1YWKA

Crystal structure of 4-deoxy-1-threo-5-hexosulose-uronate ketol-isomerase from enterococcus faecalis
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
263
structure length
255
Chain Sequence
LQNMETRYTHSPADIRHYSTEQLRDEFLVEKVFIPGAISLTYTHNDRMIFGGVTPTTEELEIILDKELGVDYFLERRELGVINIGGPGFIEIDGAKETMKKQDGYYIGKETKHVRFSSENPDNPAKFYISCVPAHHKYPNVKISIDEITPMETGDPLTLNQRKIYQYIHPNVCESCQLQMGYTILEPGSAWNTRMEAYVYFDMEEDTRIFHMMGKPDETKHLVMSNEQAAISPSWSIHSGVGTSNYSFIWAMCGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Isomerase
molecule keywords 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase 1
publication title Crystal structure of 4-deoxy-1-threo-5-hexosulose-uronate ketol-isomerase from Enterococcus faecalis V583
rcsb
source organism Enterococcus faecalis
total genus 59
structure length 255
sequence length 263
chains with identical sequence B, C, D, E, F
ec nomenclature ec 5.3.1.17: 5-dehydro-4-deoxy-D-glucuronate isomerase.
pdb deposition date 2005-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04962 KduI KduI/IolB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ywkA00
1OMIA 3EHKA 2OPKA 5T3NA 4B29A 4E2QA 2ZCWA 4K8FA 3U10A 2O8QA 4WZCA 4XFGA 5I0UA 4QM9A 3BCWA 4LEJA 5HI0A 2P17A 5D1IA 1O3TA 3HT1A 3RYKA 3S7IA 3QACA 3C3VA 3PVBB 4IEUA 4AXOA 1XRUA 4IEOA 4F8AA 3MYXA 1NXMA 1EY2A 4UBHA 5BXXA 3S7EA 1J3QA 4HSJA 1RL3A 3EQEA 3H8UA 3TNPB 1ZZBA 3KGLA 3I7DA 3IDCB 4O9EA 4A2UA 4XF0A 3D82A 2D5FA 2VQAA 5FLJA 3BB6A 3ROUA 5FQ0B 4Q0PA 3OGJA 3CJXA 4I0AA 1PMIA 4L2NA 4QGLA 2BNNA 2D40A 4MUVA 3FX3A 3SCHA 4ZU5A 4WVZA 3O14A 1O5UA 4AQ2A 2PFWA 3E97A 5BUVA 2FMYA 1TQ5A 1CAXB 2IXJA 3ES4A 3U0ZA 2XLFA 5I8SA 2H0VA 5FQ0A 1O7FA 1EPZA 5J7MA 4KL1A 5I91A 1LRHA 4QGNA 4F7ZA 3JZVA 2ATFA 1SEFA 1EYBA 1H1MA 1IPJA 4TLFA 2QCSB 4MV2A 1WGPA 2WFPA 1ZREA 4NVPA 1XE7A 1O3RA 5KHKA 4Q0VA 1UCXA 3TNQA 2Q30A 4PIZA 2XL7A 1CAXA 5I93A 2Q4SA 2D5HA 4MX3A 4LUKA 3BPZA 1FT9A 1CAUB 1PM7A 2HJIA 3FHIB 4HBNA 5CADA 1Y3TA 1L3JA 2MNGA 4IERA 5LEKA 1O3QA 1J3RA 5C6CA 3L2HA 2BNMA 2CV6A 1NZCA 3CO2A 1QY4A 3FFQA 4LA3A 2D93A 4QXKA 4KU8A 2IXCA 3LAGA 3H7YA 4KWLA 2PQQA 2VPVA 1YFWA 3NJZA 4E2GA 5C8WA 4J1WA 4AVCA 3S0MA 1CAUA 4EROA 3NW4A 2PAMA 1NE4A 4OFGA 4Q0UA 5FPZA 2QJVA 5JCTA 2GU9A 4I02A 3H3ZA 5K8SA 1ZZCA 3FJSA 3E6CC 5CVRA 2PAKA 3E6BA 4YNIA 5EFUA 2B8MA 2XKOA 2ETEA 3FWEA 1ZNPA 1YFUA 4META 2BNOA 1YHFA 3FE5A 5FLIA 5JSPA 3LA3A 4IEYA 3I59B 2PHLA 1ZZ9A 2CAUA 3G7DA 4QM8A 2XKPA 4XETA 3NVCA 1J58A 1DGRA 1DZTA 2GH2A 1RUOA 4BYYA 2GC2A 5JSOA 5J48A 4KU7A 2I45A 4HZFA 1CGPA 1VP6A 2Y0OA 4R52A 1DGWA 1LB2A 4I3PA 3I59A 2FQPA 4IEZA 4XFFA 1H1IA 2O1QA 3OD0A 1ZRFA 1ZRDA 2H6CA 3SHRA 4Q0SA 4LTAA 4YSFA 1U12A 3E6DA 3RDIA 3GBFA 4XF1A 2E9QA 5KHGA 2GC1A 2UYAA 4DINB 4XF4A 3WW4A 4PIXA 3UKVA 4XEZA 5JSRA 2MHFA 1O4TA 4MZUA 1YFYA 4IEXA 2XLAA 1CAVB 3MPBA 4I09A 4BH9A 5FPXA 2GC3A 2PTMA 4XFCA 3DN7A 2IXLA 3CL1A 4XF9A 1NE6A 3CF6E 3D0JA 4Q0QA 4WBBA 5JAXA 3HT2A 4L11A 4RD7A 3IBMA 5I0RA 2DCTA 4XFAA 2PYTA 3SCFA 4HVQA 1EP0A 5E16A 2C0ZA 2BYVE 5KHIA 4JV4A 1DZRA 2GZWA 3EJKA 3H1WA 4AVBA 1CAVA 5FCCA 3KCCA 4XFBA 4D7SA 5FDBA 1UW8A 4YRDA 5CU1A 2XHKA 1FXZA 4E2SA 5LRRA 3D0SA 3ZDSA 2CGPA 4UBGA 2K9ZA 1GQGA 4AQ6A 3FZ3A 2UY9A 3SXWA 3IDBB 3H1YA 1J3PA 3M70A 4YARA 4D7TA 1IPKA 1X8EA 2OA2A 3U11A 4GULA 3OF1A 1UIKA 1CX4A 3KMHA 4N9IA 3WW3A 1GQHA 3H1MA 1RGSA 1UPIA 3WW1A 2EA7A 2H6BA 2F4PA 5BPXA 3HQXA 2ET7A 4XF3A 2GAUA 5JR7B 1VR3A 4HLTA 1YFXA 4I0BA 5LRSA 3H9AA 1WA4A 4EV0A 4QMAA 1J59A 3PLQA 4FT8A 5KBFA 1YWKA 4ONUA 5LEJA 3LWCA 3GYDA 2K0GA 4I01A 2IXKA 3EBRA 4JVAA 1ZZ8A 2OZJA 4KWJA 4MGZE 1O3SA 1RC6A 5F1RA 2ET1A 4HMZA 3DL3A 4BHPA 4AVAA 1I5ZA 2IC1A 4PJYA 4J1XA 4FBFA 4LULA 3OCPA 4X6QB 1NYWA 2CAVA 1SQ4A 1QWRA 1OI6A 4LA2A 4FAHA 1UD1A 3RYRA 4KWKA 4P9GA 4IEVA 5J3UA 1JUHA 5I8YA 5I0SA 3CEWA 2EAAA 2UY8A 3UKNA 2BEOA 4EWDA 1LKNA 5EZWA 3E5XA 4MGIE 4HVRA 1X7NA 4Q29A 2V09A 5E1RA 3SMHA 3LOIA 4HVOA 2UYBA 4BIFA 3NSTA 2ZKLA 2MPFA 2B5HA 2OZ6A 3ELNA 3R6SA 2Q0AA 3RYPA 5BV6A 3IIAA 1RTVA 1Y9QA 3RNSA 3PNAA 3SCGA 1VJ2A 3RZZA 1UIJA 4LLOA 5I0TA 3M3IA 3NKTA 4IETA 2WC2A 3LA2A 3RPQA 1QXJA 3EO6A 4IEQA 2IXIA 3N4MA 3QOPA 1J1LA 4IEWA 4HSLA 4XFIA 4OLLA 1XE8A 1RUNA 2KXLA 4YYOA 1HW5A 2EVXA 2Z69A 1ZZ6A 1ZRCA 1ZRRA 4JTOA 2GC0A 2HKXA 1O5LA 3ST7A 4LUMA 4PIYA 3ES1A 2QNKA 3BALA 2IXHA 3IWZA 3KSCA 4R8HA 2PHDA 5KHJA 3HIFA 3H3UA 3H7JA 4IEPA 4N9HA 3ETQA 2PA7A 2Z2SB 1X8MA 3BU7A 2XL9A 4JTNA 1FI2A 4QX5A 2B9UA 1CAWB 2BGCA 4EWEA 2Q1ZB 2QVSB 3OTFA 3H50A 3NL1A 2PAEA 1SFNA 4X6RB 5BY5A 3MDPA 1YLLA 1ZZ7A 1G6NA 4EWAA 3MZHA 4IESA 4MH0E 4MGKE 3E5UA 4CYDA 5FLHA 2XGXA 1LR5A 5I8TA 3CLPA 3LA7A 4MGYE 2VECA 2QDRA 4Z82A 4HN0A 1CAWA 1WLTA 3LZZA 3E5QA 1OD5A 4Z07A 3VHRA 4ORFA 5AVPA 3I54A 1OFNA 1I6XA 2N7GA 4FAGA 4O9GA 2XLGA 1ZX5A 4H7LA 1Q43A 1ZVFA 4QGMA 3WW2A 3KGZA 1Q3EA 3ACLA 2OYZA 5KHHA 3USSA 1V70A 3DV8A 3UKTA 4ZU4A 1QXRA 3DKWA 1X82A 1YUDA 4HN1A 4UXAA 4XFHA 3B02A 4I2OA 4ZU7A 1Q5OA
chains in the Genus database with same CATH superfamily
4JGYA 4AHZA 5JMOA 1D0GA 2DFCA 1OMIA 2VZUA 5ISLA 1GZWA 2ZACA 3KT7A 1T6BX 1NY72 4E8CA 3O12A 4NHKA 3KS7A 1HDKA 1SBDA 4XFGA 1GR3A 3AP4A 1W3VA 2R072 5C3RA 5HI0A 3T09A 2R061 4PLMA 4GH4B 2A6ZA 1V6JA 2RMU3 5B4XA 1XRUA 3B7MA 1NXMA 1HXS2 1X9TA 2ORXA 1J83A 4W50A 1FV3A 2VOWA 1RUH3 1J3QA 1YQ5A 2F17A 1RL3A 1WCDJ 1JYWA 1AL21 1MQTC 1JYCA 1DLLA 1MZ5A 5KC6A 5A6YA 3I7DA 3HEIA 4B4PA 1WMFA 4GQ7A 1FAYA 1JN2P 1XNBA 2CHHA 4XJUA 3MHZA 2V72A 4Z8BA 2XQXA 3MIFA 1O8SA 5GLWA 3ILNA 2VQAA 4NIIA 5FLJA 3TEYA 3GHMA 1VBB2 3ROUA 1QJX2 2VNVA 5GZGA 3S5QA 4GH4A 1AX1A 3ZXGA 1AL0G 1BVP1 2YB7A 4OUEA 3CJXA 3N9NA 1MS8A 1POQA 3RJ2X 4BQ2A 2BNNA 1FPN3 2XR4A 4P14A 3AYAA 4GALA 1LHNA 4AAXA 2ZOEB 3AZWA 3O14A 3G6JB 4A45A 1WMEA 4M3CF 4AQ2A 4NPLA 1QJU1 2MEV2 2OS2A 3IM0A 2FMYA 1TQ5A 5BUVA 4Q2FA 3N9QA 2WT2A 4QKNA 4XHBA 1WW6A 2H0VA 1O7FA 1EPZA 1ACCA 1LU2A 3KF5A 1DFQA 4RGAA 1JBCA 2R073 4H7MA 4QGNA 1KS4A 3HBKA 4A6OA 4F7ZA 3JZVA 2ATFA 3OGGA 1H1MA 4XQ4A 4FPCA 2ZAAA 1BXHA 3UJOA 2D6PA 1KJRA 4HK9A 4YW4A 1GNZA 5LY1A 1ZREA 1F4HA 1HXS3 2FHRA 5EHDA 3JBG2 1UYYA 3AFKA 3VL9A 4QKFA 4BPZA 1UCXA 4GJZA 1VRH1 1D2QA 3GM8A 3OUHA 4PIZA 1JXNA 4EN7B 1VBD1 4P02B 4FO9A 4H14A 1D0HA 1O3TA 1LTEA 2D5HA 2P37A 2RM21 2ZGQA 4YGDA 3I97A 3MIHA 4MX3A 1LU1A 4Q26A 2BWCA 4Q4X2 4XBQA 1NZIA 2OX0A 2B4KA 2C5DA 3LEKA 3ECQA 1QJX3 1PM7A 3PMEA 3ZM8A 5CADA 1QF3A 1Y3TA 3HBZA 1ENSA 3EMRA 5HBAA 2CSGA 2WQZC 4IERA 2FDKA 1JYXA 1J3RA 4L99A 3L2HA 5C6CA 4CDUC 1PGL2 5CFCC 1GOGA 2QE3A 1AR72 5G05L 5IK8A 1QY4A 2IFRA 2D93A 3MFAA 4LA3A 3IMMA 4QXKA 3R4UA 4FPJA 3H7YA 1SCRA 4N53C 2Z79A 3NAPB 3W58A 1YFWA 4K3UA 5F2WA 4B1MA 5FP7A 2MEV3 4ZS3A 1NXD1 3ZSKA 1H9WA 1SLIA 4XC9A 3WG3A 1LHUA 4LR4A 4J1WA 2FZ2A 3R4DB 1SLCA 2PAMA 1NE4A 1SZBA 4OFGA 4UW3A 2QJVA 2JENA 2LRPA 4OULA 5FY0A 3MF6A 1UPSA 4P9WA 1KS5A 3FJSA 2YC0A 1MPXA 3GXUA 5EPAA 2PAKA 1A6CA 2NN8A 3PVOA 4XDOA 4YG3A 2B8MA 3U4XA 3HWJA 2ETEA 4JKMA 2Q8CA 3LB9A 2VE1A 2VD7A 2RG4A 2ARAA 2BZDA 2DVDA 3NAPA 3AZVA 4META 4QPGC 3OUIA 4KG0A 1RUF2 2BNOA 1W8HA 1G9FA 3J9SA 2JX9A 3ZXAC 2FDJA 5T52A 3U4SA 1XE0A 4LIUA 5FLIA 4UI9L 4PBPA 3I59B 5F8PA 1SFYA 3BUCA 5E8AA 2PHLA 2D6KA 4QM8A 4OHWA 4Q4X3 4I3GA 4QQPA 4R9BA 5F6LB 3RZHA 4ET7A 2WNUB 4G3YC 2FDHA 4H55A 3NVCA 2G1MA 2D3RA 1LHOA 1H9PA 1J58A 1Q56A 5FAXA 4AHWA 3AC0A 1TME2 3IDEA 2TBVA 2VMHA 4RS5B 1DQ6A 3VKMA 5DAQA 4YPJA 4Q4Y1 3W5NA 2RDQA 2ZX3A 1AR73 2CDPA 1QOSA 2IVJA 5F7UA 1HN1A 1F4AA 1CZVA 3BN6A 1E5HA 1OA3A 1VP6A 4BQ5A 2VNOA 5I0DA 1DGWA 1LB2A 1QGLA 3X29B 3V0AB 3T2PA 1MS0A 3I59A 4IEZA 3TN91 1RUD1 2A3WA 2BFUS 1GUIA 2VUDA 2WFF1 3IB3A 1JTZX 2WT1A 1OF3A 1H1IA 2E7TA 3WDYA 4DS0A 3NQHA 2O1QA 2ARBA 2UWBA 2WNUA 5CKMA 3WDXA 4JQRA 4XUQA 2H6CA 4O7XA 4ZPIA 3ILFA 2YPJA 3K77A 3WNKA 5J1XA 4RS5A 1SLBA 4AZZA 2VNRA 1WMDA 1UOFA 2GC1A 2UYAA 1PMJX 4BE3A 3IT8A 5FP9A 1PGW1 2D6LX 1F8VA 4JKKA 2IFWA 3GBGA 5FZBA 1X9PA 2Q8EA 2HWD1 4P9JA 5JSRA 3ZYJB 1W99A 1H2LA 2NLRA 4MOAA 3V0AA 3PUAA 1YFYA 1Q8QA 4P08A 5IK4A 5BNNB 1OLRA 1RUF3 5DG2A 2DCZA 3HNMA 1AXKA 1S55A 2GMMA 4NWWA 1C8M2 5JVVA 2PTMA 1IZ3A 3POJA 4XFCA 4Y4YA 5A1AA 1W9YA 4YW3A 1E5IA 4LO5B 4PHZA 4XJZA 1IS4A 3GALA 3K46A 4IGQA 1RUG2 5FP3A 5JOZA 4HL0A 1WCUA 1GNYA 4DZGA 1OQEA 4CUAA 3WNOA 3L2YA 1RXGA 4NN0A 4AQTA 2ES3A 1TMF2 2LW8A 1H8TC 1SACA 1TME3 2QQJA 3AKTA 3IBMA 4URTA 1CPMA 1EV12 2HWE1 2HEWF 4HVQA 2BBVA 2X5IC 3VB9A 2E6VA 1UAIA 3A0NA 4QHOA 5CZKA 4DMIA 1DZRA 2I74A 5BNNA 3H1WA 2BVVA 4LKFA 1C57A 2LROA 1MZFA 2JDMA 3A21A 1EPWA 1KXGA 2XHKA 1FXZA 4E2SA 2P3IA 4GMP1 4UBGA 3T0DA 2XWBB 4QHBA 5F39A 1GQGA 4OI1A 1QJEA 1RUH1 3K4DA 4P9LA 2JIGA 5E89A 4AQ6A 3J7MA 3ZKUA 3IDBB 3H1YA 1OPMA 2WQ8A 3OGRA 4K8RB 4FSJA 3ABZA 4D7TA 1MS1A 3TBDA 1IPKA 3M8LA 3U11A 4AAPA 4FPGA 4LKSA 4U2AA 4CEWB 2A6VA 3OF1A 4FVVA 4MVTA 4NRQA 4QQHA 3NV3A 1ULPA 2VUCA 1W9SA 4AEMA 3ZSLA 3MIEA 2DF7A 2I2SA 3JXSA 3AB0A 3LDBA 3KMHA 4D6QA 3KQRA 1GLHA 2NQYA 4YWAA 5FYBA 1UPIA 1GOFA 5EXOA 5BPXA 1HB1A 3P1IA 4P5HA 2XXZA 3FFZA 4OZOA 4HLTA 1YFXA 1C8M3 4D7YA 2VH9A 5EYXA 1Y7BA 3H9AA 4CXWA 5FY1A 5DMYA 3HR9A 5IVBA 3VGIA 2VW1A 4FT8A 1NUKA 3KVAA 4A41A 1RUG3 1RINA 3R05A 1C28A 4CEWA 3J26N 4I01A 4HKOA 3EBRA 1CZTA 4JVAA 4KWJA 4XAEA 5FYUA 3TWIA 3LSEA 5F1RA 1O3SA 2E32A 5FMOL 4BQWA 1TMF3 2C1FA 4K1YA 3DYMA 3PTYA 2P5BA 4XMIA 1K3IA 1OD3A 1EV13 1UNBA 3FC0A 3I4IA 4BHPA 3T30A 3PJQA 4AFAA 4AVAA 2JG8B 2YGMA 5T5OA 4CDWC 4WZFA 4AI0A 2XQRA 4X6QB 1XB9A 2R071 5FBZA 3NJXA 4XUNA 5BNOB 1SQ4A 4UOJA 2WDBA 1OI6A 2Y6JA 4Y1VA 2HH9A 2CWMA 1B35B 1O59A 1PIV3 2R49A 5EP9A 3WDUA 5ABJB 3I49A 1JOBA 1XYPA 4FFGA 5J3UA 1JZ8A 1AYN2 1HXS1 1WLWA 5I0SA 2OXBA 3POFA 1T2XA 4RR3B 4A7KA 5C8CB 3RZMA 1LKNA 5EZWA 1JOPA 2VUJA 1NG0A 4N8MA 2D6MA 2VTFA 4HVRA 1K42A 4JAAA 2V09A 1ND2C 3SMHA 3CU7A 4UYBA 1ULFA 1NQJA 4HVOA 4Q4W2 2JG8A 2HYXA 3ZXLA 1VMJA 3Q8FA 3T08A 2PMWB 2EF6A 3ZYIB 4BDVB 1R081 5BNOA 1VBB1 1QJX1 2A70A 1C1FA 2Q0AA 1LECA 1W8UA 4YW6A 3ZYRA 3PNAA 1B35A 3QD6A 5ABJA 5LBFA 1VJ2A 4QHZA 4CP9B 3UNPA 5FZ4A 1PO22 4LPLA 2A3YA 4FOQA 1FV2A 2VBBA 3A23A 4RR3A 3ZLIA 1YIPA 5C8CA 1DQ1A 2WC2A 2WZEA 2WAOA 4W6WA 5H9PA 5FWEA 3VZLA 2WNVC 5IK7A 4YG6A 4ITCA 1OFSA 4H3WA 5FZOB 2X10A 2G9ZA 3WQ0A 4DPNA 4JCKA 4X8NA 5FY5A 1CN1A 4LHNA 1HW5A 1QH7A 1YCIA 3AKSA 5JWPA 4FFHA 1TG7A 2A75A 1N3QA 5J98B 2EIBA 1LNSA 3VBOC 1X36A 5A3MA 4XILA 4MHUA 4CP9A 3ST7A 1WW5A 5CBLA 1NAEA 4D8MA 3IWZA 1DQ2A 3DCQA 3NNJA 3WINE 1RUI3 2PHDA 2W08A 2VULA 1AYN3 4NIGA 3JBG1 3LPGA 2JKXA 5FZOA 2JD9A 2JJ6A 1S2KA 3AP7A 3RMXA 2OW4A 4YLZA 4AGRA 2BRTA 1X8MA 4PDWB 4AFCA 3THDA 5GZEA 2XG3A 3RZKA 2YZ4A 3B9CA 4DXTA 4OMCA 1YQ8A 3OYWB 2Q1ZB 5K0UB 1US2A 2WBKA 4Q4W3 4A7ZA 4ZXKA 2QDNA 1VAVA 2WLQA 4Q4X1 4YM1A 3RS6A 5EYYA 3MDPA 1O8PA 4YVWB 2DVFA 5DG1A 4IESA 4MGKE 1BYHA 3VL8A 1GWMA 3O1RA 1W06A 4CYDA 3ZOIA 5A7PA 2SBAA 5LK7B 1OXCA 1MS3A 1PO23 2A7AA 2NMNA 4OUSA 4WVVA 1PGL1 5C4WC 3CHXA 2DCYA 3LA7A 2VZSA 3ZFFB 1AR71 3SKJE 1XPWA 2VECA 4ES9A 4PDWA 4NO4A 3NNFA 4Y33A 4Z82A 2YBKA 4QX0A 3OBZA 4S2FA 4YVSB 2J1RA 3AKQA 3LZZA 2GNMA 3O7OA 1XC6A 2VJXA 3OYWA 5K0UA 1V9U1 3ZIXA 3AL6A 4LBNA 1S0IA 1UL9A 4ORFA 1POV3 1OURA 1JUIA 2G9FA 1W39A 2A73B 4YVWA 4XIKA 2VZOA 2DYCA 2Y64A 4FAGA 4CVUA 2XLGA 5A3LA 3Q8EA 4FP3A 2OQ6A 1ZVFA 3WW2A 5LASA 3KGZA 1W2TA 4S2DA 1W28A 3FMGA 1GWKA 4B1LA 4GWMA 2RS32 2FZ1A 3DV8A 4GXLA 2QQUA 4UFMA 3ZFFA 2XBO2 3UKTA 3WG2A 5IVVA 1QDOA 1F31A 1VAKA 2VXJA 4YVSA 3T4VA 3W20A 3BVCA 4YFWA 1OT5A 1W90A 3CNAA 4UXAA 3LOBA 2DBIA 3B02A 4W65A 1RUF1 4GD4A 3ZXEA 4A3ZA 1XOYA 4ZU7A 1UMHA 5CFDC 4Z92B 3O5SA 1XYNA 4C0HA 5A3UA 3M1HA 1PZ9A 1GOHA 1GKBA 4OHXA 3C7EA 3AVSA 3KT1A 5ABJC 3RZGA 2WABA 3EHKA 5T3NA 1W8TA 5AFEA 1D4VB 2HBUA 4E2QA 2ADDA 2ZCWA 4K8FA 3OBAA 5JIAA 4QKBA 1JZ6A 3LEMA 5JLVA 2ERFA 2QFEA 3BCWA 2ZXQA 5D1IA 1ZA4A 3HT1A 5A7SA 3RYKA 1DHKB 2ENRA 2P6CA 5FK8A 3TAYA 4W6XA 3QACA 3C3VA 4JKLA 5JXGA 4M01A 3PVBB 1M06G 4CP0A 5FOBB 2JDHA 2VMEA 4IEOA 4XJ9A 5IWFA 2UWCA 2ZABA 1REFA 3Q8CA 4QPYA 1H6XA 1GZCA 4F8AA 1Z0HA 4MG2A 1KGYA 1JHNA 3GZUC 3ZMNA 2WAAA 3S7EA 1ND3C 1R1ZA 1L7LA 1WZXA 3OEBA 3H8UA 1MQTB 4D69A 1BVVA 1GWLA 1SMVA 4LO4B 1ZZBA 1H4GA 3KGLA 1SLLA 3C8XA 4LE3A 4GB32 4JZRA 1PNFA 5T5LA 3K75B 2D43A 4O9EA 2P34A 3PU3A 4WM7C 3PUHA 2EALA 5K4LA 1RMU1 2RVAA 2K46A 2DV9A 5E6HA 2Y6GA 3ACGA 4DO0A 3INAA 4IDZA 2RS33 5FQ0B 3VZNA 1QHDA 3VDCA 2XBO3 5L9RA 3OGJA 1PVXA 1A78A 2D3SA 4HG6B 1QQP2 4EN0A 5GLZA 1NKGA 1PMIA 2CTVA 1UY3A 4E8DA 4L2NA 4NIDA 4QGLA 2D40A 1OSGA 3FX3A 1MQTA 2JKBA 4P9XA 3AMQA 3LFIA 4Y24A 3BTXA 1JODA 4AWDA 1CJPA 3OSDA 1TEIA 1O91A 1C8M1 5T50A 1H2MA 5JZGC 2JEMA 1M4WA 3CJIC 1TNFA 2F4LA 2V5DA 4R9DA 2V4AA 3H3LA 2PFWA 1U5XA 3HNBM 5LATA 4CSWA 1V0AA 1T6GC 1H1AA 2YU2A 4R9CA 2WZPP 2ZKNA 5CKNA 1RUG1 4QX1A 3NMBA 3ES4A 3NKGA 4LXLA 3ZIWA 3U0ZA 2XLFA 3OOXA 3VBUC 5FQ0A 3I2OA 5A6QA 5J7MA 4OI4A 4Y22B 5I91A 4LHSA 4LORA 1S0JA 2OPWA 3C7HA 1SEFA 1EYBA 5FUIA 2PXJA 1IPJA 3RI9A 1OUXA 5CISA 2R1BA 3OBTA 1RUC2 2QCSB 2WFPA 2ZGOA 2R043 5A1LA 2ZBJA 1HIXA 3J8F2 4JRLA 1O3RA 4L8QA 1MVQA 1NQDA 1V6LA 3TNQA 3A22A 3UK9A 3WP3A 4DUWA 5IK5A 4AEJA 1NCRC 2XL7A 5DAXA 5I93A 2Q4SA 4GB33 4COYA 5IFTA 4BK4A 4SLIA 3D8CA 2C4XA 4NHMA 5F2SA 3BTZA 2VBPA 1S1AA 2DU1A 3QLQA 2ZEWA 3HNYM 4Y22A 4QB2A 1R091 1KQRA 1ENQA 1MS9A 1CPNA 1JYVA 1NT0A 1QOTA 4GWJA 5LWBA 3A7QA 3GBWA 1AXZA 4OI0A 4OHYA 4FXKB 1RITA 2Q1FA 1O3QA 1QQP3 1S0CA 2VQUA 3M3EA 1JH5A 3VHPA 2BNMA 4CDUB 4BQXA 5CFCB 5GLTA 1NZCA 3CO2A 1K45A 2BTVC 3FFQA 4QXBA 2XJVA 4UFJA 2NM1A 2WRAA 1BEV2 1Y43B 4KU8A 5FZIA 5IW0A 2IXCA 5E88A 2Q8DA 3SC7X 4KWLA 3AXEA 2PQQA 3OUJA 2VPVA 4N53B 5IVFA 4E2GA 3I3MA 1IKPA 2ORZA 4N90A 3T4HB 4BISA 3WNMA 4A6SA 4DEQA 1QNWA 4JQTA 2D6NA 2A6YA 2WWJA 4OHVA 2GU9A 3IKWA 2DVGA 4I02A 1JU3A 1OKOA 1VIWB 4MSVA 1YI9A 1CWPA 2D7FA 4CDUA 5CFCA 1RYYA 5F37A 4XUPA 4WVMB 5EFUA 5HXVA 2WT0A 1K5JA 1RUC3 1HN0A 1UF2C 2BBAA 4TZDA 2VZPA 3FWEA 4YZ4A 5A7WB 1PNGA 3J8F3 4N53A 1JMUB 2LUWA 4QPGB 2CU5A 4NIAA 3KV6A 1KFXL 2Z42A 3K3OA 5ANQA 2B39A 1YHFA 3I3BA 3FE5A 3WHUA 1F2NA 1ZBA2 1AYN1 1ULCA 4YM0A 5JSPA 1W6QB 2BU9A 1LULA 2RR11 5GZDA 5M0TA 4ZHNA 2CAUA 3G7DA 4BLIA 2UU8A 3ME2A 5FO7B 2BW8A 2UURA 3FHAA 2F6BA 1C8NA 4QDQA 2XJTA 4LKDA 5FYSA 1LODA 1UY4A 2WN3A 2WINB 2PHFA 2XJUA 4PF1A 4WVMA 1DZTA 3B3QE 1V6KA 2W1WA 4A42A 1AX2A 2JDKA 2VU9A 5KR7A 4FTBA 5A7WA 2GC2A 3OPWA 1PO11 4QPGA 4IL7A 2VNGA 1Z7S2 4QWNA 5JUVA 4HZFA 1CGPA 1BEV3 2G4IA 2O0OA 3C7FA 1PO21 2Y0OA 1RUOA 3CDZB 3HPNA 3M3QA 4LBKA 1W6QA 4MGSA 4BM8A 2BPA2 2BGPA 4I3PA 3Q9OA 5A3NA 1WLDA 3R4SA 1WD3A 4YG0A 1G9BA 1X33A 5A6XA 1XNDA 3PIGA 1AXYA 3D3AA 4QT6A 1MZEA 1DQ5A 3LKJA 3SHRA 4YSFA 3E6DA 1UXXX 3LEIA 2DVBA 3RDIA 2VGDA 3BKZA 2Z4FA 3ON7A 4XF1A 2XHNA 1POV0 2V5YA 1HLCA 4QKDA 5KHGA 2W47A 2K2SA 4D0QA 1ZBE2 4PIXA 1RVF3 1H2NA 1UZVA 1WW7A 3SQOA 3WDTA 1Y9GA 3WW4A 1QEXA 3FL7A 3RZJA 3J7LA 4JHZA 2AACA 4NMIA 4Z2WA 4CU7A 1SPPB 3OGVA 4CU8A 4FPHA 4IEXA 4AHXA 1JZ5A 1BQPA 1ZBA3 5FPXA 3ZPOA 4XTPA 3WVJA 4B4RA 2OIIA 4K7JA 3LD8A 3RFRA 1G7YA 4AFMA 5BYNA 3GZAA 1W6PB 3VHNA 1DQ0A 3CL1A 2Z5WA 4NROA 4BB3A 3LCPA 4WBBA 2WZ8A 5FXXA 3ZSJA 3HT2A 5HV0A 2BGOA 2LS6A 1H8TB 3OBRA 1W8FA 3O1UA 1CR7A 5F5CA 1EP0A 1HRV2 2C0ZA 1SPPA 2BYVE 2JDYA 2WR9A 2X5IB 5FZEA 2TNFA 4MYEA 1Z7S3 2VMDA 3JB8A 2DUPA 5FKBA 2XJRA 3T2TA 4K21A 1O6UA 4N43C 2PHWA 3KCCA 4FPLA 2W1SA 5FFOC 5FZFA 3VBSC 4D3WA 1E57A 1AF9A 4YW5A 1UW8A 2EAKA 4YRDA 3VLBB 5CU1A 5FZ8A 4D7SA 2J7MA 3UJQA 1BKZA 4K6BA 5EQUA 3PL0A 3AK0A 5FZCA 1W6PA 5BNPC 1UQXA 2C9KA 3K4AA 4XZUG 2RJLA 1HV0A 3FZ3A 1OLME 1FATA 1HV1A 4I30A 3JUUA 3SH5A 1J3PA 3M70A 1ZRIA 2XJQA 1X8EA 1H8TA 4GKYA 3POEA 2KD7A 5FREA 3IPVB 5HCFA 2G19A 2X5IA 3ETPA 3VZJA 5FTTC 5F5IA 1TNRA 2ZMKA 4AG4A 4B3NA 1ZBE3 2D6OX 2A71A 1SBFA 4CCNA 2ARXA 3EB7A 4MHRA 4OMDA 1OBNA 2VZVA 1GQHA 2XONA 3APBA 1JZ2A 4NPMA 1H0BA 2EA7A 2RS31 3DEMA 4QPWA 3HQXA 4BZ4A 4FCAA 1PK6C 1RUJ2 2P3KA 2AGSA 4XF3A 1GMMA 5JR7B 2R6QA 2QZ3A 3VKLA 1PX4A 1VLNA 3WR0A 3LF7A 3KB5A 5DABA 4CUBA 1IKQA 4COWA 3PLQA 5KBFA 2A1XA 4P5YA 3M3OA 3F95A 2K0GA 3I2FA 3RWNA 1NX9A 4MGZE 1ZZ8A 3IPVA 5DN2A 2VVDA 2B46X 4AF9A 3TB0A 1RB8G 4BOWA 2YGLA 3ASIA 1UZYA 1AZDA 2X29A 1G9AA 1W2OA 2LALA 2Q5TA 4LHKA 2DURA 4OCTA 5D8AC 1PMHX 2TUNA 2VCCA 1HRV3 1I5ZA 2IC1A 4PJYA 3AMMA 4J1XA 2G9GA 2EXIA 1GBGA 5A3TA 5FYCA 2R0FA 4LULA 3OCPA 1G8WA 4CDWB 4FPEA 1W9TA 5FZMA 1WKYA 3SEPA 3BIEA 1COV1 3V56A 3PTRB 4LA2A 4FP2A 4QU1A 5F3IA 4KWKA 1VRBA 2VCAA 2IWGB 3HQUA 4IEVA 4LBOA 1LOCA 3WOGA 4BWOA 3WLUA 4UW4A 2VTXJ 4FOVA 1HQWA 3AYDA 1V00A 2YROA 4BXFA 5JR2A 1WUVA 4ZKTB 2ZEYA 3ORJA 3WG4A 2W1QA 4Q29A 4ZY9A 2Y0IA 1ND2B 2CWSA 3LOIA 5F3EA 4DOUA 3SEEA 2YPDA 5H9SA 1C5HA 2E53A 1ODMA 1W0OA 3GZEA 3NSTA 4CDWA 2HWF2 4AVSA 2B5HA 3R6SA 3RYPA 4YZ5A 4EQVA 3DYOA 3WP4A 1GQPA 2NYYA 2UWAA 4XQDA 3AM2A 1RUJ3 4AR2A 3RJRA 1UIJA 4UW6A 5I0TA 4IGPA 3EYPA 5IVYA 3LA2A 1QXJA 1YEWA 3EO6A 2WNVB 3UT0A 3MO4A 4IEQA 5HCAA 2D3PA 1IOAA 1ND2A 3QOPA 2Y6KA 2YMZA 3MLKA 3RG0A 4IE5A 4XFIA 2YU1A 5JOYA 1XE8A 5T54A 2KXLA 1GSLA 2Z69A 2ZTNA 2ZX0A 4BLJA 5GZCA 3CQOA 4RSUA 1CVNA 2XPJA 1JU4A 2ZMNA 2RS52 4BMEA 1OH4A 5JI9A 1AUYA 3MIGA 3OPZA 1ENXA 3VD7A 3VBOB 1W03A 3W21A 1I5PA 1MVEA 3LGRA 2VBDA 4PI0A 1VALA 2JDPA 4LUMA 1H4HA 3Q8AA 3POIA 5KXEA 5EJ1B 2IXHA 2WNVA 3KSCA 4CUCA 4QQOA 5IT6A 4IEPA 3J8F1 3P3PA 2PA7A 1AR93 3GJAA 4TYSA 4L92A 5JPNB 2P1BA 4HETA 2BGCA 4QD2A 3N7LA 5L19A 2RHPA 4C8DA 4Y5Z0 4C90A 2QVSB 3H50A 2PAEA 1SFNA 2PLV2 1TE1B 3POBA 1PIV2 2RMU1 4L0PA 5DZGA 3VBOA 3BPSA 5L73A 5CNAA 1W2UA 2B7YA 2HWF3 2XH6A 3KZ4C 4KWUA 1YLLA 3BTAA 1UZWA 5FK7A 4EWAA 3AVRA 3MZHA 3E5UA 4XTMA 5T55A 5FLHA 1LR5A 3J7NA 5I8TA 2GP3A 1CD3G 1UZ0A 3ZSEA 4AE2A 5C4WB 2WA3A 1REDA 2R7EB 4FOYA 4Y5TA 4HN0A 4XJWA 1WLTA 5L9BA 5CA6A 1OD5A 2P2KA 3ZXJA 5AVPA 3N7MA 4XMAA 1OFNA 2XVLA 3AZXA 2RS53 1DIWA 3VD9A 4O9GA 4KBBA 1JS9A 1ZX5A 1QU0A 3KQ4B 4OYUA 1FPN1 2BOIA 5FRAA 1DG6A 5ACA2 4UFHA 1JZ4A 5IVEA 1Q3EA 3WF1A 4CCCA 4LBJA 2IZWA 1CZSA 3RQ0A 1EAH2 1V6IA 3OY8B 5C4WA 1URXA 4YGBA 2C6SA 4NE9A 4ZU4A 3DKWA 1WMXA 4E4ZA 1X82A 2H0BA 4K1ZA 2FCUA 4IXLA 2JIJA 1GV9A 1YUDA 5FPVA 1NY71 3KV5A 1QJZA 5CB7A 2P6HA 5DZEA 4TN7A 5FZHA 3MV11 3V64A 4I2OA 2ZEXA 4Q8KA 5C5TA 5CFDB 1Q5OA 2ZHMA 1ZBA1 5FP8A 2Y26A 3MW4A 5A33B 4AGGA 1KDMA 3IAPA 3NV4A 1B09A 1H2KA 3FLTA 3NRUA 3LFMA 2RV9A 4KI5M 1BMV2 2BV4A 2PLV3 5LBBA 4E27A 2VAUA 2AUYA 3HQRA 4IUGA 1RUI2 2OPKA 1GYKA 4AW7A 2JICA 1DYKA 4Z2AA 4IE4A 3WT3A 2DFBA 3U10A 1S0FA 2O8QA 3OY8A 4QX2A 3KHCA 5J96B 5FJKA 1QDCA 2IUWA 2P17A 2WWUA 3AX4A 4LEJA 4SBVA 2OVUA 1XNKA 3S7IA 1UY1A 4CCMA 5JDBA 4IEUA 5FZDA 1QOOA 1Z7S1 4BMBA 5CFDA 1BLZA 2GMPA 3AFGA 3ZXDA 1EY2A 2VY0A 2YC2A 4XCAA 4UBHA 5FYVA 2XDVA 3FBYA 5A33A 1WD4A 5BXXA 5A3PA 2ZAHA 4HSJA 1ND3B 5T5PA 4QB1A 3EQEA 1A34A 1UY2A 3BIWE 3TNPB 5HXMA 1QJFA 1IQDC 4Q1PA 1AJOA 5G04L 2ZGUA 5J09A 4HT1T 1LOAA 4ZZ8A 5FJHA 3WF2A 4EE2A 2PHUA 1WCKA 4XF0A 4AHYA 4WM7B 2BWAA 2OUJA 3LDRA 5ACA3 2J1SA 3B00A 2Y38A 4XURA 3T0BA 1AL22 2RJ2A 3LIHA 5FO8B 1EAH3 5A70A 2MEV1 2QZ2A 2HWC2 2KM2A 1GP6A 3C7GA 2A3XA 4Q0PA 1QH6A 4JDMA 3MW3A 3SNMA 1OKQA 2YDEA 5CEHA 4GAZA 3I2GA 2W1UA 2JXAA 4FI9A 1JI6A 3GCXA 4LOSA 5A32B 1ND3A 2PN5A 4GWIA 4MUVA 3VZMA 1ALYA 2QQOA 2EIGA 2VMGA 4TWTA 1XJAA 1OLMA 1F15A 1WBFA 1W3XA 4JGZC 4WVZA 5EV7A 1O5UA 4IV1C 2LTNA 5DDJ3 4AVVA 2B42B 5JZGB 2XJPA 3CJIB 3GDBA 2BDRA 2JE7A 4OVEA 3E97A 4WM7A 2WQ4A 3LIGA 4IV3B 3BOWA 4R4XA 1CAXB 4YW2A 2IXJA 4ASKA 2ZGPA 3W9AA 4NAOA 4EZHA 2W0XA 2WO1A 5I8SA 3VBUB 2SLIA 1MS4A 5K9YA 4PCRA 4KL1A 4QU2A 3T0AA 3PIJA 3OJBA 2QQVA 3ZYGA 1PHMA 1UOJA 1D2SA 1QJU2 5A32A 5IATA 1SDWA 4RHV2 4AGVA 5C3QA 4MV2A 1LOGA 2GNTA 2QBXA 1BBT2 1A8DA 4PQQA 5JZGA 3OB8A 4M0NA 2YXSA 4Q0VA 3DECA 1KFUL 3CJIA 3NO8A 2W52A 2Q30A 5C3SA 4IV3A 1CAXA 1NCRB 2E63A 5JI7A 3I2HA 5DUWA 3VBFC 3ZYHA 3VBUA 2CGOA 1Q8VA 3FHQA 4LUKA 3BPZA 1UN1A 1FOD2 1AX0A 2YFZA 1DZQA 3MI8A 1GNHA 1UKRA 3O1MA 1CAUB 3TEXA 2W94A 2E51A 5AVAA 4INDA 2HJIA 4A3XA 1AL23 3O1VA 2DCJA 1VRH2 1L3JA 3ZVXA 2VQTA 5FXVA 4Q4V2 4QX8A 2HWC3 2AZ5A 4NJ4A 4XUOA 4B7EA 4FFIA 3ALQA 1ASJ2 1GP4A 2VTXA 4QDRA 1UYPA 4AEDC 4EN9B 2AC1A 4P9IA 1UU5A 2RS12 4XABA 3WF0A 1NCRA 3POYA 4LITA 1HJFA 5FZ1A 5F32A 5CG8A 4LK7A 5C8WA 3WSOA 4AVCA 4CCJA 1CAUA 5CKQA 5A1FA 3NNMA 4EROA 3NW4A 1IS3A 4OI2A 3NJVA 3PUIA 1DGWX 3USUB 2NMOA 1J84A 1V6NA 5JCTA 4Q8LA 2WA4A 3WUDA 1I3HA 1W8ZA 2RDRA 2XWJB 1QJU3 2VCMA 2W2IA 1C3HA 3DGTA 5CVRA 5LA2A 3E6BA 3TYJA 5C71A 4RHV3 4YNIA 4CXXA 2XKOA 4NR1A 4DXRA 3VDDC 1S0DA 1NCQC 1F5FA 2XB6C 1YFUA 1BBT3 2W5FA 1IQAA 3AJZA 3B01A 1S0BA 2AYHA 2QKDA 4PF5A 5KXCA 4YFZA 5FPUA 4KGGA 4FOWA 3VN4A 1OVSA 1TME1 2VG9A 5HCHA 3HJRA 2JDAA 1SBEA 1WW4A 5FY8A 4G4FA 3USUA 3VBRC 1ZZ9A 4DNYA 1FOD3 1JYTA 3Q8BA 4PT6A 4Y4RA 1W6OB 2R042 5B2GB 3SH3A 5A80A 4V1PA 1VRH3 5FUPA 1HQLA 1DYPA 1F35A 3AZZA 4Q4V3 4XJAA 1W2AX 2ZA9A 3WY6A 5A6ZA 4CPBA 2HWF1 2GH2A 1ASJ3 5FR3A 1U0AA 5J48A 5JSOA 2ZX4A 4RQPC 4LO7A 4KU7A 3MF9A 2RS13 2BJSA 4RN5A 1UU4A 1LAJA 4R52A 1R1A2 2W9XA 3HAGA 2VQ0A 1SLAA 2FQPA 2GNBA 3U1XA 3RRDA 3V0BB 2A5ZA 4DRVA 1DU3D 1XNTA 2DTYA 3KLSA 1VB4A 1E5RA 1WBLA 1LOEA 1W6OA 3OD0A 4NHYA 3WDWA 1ZRDA 1AJKA 4Q0SA 4LTAA 1U12A 3ZXKA 3DF0A 4LNVA 3U07A 1HKDA 3ZO0B 2E7QA 4XOGA 2VMFA 1IPSA 1IG0A 4OQ9A 3C7OA 2GP5A 3KV9A 4MO3M 1QKQA 2RS51 1LOFC 5SV8A 3PJYA 4CEYC 4IQPA 3SISA 1LGCA 3MBWA 3UKVA 4IV3C 3QBQA 4S2HA 4CUGA 1PVC2 3ZKYA 4HKWA 4UW5A 4ZZ5A 3VZOA 2MHFA 1QNYA 4IE7A 5HPOA 1LESA 5DUXA 3ZFGB 1OQ1A 2XLAA 3ZXFA 2XUEA 1CIYA 4AI8A 3V0BA 4ASLA 1CAVB 2YBPA 1TMF1 3MPBA 4I09A 5FWJA 5IVCA 2GC3A 1J1TA 1YRZA 2ZGMA 3FLPA 3I3QA 3OGSA 1EV11 4Y1ZA 5D2AA 3ZR6A 2IXLA 4R9AA 3I2JA 1ONAA 5AC92 4W4ZA 1UWWA 4M3CE 1NE6A 3D0JA 2JE8A 3NV1A 4Q0QA 5L7OC 3DPRC 4QQLA 4E4DX 1Z78A 2PLV1 3BOPA 5FYIA 5FYZA 1PIV1 4NOTA 3AMPA 2DCTA 2PYTA 2XVGA 1STMA 5KHIA 4XJ8A 3LQCA 3ZFGA 3I2KA 5FDBA 4ZS2A 5A7OA 2WUHA 1LHVA 4AVBA 1CAVA 2IVIB 3AJYA 4LO6B 3ZN5A 4Y1YA 4ARYA 4N43B 2W91A 1R1A3 1TZOA 2W3JA 2Q8OA 1UYZA 3VBSB 5IVJA 4URAA 3M2MA 3H42B 2VMIA 4DFSA 1HB4A 5LRRA 3ZDSA 2CGPA 2HWE2 1REEA 5BNPB 5FZAA 2K9ZA 2WIIB 4XE9A 3SXWA 1XXNA 1YJKA 3WDVA 2JDUA 3LDKA 2R0HA 4COVA 3A4UA 4GULA 3WF4A 4DUXA 4DY5A 3EXUA 3L9JT 2W87A 4LO8A 3SITA 3TN93 2YG0A 4AI9A 4FXGB 1WWYA 3LE0A 1RHI2 1UXZA 2Y60A 3KM5A 1A8MA 5ACA1 2YFUA 4YZ1A 5LA1A 3N7JA 3WP6A 1PVC3 3HD8B 3N9PA 2QQWA 4N43A 5CG9A 2O14A 4Y26A 3VBSA 1DF0A 1EAH1 1LJ7A 4KMQA 2AREA 2F4PA 5FZ0A 1PK6B 3D4KA 2ET7A 2R1DA 2GAUA 1HRI2 3GZTB 1VBA2 4J6GA 4CRQA 3PDQA 5BNPA 1WA4A 4EV0A 4QMAA 5GLUA 1J59A 2VO5A 2VMCA 1RVF2 1YWKA 2JDZA 3LWCA 5AC93 1XBFA 2FD8A 4UT5A 3ACIA 1YQ2A 3THPA 2I07B 3F2ZA 1PGSA 1QXPA 2R30A 2OZJA 5DDJ1 1BMV1 1RC6A 3UGFA 2FCTA 3N9MA 2DCKA 1K5MC 1RUI1 3URFA 3ZFEC 3DL3A 2CDOA 2ADEA 2E7AA 5D8AB 1A3KA 2Y8KA 4CCEA 1YQ6A 3MIBA 3OEAA 5L9VA 4Y5SA 1NYWA 1PK6A 4NUBA 1X50A 1BCXA 3K3NA 3BTYA 3CZJA 3KF3A 5F5AA 1QWRA 1JHJA 4TLGA 1XSQA 4Q4W1 3RYRA 2PHRA 2BUKA 4Y1XA 3UGHA 3VZKA 1JUHA 4DEVA 5I8YA 2HWE3 2X8KA 3KD4A 2OT7A 2EAAA 3IDAA 3UKNA 5A3OA 2BEOA 4EWDA 5KWRA 4NIHA 4JHTA 2VVFA 1QMJA 2VOXA 2QQKA 3UGGA 2ZHLA 3AMNA 4QB6A 4DB5A 2ID4A 4CP2A 2CNAA 4JDNA 3CIHA 2Y6HA 3V65A 4Q1RA 3WP5A 1OH3A 5D8AA 3RVHA 3DXTA 4GMP3 3PHMA 1RHI3 1NOVA 1VMHA 4BIFA 3M4FA 1QJY2 1U5IA 2ZKLA 2OZ6A 2VVEA 2VM9A 1VE0A 3HOBA 5BV6A 3ZMOA 5GLVA 5AFBA 1ODNA 5IHRA 5JMCA 1Q8PA 2QTWB 4UWDA 3WV6A 2HWC1 1MACA 4MXVA 4GA9A 3AKRA 3RZZA 1POV1 4ARXA 1HRI3 3MLLA 1VBA3 1RIRA 4XPVA 4DUVA 5FPAA 4IETA 4AYUA 1W6NB 1ZM1A 3U37A 4XZPA 1LGNA 4A4AA 3O0XA 5GKAC 4GIQA 1R082 2AEZA 2IXIA 5A7QA 4D6SA 4QPIC 4LBMA 3MLJA 4F3JA 1AYM2 1BK1A 3WXPA 2JG9B 2ZJCA 3ZFGC 2E33A 3AKPA 1RUNA 3MPPG 4YYOA 4B7KA 2EVXA 1W8NA 1ULDA 1BHGA 2GDFA 1NA1C 2RDSA 1ZRCA 3M7AA 2WJSA 2OKXA 1LEMA 4WM8C 3K4ZA 3GNEA 1O5LA 4UFIA 1OLQA 5BNQA 1EUUA 4HK8A 4XCBA 3OG2A 5EIYB 5JXHA 2ZGRA 1IG3A 4W6YA 3T3YA 1CIWA 4PIYA 3WNNA 1W6MB 2W46A 1W6NA 3BALA 4JDOA 4RHV1 2V73A 1KITA 3AZYA 1VBE2 3ZN6B 3MICA 4XQWA 4CXYA 3H7JA 2FBEA 1S2EA 1BBT1 2HWB2 3FLRA 2VW2A 2J1EA 4RGKA 2Z2SB 2JG9A 5GJ6A 1S0EA 3BU7A 1UKGA 4O61A 5F6KA 2VCBA 3UL2A 3AP5A 4PBOA 4IE6A 1UOBA 4NHLA 3VD3A 3WEZA 4CP1A 4Y1UA 4EWEA 3VBHB 3NL1A 4YW7A 1F5JA 4IGOA 4KG8A 5BY5A 1S2BA 3MV01 1FOD1 2ZHNA 3WHTA 1H6YA 1QJY3 4Q27A 3WG1A 5APAA 3TEZA 3H8XA 4L9BA 1C4RA 1KJLA 3LEGA 4HFSA 4JX0A 2DUOA 1LOBA 5DAPA 1W6MA 1N3PA 4Q4V1 4UF0B 3TRSB 1KRIA 3ZN6A 2BERA 1ASJ1 2VL4A 2WS92 5LW9A 4CDQC 1DQ4A 2A6WA 1GICA 4NRPA 2Y34A 1JW6A 4MGYE 5SV5A 1W8WA 2RS11 1UX7A 5FY9A 2ARCA 1R083 1VBB3 2DWRA 3WD5A 3KT4A 5JXJA 1AYM3 4MXWB 3VBHA 1FMD2 4Z07A 3VHRA 5IAVA 2XBO1 5IYYA 3BI3A 1YI7A 1XSRA 1U5ZA 1XNAA 4ISRA 2C9AA 4MLOA 5C33A 2N7GA 3VV1A 4JGYC 4QDSA 2O8OA 2WNEA 1EUTA 4K20A 4H7LA 5IAXA 5HCBA 2NZ9A 4QGMA 1GANA 4UF0A 3H8OA 5LK5A 2JE9A 3BU0A 1AR82 5IFPA 1V9U2 4MADA 2DVAA 2AR6A 4PLOA 2WKKA 4LBQB 1QXRA 3QCWA 5ANNA 4J25A 1VBE3 3MUY1 3MW2A 3HMYA 5DQ0A 1APNA 2HWB3 2DBNA 2HYKA 2ZZQA 4XFHA 1DCSA 4IW3A 4MXWA 3P5BA 3VD5A 1O4YA 1OA4A 3ZN4A 2DDUA 5DUUA 1SFPA 1OVPA 4XHXA 3HN1A 1W8OA 4M3CB 4RFT0 2ZX2A 3PU8A 4DQAA 2J1UA 3PMSA 1RUE2 3JBG3 3U78A 2R041 4QXHA 4B29A 3MIDA 1AR62 5ERLA 2DTWA 4WZCA 1AR92 1D4M2 4CE8A 4XBNA 4QM9A 5I0UA 1OA2A 2QQIA 4RYDA 4LBQA 4AL9A 2FDIA 4IE0A 1UY0A 3MUZ1 5LA9A 2WS93 4GB31 2Q1MA 4GH4C 3J4UH 3AP6A 1FNZA 1W9FA 3O1OA 1WCQA 4AXOA 2PQSA 3MYXA 1L7QA 1BK0A 4CU9A 1OOPB 4B4QA 3B5LB 1PZ7A 1R1A1 3DYPA 3I3EA 5C9AB 2YBSA 4RGGA 3JCIA 1FMD3 2VXRA 4KGQA 4M3CA 5H9QA 2QQMA 3POGA 1QQP1 3IDCB 2GSYA 3N9OA 4A2UA 1UO9A 5CAZA 3VDBA 5FUNA 2X53S 5LZ6A 3D82A 2D5FA 3BB6A 4ZONA 5K7PA 1AR83 1Y9MA 1V9U3 2JG9C 2JB8A 4LE4A 2VOVA 4DIQA 3VUOA 5FV3A 4I0AA 3MGUA 4NAMA 1PVC1 1OOPA 1SG3A 5GM0A 2GALA 4AEKA 5C9AA 5CYYA 2QUOA 2GN3A 2ZHKA 1S0GA 4ZU5A 3SCHA 5JPMB 1RMU2 1VMFA 4AFBA 3T1MA 4JGZB 5DPNA 1G86A 2P3JA 3I8TA 4IV1B 4NWVA 4HOOA 1UU6A 3QH6A 5D21A 4YZ2A 3FBMA 2ZPXA 3HN3A 1RUC1 1P8JA 4H2AA 4V2WA 1RUE3 4BA6A 5AC91 3PVEA 3O1SA 3ACHA 1AR63 3A0KA 2B45X 1D4M3 3K48A 3WCRA 1LRHA 3WNPA 3JD72 1VB2A 5TSWA 2AENA 2BOJA 2Y6FA 4FPYA 3GCWA 3K2OA 4W8JA 3VBHC 2WN2A 4TLFA 5C70A 2Y6LA 2HLEA 1WGPA 4M4PA 5JIUA 3S5AA 4CZSA 4NVPA 1XE7A 4JGZA 3WZ1A 4CCDA 4IV1A 5KHKA 4LHLA 1GZ9A 4NPRA 3VDAA 3WNXA 3M3CA 5DXDA 2KR2A 5GALA 3B94A 4AVTA 2ZGSA 4COZA 2QQPA 5FBJA 3VBFB 5JXIA 4FFFA 4P9YA 4LIVA 1FT9A 2ZMLA 4XXPA 4YGCA 1BEV1 2Y33A 3AYCA 1DDLA 2FCVA 3FHIB 3W5MA 4HBNA 3D5OA 1U5YA 1H8VA 1KEXA 1WA6X 2MNGA 1GZTA 3N7KA 5LEKA 1RHI1 1YC61 2W95A 4GMP0 5FY4A 3ZYBA 3SKVA 2VC9A 4AFDA 1K12A 5FZLA 2CV6A 4OUMA 5DUVA 4AEDB 1N3OA 3PUQA 1MS5A 1RMU3 3OD4A 5JOWA 1Q8OA 1R092 3LAGA 1VBC2 1SLTA 1HRI1 1VBA1 1W9WA 3NAPC 4FQ4A 4AI3A 3NNLA 4O65A 2BQPA 3NJZA 4DY3A 1HQNA 3VBFA 5T5JA 1G9CA 1WCSA 1XU2A 3VKFC 1RVF1 4XACA 2VOTA 1LCLA 4DXZA 3S0MA 4C91A 4HANA 2WZR2 4CCOA 4Q0UA 4TSVA 4FPFA 5FPZA 2WSUA 2ZGKA 3WX5A 4CPBD 2ZEZA 3RWKX 5FO9B 1KDKA 1Y4WA 1YQCA 3H3ZA 5EWSA 3JD73 5LY2A 3RMYA 2W68A 1NLRA 3C2UA 1ZZCA 3VKNA 4ASMB 4N7UA 1MEC2 3E6CC 4AEDA 2A6XA 3HVDA 1VAMA 1YO8A 2XMLA 1ULOA 3GGLA 4LJHA 3VDDB 3W59A 1NCQB 4DRRA 5KXDA 1ZNPA 4I0WB 2WO7A 1ULGA 1TVGA 3ZR5A 2QQLA 4YZ3A 5FZ3A 3O1PA 1XYOA 2J1TA 4XIOA 1PX3A 4M00A 4PQ9A 3WF3A 1HX6A 3LA3A 4IEYA 4UFLA 4CCKA 2P3YA 3GF6A 2RDNA 4E4SA 1V6MA 2YYOA 3VBRB 5GZFA 1IS5A 4TXWA 2WNUC 2WYSA 1OOPC 2XKPA 4XETA 4NHXA 3CBNA 2JDNA 5DZFA 3ZDVA 5DAWA 4BQ4A 1CJDA 5FXZA 2X05A 3T1LA 2AH2A 1CX1A 1DGRA 5B4NA 4RS5C 4QQ2A 3NJYA 3ILRA 4PI2A 1IGOA 1QJY1 3NWKA 3AMHA 1NCQA 3KWVA 4ZXEA 3VDDA 4BYYA 2R062 1JZ7A 1JOJA 1KD7A 1L7RA 2J42A 2RR12 2EXKA 2YHJA 4RQPB 2I45A 4HXCA 1SCSA 5H9RA 1R093 1RJ8A 1VBC3 5J37A 4GJYA 1YYNA 2YV8A 1GFF2 4M4RA 2C26A 3RSJA 4C1XA 3B9IA 4EJRA 3I2DA 1BJQA 2FDFA 3THCA 1V6OA 4XFFA 3VBRA 1ZBE1 3JU9A 3ZPYA 3J7HA 4PLNA 4EN6B 4L97A 2XUMA 2OUHA 5EJ3A 2XJSA 1PO12 2WZR3 1ZRFA 2DU0A 4GZ9A 1AYM1 1IS6A 4CDXB 3IIIA 1O4ZA 2PHTA 1I1EA 2BVBA 3RZLA 3GBFA 4NRMA 3VHOA 2E9QA 4RFRB 4BQYA 3WUCA 4LT5A 4DINB 1MEC3 4XF4A 4DXSA 4RQPA 1YIFA 4CEYB 2R16A 3ATGA 3WNLA 1MR5A 4XEZA 5C3OA 3IMNA 3N9LA 5FY7A 4Z1VA 4D6RA 1D7PM 1GU3A 4YM3A 1O4TA 4QX7A 4HPKB 4KNCA 4MZUA 3LSDA 5BNNC 4F83A 1W05A 5F5QA 4LBLA 1UZZA 1VBE1 4BH9A 4XXAA 3FUOA 4LMFA 4E4HA 5L36A 2HWB1 4U36A 3DN7A 4UFKA 4RL7A 2GMEA 1HRV1 4CDXA 3PURA 3B69A 2FDGA 5K8SA 2E26A 2XVKA 2D44A 3U75A 4Y20B 2JWPA 4XF9A 5FZ7A 3CF6E 1UMIA 1ZA7A 5KXBA 5L7OB 3DPRB 1LOFA 5JAXA 1HB2A 4P00B 4L11A 3T2OA 4CEYA 4QAWA 4JRAA 3UETA 4RD7A 2AEYA 3NV2A 5I0RA 2TEPA 1WLCA 4XFAA 3SCFA 3T2QA 2R063 2RR13 5E16A 1FYUA 2JECA 5LBCA 4HPKA 4JV4A 5FPBA 3ZYPA 1UMZA 5FZKA 2GZWA 3EJKA 4YM2A 2LM3A 4BQ3A 4GKXA 3AP9A 5FCCA 3CZUA 4E9KA 4D94A 5F9TA 4AOCA 1VPHA 2WL1A 2WS91 2L9LA 4XFBA 3GJBA 4LKEA 2D98A 1G9DA 2VZ1A 1W04A 3BODA 3D0SA 1VBD2 2XOMA 1UOGA 3NNGA 4Y20A 1HJGA 2RM22 1W0NA 1PO13 3FUQA 4HONA 2UY9A 3ITQA 5L7OA 3DPRA 1FMD1 4XDPA 1XU1A 4FTSA 4YARA 3S57A 1RUJ1 2OA2A 2J22A 4A44A 4CEWC 4K40A 4BJ0A 2WO2A 1N47A 1UIKA 4BK5A 3N36A 4OQ8A 1CX4A 3THTA 1DLCA 5FYMA 4N9IA 3WW3A 4CCLA 5C3PA 4G9SB 5A7NA 3WQ1A 1AR81 1RGSA 3H1MA 2ZGTA 5IUQA 3E1F1 3WW1A 2H6BA 4WVWA 5LCWL 4KBZA 1DGLA 2WSVA 1R64A 5FMDA 5FYTA 4ISQA 1ENRA 1OQDA 1VR3A 2OQ7A 3FN9A 2YY1A 4I0BA 4V2VA 5LRSA 1AVBA 3KHBA 3ZX7A 2EIDA 1OC1A 2ZZJA 4LQRA 2GN7A 4ONUA 1XQNA 2NP0A 5LEJA 3GYDA 3AXDA 4LOTA 4XDQA 5LA0A 5JOXA 1ZYBA 2IXKA 1AHSA 5DAVA 3RGBA 3P3NA 2ET1A 4FPOB 4HMZA 2E31A 1NLSA 2EIEA 3JQXA 1K5MB 1RUE1 1CONA 4XVHA 3K51A 5DDJ2 3ZFEB 1AR61 1FNYA 2JG8C 2VZQA 3N3HA 4AI1A 2X09A 1AR91 1D4M1 4GWNA 1N1SA 4XUTA 4FBFA 2EXJA 3H8RA 2HEYF 5BNOC 2CAVA 2EXHA 3KCYA 2HEVF 2CGNA 2VR4A 3POSA 1B35C 1LEDA 4FAHA 1UD1A 2KA3A 5IJRA 3ENRA 4AK3A 4P9GA 4AI2A 3DKQA 3O0WA 5FXWA 1NLQA 1GP5A 1VBD3 1OPOA 3P6BA 4RR3C 3CEWA 2UY8A 4UAPA 3ZYFA 1I9RA 1YNAA 2RM23 4LLFA 3WCSA 5C8CC 5C9AC 2PELA 5FMCA 3E5XA 5FPLA 1PM4A 4MGIE 3POWA 1X7NA 1COV2 1K5MA 5E1RA 2P4EA 4KH9A 3ZFEA 4BU2A 1ST8A 2UYBA 3N35A 3MFCA 3IZOA 2MPFA 3AL5A 3ELNA 3SLIA 4YW1A 3B93A 4BCUA 3DXUA 4Q4Y2 1F9KA 4N7IA 5FZGA 4CDXC 3IIAA 1RTVA 3LPFA 1Y9QA 2ZGLA 3RNSA 5A3WA 3SCGA 5FYHA 3UV9A 3TOJA 4EN8B 2JD4A 5HV4A 3QH7A 4LLOA 3M3IA 3NKTA 1N1YA 5F3CA 5FMBA 3DUIA 2RJKA 3RPQA 4CA9A 4MGQA 3CMGA 3TN92 1RUD2 2WFF2 5LB6A 4ES8A 1OF4A 3WQBA 2D97A 5C7GA 5FZ6A 1UYXA 3KV4A 4FQZA 4ATFA 2VZTA 3N4MA 3ACFA 4QPIB 4XYXA 1J1LA 2WWSA 4HSLA 4IEWA 5FZ9A 3R0RA 3RI8A 4OLLA 2VOKA 3O0VA 5F3GA 4BQ1A 1Q8SA 2RE9A 1ZZ6A 4FTEA 1NA1B 3MEPA 1CQ9A 2C24A 1DYOA 3JB4C 2ZS6B 1ZRRA 3IAQA 4JTOA 3U14A 1PGW2 2GC0A 2HKXA 4HKLA 4WV8A 4TTGA 2HBTA 4FPKA 4WM8B 1BZWA 4AQSA 3BYWA 2HWD2 4S2GA 2QQNA 3JD71 3O1TA 2VZRA 1YJLA 3IN9A 3OPTA 3GHNA 3ES1A 3I2IA 2QNKA 1QIQA 4R8HA 5FIXA 1MZ6A 4QX3A 1OUSA 2WYFA 3HIFA 4QXCA 3H3UA 4XBLA 1DBNA 5KHJA 4QPIA 1N1TA 1W0PA 4N9HA 2YC4A 3ETQA 4OHZA 2DUQA 5FYYA 1YXWA 4PDWC 1DP0A 4MGTA 2XL9A 3TEWA 3CKHA 1FI2A 2BP6A 2CL2A 4JTNA 4QX5A 2B9UA 1CAWB 1RXFA 4OZXA 2W92A 1JZ3A 1COV3 1NA1A 2J1VA 4A7YA 5K0UC 3OTFA 4X6RB 5KC5A 1CESA 2B9VA 5FMOS 3BGAA 4WM8A 4C1WA 4XW3A 1C1LA 1ZZ7A 2CY6A 1G6NA 4YVWC 4Q4Y3 4ATEA 2BFUL 3S6PA 1H30A 3AYEA 4COUA 1RJ7A 4MH0E 5J36A 3PUSA 1W2NA 2XGXA 3UYJA 1E5SA 2VUAA 2ZGNA 5EJZB 5LBEA 1N1VA 2R32A 4R4ZA 2CYFA 3H0OA 2WO3A 1S4CA 5FP4A 3CLPA 4CU6A 3ZFFC 4CDQB 2RMU2 1RUD3 2WFF3 4KQ7A 1JYNA 3S30A 1LGBA 2QDRA 1HB3A 4X8PA 3SH4A 4YVSC 2NPIA 1XNCA 1CAWA 1VBC1 2W39A 1RUH2 3E5QA 4M0HA 3VKOA 1US3A 4RA0A 3I3DA 1ULEA 3VD4A 2VW0A 4EYUA 3WQ7A 5FOJB 2YUEA 3I54A 1I6XA 2WZR1 1SDDB 2WLPA 5FKCA 4JGYB 4LBQD 3JQWA 4BXSV 2PHXA 1IHMA 1GZWB 2ILMA 4K9SA 2VZ3A 1Q43A 4LK6A 4XAAA 2HWD3 3ACLA 4CTEA 2OYZA 5KHHA 2V4VA 1MEC1 3USSA 2EICA 1V70A 1OHFA 3UESA 1LENA 1UX6A 4CDQA 2FMDA 1C5IA 1JYIA 1FX5A 4BIOA 3KCXA 1DGRN 3D6EA 1SHWB 2JB4A 4HN1A 4C0BA 2ZX1A 1PZ8A 4JC1A 2WNOA 4Y3OA 1FPN2 1LHWA 5C5UA 2GH8A 3ZSMA 4YGEA 3KVBA 2J1AA 5CIRA 4B8EA 3PVNA 4EZ4A 4Q5OA 2GNDA
chains in the Genus database with same CATH topology
4JGYA 4AHZA 1D0GA 2DFCA 1OMIA 1GZWA 2ZACA 3KT7A 1NY72 3O12A 4NHKA 3KS7A 1HDKA 1SBDA 4XFGA 1GR3A 3AP4A 2R072 5HI0A 2R061 4PLMA 4GH4B 2A6ZA 1V6JA 2RMU3 1XRUA 3B7MA 1NXMA 1HXS2 1FV3A 2VOWA 1RUH3 1J3QA 1RL3A 1WCDJ 1AL21 1MQTC 1JYCA 1DLLA 1MZ5A 5KC6A 3I7DA 1WMFA 4GQ7A 1FAYA 1JN2P 1XNBA 4XJUA 4Z8BA 3MIFA 5GLWA 3ILNA 2VQAA 5FLJA 3GHMA 1VBB2 3ROUA 1QJX2 5GZGA 4GH4A 1AX1A 3ZXGA 1AL0G 1BVP1 3CJXA 1MS8A 3RJ2X 2BNNA 1FPN3 4P14A 3AYAA 4GALA 1LHNA 2ZOEB 3AZWA 3O14A 3G6JB 1WMEA 4M3CF 4AQ2A 1QJU1 2MEV2 3IM0A 2FMYA 1TQ5A 5BUVA 4Q2FA 2WT2A 4XHBA 1WW6A 2H0VA 1O7FA 1EPZA 1LU2A 1DFQA 4RGAA 1JBCA 2R073 4H7MA 4QGNA 1KS4A 4F7ZA 3JZVA 2ATFA 3OGGA 1H1MA 4XQ4A 4FPCA 2ZAAA 1BXHA 3UJOA 2D6PA 1KJRA 4HK9A 4YW4A 1GNZA 1ZREA 1HXS3 2FHRA 3JBG2 3AFKA 3VL9A 4BPZA 1UCXA 1VRH1 1D2QA 4PIZA 1JXNA 4EN7B 1VBD1 4FO9A 4H14A 1D0HA 1LTEA 2D5HA 2P37A 2RM21 2ZGQA 4YGDA 3MIHA 4MX3A 1LU1A 4Q26A 2BWCA 4Q4X2 4XBQA 2C5DA 3ECQA 1QJX3 1PM7A 3PMEA 5CADA 1QF3A 1Y3TA 3HBZA 1ENSA 5HBAA 2WQZC 4IERA 1J3RA 4L99A 3L2HA 5C6CA 4CDUC 1PGL2 5CFCC 2QE3A 1AR72 5IK8A 1QY4A 2IFRA 2D93A 3MFAA 4LA3A 4QXKA 3R4UA 4FPJA 3H7YA 1SCRA 4N53C 2Z79A 3NAPB 3W58A 1YFWA 4K3UA 2MEV3 1NXD1 3ZSKA 1H9WA 1SLIA 3WG3A 1LHUA 4LR4A 4J1WA 2FZ2A 3R4DB 1SLCA 2PAMA 1NE4A 4OFGA 4UW3A 2QJVA 2JENA 4OULA 3MF6A 1UPSA 4P9WA 1KS5A 3FJSA 2YC0A 2PAKA 1A6CA 2NN8A 3PVOA 4YG3A 2B8MA 3U4XA 3HWJA 2ETEA 3LB9A 4QPGC 4META 2DVDA 3NAPA 3AZVA 4KG0A 1RUF2 2BNOA 1G9FA 3J9SA 2JX9A 3ZXAC 5T52A 5FLIA 4PBPA 3I59B 1SFYA 5E8AA 2PHLA 2D6KA 4QM8A 4OHWA 4Q4X3 4I3GA 4QQPA 4R9BA 5F6LB 2WNUB 4G3YC 4H55A 3NVCA 2D3RA 1LHOA 1H9PA 1J58A 1Q56A 5FAXA 4AHWA 4RS5B 1TME2 3IDEA 2TBVA 2VMHA 3VKMA 1DQ6A 4Q4Y1 2ZX3A 1AR73 1QOSA 1OA3A 1VP6A 2VNOA 1DGWA 1LB2A 1QGLA 3X29B 3V0AB 1MS0A 3I59A 4IEZA 3TN91 1RUD1 2A3WA 2BFUS 2WFF1 1JTZX 2WT1A 1H1IA 2E7TA 3WDYA 4DS0A 2O1QA 2ARBA 2UWBA 2WNUA 3WDXA 4JQRA 2H6CA 3ILFA 2YPJA 4RS5A 1SLBA 2VNRA 1WMDA 2GC1A 2UYAA 4BE3A 3IT8A 1PGW1 2D6LX 1F8VA 2IFWA 3GBGA 2HWD1 4P9JA 5JSRA 3ZYJB 2NLRA 1H2LA 3V0AA 1YFYA 1Q8QA 5IK4A 5BNNB 1OLRA 1RUF3 5DG2A 2DCZA 1AXKA 1S55A 2GMMA 4NWWA 1C8M2 5JVVA 2PTMA 1IZ3A 4XFCA 4Y4YA 4YW3A 4LO5B 4XJZA 1IS4A 3GALA 5JOZA 1RUG2 4HL0A 4DZGA 1OQEA 3L2YA 4NN0A 4AQTA 2ES3A 1TMF2 1H8TC 1SACA 1TME3 3AKTA 3IBMA 4URTA 1CPMA 1EV12 2HWE1 2HEWF 4HVQA 2BBVA 2X5IC 2E6VA 1UAIA 3A0NA 4DMIA 1DZRA 2I74A 5BNNA 3H1WA 2BVVA 1C57A 1MZFA 1EPWA 1KXGA 2XHKA 1FXZA 4E2SA 2P3IA 4GMP1 4UBGA 2XWBB 4QHBA 1GQGA 4OI1A 1RUH1 4P9LA 4AQ6A 5E89A 3IDBB 3H1YA 1OPMA 4FSJA 4D7TA 1MS1A 3TBDA 1IPKA 3M8LA 3U11A 4FPGA 4U2AA 4CEWB 2A6VA 3OF1A 4FVVA 4MVTA 4QQHA 3NV3A 4AEMA 3ZSLA 3MIEA 2DF7A 2I2SA 3AB0A 3KMHA 3KQRA 1GLHA 2NQYA 1UPIA 5EXOA 5BPXA 4P5HA 3FFZA 4HLTA 1YFXA 1C8M3 4D7YA 2VH9A 5EYXA 1Y7BA 3H9AA 3HR9A 3VGIA 2VW1A 4FT8A 1RUG3 1RINA 3R05A 1C28A 4CEWA 3J26N 4I01A 4HKOA 3EBRA 4JVAA 4KWJA 3TWIA 1O3SA 3LSEA 5F1RA 5FMOL 1TMF3 2C1FA 4K1YA 3PTYA 4XMIA 3I4IA 1EV13 3FC0A 4BHPA 3PJQA 4AFAA 4AVAA 2JG8B 2YGMA 5T5OA 4CDWC 4WZFA 4AI0A 4X6QB 2R071 5FBZA 5BNOB 1SQ4A 1OI6A 4Y1VA 2CWMA 1B35B 2R49A 1PIV3 3WDUA 5ABJB 1XYPA 5J3UA 1AYN2 1HXS1 1WLWA 5I0SA 4RR3B 4A7KA 5C8CB 1LKNA 5EZWA 2VUJA 1NG0A 2D6MA 4HVRA 4JAAA 2V09A 1ND2C 3SMHA 3CU7A 1ULFA 1NQJA 4HVOA 4Q4W2 2JG8A 3ZXLA 2EF6A 3ZYIB 1R081 5BNOA 1VBB1 1QJX1 2A70A 1C1FA 2Q0AA 1LECA 3ZYRA 3PNAA 1B35A 3QD6A 5ABJA 1VJ2A 1PO22 2A3YA 4FOQA 1FV2A 4RR3A 5C8CA 1YIPA 1DQ1A 2WC2A 4W6WA 5H9PA 3VZLA 2WNVC 5IK7A 4YG6A 4ITCA 1OFSA 4H3WA 4DPNA 3WQ0A 4JCKA 4X8NA 1CN1A 4LHNA 1HW5A 1QH7A 1YCIA 3AKSA 5JWPA 2A75A 1N3QA 5J98B 3VBOC 1X36A 5A3MA 4XILA 3ST7A 1WW5A 5CBLA 3IWZA 1DQ2A 3WINE 1RUI3 2PHDA 2W08A 2VULA 1AYN3 3JBG1 2JJ6A 1S2KA 3AP7A 3RMXA 2OW4A 4YLZA 4AGRA 1X8MA 4PDWB 4AFCA 5GZEA 2XG3A 2YZ4A 3B9CA 3OYWB 2Q1ZB 5K0UB 4Q4W3 4A7ZA 4ZXKA 2QDNA 1VAVA 2WLQA 4Q4X1 4YM1A 3RS6A 5EYYA 3MDPA 4YVWB 2DVFA 5DG1A 4IESA 4MGKE 1BYHA 3VL8A 4CYDA 2SBAA 5LK7B 2A7AA 1MS3A 1PO23 2NMNA 4OUSA 4WVVA 1PGL1 5C4WC 2DCYA 3LA7A 3ZFFB 1AR71 2VECA 4ES9A 4PDWA 4NO4A 4Z82A 4YVSB 4S2FA 3LZZA 3AKQA 2GNMA 3O7OA 3OYWA 5K0UA 1V9U1 3ZIXA 4LBNA 1S0IA 1UL9A 4ORFA 1POV3 1JUIA 2G9FA 1W39A 2A73B 4YVWA 4XIKA 2DYCA 4FAGA 2XLGA 5A3LA 4FP3A 1ZVFA 3WW2A 3KGZA 4S2DA 3FMGA 4GWMA 2RS32 2FZ1A 3DV8A 4GXLA 3ZFFA 2XBO2 3UKTA 3WG2A 1QDOA 1F31A 1VAKA 4YVSA 4YFWA 3LOBA 3CNAA 4UXAA 3B02A 4W65A 1RUF1 3ZXEA 5CFDC 4Z92B 4ZU7A 3O5SA 1XYNA 4C0HA 3M1HA 1PZ9A 1GKBA 4OHXA 3KT1A 5ABJC 3EHKA 5T3NA 5AFEA 1D4VB 4E2QA 2ZCWA 4K8FA 5JIAA 5JLVA 2ERFA 2QFEA 3BCWA 5D1IA 1ZA4A 3HT1A 3RYKA 1DHKB 2ENRA 3TAYA 4W6XA 3QACA 3C3VA 4M01A 3PVBB 1M06G 4CP0A 5FOBB 4IEOA 4XJ9A 4F8AA 2UWCA 2ZABA 1REFA 4QPYA 1GZCA 1Z0HA 1JHNA 3GZUC 3ZMNA 3S7EA 1ND3C 1R1ZA 3H8UA 1MQTB 4D69A 1BVVA 1SMVA 4LO4B 1ZZBA 1H4GA 3KGLA 1SLLA 4LE3A 4GB32 1PNFA 5T5LA 2D43A 4O9EA 2P34A 4WM7C 2EALA 1RMU1 2DV9A 3INAA 5FQ0B 2RS33 3VZNA 1QHDA 2XBO3 3OGJA 1PVXA 1A78A 2D3SA 1QQP2 4EN0A 5GLZA 1PMIA 2CTVA 4L2NA 4QGLA 2D40A 1OSGA 3FX3A 1MQTA 2JKBA 4P9XA 3AMQA 4Y24A 4AWDA 1CJPA 1TEIA 1O91A 1C8M1 5T50A 1H2MA 5JZGC 2JEMA 1M4WA 3CJIC 1TNFA 4R9DA 2PFWA 1U5XA 4R9CA 1T6GC 1H1AA 2WZPP 2ZKNA 1RUG1 3ES4A 3NKGA 3ZIWA 3U0ZA 2XLFA 3VBUC 5FQ0A 5J7MA 4OI4A 4Y22B 5I91A 1S0JA 1SEFA 1EYBA 1IPJA 3RI9A 2R1BA 3OBTA 1RUC2 2QCSB 2WFPA 2ZGOA 2R043 2ZBJA 1HIXA 3J8F2 4JRLA 1O3RA 4L8QA 1MVQA 1NQDA 1V6LA 3TNQA 3UK9A 3WP3A 5IK5A 4AEJA 1NCRC 2XL7A 5I93A 2Q4SA 4GB33 4COYA 4SLIA 3D8CA 4NHMA 1S1AA 2DU1A 3QLQA 4Y22A 1R091 1KQRA 1ENQA 1MS9A 1CPNA 1QOTA 3GBWA 4OI0A 1AXZA 4FXKB 1RITA 1O3QA 1QQP3 1S0CA 3M3EA 1JH5A 3VHPA 2BNMA 4CDUB 5CFCB 5GLTA 1NZCA 3CO2A 2BTVC 3FFQA 2XJVA 2NM1A 1BEV2 1Y43B 4KU8A 2IXCA 5E88A 4KWLA 3AXEA 2PQQA 4N53B 2VPVA 4E2GA 1IKPA 4N90A 1QNWA 2D6NA 2A6YA 4OHVA 2GU9A 3IKWA 2DVGA 4I02A 1VIWB 4MSVA 1YI9A 2D7FA 4CDUA 5CFCA 4WVMB 5EFUA 5HXVA 2WT0A 1RUC3 4TZDA 1UF2C 3FWEA 4YZ4A 1PNGA 3J8F3 4N53A 2LUWA 4QPGB 1KFXL 2Z42A 2B39A 1YHFA 3FE5A 3WHUA 1F2NA 1ZBA2 1AYN1 1ULCA 4YM0A 5JSPA 1W6QB 1LULA 2RR11 5GZDA 2CAUA 3G7DA 4BLIA 2UU8A 3ME2A 5FO7B 2BW8A 2UURA 2F6BA 1C8NA 2XJTA 1LODA 2WINB 2PHFA 2XJUA 4WVMA 1DZTA 3B3QE 1V6KA 1AX2A 2VU9A 4FTBA 2GC2A 1PO11 4QPGA 4IL7A 2VNGA 1Z7S2 4HZFA 1CGPA 1BEV3 2G4IA 2O0OA 1PO21 2Y0OA 3M3QA 4LBKA 4BM8A 1W6QA 2BPA2 4I3PA 3Q9OA 1WLDA 3R4SA 1WD3A 4YG0A 1G9BA 1X33A 1XNDA 1AXYA 4QT6A 1MZEA 1DQ5A 3LKJA 3SHRA 4YSFA 3E6DA 2DVBA 3RDIA 2VGDA 4XF1A 1POV0 2V5YA 1HLCA 5KHGA 2K2SA 1ZBE2 4PIXA 1RVF3 1H2NA 1WW7A 3WDTA 3WW4A 4B4PA 4Z2WA 4FPHA 4IEXA 4AHXA 1BQPA 1ZBA3 5FPXA 4XTPA 3WVJA 4B4RA 2OIIA 4K7JA 1G7YA 4AFMA 5BYNA 3GZAA 1W6PB 3VHNA 1DQ0A 3CL1A 2Z5WA 3LCPA 4WBBA 3ZSJA 3HT2A 1H8TB 3OBRA 1CR7A 1EP0A 1HRV2 2C0ZA 2BYVE 2X5IB 2TNFA 4MYEA 1Z7S3 3JB8A 3T2TA 2DUPA 2XJRA 4K21A 4N43C 2PHWA 3KCCA 4FPLA 3VBSC 5FFOC 4D3WA 1E57A 1AF9A 4YW5A 1UW8A 2EAKA 4YRDA 3VLBB 5CU1A 4D7SA 5FDBA 3UJQA 1BKZA 4K6BA 3AK0A 5BNPC 1W6PA 2RJLA 1HV0A 3FZ3A 1FATA 1HV1A 4I30A 3JUUA 3SH5A 1J3PA 3M70A 2XJQA 1X8EA 1H8TA 4GKYA 5FREA 3IPVB 5HCFA 2X5IA 3VZJA 5FTTC 4AG4A 1TNRA 2ZMKA 4B3NA 1ZBE3 2D6OX 2A71A 1SBFA 2ARXA 1GQHA 3APBA 1H0BA 2EA7A 2RS31 3HQXA 4BZ4A 4FCAA 1PK6C 1RUJ2 2P3KA 2AGSA 4XF3A 5JR7B 2R6QA 2QZ3A 3VKLA 1VLNA 3WR0A 3KB5A 1IKQA 4COWA 3PLQA 5KBFA 3M3OA 2K0GA 3RWNA 4MGZE 1ZZ8A 3IPVA 2VVDA 2B46X 4AF9A 3TB0A 1RB8G 4BOWA 2YGLA 3ASIA 1UZYA 1AZDA 2X29A 1G9AA 2LALA 2Q5TA 4LHKA 2DURA 5D8AC 2TUNA 1HRV3 1I5ZA 2IC1A 4PJYA 3AMMA 4J1XA 2G9GA 2EXIA 1GBGA 4CDWB 2R0FA 4LULA 3OCPA 1G8WA 4FPEA 1COV1 3V56A 4LA2A 4FP2A 4KWKA 4LBOA 3WOGA 2IWGB 4IEVA 1LOCA 4BWOA 3WLUA 4UW4A 4FOVA 1HQWA 3AYDA 1V00A 2YROA 1WUVA 4ZKTB 3WG4A 4Q29A 2Y0IA 1ND2B 2CWSA 3LOIA 4DOUA 5H9SA 1C5HA 2E53A 1W0OA 3NSTA 4CDWA 2HWF2 4AVSA 2B5HA 3R6SA 3RYPA 4YZ5A 3WP4A 2NYYA 2UWAA 4XQDA 3AM2A 1RUJ3 3RJRA 1UIJA 4UW6A 5I0TA 3LA2A 1QXJA 3EO6A 2WNVB 4IEQA 5HCAA 2D3PA 1IOAA 1ND2A 3QOPA 2YMZA 3MLKA 3RG0A 5JOYA 4XFIA 1XE8A 5T54A 2KXLA 1GSLA 2Z69A 2ZTNA 2ZX0A 4BLJA 5GZCA 4RSUA 1CVNA 2XPJA 4BMEA 2ZMNA 2RS52 5JI9A 1AUYA 3MIGA 3OPZA 1ENXA 3VBOB 1MVEA 3LGRA 1VALA 4LUMA 1H4HA 5KXEA 2IXHA 2WNVA 3KSCA 4QQOA 5IT6A 4IEPA 3J8F1 3P3PA 2PA7A 1AR93 4TYSA 4L92A 5JPNB 4HETA 2BGCA 4QD2A 3N7LA 5L19A 2RHPA 4Y5Z0 4C90A 2QVSB 3H50A 2PAEA 1SFNA 2PLV2 1TE1B 1PIV2 2RMU1 5DZGA 3VBOA 5L73A 1W2UA 2B7YA 2HWF3 2XH6A 3KZ4C 1YLLA 3BTAA 4EWAA 3MZHA 3E5UA 4XTMA 5T55A 5FLHA 1LR5A 5I8TA 1CD3G 3ZSEA 4AE2A 5C4WB 2WA3A 1REDA 4FOYA 4HN0A 4XJWA 1WLTA 5CA6A 1OD5A 2P2KA 3ZXJA 5AVPA 3N7MA 4XMAA 1OFNA 2XVLA 3AZXA 2RS53 1DIWA 4O9GA 4KBBA 1ZX5A 1QU0A 1FPN1 5FRAA 5ACA2 1DG6A 1Q3EA 4LBJA 2IZWA 3RQ0A 1EAH2 1V6IA 3OY8B 5C4WA 1URXA 4YGBA 4ZU4A 3DKWA 4E4ZA 1X82A 2H0BA 4K1ZA 4IXLA 1GV9A 1YUDA 1NY71 1QJZA 5CB7A 5DZEA 3V64A 4I2OA 4Q8KA 5CFDB 1Q5OA 2ZHMA 1ZBA1 2Y26A 3MW4A 5A33B 4AGGA 1KDMA 3NV4A 5DDJ2 1B09A 1H2KA 3FLTA 1BMV2 2PLV3 4E27A 2AUYA 1RUI2 2OPKA 1GYKA 4AW7A 2JICA 1DYKA 3WT3A 2DFBA 3U10A 1S0FA 2O8QA 3OY8A 5J96B 1QDCA 3AX4A 2P17A 4LEJA 1O3TA 4SBVA 2OVUA 1XNKA 3S7IA 5JDBA 4IEUA 1QOOA 1Z7S1 4BMBA 5CFDA 2GMPA 3AFGA 3ZXDA 1EY2A 2VY0A 4UBHA 3FBYA 5C9AC 5A33A 1WD4A 5BXXA 2ZAHA 4HSJA 1ND3B 5T5PA 3EQEA 3BIWE 3TNPB 4Q1PA 1AJOA 2ZGUA 5J09A 4HT1T 1LOAA 2PHUA 1WCKA 4XF0A 4AHYA 4WM7B 2BWAA 2OUJA 5ACA3 3B00A 2Y38A 1AL22 5FO8B 1EAH3 2MEV1 2QZ2A 2HWC2 2KM2A 4Q0PA 2A3XA 1QH6A 4JDMA 3MW3A 3SNMA 1OKQA 2YDEA 2JXAA 5A32B 1ND3A 2PN5A 4MUVA 3VZMA 1ALYA 2EIGA 2VMGA 4TWTA 1WBFA 4WVZA 4JGZC 5EV7A 1O5UA 4IV1C 2LTNA 5DDJ3 4AVVA 2B42B 5JZGB 2XJPA 3CJIB 2JE7A 4OVEA 3E97A 4WM7A 2WQ4A 4IV3B 4R4XA 3BOWA 1CAXB 4YW2A 2IXJA 2ZGPA 3W9AA 2W0XA 5I8SA 3VBUB 2SLIA 1MS4A 5K9YA 4PCRA 4KL1A 4QU2A 3OJBA 3ZYGA 1PHMA 1D2SA 1QJU2 5A32A 1SDWA 4RHV2 4AGVA 4MV2A 1LOGA 2GNTA 1BBT2 1A8DA 5JZGA 4M0NA 2YXSA 4Q0VA 1KFUL 3CJIA 3NO8A 2W52A 2Q30A 4IV3A 1CAXA 1NCRB 2E63A 5JI7A 5DUWA 3VBFC 3VBUA 2CGOA 1Q8VA 4LUKA 3BPZA 1UN1A 1FOD2 1AX0A 3MI8A 1DZQA 1GNHA 1UKRA 1CAUB 2E51A 5AVAA 4INDA 2HJIA 4A3XA 1AL23 2DCJA 1VRH2 1L3JA 3ZVXA 4Q4V2 2HWC3 2AZ5A 4B7EA 3ALQA 1ASJ2 4AEDC 4EN9B 4P9IA 1UU5A 2RS12 1NCRA 3POYA 5CG8A 5C8WA 4AVCA 1CAUA 4EROA 3NW4A 1IS3A 4OI2A 1DGWX 3USUB 2NMOA 5JCTA 1V6NA 4Q8LA 2WA4A 3WUDA 1I3HA 2XWJB 1QJU3 3DGTA 1C3HA 5CVRA 3E6BA 3TYJA 4RHV3 4YNIA 2XKOA 4NR1A 3VDDC 1S0DA 1NCQC 1F5FA 2XB6C 1YFUA 1BBT3 1IQAA 3AJZA 3B01A 1S0BA 2AYHA 2QKDA 4PF5A