1YWKA

Crystal structure of 4-deoxy-1-threo-5-hexosulose-uronate ketol-isomerase from enterococcus faecalis
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
263
structure length
255
Chain Sequence
LQNMETRYTHSPADIRHYSTEQLRDEFLVEKVFIPGAISLTYTHNDRMIFGGVTPTTEELEIILDKELGVDYFLERRELGVINIGGPGFIEIDGAKETMKKQDGYYIGKETKHVRFSSENPDNPAKFYISCVPAHHKYPNVKISIDEITPMETGDPLTLNQRKIYQYIHPNVCESCQLQMGYTILEPGSAWNTRMEAYVYFDMEEDTRIFHMMGKPDETKHLVMSNEQAAISPSWSIHSGVGTSNYSFIWAMCGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of 4-deoxy-1-threo-5-hexosulose-uronate ketol-isomerase from Enterococcus faecalis V583
rcsb
source organism Enterococcus faecalis
molecule tags Isomerase
molecule keywords 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase 1
total genus 59
structure length 255
sequence length 263
chains with identical sequence B, C, D, E, F
ec nomenclature ec 5.3.1.17: 5-dehydro-4-deoxy-D-glucuronate isomerase.
pdb deposition date 2005-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04962 KduI KduI/IolB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ywkA00
1YUDA 2PA7A 4BHPA 1Q3EA 3KGLA 4F8AA 1XE7A 2XKOA 2P17A 1ZZ9A 1CGPA 2K0GA 2VECA 5BY5A 1L3JA 3FE5A 4XFAA 3BCWA 3I54A 3L2HA 4J1WA 3LA3A 2OZJA 4IEVA 3H8UA 4K8FA 4HN1A 3SXWA 4Q0SA 5D1IA 4XFCA 2XL9A 2GH2A 5I8TA 3MYXA 1ZNPA 3IDBB 4I02A 2IXKA 4XFFA 2ZCWA 3BALA 4YYOA 4JTOA 2IXHA 3E6BA 2DCTA 2BYVE 3IDCB 4H7LA 3RYKA 2BNNA 4DINB 2PYTA 4XFIA 1J3PA 1VR3A 1X8MA 3LAGA 1CAXB 2H6BA 3UKNA 4HSLA 1Q43A 1DGWA 1LB2A 3S7EA 1CAVB 4QX5A 4N9HA 2GZWA 2QVSB 3S0MA 1O4TA 2GC0A 4MGKE 4IEOA 5FLIA 2VQAA 4AQ6A 4XF9A 4MZUA 2XLFA 3RDIA 4AVAA 5I0SA 4JV4A 1J58A 3ETQA 2OA2A 2BGCA 1CAWB 2PAEA 3WW3A 5CADA 2V09A 3ACLA 4HSJA 1J1LA 1UPIA 1EP0A 4EWDA 2GC3A 1LKNA 1NYWA 1UCXA 1QY4A 2Q1ZB 4LLOA 2ETEA 1NE4A 2IXLA 2IXCA 4I0AA 4KWLA 4MGYE 3LA7A 1RUOA 5FQ0B 2GAUA 3JZVA 2BEOA 3B02A 1ZRRA 1ZZ6A 2PTMA 5I0RA 3DN7A 4LEJA 1WLTA 4Q29A 3WW1A 1SEFA 4IEPA 4KWKA 1ZRCA 2EA7A 3CEWA 3I59A 5KHHA 2QCSB 4OFGA 4CYDA 2KXLA 3E5QA 4O9GA 1X7NA 2CV6A 3CL1A 2K9ZA 4ZU5A 3EHKA 3MZHA 1O3QA 2XL7A 1OFNA 5LEJA 1X8EA 1I6XA 3E6DA 4FBFA 3H50A 2Q4SA 3FJSA 4YARA 3H7JA 4N9IA 2CGPA 1FT9A 4GULA 4L2NA 1OD5A 5I91A 5EFUA 3SCFA 4JVAA 4XF0A 3NL1A 4HZFA 4JTNA 4XFGA 1UD1A 5LEKA 3FZ3A 3IWZA 4D7TA 4EWAA 1VP6A 3NW4A 5J7MA 4LUMA 4KU8A 3TNQA 3FWEA 1WA4A 3DL3A 5FCCA 2ET1A 4OLLA 4UBHA 1O3RA 4PIYA 1TQ5A 1CAVA 2I45A 2XLGA 5KHGA 1O5LA 4KWJA 3EJKA 5KHJA 3S7IA 3HIFA 1YFUA 2UY9A 1CAUB 3LOIA 4IEUA 4XETA 1O7FA 3KGZA 4B29A 2E9QA 3E6CC 2CAUA 3U10A 1NXMA 4XEZA 3BU7A 4BIFA 1DZRA 4Q0PA 1Q5OA 5E16A 1RTVA 3LZZA 3E97A 2Y0OA 4BYYA 3MPBA 4KL1A 4I09A 4D7SA 1YFYA 5E1RA 1SQ4A 2IXJA 3UKTA 5FQ0A 1LR5A 3FHIB 3D0SA 4HN0A 4Q0VA 2Z2SB 5CVRA 1ZREA 3BB6A 2O1QA 4I01A 1GQGA 1FXZA 3SCGA 1PMIA 2QNKA 2MPFA 5KBFA 5FPZA 4P9GA 4MGIE 1X82A 3PLQA 1QWRA 3OD0A 3C3VA 4UXAA 1WGPA 3UKVA 3OF1A 4HVOA 5FLJA 1UIJA 4HBNA 2ET7A 1CAXA 1EPZA 2FMYA 2XGXA 4FAGA 4Q0QA 4QXKA 4LA2A 1JUHA 4LTAA 4MX3A 2FQPA 5J48A 3LWCA 4LULA 1UW8A 2CAVA 3CLPA 4QGNA 3H7YA 1ZRDA 2GU9A 5KHKA 4HVRA 4O9EA 1Y3TA 3O14A 2N7GA 4LA3A 4WZCA 1RUNA 2D5HA 1YHFA 3GBFA 1XRUA 2GC1A 3FX3A 4PIXA 3D82A 3H1YA 4YRDA 4PJYA 5C6CA 4HLTA 3TNPB 4FAHA 4FT8A 3EO6A 1CAUA 1I5ZA 4NVPA 4WVZA 1O3SA 2B8MA 1OMIA 4QM8A 4Z82A 3OGJA 4XF4A 1IPJA 4IEZA 2VPVA 4KU7A 3ROUA 3I59B 3FFQA 3KSCA 3R6SA 5J3UA 3N4MA 2XKPA 1J3RA 4AXOA 4QGLA 2D93A 1YFWA 5T3NA 4AVCA 1DGRA 1ZZCA 4AVBA 3VHRA 2PAKA 4IEXA 4ZU7A 1NZCA 2B5HA 3E5UA 2H0VA 2D40A 3H9AA 3NVCA 4ONUA 3IBMA 2H6CA 2PQQA 4Z07A 3E5XA 3MDPA 4E2SA 3BPZA 5CU1A 4EROA 4MV2A 4J1XA 3WW4A 3NSTA 1J3QA 4MH0E 2Q0AA 3M3IA 4A2UA 5JSPA 4IETA 1LRHA 3OTFA 2IC1A 2PHDA 2MNGA 4QMAA 1UIKA 2Z69A 2UY8A 1HW5A 1YWKA 2XLAA 3RYPA 4EV0A 1V70A 2EVXA 1ZZ7A 2WC2A 3D0JA 5FLHA 3SCHA 1ZRFA 4E2QA 3PNAA 2XHKA 3KMHA 3G7DA 5I8SA 1NE6A 1YFXA 3ES4A 5JSOA 3ELNA 2OZ6A 1DZTA 4IERA 1GQHA 1QXJA 3RZZA 4XFHA 3QOPA 5LRRA 1CX4A 4IEWA 2PHLA 1O5UA 3ST7A 2BNOA 2PFWA 3RNSA 5BUVA 3LA2A 5I93A 2Q30A 4F7ZA 2D5FA 1CAWA 3OCPA 4R52A 4L11A 1J59A 2OPKA 3ES1A 4LUKA 1OI6A 4R8HA 3U11A 3CO2A 1ZZBA 4UBGA 4IESA 1VJ2A 5JCTA 4XF3A 4WBBA 4XF1A 1XE8A 3IIAA 4ZU4A 5EZWA 5LRSA 4I3PA 5FPXA 5KHIA 4I2OA 5BPXA 1RC6A 3CF6E 4ORFA 3H1WA 3NKTA 5I0UA 5HI0A 3NJZA 1EY2A 3QACA 4HVQA 4TLFA 3ZDSA 1ZX5A 3EBRA 1EYBA 3U0ZA 3USSA 1ZVFA 2C0ZA 4RD7A 5I0TA 3HT1A 3H3UA 2PAMA 4PIZA 2QJVA 2WFPA 2B9UA 2ATFA 3PVBB 5BXXA 4X6RB 5F1RA 3RYRA 2IXIA 3SHRA 3EQEA 2HKXA 2O8QA 2EAAA 5JSRA 1H1IA 3DKWA 3H1MA 1Y9QA 1QXRA 4HMZA 3CJXA 3M70A 4YNIA 1PM7A 4IEQA 4BH9A 2BNMA 2UYAA 2F4PA 3DV8A 4XFBA 2MHFA 4QGMA 3WW2A 5BV6A 1RL3A 3KCCA 1U12A 2OYZA 4IEYA 5JAXA 5AVPA 4META 5JR7B 4MUVA 5K8SA 4X6QB 4YSFA 5I8YA 3SMHA 4I0BA 1RGSA 4QM9A 1FI2A 3RPQA 3HQXA 2GC2A 3H3ZA 3HT2A 5C8WA 4EWEA 2QDRA 5FDBA 4E2GA 4Q0UA 1SFNA 4MGZE 2ZKLA 3GYDA 3I7DA 1G6NA 4AQ2A 1H1MA 1IPKA 2HJIA 1ZZ8A 2UYBA 1O3TA 1YLLA
chains in the Genus database with same CATH superfamily
3KVAA 4F8AA 1Q3EA 3KGLA 4A4AA 1W2OA 1Q8PA 3PTRB 3J8F3 1SLBA 2P17A 4A44A 4RR3A 1BJQA 1ZZ9A 3SH3A 2EALA 4A6SA 2XJRA 1LESA 3WEZA 3ZXEA 3KHCA 2XUEA 5BY5A 5FV3A 4JDNA 3THPA 4K7JA 1KS5A 3IAQA 2HBTA 2YXSA 5LK7B 3LIHA 4J1WA 4PDWA 3V65A 3LA3A 1H2NA 3H8UA 3BTZA 4Q0SA 4XMIA 4XJ8A 1KJLA 1GFF2 2WA3A 3VDBA 3AZZA 3HWJA 2FMDA 5J1XA 3ZR6A 2MEV1 5FFOC 4AYUA 4I02A 3DPRA 1H2MA 1MS4A 2IXKA 3BALA 4XFFA 4IV1B 2E63A 1AX2A 1VBD1 4JTOA 5E88A 4YYOA 3O1TA 4CDWA 4NIAA 3BU0A 3FUQA 4Y3OA 3E6BA 1ZBA3 1PZ7A 1PGW2 5IT6A 2PYTA 1LOCA 4P5HA 5J98B 3CHXA 3TRSB 1J3PA 1QNYA 2CGOA 1X8MA 4BXSV 1YO8A 2ZEYA 1W8ZA 3LAGA 1CAXB 2H6BA 4E8DA 1HXS1 1RUE1 1CZTA 2UWCA 1Q43A 2VZTA 1DGWA 3B00A 1PZ9A 5IVJA 1QJY2 4YW5A 4AVVA 1IS6A 1B35B 3NV4A 4QKNA 1OLME 5DZEA 4AHWA 2WUHA 3MW2A 2JDUA 1H4GA 3OYWA 1CONA 3WCRA 4MHRA 4CDWB 4LBKA 3RVHA 3JUUA 4IEOA 4NHMA 2TBVA 5FLIA 1YQ5A 4BIOA 3H42B 2BGOA 1UOGA 5FZ9A 1N1VA 4MZUA 4QX3A 3RDIA 4YZ1A 4JV4A 1J58A 2VZRA 3MUZ1 4DS0A 4RSUA 4Y4YA 4EJRA 2RDSA 4G3YC 3AVRA 3K46A 4H2AA 4PF5A 1X50A 4AI3A 1OFSA 2ENRA 2ZHMA 3ACLA 5FMCA 1J1LA 4EN0A 1T2XA 2OKXA 2V73A 4CCDA 1W6OB 1MQTB 1LKNA 1UKGA 2WO7A 2QUOA 2YHJA 2B4KA 4CXXA 3JB8A 5C9AC 1AYN1 1Z7S3 4LLOA 4ITCA 2BQPA 4QPWA 3T3YA 1D7PM 1ZBE2 1NY72 4K21A 4N90A 5JZGC 4BWOA 1UN1A 4LMFA 2IXCA 5DAVA 4I0AA 4QKFA 4AF9A 4BQ2A 4MGQA 1I5PA 3ACHA 3RG0A 4E8CA 1BEV2 1DCSA 1VLNA 3LA7A 2PHWA 4FOQA 2LW8A 4V2WA 5F5CA 2BEOA 4JRAA 5C3OA 4W65A 4Y1UA 4Z2WA 1N1TA 4QB1A 3WW1A 4H14A 1GP5A 3U37A 2ZZQA 5ABJA 4LORA 2QCSB 3AKTA 3CU7A 3N9LA 1DQ5A 2C6SA 4HL0A 4OFGA 5L73A 1NCRA 5LBEA 5HPOA 4OYUA 3HQUA 5A7SA 4O9GA 1X7NA 3T2PA 3VDDA 2CV6A 3LIGA 4YGCA 4Q4Y1 4ZU5A 3A22A 5A3OA 3BN6A 3WNNA 5AC93 2XL7A 2RM21 3NAPA 3PURA 4DNYA 5LEJA 2JECA 2VGDA 3NAPB 4QHZA 4FPCA 3FJSA 4YARA 2YC4A 2CGPA 3IAPA 5DQ0A 1VBB3 1W99A 2JE9A 5JI9A 2QZ2A 3VDDB 3K2OA 1IQDC 1UY4A 5GZGA 5JXGA 3H8XA 3O1MA 2OVUA 1VBB1 4XFGA 5LEKA 5LBCA 4QPIC 4BDVB 1C8M3 3HOBA 5FYUA 5EHDA 3INAA 3BODA 3SITA 1F31A 3LE0A 2QQJA 5E89A 2GNTA 2VC9A 1DYPA 3MPPG 4OZXA 4QPIA 3TNQA 1WA4A 4LIUA 4CU6A 1WKYA 2VY0A 5C71A 1ZBA1 3VZJA 4OLLA 3TEYA 3CJIC 3RQ0A 2RR13 4PIYA 2QQVA 3OGSA 1F5FA 1BQPA 5FIXA 4BE3A 1POV3 4DXSA 3NQHA 5C8CC 4ZY9A 3VBHC 3LSDA 3OPTA 4O65A 4TZDA 3V0AA 4GIQA 5FK8A 1JYXA 2ZGTA 1DF0A 3GZTB 5DDJ1 5IFTA 4FQ4A 3ZR5A 3C8XA 3OOXA 3KGZA 2DWRA 1X9TA 5CYYA 3SH5A 1XJAA 2VZUA 4XTMA 5FYMA 3K3NA 4DUVA 3E6CC 1H30A 1S0GA 5GLUA 2YGLA 2W1SA 3QBQA 1VAKA 1MS5A 5E16A 5LASA 2Y64A 2NQYA 3LZZA 4X8PA 5FP8A 1M06G 5EWSA 3E97A 1KDKA 3MPBA 2WZR1 4KL1A 4QB6A 1A78A 4D7SA 1L7RA 4HOOA 1NLQA 4QKDA 1YI9A 2JKBA 1GNYA 3WP6A 2HWB2 5FQ0A 1UOBA 3U4SA 1JOBA 1ZREA 4I01A 4QX8A 1HB4A 2P1BA 5GLTA 1YYNA 4OUSA 1MS9A 1FXZA 1D0HA 4GD4A 3CQOA 4H3WA 2VE1A 3SCGA 1J1TA 2CHHA 3B01A 2QNKA 1SMVA 2LROA 4QQHA 1AXKA 1X82A 3PLQA 4I30A 4JKMA 4BLIA 3OF1A 4BISA 5FLJA 5HCBA 1XNKA 2XGXA 1W6QA 5K7PA 1LULA 4GH4B 4QXKA 5A6YA 1XNCA 1DDLA 1G9FA 2C26A 4GH4A 4DB5A 4Y5SA 1O8SA 2FQPA 5J48A 4CXWA 4CU9A 2PXJA 4IGQA 3QCWA 4RN5A 1Q8SA 4HK8A 4DUWA 2JDHA 4RGKA 4XUTA 4LO6B 4AAXA 2GU9A 4AVSA 3L9JT 5FP4A 4O9EA 3BTYA 5F8PA 1X36A 4AI9A 4YWAA 3C7HA 1GOFA 2BZDA 3WF4A 3T1MA 1RUNA 1N1YA 2P4EA 3AMQA 3AZVA 1APNA 2R49A 3KT1A 3NV1A 1OA4A 4Q4V1 4XJZA 4PIXA 1JZ8A 1U5XA 2OW4A 2UU8A 1COV2 1OH3A 1GZWA 1S1AA 2ZEZA 2W3JA 5FYCA 4NIDA 2RM23 5C6CA 3ITQA 4GB33 4FAHA 2JKXA 1AYM1 1O6UA 3MHZA 3WNPA 3ENRA 5A6XA 4CZSA 1HB1A 5FKCA 3VKMA 1OMIA 4Y1ZA 4QM8A 2SLIA 1TEIA 5E6HA 1PO13 3CIHA 1XBFA 1AYM3 2J1AA 2Y0IA 4FI9A 2XMLA 4LBQB 3GCWA 5JXIA 4W6XA 1VRBA 3K75B 5CFCC 2VD7A 1FOD1 3ZDVA 4AL9A 2R0FA 2A71A 3ZYJB 4OHXA 4P00B 3POIA 1V6MA 4AXOA 5IVBA 3I2JA 1REEA 1V6JA 2GALA 4FXGB 5T3NA 3VDCA 1YJKA 4LIVA 1W06A 1GNZA 1S0EA 4UW6A 5EJZB 5DUWA 2VQTA 1YEWA 3R4DB 1OLMA 3LDRA 4LOSA 3B5LB 3POSA 1NZCA 5F3CA 2QQPA 2D6LX 5AVAA 1ASJ2 2B5HA 4QPIB 1PO22 2H0VA 3B93A 4XJ9A 3BI3A 1UZYA 1RUD2 3WXPA 1GWMA 1RUG1 4N43A 1ACCA 2VXRA 2W95A 4RA0A 5BNOB 1SPPB 2XG3A 3GJAA 3N7KA 4Q4V2 3S5AA 1RHI3 4Z07A 1HJGA 2CWSA 2DVBA 4I0WB 3C7OA 4YZ4A 1LAJA 2Y38A 2CSGA 1KEXA 1US3A 2TUNA 5CU1A 2FHRA 1Q56A 4AEJA 3U75A 4FP2A 2XQRA 1HQWA 4HKOA 2FDFA 5GKAC 2WSUA 2D6KA 2VM9A 3ZVXA 5JDBA 2O8OA 5A1AA 4JGZC 1VRH3 1CZSA 2G9GA 4OULA 2B7YA 1YC61 1J3QA 1W8TA 3LF7A 2Q5TA 2DUOA 2EIDA 4MH0E 5AFBA 2ZHNA 4XCBA 1D4VB 1REDA 1RVF2 2WNUA 1JTZX 2AUYA 3CNAA 4HETA 3W20A 5KXEA 5EIYB 4IETA 1NCRB 3OTFA 4GAZA 1OVSA 4LHSA 2JG9B 2MNGA 4QMAA 1W0OA 3NV3A 2UY8A 5FYZA 4PDWC 1GICA 2XJPA 2DVDA 3NNLA 5CFDB 3I2HA 1YWKA 4E4SA 5BNQA 5JR2A 3RYPA 4GMP1 1ZRFA 2X5IA 2ZGRA 4C1WA 1CPNA 4E2QA 2ARCA 3PNAA 1IGOA 1JOPA 1EAH1 2E26A 2XHKA 2WNVB 3KMHA 3MLKA 5FP9A 1JYVA 3MLJA 1OUSA 2FBEA 1RYYA 4UFHA 4BQ4A 2R063 2GSYA 4P9LA 1COV3 1MVEA 2R1BA 3WF1A 3VBRC 1JZ2A 4JHZA 2DURA 4XBQA 4JC1A 3RZZA 5HBAA 5HCFA 2JE8A 4P14A 4QXHA 2QBXA 4XFHA 2WYFA 5FYSA 3QOPA 5IYYA 4NRMA 4RQPC 1QMJA 1CX4A 1DQ1A 5LRRA 1R1A3 3OBRA 3M8LA 1RUH1 3RNSA 2ID4A 1JH5A 3LA2A 2WFF2 4C0HA 4F7ZA 2RJ2A 4SBVA 3FUOA 2WZPP 1QJX3 1ND3A 4ZS3A 3WUDA 1J59A 3IM0A 2ZEXA 3D8CA 1Q8VA 3MW3A 3TYJA 4LUKA 1ND2B 1OI6A 4JGZA 1MEC3 2JE7A 2W08A 5IATA 4PDWB 4OUEA 4AI8A 1WA6X 1STMA 4W6WA 3CO2A 3VZLA 3HQRA 3ZX7A 1F4HA 3O0VA 1VJ2A 4Q1PA 2E32A 4XF1A 5G05L 4BMEA 2R042 3OYWB 3O0XA 3W21A 4I2OA 5JIAA 5DZGA 3RS6A 4BQ3A 4B3NA 1OLQA 5FY8A 5FZOA 3FLTA 4NAOA 2QE3A 2WLQA 3AXEA 2DVGA 1WD4A 3U4XA 5KXBA 5FP7A 1AF9A 5I0UA 1U0AA 1RXGA 1VE0A 5HI0A 4JQRA 4DZGA 1K5MC 3HMYA 4HVQA 4XE9A 3LCPA 1GLHA 4TLFA 2JB8A 3PU3A 5DDJ2 5F5IA 2Z4FA 3KF3A 3EBRA 1EYBA 2WRAA 1H6YA 1VRH2 2Z42A 3ZO0B 5I0TA 3HT1A 4V1PA 5BNOC 3PVOA 3KZ4C 5CZKA 3OUIA 3POJA 3ME2A 2WFPA 2B9UA 2JG8A 4COWA 2JWPA 3RZJA 2VUCA 5C4WB 2OQ7A 4X6RB 3RYRA 3RFRA 3ZFEB 4FTBA 4BQ1A 3PUHA 2HKXA 2O8QA 1N3PA 4UAPA 2C9AA 2EAAA 2FDIA 3UGGA 2RS53 5CFDA 1PGSA 1OPOA 4Q2FA 5JMCA 1GSLA 3U07A 1SFPA 4Q4W1 4P02B 2WWSA 4XZUG 1DQ6A 5FZEA 1CVNA 5FJKA 3WNOA 4INDA 2VZ3A 4CVUA 1R091 3MUY1 4GWMA 4CDXC 1RVF1 4CDUC 3WG4A 1QXRA 1Y9MA 4HMZA 2VBBA 3Q8BA 5IW0A 3AK0A 3M70A 3VBOB 4CCOA 5CFCB 1OKQA 1RINA 4KI5M 5F5AA 1YNAA 4CEYA 1LOGA 3O0WA 1XNBA 1W6PA 2F4PA 4QPGA 1POV1 2XWBB 1GZ9A 5BV6A 4QQ2A 3S30A 3KCCA 1MEC2 4B8EA 2JG9C 5A3NA 1PVXA 4HPKB 1SZBA 3I2FA 4IEYA 1W3VA 4QDQA 4QXBA 1NA1C 3SISA 3IKWA 3D5OA 2FZ2A 2YY1A 4FFFA 4YW7A 3KQRA 3R05A 4RS5B 4Y22B 1TME3 4X6QB 4YSFA 4ZKTB 1KGYA 2WAOA 1ND2A 1KXGA 5FZ3A 2H0BA 1NLRA 2B46X 4R9AA 2Q8OA 4X8NA 2R061 4AEDB 4QX7A 1FI2A 1R092 2FCUA 3RPQA 3VBUB 3H3ZA 4OI0A 3HT2A 4EWEA 4V2VA 2X53S 5GZDA 1AZDA 2Q8CA 3VKOA 4E2GA 3VGIA 5JIUA 1GV9A 1SLIA 2KD7A 4MGZE 3OGRA 2Q8EA 5F32A 2BRTA 3VBFA 1KRIA 4XW3A 2WZEA 1WZXA 3ZSJA 2VW1A 5D21A 2AZ5A 1IPKA 1S0CA 1AYN2 2JJ6A 1UYPA 3A0NA 1MQTA 4MYEA 4FPLA 1I1EA 4M01A 1WCKA 3A0KA 2O14A 4NIIA 4BHPA 1LENA 2WO1A 1XE7A 1UMIA 1MEC1 2WNVA 2PLV2 2XKOA 3VKFC 1NX9A 1S0IA 2IFWA 3J7MA 3TN92 2GN7A 2ZAAA 3CDZB 2K0GA 5A33A 3SLIA 2GNMA 4NN0A 4QPGC 2WQZC 2LUWA 2HWE3 4XFAA 3BCWA 1AJKA 1RMU3 4IEVA 3P6BA 3NNMA 1O4ZA 1GZWB 1BBT3 5L7OA 2HWE1 4S2HA 2C9KA 1FPN1 4JX0A 2J22A 1UKRA 1HN1A 4ARXA 5C8CA 1AHSA 1K3IA 1VALA 2FCTA 2WA4A 3WP3A 4A45A 5A33B 5I8TA 4CU8A 2ORXA 1ZNPA 3IDBB 4OVEA 1LTEA 3RWNA 3BUCA 3KT7A 3UJOA 2IXHA 1MZ6A 1HKDA 4K6BA 2YPJA 2YYOA 2G9ZA 2WZR2 2XWJB 2VUAA 4YVWA 1W9SA 2DCTA 2BYVE 3NO8A 3I2IA 3IDCB 1HXS3 1RUE3 1KQRA 1QJZA 3I97A 2QQMA 2R32A 4UFKA 2IUWA 4XPVA 4GALA 5BNOA 2A5ZA 4HSLA 2A3YA 5FY0A 3WP4A 4AI0A 2FDJA 1CAVB 1RUH2 1U5ZA 1YQCA 3K48A 4LJHA 3O1UA 3ZM8A 3NNGA 2FZ1A 3KCXA 1O4TA 4DUXA 4M3CF 2FDKA 2D98A 2Z79A 5FZ6A 4DQAA 4MGKE 1IS3A 1RUJ2 4YW2A 1CIYA 3GXUA 2DF7A 1RXFA 2A6ZA 2ZGLA 1SCSA 4AQ6A 2RMU3 2JDYA 4NPLA 4XF9A 1POQA 2PLV1 1EV11 4CCCA 1RB8G 1EAH2 3FHQA 3I2GA 3ON7A 5A32A 3ETQA 3OJBA 4C91A 4FPYA 1F9KA 4LKFA 4NIGA 4K8RB 1ODMA 2WT0A 3SEEA 1SHWB 2CGNA 3UT0A 2PLV3 2V09A 1G9AA 5FXWA 4M00A 4CEYB 1KFUL 1XNTA 1IG0A 1UCXA 4ET7A 2Q1ZB 2HWE2 5J37A 4D69A 5FZDA 3GJBA 1UU4A 2IXLA 2KM2A 3DF0A 2RV9A 1A6CA 4GB32 5LA0A 4ZONA 3GZEA 3P3NA 4ZXEA 4L9BA 4IE5A 2ZGPA 4RHV1 1OOPC 1WLDA 5FYTA 5TSWA 4DRRA 1TNRA 2WT1A 2GDFA 4C8DA 2GN3A 2GAUA 1ZBA2 1ZZ6A 3WHTA 5I0RA 1ULFA 1TZOA 3GBWA 4LEJA 2JDAA 5DPNA 4Q29A 1BBT2 4A3XA 4AEKA 4IEPA 3ZPYA 3I59A 1PK6C 2BUKA 2DCKA 2W87A 1HB2A 3K51A 4MXWA 3AKRA 5IUQA 4OQ8A 2GNBA 2B45X 5FWJA 1GUIA 3RWKX 3EHKA 5KC5A 1W6QB 3HN1A 1OT5A 4C0BA 4IV1A 3T0AA 4PBOA 3ZFGB 5C3SA 3V0BA 3RI9A 2OQ6A 5CB7A 1ULEA 1KS4A 3E6DA 4FBFA 3ZSMA 4N9IA 4AFDA 1FT9A 1PGL1 4XABA 2F6BA 4LBJA 5CIRA 2VL4A 1ENXA 3KM5A 4Y5Z0 5E8AA 1DU3D 5FZOB 2YDEA 5JI7A 2BBVA 3DECA 3J9SA 4JVAA 2NPIA 1NQJA 3NL1A 3N7JA 4J25A 2E6VA 4ATEA 4QB2A 1FMD3 3VBOC 2RDRA 3FZ3A 4HT1T 5A6ZA 1W2UA 1NCQA 1AXZA 2VBPA 3IWZA 4K1YA 1VP6A 3NW4A 2RJLA 4DY5A 1O8PA 2EXJA 1ENQA 4NMIA 1ULCA 2DTYA 2C5DA 1GP6A 2Y60A 1DGWX 3WOGA 5A7WA 3DL3A 5FCCA 1H9WA 3C7EA 4UBHA 4LK7A 1LECA 3BOPA 1AYM2 3VBRB 1VBD2 1BEV1 1PO23 1TQ5A 2A75A 1CAVA 5T5PA 1QJU3 4EE2A 1SACA 5HCAA 5KHGA 5FY9A 1O5LA 3V0AB 5KHJA 2AREA 4MGSA 1IS5A 2VMIA 4Z1VA 4AHZA 3THCA 1CAUB 3LOIA 3SEPA 1POV0 2QQUA 1LGCA 4XJAA 5C5TA 1YI7A 5ACA2 5FUNA 1GBGA 1W39A 4DOUA 2TEPA 2ZEWA 3NKGA 1ND3C 1S0DA 1MVQA 1QOOA 2CAUA 4FP3A 4XEZA 2BVBA 4BIFA 1UQXA 1FOD2 4NHXA 3LOBA 2X09A 1DZRA 1R083 4XUNA 5JWPA 1FYUA 1GOHA 3O7OA 4Q0PA 3ZXGA 1E5IA 2AR6A 2OPWA 2RMU1 3DGTA 4MOAA 3UESA 3UGHA 3RJ2X 3KV4A 5C9AB 4LO5B 3ATGA 4ISQA 1LR5A 3EB7A 3D0SA 1BZWA 1JBCA 4HN0A 2XJTA 3VUOA 4OI1A 3WINE 4E4DX 1JZ7A 5IVVA 1AX0A 1WW5A 3USUA 4Q4W2 3PDQA 5KBFA 2VW2A 1JYWA 2WNVC 2IZWA 4Y26A 1BMV1 1HLCA 1QWRA 1WW4A 1XYPA 3C3VA 4LOTA 4P08A 5BNNC 3B94A 4CEWC 2Y8KA 4AGRA 4XIKA 4IXLA 3J26N 5HXVA 2G9FA 2ET7A 2HWC1 1CAXA 5C70A 1BHGA 5F2SA 3O1OA 1G8WA 1JN2P 1XOYA 3WUCA 3LEMA 3O1PA 3ACGA 3VLBB 1RVF3 4LTAA 4RHV3 4N7IA 3NRUA 3AB0A 5J96B 2O0OA 3KD4A 4CCNA 2CAVA 2YU1A 4QGNA 4UT5A 5A80A 2XDVA 1W8OA 4BA6A 1WBLA 2ZGKA 1ZRDA 4XMAA 4A6OA 4OI2A 4DRVA 1V00A 1AL0G 5FYVA 2N7GA 2XVKA 1YQ6A 1IZ3A 2HBUA 4NUBA 4WZCA 4XURA 3ILFA 1XNDA 1RMU2 1FMD2 1OOPA 1YHFA 3GBFA 1XRUA 4DXRA 4EN9B 3FX3A 3VBUA 3S57A 1F8VA 2ZX3A 2NM1A 3H1YA 3OEBA 4YRDA 1HJFA 1VIWB 3BTAA 1NA1A 3OBTA 5K0UB 4HLTA 3AYEA 3VKNA 1AUYA 1CAUA 2WNEA 4YW1A 4LHLA 4WVZA 3VZMA 5FO9B 2CY6A 4LBLA 4XQWA 2VCAA 4XF4A 1IPJA 5FZBA 3MF6A 5FMDA 1WBFA 3VHPA 2JXAA 4QU2A 2AENA 2E7TA 3ROUA 3OUHA 1R082 3FFQA 2D6OX 2WBKA 5J3UA 1S0JA 3CKHA 1D4M1 2XKPA 1J3RA 1E5HA 2CL2A 1YXWA 3MO4A 5A7WB 2QZ3A 1HRV3 4QGLA 4EYUA 2D93A 3WNXA 2PHRA 5DG2A 4AVBA 5LW9A 2E31A 5FO7B 3LSEA 5LBFA 5ISLA 1PMJX 1C1FA 1MS0A 3VD9A 4JQTA 2ZGUA 5DABA 1H8TB 2JIJA 2JG8C 3AZWA 1RUJ1 5T54A 5T5OA 2JDMA 2YZ4A 4XC9A 5FZGA 2QQKA 4EN6B 5IVFA 3ZFEA 3H9AA 1XE0A 3P5BA 1LHOA 2ZGSA 5DXDA 3NVCA 5F9TA 4WVMA 4KG0A 4R9BA 1RMU1 1OURA 2EAKA 4QXCA 1S55A 3E5XA 3ZOIA 3V0BB 3VZNA 4M3CB 2VUDA 4COVA 3VD4A 4R4ZA 3WDTA 1LHWA 3MDPA 4YGBA 1W05A 2Y6LA 2BU9A 1SLLA 1QF3A 1W8UA 3BPZA 4PQ9A 1BVP1 4XTPA 4CP1A 2WJSA 4RFRB 1R081 1AJOA 4MV2A 1HRI2 1YQ2A 3I3QA 2ZHLA 3DPRB 3WW4A 1WCSA 2WQ4A 5CBLA 1QQP3 2HEVF 5C3QA 2D7FA 3GM8A 2NLRA 1WMDA 4N7UA 4NPMA 4YG3A 5FZAA 5FZKA 2D97A 1D0GA 5C3RA 4S2FA 4A7KA 2R1DA 2PHDA 1UIKA 1WMEA 1VBC1 2JDPA 5IJRA 2DFBA 1Z0HA 3H3LA 3I3MA 3MI8A 5JOWA 2XLAA 2QQIA 3GBGA 2DCJA 1D2QA 2JEMA 2EVXA 1ZYBA 4AFBA 4BQYA 2Y33A 4D0QA 1VBE1 2EXIA 4RGAA 4IE6A 2VQUA 5FYBA 4AGGA 4OCTA 1NUKA 1V6LA 2NN8A 2VZVA 3IZOA 3ES4A 3R0RA 5FZ7A 4UW3A 3T2QA 3WDWA 4EZHA 1OF4A 2OZ6A 3GZAA 1ASJ1 2QQOA 3J8F2 1O91A 1DZTA 3CJIB 5T50A 2E53A 1AX1A 1K45A 3BIWE 1GQHA 1HRV2 1RUI2 2EIBA 3VBSC 1JI6A 3J4UH 3TOJA 1AR83 4GA9A 4YFWA 1QJX1 4IEWA 3AMHA 3JBG2 4P9WA 1PO11 3MF9A 3MV01 1TME2 2D5FA 1CAWA 1Q8OA 3OCPA 3DXTA 2BOIA 4NHKA 4LLFA 4L11A 3J7LA 4NIHA 2OPKA 3J7NA 2OUHA 3ZKUA 3ZN6B 1JZ5A 5DG1A 4R8HA 4Y20B 2JX9A 3LD8A 1C1LA 1PNFA 2VW0A 3POEA 1CD3G 3A7QA 3AKSA 1ZZBA 2J7MA 4UBGA 4OHWA 4IESA 1VBA3 2W1UA 2VO5A 4M3CE 4XF3A 4ZU4A 3IIAA 3VBHA 1SBEA 4Y1XA 1TE1B 2VNRA 3IDAA 4CDQB 5B4NA 5LRSA 4I3PA 1XB9A 3IPVA 1NKGA 5BPXA 2JG9A 1A3KA 3CF6E 4URTA 3N35A 2WAAA 3AKPA 3H1WA 3LQCA 4K3UA 4NROA 4AHXA 3WCSA 2QQNA 1AXYA 3TN91 4TTGA 2YROA 5FZ8A 4AI2A 4Y5TA 5FUPA 3HJRA 4TYSA 2D43A 3IMMA 4TSVA 3GCXA 1OF3A 3VKLA 2VOTA 1F15A 4HANA 3VN4A 1R1ZA 1T6GC 4NE9A 4WM8A 1QJY3 4YVWC 2A1XA 4YW3A 3RGBA 5C5UA 3USSA 4FVVA 2PQSA 3N9QA 4RD7A 1L7QA 2DBIA 1UU5A 3DXUA 3AJZA 1OQDA 2PAMA 1DIWA 4E4HA 4IDZA 3GNEA 2G1MA 3MLLA 3WF2A 4CPBA 2QJVA 3WDUA 4XXPA 1A34A 2YU2A 2EIGA 2YBKA 2ATFA 3QH7A 1CJDA 2A6WA 4YZ2A 5C8CB 4AK3A 1QJFA 1V6OA 3CZJA 5F1RA 3UNPA 2IXIA 5FJHA 3NAPC 4LBNA 2MEV2 5EPAA 2JD4A 1K5JA 3WQ7A 1AR91 1E57A 1GZTA 2I07B 1PNGA 2UURA 3B7MA 3R4SA 5JSRA 2VOXA 2VZQA 3ZN5A 5FY1A 2X05A 3A21A 3BPSA 5I8SA 2XR4A 3I3DA 3BIEA 3IT8A 1AR93 2DVFA 3N9MA 4LHKA 1Y9QA 2W9XA 1DLCA 3DEMA 1LOFA 3KLSA 4AQTA 3WF3A 2RR11 3PL0A 1A8DA 3OEAA 4AQSA 3W5NA 2A6XA 3OBZA 4Q5OA 2P37A 4CSWA 5A3WA 2MHFA 3I49A 5CNAA 4LBQA 2WSVA 1VBC3 1U12A 2C1FA 3MW4A 3N9NA 2Q1MA 5AVPA 2D6NA 4META 2DUPA 4Q8LA 1SBFA 1W90A 1VBE3 1R1A1 1RUC3 4LHNA 4YVSC 3JBG3 5H9RA 1EV12 1W9YA 4U36A 4UFMA 4YVSB 1RGSA 3ZSLA 4QM9A 4CEWA 5BNNA 4CU7A 2KR2A 3THTA 3FBMA 2RDQA 1B35A 1HV1A 5LWBA 1DYOA 1QOSA 1E5SA 1SLCA 1S2EA 4Q0UA 2Y6HA 3FHAA 3LFIA 2ZKLA 3NMBA 3WP5A 5SV5A 3T30A 3OGGA 4LKDA 1Z7S1 4P9XA 3F2ZA 1SG3A 3TEXA 1H1MA 5IFPA 5IAXA 2DYCA 1OHFA 2HJIA 3WG2A 3OY8B 4IV3B 1HB3A 3FMGA 5DAWA 1UX6A 1GQPA 4LK6A 5A3MA 3I3EA 1YUDA 2PA7A 4NAMA 3AX4A 4CDXA 2VCMA 2WABA 2Y6KA 3I3BA 4WM7B 4NRQA 2ZX0A 1PM4A 4KGGA 4N43C 1UZ0A 1L3JA 5JUVA 3FE5A 3I54A 3ZMOA 4AFAA 3BKZA 4FCAA 1LOFC 2OZJA 4KGQA 2ZS6B 4HN1A 4NPRA 1GANA 2WDBA 1AL22 1FV3A 5D1IA 1GOGA 3HR9A 3PIGA 4CE8A 3MBWA 4B4PA 3FLRA 4PLNA 4MLOA 4XFCA 3POBA 4K9SA 4JKKA 4D6RA 4A3ZA 4DO0A 1ONAA 1GR3A 3ILNA 4FPJA 4KWUA 2WZ8A 3ETPA 4ZS2A 2P6CA 4Y24A 2ZX1A 4FQZA 3KB5A 1CZVA 3FFZA 2IVJA 5JOYA 4H7LA 4HKLA 4M0HA 1UY0A 3RYKA 1S4CA 2BNNA 2R043 1JMUB 4YZ3A 2XJQA 4DINB 5KXCA 4XFIA 2YC0A 4UFIA 4YPJA 1VR3A 3AZXA 5GZEA 1R093 2JICA 2OT7A 1NZIA 1W3XA 3VBRA 1ULPA 1VBC2 3UKNA 4R9CA 4NOTA 2I2SA 1W9FA 1ALYA 1YRZA 3GHNA 4JKLA 4QX5A 3S7EA 3ZXLA 2GZWA 4B1LA 2QVSB 2A70A 4D8MA 3AVSA 3HAGA 5DMYA 5K0UA 3LB9A 1PZ8A 1WMFA 4M0NA 3DUIA 1QIQA 5H9PA 4ATFA 1G9BA 1W6MA 4XOGA 2P3JA 4CCJA 4TLGA 1RITA 3V56A 1HRI1 1NG0A 4PCRA 1UY2A 1ZBE3 4QQPA 4AVAA 5I0SA 3DKQA 5FYHA 5DDJ3 3ZXDA 3ILRA 3B69A 4CRQA 4URAA 2WT2A 1HN0A 5FBZA 1VMJA 5CADA 5EQUA 2RHPA 3WW3A 4LE4A 2J1TA 2GH8A 3NNFA 5LY2A 2BJSA 2CTVA 2X8KA 2ZGNA 1RHI1 2XVLA 3VD7A 1EP0A 4L99A 5IK5A 3I2KA 4QU1A 1AR82 1NYWA 1CJPA 3BOWA 2K46A 1QY4A 3PJQA 4B7EA 1S2BA 4B7KA 5LA1A 3JBG1 4UFJA 3ZYPA 3U14A 2P3YA 2QDNA 4KG8A 1AR73 1YIPA 3JU9A 4M4PA 1MR5A 1H8TA 5DUVA 5G04L 1NE4A 4D7YA 3AC0A 5ABJC 2R0HA 1VRH1 2WS93 4DPNA 2X5IC 2I74A 3WX5A 2J1UA 4MGYE 4DEVA 1ST8A 2R071 3RI8A 1AR71 2VNOA 1CQ9A 1W2AX 1PX3A 2Y6JA 3JZVA 3ZFFA 5LCWL 3APBA 1DG6A 5EYXA 3DN7A 4XHBA 2XVGA 4XIOA 1AL23 2HH9A 3PMSA 4XBNA 3T08A 1SEFA 1PVC1 4KWKA 1NT0A 2B42B 2V72A 1PIV2 1IG3A 3CEWA 3KT4A 4IE0A 4FPKA 5KHHA 5JZGA 4CCEA 2GNDA 1IPSA 2ZA9A 5FOJB 3U78A 2VULA 4LQRA 4Y4RA 2EICA 4FPOB 5LBBA 5GLZA 3CL1A 1WCQA 3NWKA 5GZFA 1PVC3 2YGMA 3ZMNA 5IK4A 3SQOA 3T2TA 4RHV2 2XJVA 1OFNA 2AYHA 4RS5C 4YG6A 1LHUA 4FPHA 2BERA 3MFAA 5FUIA 5T52A 2QFEA 3WDVA 4QQOA 5HXMA 4CP9B 3KWVA 2Q4SA 4JGYA 3NJXA 3H7JA 1Y43B 1KFXL 1NA1B 5DAQA 2BTVC 4AFMA 1R64A 5C4WC 2VVEA 1J84A 2SBAA 3UK9A 4HG6B 1FMD1 2P5BA 3CJIA 1W6MB 2DV9A 2IFRA 3SCFA 4EN8B 4IV3C 1V6NA 1H2LA 2QQLA 4XF0A 4OHVA 2JIGA 2KA3A 3TB0A 4HZFA 4AEDA 1UD1A 4XILA 3M2MA 2LALA 3T4HB 2ZJCA 2K2SA 4DEQA 2B39A 4UWDA 3O1RA 4EWAA 3JB4C 4ASLA 5J7MA 3N36A 2CWMA 4CDUA 1HX6A 2A6YA 2FCVA 4LO7A 2GMPA 1FNYA 4HKWA 1BK1A 4LNVA 5LB6A 4YGDA 1CN1A 5F5QA 1W8HA 3TAYA 4AEDC 5L19A 1O3RA 5J09A 1US2A 1W6NA 4TN7A 2BPA2 1URXA 2I45A 3ZFEC 3IB3A 2Q8DA 3VDAA 1CX1A 1F2NA 3OUJA 1BYHA 2JB4A 4KWJA 5FREA 3S7IA 2RS11 1W8WA 3K4DA 2XUMA 1VAVA 1EV13 2JDZA 5CFCA 2UY9A 4UW4A 3UJQA 4E27A 1WLWA 1OLRA 4B29A 4AZZA 1QKQA 4H55A 2W1WA 4QDRA 1KJRA 1NXMA 1OSGA 3K77A 3U10A 4RL7A 1H0BA 2JD9A 5FBJA 4UYBA 5A7PA 2G19A 1Y9GA 1Q5OA 2ZPXA 1JHJA 1RTVA 3LEIA 2RE9A 2QTWB 3OBAA 1QHDA 4IGPA 4A42A 3RZHA 4F3JA 1H8VA 2Y0OA 1K5MB 4MSVA 4FPEA 3JQXA 4I09A 4Q1RA 5JVVA 1YFYA 4MXVA 5E1RA 1ZA7A 1K5MA 2WNOA 2IXJA 3UKTA 1V9U2 2F17A 3KHBA 4CTEA 4FTEA 2DU1A 2O1QA 5DUUA 2G4IA 5FZHA 1GQGA 3L2YA 1UXZA 3WQ0A 4BU2A 4D3WA 1H6XA 2GP5A 5IAVA 2MPFA 1PHMA 3MICA 1BMV2 3CMGA 5FZFA 1C3HA 4P9GA 2VTXA 4MGIE 3K3OA 3LPGA 3UKVA 4WZFA 2XPJA 5FXXA 1PIV3 4PBPA 1UIJA 4HBNA 1EPZA 4JCKA 4COUA 1YQ8A 2VZOA 3HN3A 1F4AA 4PF1A 4FAGA 4Q0QA 5BNPA 1JUHA 1QH6A 3VDDC 4EZ4A 4MX3A 2D3RA 2RM22 3EMRA 4GWIA 2VJXA 4KQ7A 1NCRC 2VUJA 1UW8A 2PN5A 3O12A 2E33A 2W47A 3WHUA 1B35C 3MIHA 5EJ1B 2Q1FA 4RQPB 1DQ4A 1F35A 1UF2C 1N3OA 3HPNA 4MVTA 5FZMA 3VL9A 3ZFGC 3WF0A 2E51A 1Y3TA 2D6PA 5DAXA 5CISA 2RVAA 3A4UA 4XDPA 2VMCA 4LKEA 2D5HA 4JGZB 3W58A 2Y34A 3MIDA 3QLQA 4IE4A 1FPN2 2WR9A 3AL6A 1ZRIA 3VV1A 5FAXA 1C5IA 1RUC1 3POFA 3SKVA 3RZLA 4OMCA 3ZYFA 3AJYA 1I5ZA 2OX0A 4NVPA 4WM7A 1RUI3 4QD2A 2J1SA 2WINB 3H8RA 5CFDC 2BV4A 4Z82A 3OGJA 4AI1A 1JU4A 5FZCA 3T0BA 3U1XA 4L97A 5FZ0A 4XXAA 2VPVA 2FDGA 1MZ5A 4KU7A 4Q27A 2BFUL 2ZXQA 3I59B 1LGBA 3KSCA 3R6SA 5I0DA 4E9KA 4MGTA 2WNUC 3JD72 1JZ4A 1FV2A 1XC6A 4PLMA 3THDA 4QDSA 2OIIA 5F6KA 1YFWA 2YFZA 3P1IA 1DGRA 4ZXKA 1ZZCA 4AVCA 4A7ZA 4WVWA 5IK8A 3W5MA 1QXPA 1PGL2 2CU5A 5IWFA 3PUQA 5CA6A 3O5SA 3ALQA 2PAKA 2R6QA 2XOMA 3C7FA 4RFT0 3USUB 2XXZA 1DGLA 1PO21 2XHNA 4GKYA 2ZZJA 2UWAA 3KV6A 2GP3A 2W92A 5FYYA 5A1LA 4Z92B 4FOWA 2LRPA 3OPWA 4ONUA 3IBMA 4IW3A 4XUOA 1MZEA 4JAAA 1UO9A 3HNMA 1OD3A 5APAA 5JXHA 1IKPA 3AP5A 4U2AA 1SBDA 2RS33 3T1LA 2V4AA 4WM8C 2TNFA 4GJZA 4ARYA 5FOBB 4E2SA 1JXNA 2RS52 4L92A 1HIXA 1RIRA 2XJUA 4MHUA 3WNKA 2VXJA 4QAWA 1WUVA 3BYWA 1PGW1 1N1SA 4J1XA 1TG7A 2VMFA 2VCCA 3RJRA 2W2IA 2YC2A 3DPRC 1W0NA 3WVJA 4FSJA 4AHYA 3LDBA 3WZ1A 4CCKA 1ULDA 2ARBA 1WCUA 1XSQA 2WYSA 3SKJE 4CP0A 2Q0AA 4YW6A 1AR62 4LXLA 5F6LB 4CDQC 2IC1A 1WLCA 1QH7A 1H1AA 3NNJA 4IV1C 5JPNB 1HW5A 1IS4A 2L9LA 1CPMA 5ACA3 5C33A 1LOBA 2RJKA 1TMF1 2RDNA 3S6PA 3ZFFB 3DYOA 2ADDA 2WC2A 3D0JA 1NCQB 2XBO3 4JHTA 4ASMB 4YM3A 4UFLA 1DYKA 1H8TC 5EP9A 4QHOA 1NE6A 1OXCA 4LO8A 1UAIA 1HQLA 3ZXKA 3VBSB 1W6PB 2ZKNA 4GB31 4IERA 5GALA 3VZKA 1QXJA 5BNPB 3H8OA 2CDOA 2WQ8A 3RMYA 4Q4X2 1BK0A 1O5UA 2WFF1 2BNOA 2PFWA 4K20A 4YW4A 5L7OB 1E5RA 5I93A 1C8M1 1WW6A 3N3HA 3D6EA 4GWJA 3GALA 5FY7A 5J36A 5IVYA 3SNMA 1FATA 4GH4C 2VOVA 4LO4B 2ZMNA 4XYXA 4CUGA 4IQPA 1NXD1 1M4WA 2YMZA 2BGPA 3R4UA 4UW5A 3U11A 3ZYBA 2C4XA 1V9U1 1OBNA 5ANNA 5JCTA 3N9OA 5KWRA 2VMEA 5K0UC 1C5HA 2CNAA 4P5YA 5L9VA 5KHIA 1BCXA 3LKJA 4KBZA 2HWC2 5EXOA 1W2TA 3NKTA 1D4M3 4C1XA 2BBAA 5IVEA 3NJZA 5FMBA 1NQDA 3QACA 2VTFA 1QU0A 2WL1A 1SCRA 4QX2A 4FFHA 4P9JA 4XJWA 3ZDSA 1XSRA 1UOFA 2VTXJ 4NRPA 1CR7A 2ADEA 4LE3A 2A3WA 5CG8A 3WG3A 1OC1A 2VVDA 3U0ZA 1YCIA 3DYMA 4FPGA 2WZR3 3H3UA 2HWF3 2W39A 4PIZA 1W6NB 5FY5A 3ACIA 5CEHA 2ORZA 1QDCA 2DFCA 2ZMLA 4CEWB 2UWBA 5BNNB 5FRAA 5FZLA 4OUMA 4BQXA 1XYOA 4CUCA 2DU0A 1XQNA 1RHI2 3HD8B 3IIIA 3RMXA 5F2WA 1MS8A 4NWVA 2V5YA 4CA9A 3SHRA 3OPZA 1XXNA 1UL9A 3GHMA 1TMF2 1UMZA 1Y7BA 4HK9A 4QPGB 1RUG2 1GMMA 1W0PA 1DQ2A 1H9PA 2HWD1 4FO9A 4PI0A 3MV11 3HVDA 4RR3C 3DKWA 3H1MA 4JDMA 3TEWA 4IE7A 3ORJA 4N8MA 1AR61 3E1F1 4YM2A 2WWJA 1QQP1 2VMDA 2DBNA 3CJXA 2XBO2 3IN9A 4O7XA 3BVCA 3GF6A 1PM7A 5DUXA 4LBQD 1BEV3 1NY71 2BOJA 1EAH3 1OKOA 4IEQA 1RJ7A 2BNMA 1VBA2 2UYAA 3HBZA 3DV8A 2EIEA 3B3QE 3VB9A 1RJ8A 4YZ5A 4QGMA 1HDKA 4IV3A 5AC92 5L36A 4XHXA 4M3CA 2OYZA 1LJ7A 2A7AA 2QQWA 3VD3A 1B09A 2D6MA 4YG0A 3WQ1A 1MZFA 4XJUA 5C4WA 5JZGB 1MPXA 4GWNA 3PMEA 2E7QA 3VBUC 1UXXX 3AYDA 1AYN3 1VMHA 4LPLA 5I8YA 3SMHA 4PQQA 2HLEA 2WS92 3PVNA 1K12A 2D44A 3ACFA 4YVSA 5EYYA 3ZIXA 1A8MA 1C28A 1UY1A 2WKKA 5FYIA 1N47A 3WD5A 3N9PA 3HQXA 1JYTA 2GC2A 4XACA 1QQP2 5C8WA 2QDRA 3W59A 2ILMA 1BVVA 2NMOA 2HWD2 2YB7A 5FDBA 3TWIA 1LGNA 1SFNA 3Q8CA 2ZOEB 2VAUA 1UZWA 4O61A 3GYDA 2W1QA 3I7DA 4AQ2A 3D3AA 4SLIA 4GMP0 2P3KA 3VBSA 1U5YA 1ZZ8A 3POWA 2ZMKA 1C8NA 1YLLA 1TNFA 1QJX2 1LEDA 3KF5A 4YLZA 5FPLA 2V4VA 1ULOA 4N53A 2NYYA 1JZ6A 3OSDA 1OA3A 1X33A 3ZYIB 1QEXA 2CYFA 4EN7B 1ENSA 5A7OA 1CGPA 3IPVB 1VBA1 5H9QA 4JRLA 2VECA 3AP9A 2XONA 5C9AA 5D8AB 4DXZA 4N43B 5T5LA 2YUEA 5CAZA 4WV8A 3MIFA 1VBE2 4AEMA 5HV4A 5B2GB 1RUG3 2OXBA 1UMHA 2XH6A 2XQXA 3L2HA 4I3GA 2GMEA 5FP3A 1DP0A 4K8FA 3SXWA 1OQEA 3FBYA 1TVGA 3TN93 4BOWA 1Z7S2 3AYCA 5A3PA 3ZYRA 3S5QA 4UF0A 2DDUA 4XUPA 5D8AA 2XL9A 4BXFA 4IUGA 1BKZA 2DCYA 2GH2A 3MYXA 4UI9L 2AEZA 4FPFA 1QJY1 2HWB1 2ZCWA 2VNGA 3VL8A 2R041 4CCLA 4FFIA 5FMOL 1JHNA 2ZACA 1SLTA 4HPKA 4YVWB 4N53B 4QWNA 5SV8A 3BTXA 4BCUA 1VBD3 1JYCA 1UZVA 1G86A 3RSJA 1IOAA 2VMGA 2WN3A 3JXSA 5F37A 1JODA 3I2DA 4TXWA 5K9YA 1T6BX 1LEMA 2ERFA 1JW6A 2GMMA 1UU6A 3X29B 4W8JA 5IK7A 3GZUC 1LB2A 3PU8A 4AOCA 4JZRA 1LOAA 1W03A 4N9HA 3OGVA 3S0MA 1HQNA 1I9RA 1OH4A 1UY3A 1W9TA 4N53C 4D6SA 1LHVA 3Q8EA 5JOXA 2HWD3 1JZ3A 1DQ0A 2GC0A 2W91A 1QJU1 4ISRA 4ZZ5A 2VQAA 4S2DA 3W9AA 3RZMA 1VAMA 4W6YA 3DCQA 1O59A 3Q8AA 3URFA 1LHNA 2XLFA 3AYAA 4B4RA 4DFSA 4NWWA 4GQ7A 5GZCA 4A7YA 3MIEA 1C57A 1XPWA 5EJ3A 4Z8BA 5C3PA 2OA2A 1LCLA 2BGCA 1CAWB 2PAEA 4Y1YA 2ZABA 5F3IA 5HV0A 4HSJA 3KVBA 5FMOS 1UPIA 3MGUA 4EWDA 1SPPA 2GC3A 1H2KA 2VU9A 4Q4X3 5T55A 1F5JA 3OY8A 1VBB2 5FPVA 3UGFA 4QX1A 3OD4A 1NAEA 2P2KA 2ETEA 1LODA 2VG9A 4XAAA 1DHKB 3F95A 2RR12 2W52A 1EPWA 4Q4X1 3VHOA 3M4FA 4CPBD 2Y26A 1UPSA 3N7LA 2ES3A 4KWLA 1MACA 2P3IA 4CCMA 1RUOA 3IMNA 2W68A 5FQ0B 4BB3A 4BMBA 4QPYA 4NO4A 3B02A 1ZRRA 2PTMA 3I4IA 1QGLA 4OMDA 3HEIA 4CXYA 1AR92 1GWKA 1WLTA 1ZM1A 1SFYA 1GWLA 3JD71 2WO3A 4IL7A 2AH2A 1MS3A 4W4ZA 5T5JA 3M3QA 2EA7A 4CYDA 2HWC3 4AR2A 2KXLA 4RR3B 4BK5A 3P3PA 4NHYA 3E5QA 5CG9A 4LT5A 5GLWA 1OVPA 3JD73 4P9YA 2D3PA 2K9ZA 1NLSA 4OHZA 4L8QA 3MZHA 5FPBA 1EUTA 2AEYA 2XBO1 5FK7A 1O3QA 1H4HA 2R072 3LEGA 4BJ0A 1G9DA 2W5FA 1X8EA 2PHTA 1I6XA 4Y1VA 3AZYA 3G6JB 4QQLA 2ZTNA 3WNLA 3H50A 1DGRN 2WLPA 1ASJ3 2IWGB 4GULA 3WY6A 2VOWA 4QHBA 4L2NA 4AG4A 1UYZA 2LM3A 3WSOA 4W50A 1OD5A 5I91A 5EFUA 4AAPA 1DBNA 2PHUA 1AR81 4M4RA 4P9IA 4RGGA 2D3SA 4JTNA 2VH9A 2A73B 2RS51 1LU1A 3ZKYA 4NJ4A 2JG8B 4D7TA 3Q8FA 2HWB3 2RS32 4LUMA 4RYDA 4KU8A 4C90A 5FPUA 3FWEA 4Y33A 1RUF1 4YGEA 4FOYA 5FWEA 5L9BA 4BQWA 4MG2A 1OQ1A 2VCBA 3WT3A 2ET1A 2J1VA 1ENRA 3KCYA 4LKSA 4BM8A 1AR72 1FOD3 5CKQA 2A6VA 2Y6FA 3O1SA 1SLAA 2BP6A 5LA9A 5A6QA 3GDBA 2XLGA 1VPHA 2R062 1GZCA 3EJKA 2BFUS 4XDQA 4OHYA 3HIFA 1SDWA 1YFUA 2VR4A 1CESA 3QD6A 1ZBE1 1G9CA 3AFKA 3KQ4B 4K40A 4IEUA 4XQDA 2IVIB 4XETA 1GNHA 4GZ9A 4OZOA 1JYNA 5KR7A 1O7FA 4Z2AA 1JUIA 3JCIA 2XJSA 2E9QA 4MO3M 4AGVA 5FZIA 5C7GA 1HXS2 1RUE2 1HV0A 3BU7A 4XVHA 5A32B 1FX5A 3DYPA 4COZA 2BWAA 1U5IA 5A3LA 1DFQA 1HRI3 5F3GA 4CDUB 4PT6A 5ABJB 5L7OC 4IGOA 4BYYA 2HWF1 3RZGA 1V6KA 1SQ4A 3O1VA 3FHIB 4Q0VA 2Z2SB 4R9DA 5CVRA 3BB6A 4Y20A 3N7MA 3ZN6A 3M3CA 5FZ1A 4WM7C 2R073 2VBDA 1PMIA 3AXDA 4DMIA 5FPZA 4JGYB 4HONA 3WR0A 1L7LA 3OD0A 1PO12 1AL21 1WGPA 4UXAA 4HVOA 3BGAA 4FTSA 3EYPA 2DUQA 1W6OA 5GM0A 2FMYA 4LBOA 4B1MA 5M0TA 4QKBA 4LA2A 4B4QA 5JPMB 3AM2A 3AMMA 3LDKA 1RUD3 1IHMA 4OQ9A 1AR63 3LWCA 2ZBJA 4LULA 4D94A 1JU3A 1MS1A 1D2SA 1O4YA 3CLPA 3K4AA 3H7YA 5KHKA 4HVRA 2VVFA 1UZZA 3CZUA 2PHFA 3MIGA 4GMP3 4AWDA 1V0AA 2VNVA 3O14A 5BNPC 2HYKA 1JYIA 5L9RA 4LA3A 3T0DA 3KV5A 2GC1A 3AP4A 2WNUB 4AFCA 4FXKB 3D82A 2PMWB 4PJYA 1XU2A 3POYA 2E7AA 3HBKA 4KBBA 1VB2A 4G9SB 4LBMA 2B9VA 4FT8A 3EO6A 4Q4V3 2V5DA 3C7GA 4WM8B 3TNPB 3AP6A 4S2GA 3ABZA 5F39A 5FR3A 1LOEA 2B8MA 1O3SA 3LPFA 4BK4A 1S0BA 4FFGA 1NOVA 3IDEA 4Q4Y2 3C2UA 1WD3A 3ZYHA 3RZKA 3T4VA 3HNBM 4AW7A 1OUXA 1XYNA 4XUQA 5LATA 4IEZA 4L0PA 4NHLA 1EUUA 2YBPA 4CDXB 3HNYM 1D4M2 3WNMA 2NMNA 3N4MA 2EXHA 3POGA 1XU1A 3OB8A 4Q26A 3VBFB 1REFA 1C8M2 1DLLA 1Y4WA 5D8AC 2BWCA 1QJEA 3ASIA 1WCDJ 1RUF3 1VB4A 2EF6A 4OI4A 1QDOA 5GJ6A 3VHRA 3ZPOA 2ZX2A 2ZAHA 3MFCA 1LNSA 3LFMA 4IEXA 4AVTA 3PVEA 4YFZA 4ZU7A 1I3HA 3MIBA 1OPMA 1UYXA 2YFUA 1JS9A 1QJU2 2WIIB 2HEYF 3E5UA 2X29A 3ZN4A 2D40A 2ZGQA 5JLVA 1W2NA 5F3EA 2AACA 2RS13 2R30A 2ZGMA 2W46A 1G7YA 2VOKA 4FOVA 2H6CA 3SC7X 4H7MA 1OA2A 2PQQA 1KD7A 3M3EA 4CDWC 4XAEA 1PVC2 1W04A 1ULGA 2YPDA 5K4LA 3B9CA 3WLUA 1W28A 2JDNA 4DIQA 2A3XA 4COYA 3T2OA 2HWF2 3KV9A 4EROA 5EV7A 2R16A 5A1FA 4JDOA 1JOJA 4CUAA 1DZQA 2J1EA 3NSTA 1W8NA 4XZPA 3ZFGA 5BYNA 2YG0A 3VBFC 5FXVA 3WG1A 1RUC2 5A7NA 5IHRA 5JXJA 1PK6B 3FN9A 4MADA 4ZZ8A 1Q8QA 3M3IA 5KC6A 4A2UA 5ACA1 4Q8KA 5JSPA 1LRHA 1LU2A 1TMF3 3UETA 4MXWB 3AP7A 4XDOA 3GGLA 1GKBA 2Z69A 4Q4W3 1WMXA 1GU3A 1ND3B 5JMOA 1ND2C 4XBLA 4GJYA 1YIFA 3V64A 1OOPB 2AC1A 4CUBA 3FLPA 4EV0A 4Q4Y3 1V70A 1GP4A 1PIV1 1ZZ7A 2ZGOA 5FLHA 3SCHA 5AC91 1N3QA 1PMHX 3ZXJA 3AFGA 3WDXA 5F7UA 3G7DA 1VMFA 2OS2A 2J42A 4NR1A 2VZ1A 3I2OA 1RUD1 1YFXA 2NZ9A 5JSOA 3ELNA 2PELA 2JENA 4E4ZA 3AKQA 2YV8A 4XQ4A 5FTTC 1MQTC 4CEYC 1J83A 3ZSKA 3WQBA 5HCHA 1COV1 4LITA 2PHLA 4G4FA 3UYJA 1TME1 5FY4A 3ST7A 2Z5WA 3J7HA 3PUIA 5H9SA 2VQ0A 4QT6A 5FPAA 5BUVA 1QOTA 2Q30A 4R52A 3PJYA 1V9U3 1QNWA 5FKBA 3ZXFA 1WW7A 1RUH3 4WVVA 5GLVA 3ES1A 1S2KA 1XNAA 3PIJA 4BPZA 5LZ6A 3J8F1 2DCZA 3M7AA 1RUI1 1HRV1 2LS6A 5KXDA 4GXLA 2LTNA 2WS91 4WBBA 1ZA4A 1XE8A 2VZSA 4CDQA 1RUF2 5EZWA 4HXCA 4TWTA 2DTWA 3AL5A 5FPXA 4GKXA 5B4XA 2RMU2 1RC6A 2FD8A 5DN2A 2QKDA 4ORFA 2RG4A 3ZIWA 1BLZA 1UOJA 1RUJ3 4KNCA 4QX0A 5IVCA 1KDMA 1BBT1 2VMHA 3TBDA 1K42A 2RS12 3UV9A 2CDPA 1YJLA 1EY2A 3VHNA 3WDYA 4CP9A 1SDDB 3Q9OA 1ZX5A 5FXZA 4BQ5A 3CBNA 5AFEA 2YBSA 2MEV3 4YM0A 4ASKA 2HEWF 3ZXAC 2P34A 4UF0B 1FNZA 1ZVFA 2C0ZA 3I8TA 1GYKA 2NP0A 4DY3A 2JDKA 5CKNA 3QH6A 2Y6GA 2BVVA 4D6QA 2ARAA 1FPN3 2X5IB 2W94A 1W9WA 3MEPA 3EXUA 3PVBB 2PHXA 4JGYC 5D2AA 5BXXA 1X9PA 4HFSA 1KITA 3M1HA 4BLJA 2EXKA 5A7QA 4RS5A 4Y22A 3EQEA 2RS31 4KH9A 3VD5A 3ZSEA 5LY1A 4F83A 1W8FA 3NJVA 3PUAA 5A70A 4ES8A 4PHZA 3H0OA 1H1IA 4A41A 3B9IA 4AE2A 1ZRCA 4J6GA 2R7EB 3WV6A 3PUSA 5ANQA 3LEKA 5LA2A 1BXHA 3TEZA 3D4KA 3PTYA 4XCAA 2F4LA 4KMQA 4PI2A 5A3UA 1IQAA 3M3OA 1NCQC 3AMNA 3KS7A 3NV2A 4LR4A 1P8JA 2ZX4A 4YNIA 3ZFFC 1WWYA 3VBOA 2ARXA 2WO2A 2C24A 3UL2A 4BH9A 5FO8B 1UWWA 4R4XA 4XFBA 3WW2A 1IKQA 1RL3A 5FZ4A 4YM1A 3OG2A 2J1RA 1S0FA 5JAXA 3ECQA 4UOJA 4ZHNA 3SH4A 1Z78A 1CWPA 2WWUA 1C4RA 3VBHB 5JR7B 4MUVA 4BZ4A 3T09A 4EQVA 5K8SA 2WFF3 1AVBA 2BW8A 5A3TA 4PLOA 4WVMB 3PHMA 4ES9A 3LGRA 4I0BA 1UNBA 5JOZA 2WN2A 3NJYA 3FC0A 4DXTA 2OUJA 1FAYA 1ODNA 1CIWA 2BDRA 5DAPA 4CP2A 5LK5A 3AMPA 2W0XA 3VZOA 2ZHKA 5ERLA 1PK6A 4K1ZA 3K4ZA 1UYYA 2VZPA 3RRDA 5DZFA 4RQPA 2XB6C 3ZYGA 1G6NA 2AGSA 2FDHA 3FL7A 2P6HA 1R1A2 5CKMA 3ZLIA 1UX7A 2HYXA 3A23A 3JQWA 2UYBA 4ZPIA 1O3TA 1PX4A 2DVAA 2X10A 1V6IA
chains in the Genus database with same CATH topology
4F8AA 1Q3EA 3KGLA 1Q8PA 3J8F3 1SLBA 2P17A 4RR3A 1BJQA 1ZZ9A 3SH3A 2EALA 2XJRA 1LESA 3ZXEA 5BY5A 4JDNA 3THPA 4K7JA 1KS5A 2YXSA 5LK7B 4J1WA 4PDWA 3V65A 3LA3A 1H2NA 3H8UA 4Q0SA 4XMIA 4XJ8A 1KJLA 1GFF2 2WA3A 3AZZA 3HWJA 2FMDA 2MEV1 5FFOC 4AYUA 4I02A 3DPRA 1H2MA 1MS4A 2IXKA 3BALA 4XFFA 4IV1B 2E63A 1AX2A 1VBD1 4JTOA 5E88A 4YYOA 3FUQA 3E6BA 1ZBA3 1PZ7A 1PGW2 5IT6A 2PYTA 1LOCA 4P5HA 5J98B 3TRSB 1J3PA 1QNYA 2CGOA 1X8MA 1YO8A 3LAGA 1CAXB 2H6BA 1HXS1 1RUE1 2UWCA 1Q43A 1DGWA 3B00A 1PZ9A 1QJY2 4YW5A 4AVVA 1IS6A 1B35B 3NV4A 5DZEA 4AHWA 3MW2A 1H4GA 3OYWA 1CONA 3WCRA 4CDWB 4LBKA 3JUUA 4IEOA 4NHMA 2TBVA 5FLIA 4BIOA 1N1VA 4MZUA 3RDIA 4YZ1A 4JV4A 1J58A 4DS0A 4RSUA 4Y4YA 4EJRA 4G3YC 4PF5A 1X50A 4AI3A 1OFSA 2ENRA 2ZHMA 3ACLA 1J1LA 4EN0A 2V73A 1W6OB 1MQTB 1LKNA 1UKGA 2YHJA 2QUOA 3JB8A 5C9AC 1AYN1 1Z7S3 4LLOA 4ITCA 2BQPA 1ZBE2 1NY72 4K21A 4N90A 5JZGC 4BWOA 1UN1A 2IXCA 4I0AA 4AF9A 3RG0A 1BEV2 1VLNA 3LA7A 2PHWA 4FOQA 2BEOA 4JRAA 4W65A 4Y1UA 4Z2WA 1N1TA 3WW1A 4H14A 5ABJA 2ZZQA 2QCSB 3AKTA 3CU7A 4OFGA 1DQ5A 4HL0A 5L73A 1NCRA 4O9GA 1X7NA 3VDDA 2CV6A 4YGCA 4Q4Y1 4ZU5A 5AC93 2XL7A 2RM21 3NAPA 4DNYA 5LEJA 2JECA 2VGDA 3NAPB 4FPCA 3FJSA 4YARA 2CGPA 1VBB3 2JE9A 5JI9A 2QZ2A 3VDDB 5GZGA 2OVUA 1VBB1 4XFGA 5LEKA 4QPIC 1C8M3 3INAA 3BODA 3SITA 1F31A 5E89A 2GNTA 4OZXA 1DYPA 3MPPG 4QPIA 3TNQA 1WA4A 2VY0A 1ZBA1 3VZJA 4OLLA 3CJIC 3RQ0A 2RR13 4PIYA 1F5FA 1BQPA 4BE3A 1POV3 5C8CC 3VBHC 3LSDA 4TZDA 3V0AA 4GIQA 2ZGTA 1DF0A 3GZTB 5DDJ1 4FQ4A 3KGZA 2DWRA 3SH5A 4XTMA 3E6CC 1H30A 1S0GA 5GLUA 2YGLA 3QBQA 1VAKA 1MS5A 5E16A 2NQYA 3LZZA 4X8PA 1M06G 5EWSA 3E97A 1KDKA 3MPBA 2WZR1 4KL1A 1A78A 4D7SA 3WP6A 1YI9A 2JKBA 2HWB2 5FQ0A 1ZREA 4I01A 5GLTA 1YYNA 4OUSA 1MS9A 1FXZA 1D0HA 4H3WA 3SCGA 1J1TA 3B01A 2QNKA 1SMVA 4QQHA 1AXKA 1X82A 3PLQA 4I30A 4BLIA 3OF1A 5FLJA 5HCBA 1XNKA 2XGXA 1W6QA 5K7PA 1LULA 4GH4B 4QXKA 1XNCA 1DDLA 1G9FA 4GH4A 4DB5A 2FQPA 5J48A 3QCWA 1Q8SA 4HK8A 4LO6B 2GU9A 4AVSA 3L9JT 4O9EA 1X36A 3T1MA 1RUNA 1N1YA 3AMQA 3KT1A 3AZVA 1APNA 2R49A 3NV1A 4Q4V1 1OA4A 4XJZA 4PIXA 1U5XA 2OW4A 2UU8A 1COV2 1S1AA 1GZWA 2RM23 5C6CA 4GB33 4FAHA 1AYM1 3ENRA 4CZSA 3VKMA 1OMIA 4Y1ZA 4QM8A 2SLIA 1TEIA 1PO13 1AYM3 2Y0IA 4LBQB 4W6XA 5CFCC 1FOD1 2R0FA 2A71A 3ZYJB 4OHXA 1V6MA 4AXOA 1REEA 1V6JA 2GALA 4FXGB 5T3NA 1YJKA 4UW6A 1GNZA 1S0EA 5DUWA 3R4DB 3B5LB 3POSA 1NZCA 2QQPA 2D6LX 5AVAA 1ASJ2 2B5HA 4QPIB 1PO22 2H0VA 3B93A 4XJ9A 1UZYA 1RUD2 3WXPA 1RUG1 4N43A 2VXRA 4RA0A 5BNOB 2XG3A 4Q4V2 3N7KA 1RHI3 4Z07A 2CWSA 2DVBA 4I0WB 4YZ4A 2Y38A 2TUNA 5CU1A 2FHRA 1Q56A 4AEJA 4FP2A 1HQWA 4HKOA 5GKAC 2WSUA 2D6KA 3ZVXA 5JDBA 2O8OA 4JGZC 1VRH3 2G9GA 4OULA 2B7YA 1J3QA 2Q5TA 2DUOA 4MH0E 5AFBA 2ZHNA 1D4VB 1REDA 1RVF2 2WNUA 1JTZX 2AUYA 3CNAA 4HETA 5KXEA 4IETA 1NCRB 3OTFA 4QMAA 2JG9B 2MNGA 1W0OA 3NV3A 2UY8A 4PDWC 1GICA 2XJPA 2DVDA 5CFDB 1YWKA 4E4SA 5BNQA 3RYPA 4GMP1 1ZRFA 2ZGRA 2X5IA 4C1WA 1CPNA 4E2QA 3PNAA 1IGOA 1EAH1 2XHKA 3KMHA 3MLKA 2WNVB 5I8SA 3MLJA 2FBEA 2R063 2GSYA 4P9LA 1COV3 1MVEA 2R1BA 3VBRC 2DURA 4XBQA 4JC1A 3RZZA 5HBAA 5HCFA 4P14A 4XFHA 3QOPA 5LRRA 4RQPC 1QMJA 1CX4A 1DQ1A 1R1A3 3OBRA 3M8LA 1RUH1 3RNSA 1JH5A 3LA2A 2WFF2 4C0HA 4F7ZA 4SBVA 3FUOA 2WZPP 1QJX3 1ND3A 3WUDA 1J59A 3IM0A 3D8CA 1Q8VA 3MW3A 3TYJA 4LUKA 1ND2B 1OI6A 4JGZA 1MEC3 2JE7A 2W08A 4PDWB 4AI8A 4W6WA 3VZLA 3CO2A 3ZX7A 3O0VA 1VJ2A 4Q1PA 4BMEA 4XF1A 2R042 3OYWB 3O0XA 4I2OA 5JIAA 5DZGA 3RS6A 4B3NA 1OLQA 3FLTA 2QE3A 2WLQA 3AXEA 2DVGA 1WD4A 3U4XA 5KXBA 5I0UA 1AF9A 1U0AA 5HI0A 4JQRA 4DZGA 1K5MC 3HMYA 4HVQA 4XE9A 3LCPA 1GLHA 4TLFA 5DDJ2 3EBRA 1EYBA 1VRH2 2Z42A 3ZO0B 5I0TA 3HT1A 4V1PA 5BNOC 3PVOA 3KZ4C 3ME2A 2WFPA 2B9UA 2JG8A 4COWA 5C4WB 4X6RB 3RYRA 3ZFEB 4FTBA 4BQ1A 2HKXA 2O8QA 1N3PA 2C9AA 2EAAA 2RS53 5CFDA 1PGSA 1OPOA 4Q2FA 5JMCA 1GSLA 3U07A 4Q4W1 2WWSA 1DQ6A 1CVNA 4INDA 1R091 4GWMA 4CDXC 1RVF1 4CDUC 3WG4A 1QXRA 4HMZA 5CFCB 3VBOB 3AK0A 3M70A 1OKQA 1RINA 1YNAA 4CEYA 1LOGA 3O0WA 1XNBA 1W6PA 2F4PA 4QPGA 1POV1 2XWBB 1GZ9A 5BV6A 4QQ2A 3S30A 3KCCA 1MEC2 4B8EA 2JG9C 1PVXA 4HPKB 4IEYA 3SISA 1NA1C 3IKWA 3D5OA 2FZ2A 2YY1A 3KQRA 3R05A 4RS5B 4Y22B 1TME3 4X6QB 4YSFA 4ZKTB 1ND2A 1KXGA 2H0BA 1NLRA 2B46X 4R9AA 2Q8OA 4X8NA 2R061 4AEDB 1FI2A 1R092 3RPQA 3VBUB 3H3ZA 4OI0A 3HT2A 4EWEA 2X53S 5GZDA 1AZDA 3VKOA 4E2GA 3VGIA 5JIUA 1GV9A 1SLIA 4MGZE 3VBFA 1KRIA 4XW3A 3ZSJA 2VW1A 2AZ5A 1IPKA 1S0CA 1AYN2 2JJ6A 3A0NA 1MQTA 4MYEA 4FPLA 1I1EA 4M01A 1WCKA 3A0KA 4BHPA 1LENA 1XE7A 2WNVA 1MEC1 2XKOA 2PLV2 3VKFC 1S0IA 2IFWA 2GN7A 2ZAAA 2K0GA 5A33A 3SLIA 2GNMA 4NN0A 4QPGC 2WQZC 2LUWA 2HWE3 4XFAA 3BCWA 1AJKA 1RMU3 4IEVA 1O4ZA 1GZWB 1BBT3 5L7OA 2HWE1 4S2HA 1FPN1 1UKRA 1AHSA 1VALA 2WA4A 3WP3A 5A33B 5I8TA 1ZNPA 3IDBB 4OVEA 1LTEA 3RWNA 3KT7A 3UJOA 2IXHA 1MZ6A 1HKDA 4K6BA 2YPJA 2YYOA 2WZR2 2XWJB 2VUAA 4YVWA 2DCTA 2BYVE 3NO8A 3IDCB 1HXS3 1RUE3 1KQRA 1QJZA 2R32A 4XPVA 4GALA 5BNOA 2A5ZA 4HSLA 2A3YA 3WP4A 4AI0A 1CAVB 1RUH2 1U5ZA 3K48A 2FZ1A 3KCXA 1O4TA 4M3CF 2D98A 2Z79A 4DQAA 4MGKE 1IS3A 1RUJ2 4YW2A 2DF7A 2A6ZA 2ZGLA 1SCSA 4AQ6A 2RMU3 4XF9A 2PLV1 1EV11 1RB8G 1EAH2 5A32A 3ETQA 3OJBA 4C91A 4FPYA 1F9KA 2WT0A 2CGNA 2PLV3 2V09A 1G9AA 4M00A 4CEYB 1KFUL 1UCXA 2Q1ZB 2HWE2 5J37A 4D69A 1UU4A 2IXLA 2KM2A 3DF0A 1A6CA 4GB32 3P3NA 4L9BA 4RHV1 2ZGPA 5TSWA 1OOPC 1WLDA 4DRRA 1TNRA 2WT1A 2GDFA 2GN3A 2GAUA 1ZBA2 1ZZ6A 3WHTA 5I0RA 1ULFA 3GBWA 4LEJA 4Q29A 1BBT2 4A3XA 4AEKA 4IEPA 3ZPYA 3I59A 1PK6C 2BUKA 2DCKA 4MXWA 3K51A 3AKRA 5IUQA 2GNBA 2B45X 3EHKA 5KC5A 1W6QB 3HN1A 4C0BA 4IV1A 4PBOA 3ZFGB 3V0BA 3RI9A 5CB7A 1ULEA 1KS4A 3E6DA 4FBFA 3ZSMA 4N9IA 4AFDA 1FT9A 1PGL1 2F6BA 4LBJA 5CIRA 3KM5A 1ENXA 4Y5Z0 5E8AA 1DU3D 2YDEA 5JI7A 2BBVA 3J9SA 4JVAA 2NPIA 1NQJA 3NL1A 3N7JA 2E6VA 4ATEA 1FMD3 3VBOC 3FZ3A 4HT1T 1W2UA 1NCQA 1AXZA 3IWZA 4K1YA 1VP6A 3NW4A 2RJLA 4DY5A 2EXJA 1ENQA 1ULCA 2DTYA 2C5DA 1DGWX 3WOGA 3DL3A 5FCCA 1H9WA 4UBHA 1LECA 3BOPA 1AYM2 3VBRB 1VBD2 1BEV1 1PO23 1TQ5A 2A75A 1CAVA 5T5PA 1QJU3 1SACA 5HCAA 5KHGA 1O5LA 3V0AB 5KHJA 2AREA 1IS5A 2VMIA 4Z1VA 4AHZA 1CAUB 3LOIA 1POV0 1LGCA 4XJAA 1YI7A 5ACA2 1GBGA 1W39A 4DOUA 2TEPA 3NKGA 1ND3C 1S0DA 1MVQA 1QOOA 2CAUA 4FP3A 4XEZA 2BVBA 4BIFA 1FOD2 3LOBA 1DZRA 1R083 5JWPA 1FYUA 3O7OA 4Q0PA 3ZXGA 2AR6A 2RMU1 3DGTA 3RJ2X 5C9AB 4LO5B 3ATGA 4ISQA 1LR5A 4HN0A 3D0SA 1BZWA 1JBCA 2XJTA 3VUOA 4OI1A 3WINE 4E4DX 1AX0A 1WW5A 3USUA 4Q4W2 5KBFA 2VW2A 2WNVC 2IZWA 4Y26A 1BMV1 1HLCA 1QWRA 1WW4A 1XYPA 3C3VA 5BNNC 4CEWC 3B94A 4AGRA 4XIKA 4IXLA 3J26N 5HXVA 2G9FA 2ET7A 2HWC1 1CAXA 1G8WA 1JN2P 3WUCA 3VLBB 1RVF3 4LTAA 4RHV3 4N7IA 3AB0A 5J96B 2O0OA 3KD4A 2CAVA 4QGNA 4BA6A 1WBLA 2ZGKA 1ZRDA 4XMAA 4OI2A 4DRVA 1V00A 1AL0G 2N7GA 2XVKA 1IZ3A 4WZCA 3ILFA 1XNDA 1RMU2 1FMD2 1OOPA 1YHFA 3GBFA 1XRUA 4EN9B 3FX3A 3VBUA 1F8VA 2ZX3A 2NM1A 3H1YA 4YRDA 5K0UB 1VIWB 3BTAA 1NA1A 3OBTA 4HLTA 3AYEA 1AUYA 1CAUA 2WNEA 4YW1A 4LHLA 4WVZA 3VZMA 2CY6A 4LBLA 4XQWA 4XF4A 1IPJA 3MF6A 1WBFA 3VHPA 2JXAA 4QU2A 2AENA 2E7TA 3ROUA 1R082 3FFQA 2D6OX 5J3UA 1S0JA 1D4M1 2XKPA 1J3RA 2CL2A 1YXWA 2QZ3A 1HRV3 4QGLA 2D93A 3WNXA 2PHRA 5DG2A 4AVBA 5FO7B 3LSEA 1C1FA 1MS0A 2ZGUA 1H8TB 2JG8C 3AZWA 1RUJ1 5T54A 5T5OA 2YZ4A 4EN6B 3ZFEA 3H9AA 1LHOA 2ZGSA 5DXDA 3NVCA 5F9TA 4WVMA 4KG0A 4R9BA 1RMU1 2EAKA 1S55A 3E5XA 3V0BB 3VZNA 4M3CB 4COVA 4R4ZA 3WDTA 1LHWA 3MDPA 4YGBA 1SLLA 1QF3A 3BPZA 4PQ9A 1BVP1 4XTPA 4CP1A 2WJSA 1R081 1AJOA 4MV2A 1HRI2 2ZHLA 3DPRB 3WW4A 1WCSA 2WQ4A 5CBLA 1QQP3 2HEVF 2D7FA 4N7UA 2NLRA 1WMDA 4YG3A 2D97A 1D0GA 4S2FA 4A7KA 2R1DA 2PHDA 1UIKA 1WMEA 1VBC1 2DFBA 1Z0HA 3MI8A 5JOWA 2XLAA 3GBGA 2DCJA 1D2QA 2EVXA 2JEMA 1ZYBA 4AFBA 1VBE1 2EXIA 4RGAA 4AGGA 1V6LA 2NN8A 3R0RA 3WDWA 3ES4A 4UW3A 2OZ6A 3GZAA 1ASJ1 3J8F2 1O91A 1DZTA 3CJIB 5T50A 2E53A 1AX1A 3BIWE 1GQHA 1HRV2 1RUI2 3VBSC 3J4UH 3TOJA 1AR83 4GA9A 4YFWA 1QJX1 4IEWA 3AMHA 3JBG2 4P9WA 1PO11 3MF9A 1TME2 2D5FA 1CAWA 1Q8OA 3OCPA 4NHKA 4LLFA 4L11A 2OPKA 2OUHA 3ZN6B 5DG1A 4R8HA 4Y20B 2JX9A 1C1LA 1PNFA 2VW0A 1CD3G 3AKSA 1ZZBA 4UBGA 4OHWA 4IESA 1VBA3 4M3CE 4XF3A 4ZU4A 3IIAA 3VBHA 1SBEA 4Y1XA 1TE1B 2VNRA 4CDQB 5C8CA 5LRSA 4I3PA 3IPVA 5BPXA 2JG9A 1A3KA 3CF6E 4URTA 3N35A 3H1WA 3AKPA 4K3UA 4AHXA 3WCSA 1AXYA 3TN91 2YROA 4AI2A 4TYSA 2D43A 4TSVA 3VKLA 4HANA 3VN4A 1R1ZA 1T6GC 4YVWC 4WM8A 1QJY3 4YW3A 3USSA 4FVVA 4RD7A 1UU5A 3AJZA 1OQDA 2PAMA 1DIWA 3GNEA 3MLLA 2QJVA 3WDUA 4XXPA 2EIGA 3QH7A 2ATFA 1CJDA 2A6WA 4YZ2A 5C8CB 4AK3A 1V6OA 5F1RA 2IXIA 3NAPC 4LBNA 2MEV2 2JD4A 3WQ7A 1AR91 1E57A 2I07B 3B7MA 1PNGA 2UURA 3R4SA 5JSRA 2VOXA 3ZN5A 3IT8A 1AR93 2DVFA 4LHKA 1Y9QA 1LOFA 3KLSA 4AQTA 2RR11 1A8DA 4AQSA 2A6XA 2P37A 2MHFA 5CNAA 4LBQA 2WSVA 1VBC3 1U12A 2C1FA 3MW4A 2Q1MA 5AVPA 2D6NA 4META 2DUPA 4Q8LA 1SBFA 1VBE3 1R1A1 1RUC3 4LHNA 4YVSC 3JBG3 5H9RA 1EV12 4U36A 4YVSB 1RGSA 3ZSLA 4QM9A 4CEWA 5BNNA 3THTA 3FBMA 1B35A 1HV1A 1QOSA 1SLCA 4Q0UA 2ZKLA 3WP5A 5SV5A 3OGGA 1Z7S1 4P9XA 1H1MA 2DYCA 1OHFA 2HJIA 3WG2A 3OY8B 4IV3B 3FMGA 1UX6A 5A3MA 1YUDA 2PA7A 3AX4A 4CDXA 4WM7B 2ZX0A 4KGGA 4N43C 1L3JA 3FE5A 3I54A 3ZMOA 4AFAA 4FCAA 1LOFC 2OZJA 4KGQA 2ZS6B 4HN1A 4NPRA 1GANA 1AL22 1FV3A 5D1IA 3HR9A 4B4PA 3FLRA 4PLNA 4MLOA 4XFCA 4K9SA 1ONAA 1GR3A 3ILNA 4FPJA 4Y24A 2ZX1A 4FQZA 3KB5A 3FFZA 4H7LA 4HKLA 4M0HA 3RYKA 2BNNA 4YZ3A 2R043 4DINB 2XJQA 5KXCA 4XFIA 2YC0A 1VR3A 3AZXA 5GZEA 1R093 2JICA 3UKNA 1VBC2 4R9CA 4NOTA 2I2SA 3GHNA 1ALYA 1YRZA 3S7EA 4QX5A 3ZXLA 4EN7B 2GZWA 2QVSB 2A70A 3HAGA 5K0UA 3LB9A 1PZ8A 1WMFA 4M0NA 3DUIA 5H9PA 4ATFA 1G9BA 1W6MA 4XOGA 2P3JA 1RITA 3V56A 1HRI1 1NG0A 4PCRA 1ZBE3 4QQPA 4AVAA 5I0SA 5DDJ3 3ZXDA 3ILRA 3B69A 4CRQA 2WT2A 5FBZA 5CADA 3WW3A 2RHPA 4LE4A 2GH8A 2CTVA 2X8KA 2ZGNA 1RHI1 2XVLA 1EP0A 4L99A 5IK5A 1AR82 1NYWA 1CJPA 3BOWA 1QY4A 3PJQA 4B7EA 1S2BA 4B7KA 3JBG1 3ZYPA 2QDNA 4KG8A 1AR73 1YIPA 3JU9A 5DUVA 1MR5A 1H8TA 5ABJC 1NE4A 4D7YA 2R0HA 1VRH1 2WS93 4DPNA 2X5IC 2I74A 3WX5A 4MGYE 2R071 3RI8A 1AR71 2VNOA 1CQ9A 3JZVA 3ZFFA 3APBA 1DG6A 5EYXA 3DN7A 4XHBA 2XVGA 4XIOA 1AL23 3PMSA 4XBNA 1SEFA 1PVC1 4KWKA 1ZRCA 2B42B 1PIV2 3CEWA 3KT4A 5KHHA 4FPKA 5JZGA 2GNDA 2ZA9A 5FOJB 2VULA 4FPOB 5GLZA 3CL1A 3NWKA 5GZFA 1PVC3 2YGMA 3ZMNA 5IK4A 3T2TA 4RHV2 2XJVA 1OFNA 2AYHA 4RS5C 4YG6A 1LHUA 4FPHA 5T52A 3MFAA 3WDVA 2QFEA 4QQOA 2Q4SA 4JGYA 3H7JA 1Y43B 1KFXL 1NA1B 4AFMA 2BTVC 5C4WC 2VVEA 2SBAA 3UK9A 1FMD1 3CJIA 1W6MB 2DV9A