4ZGU A;  3U9P C;  1MDC A;  3APV A;  4QGW A;  5D8J A;  2N93 A;  2AMM X;  3VG5 A;  4OMW A;  1LKE A;  3NX1 A;  1BSY A;  5F7G A;  4DQ4 A;  1D2U A;  1DC9 A;  5F6Z A;  2AL0 X;  2AH7 X;  3FR2 A;  5IO5 A;  4A60 A;  3WXQ A;  4ZHD A;  2HYS A;  3KFH A;  4Y0R A;  1HMS A;  2A2G A;  4YCH A;  2E4J A;  1ZNH A;  2WEX A;  4ORU A;  5LJB A;  3PH6 A;  3WJD A;  3HWG A;  1I04 A;  1BSO A;  1EW3 A;  1VPR A;  2G79 A;  3BX7 A;  1CBS A;  5KHP A;  5HCC C;  4YGG A;  3HWF A;  2Q2M A;  5C0N A;  2LBA A;  4OS0 A;  4ALO A;  5JR8 A;  3BU9 A;  4RUU A;  5FEN A;  1B56 A;  2L67 A;  1U17 A;  1JZU A;  2EU7 X;  4DQ3 A;  4NLJ A;  1QY1 A;  4YGH A;  1TOW A;  4YGZ A;  1YWC A;  1SY2 A;  4XMC A;  4ZHC A;  2WQ9 A;  5LKF A;  4A1Y A;  3NQ9 A;  1NP4 A;  5CE4 A;  1QWD A;  4IBA A;  3WJB A;  1TVQ A;  3BU1 A;  4I3B A;  1LID A;  4M6S A;  3HWD A;  3I17 A;  3RSW A;  1BRP A;  1SY0 A;  1OBQ A;  2FRS A;  3AKN A;  3FMZ A;  2R56 A;  4O9S A;  2QO6 A;  3CR6 A;  3PPT A;  1GT5 A;  2WEW A;  3I0A A;  1MVG A;  1PEE A;  4IB9 A;  2MO5 A;  2AT8 X;  1EUO A;  2KT4 B;  1X8O A;  3CQR A;  3ZQ3 A;  4EFG A;  4ZHG A;  3FA7 A;  3STN A;  1KOI A;  2HZR A;  2LKK A;  1R0U A;  1UZ2 X;  3Q6L A;  1XCA A;  4GET A;  4IB6 A;  1E00 A;  4YH0 A;  4ZCB A;  2WR6 A;  1EIO A;  3FR5 A;  2NNE A;  1DFV A;  1NGL A;  4NYR A;  1EAL A;  1PBO A;  4I9S A;  3WVM A;  3FEL A;  4N7D A;  2WUT A;  4D6A A;  2OFR X;  2QO5 A;  3SAO A;  5LJC A;  1LIF A;  2JU7 A;  1T68 X;  3B2K A;  1ML7 A;  5F58 A;  4N7C A;  2MJI A;  3FEK A;  1AEL A;  1VYG A;  4UU3 A;  4EXZ A;  3OJY C;  5KIC A;  1LPJ A;  2W2B A;  3AKM A;  5L8N A;  1U0X A;  4KII A;  4GRJ A;  2YG2 A;  3APU A;  3DTQ A;  2LB6 A;  1KZX A;  1B8E A;  1HN2 A;  3KQ0 A;  2Q9S A;  5D48 A;  5HZ8 A;  1KT6 A;  3P6C A;  2AKQ A;  5HBS A;  3UEW A;  2WQA E;  1DF3 A;  1BJ7 A;  1O1U A;  1S2P A;  2HMB A;  2OZQ A;  4YBP A;  1I05 A;  4PSQ A;  1MUP A;  5B27 A;  5LJD A;  1DV9 A;  3TF6 A;  3NR3 A;  1KT7 A;  2OVE A;  4TQ2 A;  3F8A A;  2Q39 A;  2A13 A;  3IA8 A;  2CZU A;  2K23 A;  5D45 A;  5H8T A;  2P8G A;  1QY0 A;  3B2L A;  1N0S A;  3TZS A;  1BEB A;  1GKA B;  4OS3 A;  2X45 A;  2A3F X;  3NX2 A;  4ORS A;  3TGA A;  3NPO A;  5FAZ A;  4ZJ0 A;  2RCT A;  1IIU A;  4A8Z A;  3T1D A;  4AYH A;  2NNQ A;  1QG5 A;  4TKB A;  2OFM X;  2MM3 A;  5LJE A;  4QZU A;  2ACO A;  2HLV A;  5EEE A;  1YP7 A;  1OEJ A;  1RBP A;  3NQ3 A;  5HTE A;  1QAB E;  4WFV A;  5HA1 A;  1OPA A;  1GT4 A;  1B0O A;  4AZN A;  4AZO A;  1U18 A;  2FT9 A;  4LZU A;  2DM5 A;  4BVM A;  5EED A;  3ZUO A;  2CBR A;  3MVF A;  5HWZ A;  1KT4 A;  5LKE A;  4GE1 A;  3P6F A;  4YFP A;  1HMR A;  1O1V A;  4ORY A;  1OEK A;  4QZT A;  3STK A;  1SXY A;  1SY1 A;  5AQ6 A;  2W2A A;  3CWK A;  3STM X;  4ZHF A;  5HTD A;  4I3D A;  2QM9 A;  3P6G A;  2G7B A;  5D47 A;  4HPC A;  1KQX A;  4ORR A;  1OBP A;  3KFI A;  1EPA A;  1EQD A;  1GXA A;  2R74 A;  4XMH A;  1FDQ A;  4ODD A;  4AZR A;  2FS7 A;  3GAQ A;  1VYF A;  3KFF A;  2RQ0 A;  4I3C A;  4MVL A;  3FEN A;  1BLR A;  1RLB E;  1SY3 A;  1X89 A;  1EPB A;  4WBK A;  3B2I A;  1KT5 A;  3MBT A;  1E02 A;  5KID A;  3ELX A;  3APW A;  4ORW A;  4YDA A;  1DZM A;  4YMY A;  3C76 X;  4YFR A;  3ELZ A;  1JBH A;  3O2Y A;  5HCD C;  2ASN X;  1BWY A;  1HBP A;  2JN3 A;  2XKL A;  3U03 A;  3BDR A;  3CBS A;  4QYN A;  3APX A;  4YKO A;  4AZQ A;  4IB7 A;  1CBQ A;  4ZH6 A;  3WJE A;  2OVD A;  3BX8 A;  1X8Q A;  1HMT A;  3KZA A;  1A2D A;  1ACD A;  4HPD A;  1E5P A;  5BVS A;  4QYP A;  4WFU A;  1GX9 A;  3HK1 A;  1ZNK A;  5HZ5 A;  4ARH A;  3VG2 A;  1ZND A;  3CBC A;  3WJF A;  1E06 A;  1TXL A;  1P6P A;  4IMN A;  4TKH A;  1O8V A;  2W2F A;  1LIB A;  2WWP A;  1CBR A;  2RD7 C;  5HA0 A;  5EZ2 A;  1X8P A;  3WJC A;  1YP6 A;  3WBG A;  1HBQ A;  1Z24 A;  5F1E A;  3BY0 A;  1QQS A;  4NNT A;  1YUP A;  5DG4 A;  5EPQ A;  1ZNE A;  3CMP A;  2R73 A;  4XMG A;  3L4R A;  1BBP A;  1B4M A;  2HZQ A;  1GT1 A;  4M7M A;  1S7D A;  4GKC A;  4HPA A;  1HQP A;  4IAX A;  5FFH A;  3C77 X;  4NP1 A;  2AT5 X;  3JS1 A;  2AT6 X;  3RZY A;  4A1H A;  1KZW A;  3VG6 A;  1T0V A;  1ICN A;  4RUN A;  2RA6 A;  2ACP X;  3B2J A;  1SA8 A;  1A3Y A;  2CM9 A;  5H9N A;  2POA A;  4I9R A;  2JU8 A;  1FEN A;  1OEE A;  4YBU A;  3TGB A;  3F9D A;  4R0B A;  3VG4 A;  1G5W A;  2K62 A;  4YDB A;  4NYQ A;  2FS6 A;  2PY1 A;  4YCE A;  1YWA A;  1LIE A;  4TNN A;  2JOZ A;  1EII A;  1S44 A;  3P6H A;  5D4A A;  3JSQ A;  1AB0 A;  3EMM A;  1A57 A;  3D95 A;  4TLJ A;  1G85 A;  1AQB A;  4GNY A;  4IB8 A;  3UEX A;  5K06 A;  1QY2 A;  3C78 X;  1IFC A;  2A0A A;  3EBK A;  1JV4 A;  4AZM A;  4LZV A;  3O22 A;  4ZR2 A;  4ORX A;  5HCE C;  2GTF X;  1OBU A;  1QFV A;  4LKT A;  4ES7 A;  1L6M A;  4YKM A;  4HFO A;  3EYC A;  3P6D A;  1SXX A;  1QFT A;  1X8N A;  3HWE A;  3FR4 A;  3O19 A;  1I4U A;  5L8I A;  3FW5 A;  2A2U A;  1MX7 A;  3QKG A;  1XKI A;  3NAD A;  1LNM A;  4HPB A;  1X71 A;  1DZK A;  2X46 A;  1KT3 A;  1TOU A;  1IW2 A;  3VG3 A;  1PM1 X;  4YFQ A;  1AVG I;  1KXO A;  4MVK A;  4GNW A;  5HZ9 A;  1D3S A;  1KGL A;  4K19 A;  1YWB A;  3BRN A;  5LJG A;  5HZ6 A;  2FTB A;  5IO6 A;  3D96 A;  3S26 A;  1ZNG A;  1JJX A;  1PMP A;  4UU2 A;  1CRB A;  2GC9 A;  2ANS A;  3G7X A;  1FTP A;  2GJ5 A;  2Q4N A;  3WJG A;  3FA9 A;  4Y0Q A;  4CK4 A;  3PH5 A;  3UEU A;  3BS2 A;  4XMF A;  2AT3 X;  1FEM A;  2FWV A;  1DZP A;  3KFG A;  3VG7 A;  1TW4 A;  1GM6 A;  3PED A;  1I06 A;  1JYD A;  3DSZ A;  1MX8 A;  2AT0 X;  3FA8 A;  3IFB A;  5H9A A;  3U0D A;  2Q2P A;  4XMD A;  1G74 A;  1X8U A;  3EBW A;  4MVI A;  1JJJ A;  4ZH9 A;  5DPQ A;  1LFO A;  1T8V A;  5B29 A;  2O62 A;  1YWD A;  2XST A;  1DZJ A;  4NNS A;  2CBS A;  3D97 A;  1IKE A;  4IMO A;  2BLG A;  5LJK A;  5BVT A;  5BVQ A;  3FLL A;  2L9C A;  4QGV A;  1LIC A;  2QO4 A;  4QAE A;  1ZRY A;  1SXU A;  2G78 A;  3ZUI A;  5H9L A;  5EDC A;  3BLG A;  4EDE A;  1FEL A;  1JYJ A;  2LBV A;  1NP1 A;  1GX8 A;  4Y0P A;  5HZQ A;  4BQU A;  2RCQ A;  4BOE A;  1G7N A;  5H9K A;  3CQN A;  2FLJ A;  1KQW A;  4TJZ A;  3FW4 A;  1BRQ A;  2JU3 A;  1YIV A;  4D6B A;  4AW8 A;  5LJH A;  1ERX A;  1ICM A;  1ZNL A;  2OVA A;  3PEC A;  5HAE A;  4QGX A;  1H91 A;  1SXW A;  4ALB A;  4LKP A;  3TGC A;  3NP1 A;  3PP6 A;  1IFB A;  2FR2 A;  4OMX A;  4ZHH A;  2KTD A;  2LFO A;  4AZP A;  3K3L A;  2HNX A;  4IAW A;  5L8O A;  4GH7 A;  4ZFX A;  1LF7 A;  4XME A;  1EXS A;  1GT3 A;  1URE A;  2L68 A;  3UEV A;  3B2H A;  4OS8 A;  1ALB A;  2NP1 A;  2IFB A;  2WSJ A;  3FA6 A;  3FEP A;  1BSQ A;  1GGL A;  2CZT A; 
#chains in the Genus database with same CATH topology
 3BSZ E;  2F73 A;  3T6L A;  4NLI A;  3EM0 A;  3FIQ A;  4Y0S A;  1A18 A;  1CBI A;  3VPJ E;  4U8U O;  2NND A;  1FE3 A;  1SWB A;  4I95 A;  5IO7 A;  1ERB A;  2CM4 A;  4GGZ A;  5B11 O;  3N91 A;  2ALL X;  1SMP I;  4PJ2 A;  1ADL A;  5AJB A;  2FR3 A;  1GKA A;  4CPE A;  4EEJ A;  2HKD A;  5F6B A;  4BGF A;  1IKJ A;  5EDB A;  1BM5 A;  5BYP A;  2QOS C;  4TKJ A;  3P6E A;  4I60 A;  1CJ5 A;  1OPB A;  2L5P A;  4ZGU A;  3U9P C;  1MDC A;  3APV A;  4QGW A;  5D8J A;  1GX3 A;  2AMM X;  2N93 A;  4OMW A;  4NV7 A;  5FQ6 E;  1LKE A;  3NX1 A;  1BSY A;  4NV8 A;  5F7G A;  4DQ4 A;  2Y3F A;  3RDS A;  1W6F A;  1D2U A;  4BCS A;  1DC9 A;  5F6Z A;  4ZJ0 A;  2AL0 X;  2AH7 X;  1Y52 X;  3FR2 A;  5IO5 A;  4FBO A;  4A60 A;  4O3X B;  3WXQ A;  4ZHD A;  2HYS A;  3KFH A;  4Y0R A;  4Z6J A;  1HMS A;  2A2G A;  4YCH A;  2E4J A;  1ZNH A;  2WEX A;  4ORU A;  5LJB A;  4ML7 B;  1SRE A;  3PH6 A;  3RWX A;  3OE3 A;  3WJD A;  3HWG A;  1I04 A;  1BSO A;  1EW3 A;  1VPR A;  2G79 A;  3BX7 A;  1CBS A;  4GD9 A;  5KHP A;  5HCC C;  4YGG A;  1HXZ A;  2Q2M A;  3HWF A;  5C0N A;  2LBA A;  4OS0 A;  4ALO A;  5JR8 A;  5IXG A;  3BU9 A;  4RUU A;  5FEN A;  1B56 A;  2L67 A;  1U17 A;  1JZU A;  2DJF A;  2EU7 X;  4GUZ A;  4NLJ A;  1QY1 A;  4DQ3 A;  1LCV A;  4L3R A;  4QNI A;  3HOE A;  4YGH A;  1TOW A;  2GTL M;  4Z27 A;  4U8U N;  4YGZ A;  1YWC A;  1SY2 A;  4XMC A;  4ZHC A;  2WQ9 A;  2RTK A;  3RDU A;  4O49 A;  5LKF A;  4A1Y A;  3NQ9 A;  3HOL A;  1NP4 A;  2BC3 A;  5CE4 A;  1QWD A;  2RTD B;  4GDA A;  4IBA A;  3WJB A;  4IAB A;  1TVQ A;  3BU1 A;  1SLG B;  2JGS A;  2RTC B;  4I3B A;  1LID A;  3RDX A;  1MM9 A;  4M6S A;  4O4U A;  3HWD A;  3I17 A;  3RSW A;  1BRP A;  1SY0 A;  1OBQ A;  1KL3 A;  2IZK A;  2FRS A;  3AKN A;  3FMZ A;  2R56 A;  4O9S A;  2DJG A;  2QO6 A;  3CR6 A;  3PPT A;  4U9C A;  4L1N A;  1GT5 A;  2WEW A;  3I0A A;  1HY2 A;  1MVG A;  1SRI A;  3P24 A;  4IB9 A;  1PEE A;  2MO5 A;  2AT8 X;  1EUO A;  1EAL A;  2KT4 B;  3E3C A;  3OBL A;  1SWJ A;  1X8O A;  2BSZ A;  3CQR A;  3ZQ3 A;  4EFG A;  4ZHG A;  2IZG B;  3FA7 A;  3STN A;  4GU8 A;  1KOI A;  2HZR A;  2LKK A;  1R0U A;  1UZ2 X;  3Q6L A;  1SRF A;  1XCA A;  2KW1 A;  1E00 A;  4GET A;  1VWK B;  2WR6 A;  4IB6 A;  2C1S A;  4ZCB A;  1EIO A;  1SWP A;  1HQQ A;  1SWU A;  3FR5 A;  5JD2 A;  1MEP A;  1K3B A;  2RTN B;  1OSP O;  1SLF B;  2NNE A;  3UAQ A;  1DFV A;  1NGL A;  1HXL A;  4NYR A;  2AF5 A;  1PBO A;  4I9S A;  3WVM A;  3FEL A;  4GK9 A;  2WUT A;  2F09 A;  4N7D A;  4FQB B;  4D6A A;  2OFR X;  2QO5 A;  3D4R A;  4U46 A;  1KFF A;  1Y55 X;  3SAO A;  5LJC A;  1LIF A;  2JU7 A;  4O4X A;  5B3M O;  1T68 X;  3B2K A;  1ML7 A;  1WUB A;  4N7C A;  2MJI A;  5F58 A;  3FEK A;  1AEL A;  1VYG A;  4UU3 A;  4EXZ A;  3OJY C;  5KIC A;  1LPJ A;  2W2B A;  3AKM A;  5L8N A;  3ZI8 A;  2RTI B;  1U0X A;  4KII A;  1RXH A;  4GRJ A;  2C1Q A;  1RSU B;  2YG2 A;  3APU A;  3NQK A;  3DTQ A;  3X00 A;  2LB6 A;  4Z2V A;  1KZX A;  1B8E A;  1HN2 A;  1VWR B;  2BHV A;  1SRG A;  2QOM A;  2Q9S A;  3KQ0 A;  5D48 A;  5HZ8 A;  1KT6 A;  3P6C A;  2AKQ A;  1MOY A;  5HBS A;  3UEW A;  2WQA E;  1DF3 A;  2G8C O;  1STR B;  2OF9 A;  4KC8 A;  2OY7 A;  1SWR A;  1BJ7 A;  1KL5 A;  1O1U A;  1S2P A;  2HMB A;  1AVD A;  2OZQ A;  4GZV A;  1I05 A;  4PSQ A;  4YBP A;  1MUP A;  1JIW I;  5B27 A;  1PTS A;  5LJD A;  2OL8 O;  1DV9 A;  3TF6 A;  3WZO A;  3NR3 A;  1VWQ B;  1KT7 A;  2MHD A;  2OVE A;  3QQ2 A;  4TQ2 A;  3RBY A;  2BT9 A;  3VGW A;  3FID A;  2IZI A;  3F8A A;  3NBX X;  4KCA A;  2X8T A;  2Q39 A;  2A13 A;  3IA8 A;  4O4O A;  2CZU A;  2K23 A;  3GE2 A;  5D45 A;  5H8T A;  4BX5 B;  1N43 A;  1QY0 A;  1SWS A;  2P8G A;  3B2L A;  1N0S A;  3MG5 A;  3TZS A;  1BEB A;  1GKA B;  4DCB A;  4OS3 A;  2X45 A;  4ON1 A;  4BX5 A;  4Z2P A;  2A3F X;  3NX2 A;  4ORS A;  1STS B;  3TGA A;  3NPO A;  5FAZ A;  4MIS A;  1SWH A;  1I78 A;  1RAV A;  2RCT A;  4CDF A;  1IIU A;  1SWC A;  1RXK A;  2OL7 A;  5K67 A;  1EI5 A;  2A5C A;  3PQU A;  3T1D A;  3SZJ A;  4A8Z A;  4AYH A;  4Z2O A;  2NNQ A;  2KTS A;  3VHM A;  1QG5 A;  4TKB A;  2OVS A;  2OFM X;  2MM3 A;  2OYB O;  5LJE A;  4QZU A;  2ACO A;  2HLV A;  2RTF B;  5EEE A;  3SLJ A;  4CDC A;  1SWL A;  1VWB B;  3JQO A;  1YP7 A;  1OEJ A;  1SLE B;  1RBP A;  2OFA A;  3NQ3 A;  3P02 A;  1SWA A;  5HTE A;  1QAB E;  2UYW A;  4WFV A;  1LUQ A;  5HA1 A;  1OPA A;  1GT4 A;  1B0O A;  1Y9T A;  2FGS A;  2I5V O;  3LTW A;  5K68 A;  1U18 A;  4AZO A;  1JMZ A;  2IZE B;  3RDO A;  4AZN A;  2FT9 A;  3S5V A;  1UYO X;  1VWI B;  2OL6 O;  4OEM A;  5F2B A;  4LZU A;  1Y9L A;  4MVE A;  5CSE A;  3T6F A;  2DM5 A;  4BVM A;  5EED A;  3ZUO A;  2CBR A;  3MVF A;  5HWZ A;  1KT4 A;  2RTB B;  5LKE A;  4GE1 A;  2GTL O;  3P6F A;  2LA7 A;  4YFP A;  1SWK A;  2BS5 A;  1HMR A;  2RTM A;  4BX7 B;  1O1V A;  3D9W A;  4ORY A;  1OEK A;  1VWD B;  4QZT A;  3STK A;  3V8U A;  1SXY A;  4MEE A;  2PI3 O;  1SY1 A;  5AQ6 A;  2W2A A;  3CWK A;  3STM X;  4ZHF A;  4BX7 A;  5HTD A;  4I3D A;  3AUM O;  3T2W A;  2QM9 A;  3P6G A;  4OKA A;  2G7B A;  2Y32 A;  5D47 A;  4HPC A;  2GH7 A;  1KQX A;  4ORR A;  1OBP A;  3KFI A;  1EPA A;  1EQD A;  1GXA A;  2R74 A;  4XMH A;  3SLO A;  1FDQ A;  2FHL A;  2Z4I A;  2RTH B;  3KVN A;  4O3Y A;  4ODD A;  4AZR A;  2FS7 A;  3GAQ A;  1VYF A;  3KFF A;  2RQ0 A;  4I3C A;  5CYB A;  2M4L A;  4MVL A;  2FKG A;  3HTY A;  5AEO A;  1SWN A;  3FEN A;  1BLR A;  1NDJ A;  1RLB E;  1W4T A;  1SY3 A;  4GGT A;  1X89 A;  1EPB A;  2X8S A;  1SWF A;  4WBK A;  3B2I A;  5FQ7 E;  1KT5 A;  3MBT A;  1E02 A;  1SWE A;  4YVB A;  4GJS A;  5KID A;  3VG5 A;  3ELX A;  2Y3E A;  3APW A;  4ORW A;  4YDA A;  1DZM A;  4YMY A;  2KD2 A;  3C76 X;  3ELZ A;  4YFR A;  1JBH A;  3SZH A;  2A5B A;  3O2Y A;  3VE1 A;  2ASN X;  2X56 A;  1HBP A;  5HCD C;  2JN3 A;  1SWO A;  1BWY A;  2XKL A;  3U03 A;  3BDR A;  3CBS A;  2UZ2 A;  3APX A;  4QYN A;  4YKO A;  4AZQ A;  2IZH B;  4IB7 A;  1CBQ A;  4ZH6 A;  1N9Y A;  3WJE A;  2OVD A;  3BX8 A;  1X8Q A;  1HMT A;  3KZA A;  2IZD B;  1A2D A;  1ACD A;  4HPD A;  1W5R A;  1E5P A;  5BVS A;  4QYP A;  2GTL N;  1JMX A;  4WFU A;  1VWF B;  1GX9 A;  2X34 A;  3HK1 A;  1ZNK A;  4B55 A;  2IZA A;  4ARH A;  1VWG B;  1ZND A;  3VG2 A;  3CBC A;  3WJF A;  1E06 A;  1TXL A;  5B2A O;  4Z28 A;  1P6P A;  3S5X A;  1IJ8 A;  2X55 A;  4IMN A;  4TKH A;  3VHI A;  1O8V A;  4I6S A;  2W2F A;  1LIB A;  2WWP A;  1CBR A;  2RD7 C;  2OFB A;  5HA0 A;  2ZAG A;  2Z4H A;  5D4A A;  5EZ2 A;  3SZI A;  1X8P A;  3WJC A;  1YP6 A;  1VWJ B;  1VWH B;  3WZP A;  2JW1 A;  3WBG A;  1HBQ A;  1Z24 A;  5F1E A;  3BY0 A;  1QQS A;  4NNT A;  1YUP A;  5DG4 A;  1N9M A;  3RY1 A;  5IRA A;  1K24 A;  1ZNE A;  5EPQ A;  3CMP A;  2R73 A;  2RTE B;  4INN A;  4XMG A;  3L4R A;  1BBP A;  1B4M A;  1VWL B;  1GT1 A;  1LCW A;  2HZQ A;  1S7D A;  4GGR A;  4GKC A;  4M7M A;  3RE6 A;  4HPA A;  1HQP A;  4IAX A;  3WYP A;  5FFH A;  3C77 X;  3T2X A;  4NP1 A;  2AT5 X;  5IRW A;  3JS1 A;  2AT6 X;  1RST B;  3RZY A;  4A1H A;  2VFB A;  3VG6 A;  1T0V A;  1ICN A;  3F6Z B;  2RN4 A;  4ZGF A;  4CV7 A;  1KZW A;  4GJV A;  2RA6 A;  2ACP X;  3B2J A;  4RUN A;  1SA8 A;  2OF8 A;  2RTA A;  1A3Y A;  2CM9 A;  4OEL A;  4KT5 A;  2POA A;  4I9R A;  5H9N A;  4CSB A;  4CDD A;  3CKG A;  2JU8 A;  1FEN A;  1OEE A;  4YBU A;  2QMI A;  3WZQ A;  4EQA C;  3TGB A;  4LQZ A;  4NW4 A;  2C4I A;  3F9D A;  4R0B A;  3VG4 A;  1G5W A;  5IRU A;  2K62 A;  3EW2 A;  4BX6 A;  4YDB A;  3ZZV A;  3RDQ A;  4NYQ A;  1RXJ A;  2FS6 A;  2PY1 A;  4C5P A;  1SWD A;  4YCE A;  1YWA A;  1LIE A;  4TNN A;  2JOZ A;  1EII A;  1S44 A;  1N4J A;  2F01 A;  2G5L A;  2ZAI A;  3EW1 A;  1AB0 A;  3EMM A;  3JSQ A;  3MX7 A;  3D95 A;  3P6H A;  4IRW A;  4TLJ A;  1A57 A;  1G85 A;  2RTR B;  3RKG A;  1AQB A;  4GNY A;  2X32 A;  4IB8 A;  3UEX A;  1QY2 A;  3RDM A;  5K06 A;  2VDF A;  2AVI A;  1IFC A;  3C78 X;  2A0A A;  2OY5 O;  3EBK A;  1JV4 A;  1SWT A;  2RTQ B;  4AZM A;  4LZV A;  3O22 A;  4ID2 A;  4ZR2 A;  4ORX A;  5B5G A;  4CDE A;  5HCE C;  2GTF X;  1OBU A;  1QFV A;  1LDO A;  4JNJ A;  4LKT A;  4O3Z A;  4GDZ A;  4ES7 A;  1L6M A;  4YKM A;  4HFO A;  3EYC A;  1LEL A;  4JHQ A;  3H3I A;  3P6D A;  1SXX A;  1QFT A;  1X8N A;  2IZL B;  3HWE A;  3PQS A;  1DF8 A;  3FR4 A;  1VWE B;  3O19 A;  4U8U M;  5HZ5 A;  1I4U A;  3PDF A;  3FW5 A;  2A2U A;  1KL4 A;  1MX7 A;  1VWM B;  2BS6 A;  5L8I A;  4EKV A;  3QKG A;  1XKI A;  1SRH A;  3NAD A;  2MF6 A;  1LNM A;  4HPB A;  1X71 A;  1DZK A;  1VWC B;  1KT3 A;  1FJ1 E;  2X46 A;  3FDC A;  3HPE A;  1TOU A;  1IW2 A;  3VG3 A;  1PM1 X;  4YFQ A;  1AVG I;  1E2T A;  1I9H A;  1KXO A;  3PK2 A;  4MVK A;  1NQN A;  4GNW A;  4BJ8 A;  5HZ9 A;  4FGI B;  1D3S A;  1KGL A;  1VWO B;  1NBX A;  1YWB A;  2ZSC A;  3BRN A;  4K19 A;  5LJG A;  5L3Y A;  2FKJ A;  1Y0G A;  5HZ6 A;  2FTB A;  5IO6 A;  3LHN A;  2IZF B;  3D96 A;  1SLD B;  5CHK A;  3S26 A;  1ZNG A;  1JJX A;  1PMP A;  4UU2 A;  4FBV A;  1CRB A;  1NQM A;  4BBO A;  2GC9 A;  2IZJ A;  2RTG B;  4Y59 A;  3ZW2 A;  3ZW1 B;  2ANS A;  4YH0 A;  3G7X A;  1FTP A;  2QCB A;  2GJ5 A;  5B10 O;  2Q4N A;  3WJG A;  3ZW1 A;  1VWP B;  3FA9 A;  4Y0Q A;  3PH5 A;  3UEU A;  3BS2 A;  4CK4 A;  4DNE A;  4COT A;  4XMF A;  2AT3 X;  1FEM A;  1UYN X;  3ZW0 B;  2FWV A;  1DZP A;  3KFG A;  3VG7 A;  4CPF A;  1TW4 A;  1GM6 A;  3PED A;  1I06 A;  1JYD A;  3ZW0 A;  3DSZ A;  1MX8 A;  2AT0 X;  3FA8 A;  1JJU A;  3IFB A;  4MIR A;  5H9A A;  4HWM A;  1N7Y A;  3U0D A;  2Q2P A;  1MK5 A;  1NC9 A;  1G74 A;  1X8U A;  2MWH A;  3EBW A;  4XMD A;  4MVI A;  3ZWE A;  2IZC B;  1JJJ A;  4ZH9 A;  5DPQ A;  1LFO A;  3SLT A;  1T8V A;  5B29 A;  2O62 A;  1YWD A;  3RY2 A;  2XST A;  3OD9 A;  1VYO A;  1DZJ A;  4NNS A;  2CBS A;  3D97 A;  1IKE A;  4IMO A;  1VWA B;  2BLG A;  3RE5 A;  2X4M A;  5LJK A;  2OY8 A;  5BVT A;  5BVQ A;  3FLL A;  2L9C A;  2VFC A;  4QGV A;  4O3W A;  2I5Z O;  1LIC A;  2QO4 A;  3VU1 A;  2A8G A;  4QAE A;  2JMB A;  1PBY A;  4JGL A;  1ZRY A;  1STP A;  4BX6 B;  1SXU A;  1SWG A;  2G78 A;  4WHI A;  2CAM A;  3ZUI A;  5H9L A;  1SWQ A;  5EDC A;  3BLG A;  3VE2 A;  4EDE A;  1FEL A;  1JYJ A;  2LBV A;  1NP1 A;  1GX8 A;  2OY1 O;  4Y0P A;  2YMS A;  5HZQ A;  2RCQ A;  3SOT A;  1G7N A;  5H9K A;  1VWN B;  4BOE A;  4BQU A;  3CQN A;  2WPU A;  2FLJ A;  1KQW A;  4TJZ A;  3WOV A;  3FW4 A;  3EC5 A;  1BRQ A;  2JU3 A;  3WYQ A;  1YIV A;  4D6B A;  4AW8 A;  5LJH A;  1ERX A;  1ICM A;  1JQP A;  1ZNL A;  2OVA A;  3PEC A;  3WZN A;  4QGX A;  4KC7 A;  4CPI A;  4Y5D A;  5HAE A;  2RTO B;  2RTL A;  2FHN X;  3AEH A;  3VHH A;  1H91 A;  1SXW A;  4U3Q A;  4ALB A;  4FBR A;  4LKP A;  3FYF A;  5B5F A;  3TGC A;  3NP1 A;  3PP6 A;  1IFB A;  2FR2 A;  4OMX A;  2IZB A;  4ZHH A;  2X8F A;  2KTD A;  4KH8 A;  2LFO A;  4AZP A;  4CPH B;  3K3L A;  2HNX A;  4IAW A;  2RTJ A;  4CPH A;  5L8O A;  1Y53 X;  4GH7 A;  5FQ8 E;  1WBI A;  4ZFX A;  1LF7 A;  4XME A;  3CKF A;  1LCZ A;  1URE A;  1EXS A;  1GT3 A;  2L68 A;  3MM0 A;  5AJC A;  1LDQ A;  3LV4 A;  3UEV A;  3B2H A;  4OS8 A;  1ALB A;  1AVE A;  1SRJ A;  2NP1 A;  2IFB A;  3Q34 A;  4QRL A;  4QQ1 A;  2WSJ A;  3FA6 A;  3FEP A;  1BSQ A;  2RTP B;  4JO6 A;  1GGL A;  4O4S A;  2CZT A;  3S60 A; 
#chains in the Genus database with same CATH homology
 3BSZ E;  2F73 A;  4NLI A;  3EM0 A;  3FIQ A;  4Y0S A;  1A18 A;  1CBI A;  3VPJ E;  4U8U O;  2NND A;  1FE3 A;  4I95 A;  5IO7 A;  1ERB A;  2CM4 A;  3N91 A;  2ALL X;  1SMP I;  4PJ2 A;  1ADL A;  5AJB A;  2FR3 A;  1GKA A;  4EEJ A;  5F6B A;  1IKJ A;  5EDB A;  1BM5 A;  5BYP A;  2QOS C;  4TKJ A;  3P6E A;  1CJ5 A;  1OPB A;  2L5P A;  4ZGU A;  3U9P C;  1MDC A;  3APV A;  4QGW A;  5D8J A;  2N93 A;  2AMM X;  3VG5 A;  4OMW A;  5FQ6 E;  1LKE A;  3NX1 A;  1BSY A;  5F7G A;  4DQ4 A;  1D2U A;  1DC9 A;  5F6Z A;  2AL0 X;  2AH7 X;  3FR2 A;  5IO5 A;  4FBO A;  4A60 A;  4O3X B;  3WXQ A;  4ZHD A;  2HYS A;  3KFH A;  4Y0R A;  1HMS A;  2A2G A;  4YCH A;  2E4J A;  1ZNH A;  2WEX A;  4ORU A;  5LJB A;  4ML7 B;  3PH6 A;  3RWX A;  3OE3 A;  3WJD A;  3HWG A;  1I04 A;  1BSO A;  1EW3 A;  1VPR A;  2G79 A;  3BX7 A;  1CBS A;  5KHP A;  5HCC C;  4YGG A;  3HWF A;  2Q2M A;  5C0N A;  2LBA A;  4OS0 A;  4ALO A;  5JR8 A;  3BU9 A;  4RUU A;  5FEN A;  1B56 A;  2L67 A;  1U17 A;  1JZU A;  2EU7 X;  4DQ3 A;  4NLJ A;  1QY1 A;  4L3R A;  4QNI A;  3HOE A;  4YGH A;  1TOW A;  2GTL M;  4U8U N;  4YGZ A;  1YWC A;  1SY2 A;  4XMC A;  4ZHC A;  2WQ9 A;  4O49 A;  5LKF A;  4A1Y A;  3NQ9 A;  3HOL A;  1NP4 A;  5CE4 A;  1QWD A;  4IBA A;  3WJB A;  4IAB A;  1TVQ A;  3BU1 A;  4I3B A;  1LID A;  4M6S A;  4O4U A;  3HWD A;  3I17 A;  3RSW A;  1BRP A;  1SY0 A;  1OBQ A;  2FRS A;  3AKN A;  3FMZ A;  2R56 A;  4O9S A;  2QO6 A;  3CR6 A;  3PPT A;  4U9C A;  4L1N A;  1GT5 A;  2WEW A;  3I0A A;  3P24 A;  1MVG A;  1PEE A;  4IB9 A;  2MO5 A;  2AT8 X;  1EUO A;  2KT4 B;  3E3C A;  3OBL A;  1X8O A;  3CQR A;  3ZQ3 A;  4EFG A;  4ZHG A;  3FA7 A;  3STN A;  4GU8 A;  1KOI A;  2HZR A;  2LKK A;  1R0U A;  1UZ2 X;  3Q6L A;  1XCA A;  4GET A;  2KW1 A;  1E00 A;  4IB6 A;  4ZCB A;  2WR6 A;  1EIO A;  3FR5 A;  2NNE A;  3UAQ A;  1DFV A;  1NGL A;  4NYR A;  1EAL A;  1PBO A;  4I9S A;  3WVM A;  3FEL A;  4GK9 A;  2WUT A;  2F09 A;  4N7D A;  4FQB B;  4D6A A;  2OFR X;  2QO5 A;  3D4R A;  3SAO A;  5LJC A;  1LIF A;  2JU7 A;  4O4X A;  1T68 X;  3B2K A;  1ML7 A;  5F58 A;  4N7C A;  2MJI A;  3FEK A;  1AEL A;  1VYG A;  4UU3 A;  4EXZ A;  3OJY C;  5KIC A;  1LPJ A;  2W2B A;  3AKM A;  5L8N A;  3ZI8 A;  1U0X A;  4KII A;  4GRJ A;  2YG2 A;  3APU A;  3NQK A;  3DTQ A;  2LB6 A;  1KZX A;  1B8E A;  1HN2 A;  2BHV A;  3KQ0 A;  2Q9S A;  5D48 A;  5HZ8 A;  1KT6 A;  3P6C A;  2AKQ A;  5HBS A;  3UEW A;  2WQA E;  1DF3 A;  4KC8 A;  1BJ7 A;  1O1U A;  1S2P A;  2HMB A;  2OZQ A;  4GZV A;  4YBP A;  1I05 A;  4PSQ A;  1MUP A;  1JIW I;  5B27 A;  5LJD A;  1DV9 A;  3TF6 A;  3NR3 A;  1KT7 A;  2MHD A;  2OVE A;  4TQ2 A;  3RBY A;  2BT9 A;  3F8A A;  3NBX X;  4KCA A;  2X8T A;  2Q39 A;  2A13 A;  3IA8 A;  4O4O A;  2CZU A;  2K23 A;  3GE2 A;  5D45 A;  5H8T A;  2P8G A;  1QY0 A;  3B2L A;  1N0S A;  3TZS A;  1BEB A;  1GKA B;  4OS3 A;  2X45 A;  4ON1 A;  2A3F X;  3NX2 A;  4ORS A;  3TGA A;  3NPO A;  5FAZ A;  4MIS A;  2RCT A;  4ZJ0 A;  1IIU A;  1EI5 A;  3PQU A;  4A8Z A;  3T1D A;  4AYH A;  2NNQ A;  2KTS A;  1QG5 A;  4TKB A;  2OVS A;  2OFM X;  2MM3 A;  5LJE A;  4QZU A;  2ACO A;  2HLV A;  5EEE A;  3JQO A;  1YP7 A;  1OEJ A;  1RBP A;  3NQ3 A;  3P02 A;  5HTE A;  1QAB E;  4WFV A;  5HA1 A;  1OPA A;  1GT4 A;  1B0O A;  1Y9T A;  4AZN A;  4AZO A;  1U18 A;  2FT9 A;  3S5V A;  4LZU A;  1Y9L A;  4MVE A;  2DM5 A;  4BVM A;  5EED A;  3ZUO A;  2CBR A;  3MVF A;  5HWZ A;  1KT4 A;  5LKE A;  4GE1 A;  2GTL O;  3P6F A;  2LA7 A;  4YFP A;  2BS5 A;  1HMR A;  1O1V A;  4ORY A;  1OEK A;  4QZT A;  3STK A;  3V8U A;  1SXY A;  1SY1 A;  5AQ6 A;  2W2A A;  3CWK A;  3STM X;  4ZHF A;  5HTD A;  4I3D A;  2QM9 A;  3P6G A;  2G7B A;  5D47 A;  4HPC A;  1KQX A;  4ORR A;  1OBP A;  3KFI A;  1EPA A;  1EQD A;  1GXA A;  2R74 A;  4XMH A;  1FDQ A;  2Z4I A;  4O3Y A;  4ODD A;  4AZR A;  2FS7 A;  3GAQ A;  1VYF A;  3KFF A;  2RQ0 A;  4I3C A;  5CYB A;  2M4L A;  4MVL A;  3HTY A;  5AEO A;  3FEN A;  1BLR A;  1RLB E;  1SY3 A;  1X89 A;  1EPB A;  2X8S A;  4WBK A;  3B2I A;  5FQ7 E;  1KT5 A;  3MBT A;  1E02 A;  5KID A;  3ELX A;  3APW A;  4ORW A;  4YDA A;  1DZM A;  4YMY A;  2KD2 A;  3C76 X;  3ELZ A;  4YFR A;  1JBH A;  3O2Y A;  3VE1 A;  5HCD C;  2ASN X;  1BWY A;  1HBP A;  2JN3 A;  2XKL A;  3U03 A;  3BDR A;  3CBS A;  4QYN A;  3APX A;  4YKO A;  4AZQ A;  4IB7 A;  1CBQ A;  4ZH6 A;  3WJE A;  2OVD A;  3BX8 A;  1X8Q A;  1HMT A;  3KZA A;  1A2D A;  1ACD A;  4HPD A;  1E5P A;  5BVS A;  4QYP A;  2GTL N;  4WFU A;  1GX9 A;  3HK1 A;  1ZNK A;  5HZ5 A;  4ARH A;  3VG2 A;  1ZND A;  3CBC A;  3WJF A;  1E06 A;  1TXL A;  1P6P A;  3S5X A;  4IMN A;  4TKH A;  1O8V A;  4I6S A;  2W2F A;  1LIB A;  2WWP A;  1CBR A;  2RD7 C;  5HA0 A;  2ZAG A;  2Z4H A;  5EZ2 A;  1X8P A;  3WJC A;  1YP6 A;  2JW1 A;  3WBG A;  1HBQ A;  1Z24 A;  5F1E A;  3BY0 A;  1QQS A;  4NNT A;  1YUP A;  5DG4 A;  5EPQ A;  1ZNE A;  3CMP A;  2R73 A;  4INN A;  4XMG A;  3L4R A;  1BBP A;  1B4M A;  2HZQ A;  1GT1 A;  4M7M A;  1S7D A;  4GKC A;  4HPA A;  1HQP A;  4IAX A;  5FFH A;  3C77 X;  4NP1 A;  2AT5 X;  3JS1 A;  2AT6 X;  3RZY A;  4A1H A;  1KZW A;  3VG6 A;  1T0V A;  1ICN A;  3F6Z B;  2RN4 A;  4ZGF A;  4CV7 A;  4RUN A;  2RA6 A;  2ACP X;  3B2J A;  1SA8 A;  1A3Y A;  2CM9 A;  4KT5 A;  2POA A;  4I9R A;  5H9N A;  4CSB A;  2JU8 A;  1FEN A;  1OEE A;  4YBU A;  2QMI A;  4EQA C;  3TGB A;  4NW4 A;  3F9D A;  4R0B A;  3VG4 A;  1G5W A;  2K62 A;  4YDB A;  3ZZV A;  4NYQ A;  2FS6 A;  2PY1 A;  4YCE A;  1YWA A;  1LIE A;  4TNN A;  2JOZ A;  1EII A;  1S44 A;  2ZAI A;  3MX7 A;  3P6H A;  5D4A A;  3JSQ A;  1AB0 A;  3EMM A;  1A57 A;  3D95 A;  4TLJ A;  1G85 A;  3RKG A;  1AQB A;  4GNY A;  4IB8 A;  3UEX A;  5K06 A;  1QY2 A;  3C78 X;  1IFC A;  2A0A A;  3EBK A;  1JV4 A;  4AZM A;  4LZV A;  3O22 A;  4ID2 A;  4ZR2 A;  4ORX A;  5HCE C;  2GTF X;  1OBU A;  1QFV A;  4LKT A;  4O3Z A;  4GDZ A;  4ES7 A;  1L6M A;  4YKM A;  4HFO A;  3EYC A;  3H3I A;  3P6D A;  1SXX A;  1QFT A;  1X8N A;  3HWE A;  3PQS A;  3FR4 A;  3O19 A;  4U8U M;  1I4U A;  5L8I A;  3FW5 A;  2A2U A;  1MX7 A;  2BS6 A;  3QKG A;  1XKI A;  3NAD A;  4LQZ A;  1LNM A;  4HPB A;  1X71 A;  1DZK A;  2X46 A;  1KT3 A;  1TOU A;  1IW2 A;  3VG3 A;  1PM1 X;  4YFQ A;  1AVG I;  1KXO A;  4MVK A;  4GNW A;  5HZ9 A;  4FGI B;  1D3S A;  1KGL A;  4K19 A;  1YWB A;  3BRN A;  5LJG A;  5HZ6 A;  2FTB A;  5IO6 A;  3LHN A;  3D96 A;  3S26 A;  1ZNG A;  1JJX A;  1PMP A;  4UU2 A;  4FBV A;  1CRB A;  2GC9 A;  3ZW2 A;  3ZW1 B;  2ANS A;  4YH0 A;  3G7X A;  1FTP A;  2GJ5 A;  2Q4N A;  3WJG A;  3ZW1 A;  3FA9 A;  4Y0Q A;  4CK4 A;  3PH5 A;  3UEU A;  3BS2 A;  4COT A;  4XMF A;  2AT3 X;  1FEM A;  3ZW0 B;  2FWV A;  1DZP A;  3KFG A;  3VG7 A;  1TW4 A;  1GM6 A;  3PED A;  1I06 A;  1JYD A;  3ZW0 A;  3DSZ A;  1MX8 A;  2AT0 X;  3FA8 A;  3IFB A;  4MIR A;  5H9A A;  4HWM A;  3U0D A;  2Q2P A;  4XMD A;  1G74 A;  1X8U A;  2MWH A;  3EBW A;  4MVI A;  3ZWE A;  1JJJ A;  4ZH9 A;  5DPQ A;  1LFO A;  1T8V A;  5B29 A;  2O62 A;  1YWD A;  2XST A;  3OD9 A;  1DZJ A;  4NNS A;  2CBS A;  3D97 A;  1IKE A;  4IMO A;  2BLG A;  5LJK A;  5BVT A;  5BVQ A;  3FLL A;  2L9C A;  4QGV A;  4O3W A;  1LIC A;  2QO4 A;  3VU1 A;  4QAE A;  2JMB A;  4JGL A;  1ZRY A;  1SXU A;  2G78 A;  4WHI A;  3ZUI A;  5H9L A;  5EDC A;  3BLG A;  3VE2 A;  4EDE A;  1FEL A;  1JYJ A;  2LBV A;  1NP1 A;  1GX8 A;  4Y0P A;  5HZQ A;  2YMS A;  3SOT A;  2RCQ A;  4BOE A;  1G7N A;  5H9K A;  4BQU A;  3CQN A;  2FLJ A;  1KQW A;  4TJZ A;  3WOV A;  3FW4 A;  1BRQ A;  2JU3 A;  1YIV A;  4D6B A;  4AW8 A;  5LJH A;  1ERX A;  1ICM A;  1ZNL A;  2OVA A;  3PEC A;  5HAE A;  4QGX A;  4KC7 A;  1H91 A;  1SXW A;  4U3Q A;  4ALB A;  4FBR A;  4LKP A;  3FYF A;  3TGC A;  3NP1 A;  3PP6 A;  1IFB A;  2FR2 A;  4OMX A;  4ZHH A;  2X8F A;  2KTD A;  4KH8 A;  2LFO A;  4AZP A;  3K3L A;  2HNX A;  4IAW A;  5L8O A;  4GH7 A;  5FQ8 E;  4ZFX A;  1LF7 A;  4XME A;  1EXS A;  1GT3 A;  1URE A;  2L68 A;  5AJC A;  3LV4 A;  3UEV A;  3B2H A;  4OS8 A;  1ALB A;  2NP1 A;  2IFB A;  4QRL A;  4QQ1 A;  2WSJ A;  3FA6 A;  3FEP A;  1BSQ A;  3S60 A;  1GGL A;  4O4S A;  2CZT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...