1YWKA

Crystal structure of 4-deoxy-1-threo-5-hexosulose-uronate ketol-isomerase from enterococcus faecalis
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
263
structure length
255
Chain Sequence
LQNMETRYTHSPADIRHYSTEQLRDEFLVEKVFIPGAISLTYTHNDRMIFGGVTPTTEELEIILDKELGVDYFLERRELGVINIGGPGFIEIDGAKETMKKQDGYYIGKETKHVRFSSENPDNPAKFYISCVPAHHKYPNVKISIDEITPMETGDPLTLNQRKIYQYIHPNVCESCQLQMGYTILEPGSAWNTRMEAYVYFDMEEDTRIFHMMGKPDETKHLVMSNEQAAISPSWSIHSGVGTSNYSFIWAMCGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase 1
publication title Crystal structure of 4-deoxy-1-threo-5-hexosulose-uronate ketol-isomerase from Enterococcus faecalis V583
rcsb
source organism Enterococcus faecalis
molecule tags Isomerase
total genus 59
structure length 255
sequence length 263
chains with identical sequence B, C, D, E, F
ec nomenclature ec 5.3.1.17: 5-dehydro-4-deoxy-D-glucuronate isomerase.
pdb deposition date 2005-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04962 KduI KduI/IolB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ywkA00
3S7EA 2VECA 5BV6A 1DGWA 4Q0QA 4OFGA 3FHIB 1WLTA 4MGYE 4MGZE 2ZCWA 2QCSB 4EWAA 2Z69A 3NSTA 2GH2A 4MV2A 1RUNA 4HVRA 2CAVA 3FFQA 4MH0E 2PAEA 4ZU5A 4NVPA 4L11A 4WVZA 3D0JA 5LRSA 1NXMA 1QXJA 3SCFA 3EBRA 1EYBA 3HT2A 2IC1A 4HSLA 2HJIA 1LR5A 4XETA 5E16A 4IEOA 2V09A 5KHGA 3SXWA 3C3VA 1XRUA 4Q29A 1YFUA 2PQQA 3EO6A 3FE5A 3NJZA 3UKVA 3BB6A 4AVCA 3I59A 4JTNA 5FQ0A 2B8MA 1HW5A 4LEJA 4XEZA 3H7JA 1CAVB 1ZRDA 1DGRA 5FQ0B 3DL3A 3H7YA 4AVAA 4IEQA 2WFPA 3BU7A 1XE8A 2PAKA 3VHRA 1WGPA 3PNAA 2XLFA 2MPFA 3I54A 4BH9A 5JSOA 1ZRCA 3NKTA 5JR7B 4AVBA 5JAXA 1O5LA 2P17A 2GAUA 2Q4SA 2Y0OA 1GQGA 4KWJA 2XLGA 1CAXA 2Q1ZB 5HI0A 1Q3EA 2D93A 2VPVA 5JSRA 1H1MA 3EQEA 1DZTA 3M70A 5BY5A 5FPXA 1O7FA 1NE4A 1LKNA 2XKOA 1CAUA 1RC6A 2HKXA 5D1IA 4LTAA 1RTVA 2XGXA 3OTFA 3N4MA 1X7NA 4KU8A 4MGKE 4XF9A 5BXXA 1XE7A 4EROA 3B02A 1J1LA 3RYKA 2GU9A 1UW8A 3OD0A 2VQAA 3PVBB 5I91A 1CAWB 4X6RB 3MDPA 2XLAA 3ELNA 1J58A 2UY8A 3BCWA 2DCTA 4E2QA 4QGNA 4MUVA 3SCGA 2OPKA 4O9EA 3QACA 4DINB 2UYAA 5I0UA 1Y3TA 4F8AA 3L2HA 1GQHA 4I2OA 4EWDA 3RZZA 1O3TA 4LA3A 1Q43A 1WA4A 3DKWA 1QXRA 3WW1A 2MNGA 3E6BA 2ET1A 4WZCA 4IEWA 4QGLA 4E2GA 1NYWA 4Z82A 3FX3A 1UIJA 3UKNA 1LB2A 3LA3A 3FWEA 1V70A 5CU1A 1EY2A 2PA7A 2PHLA 3JZVA 3NW4A 2CGPA 1OFNA 1YFWA 2K9ZA 1YLLA 2D5FA 2GC0A 4LA2A 1UIKA 4Q0VA 5I0SA 2CAUA 4QM9A 5BUVA 3CF6E 1IPJA 2BNMA 3H50A 3SMHA 5JCTA 4D7TA 3BPZA 1DZRA 3ETQA 4FAGA 3RYPA 2BGCA 1CX4A 3RNSA 3IBMA 4HVOA 4R8HA 4ORFA 4AQ2A 3OGJA 1ZZ7A 2BNNA 5CADA 3SCHA 4YARA 3IDCB 3RYRA 3E5XA 4WBBA 2B9UA 3HT1A 3O14A 4JVAA 2QVSB 1RL3A 5I8SA 2CV6A 3E6CC 2PHDA 4JTOA 4META 3CL1A 4ZU4A 4HSJA 2D5HA 5FLJA 4LULA 4PJYA 3GYDA 3EJKA 3LOIA 3E5QA 4I01A 2K0GA 4RD7A 5K8SA 3OF1A 1O5UA 4XF0A 4IEVA 1QWRA 2XL7A 3I59B 4XF3A 2ZKLA 3FZ3A 2FMYA 1ZZ8A 5F1RA 2IXLA 3S0MA 3ST7A 3H1MA 4MGIE 1O3RA 4D7SA 2BNOA 2XKPA 3CLPA 4HZFA 5I8YA 2PYTA 1X8EA 4KL1A 1O3SA 4JV4A 3WW2A 4I0BA 5KHKA 3WW3A 2UYBA 1ZZCA 2H6CA 3LWCA 4IEUA 5FLIA 4HN0A 2C0ZA 2IXHA 3H8UA 1UCXA 1CAXB 5KBFA 4HN1A 4P9GA 1Y9QA 4XFCA 4XFHA 2ATFA 1ZZ6A 3CEWA 4YNIA 3NL1A 4Q0UA 5I8TA 1FI2A 1CAUB 3RDIA 2KXLA 4HLTA 4QXKA 3E6DA 2XL9A 2QNKA 4TLFA 2MHFA 4BIFA 2BEOA 3TNPB 1J3RA 1VR3A 5BPXA 3CJXA 2N7GA 1EPZA 1QY4A 2B5HA 4CYDA 3S7IA 4MZUA 4EWEA 1PMIA 5FLHA 4IEPA 3KSCA 1ZZ9A 4QGMA 4GULA 3KMHA 1FXZA 1OMIA 1ZRRA 2EAAA 3QOPA 4R52A 1J3PA 4FBFA 3DV8A 4I3PA 3MYXA 4OLLA 2EA7A 1G6NA 4EV0A 5KHIA 4PIYA 4Q0SA 3KGZA 1EP0A 4UBHA 1YFXA 5EZWA 1U12A 3R6SA 2Q30A 4N9IA 4XFIA 4MX3A 3ES4A 4LUKA 4XF1A 4QM8A 4UXAA 3LZZA 4XFGA 4PIXA 3ES1A 5J3UA 5C8WA 5CVRA 4Z07A 2H0VA 3D0SA 1TQ5A 2EVXA 4K8FA 4XFAA 2GC3A 4IEYA 4KU7A 4IESA 2PAMA 3H3UA 1ZZBA 4J1XA 3G7DA 2D40A 1CGPA 4XFBA 3LAGA 5FDBA 4QMAA 5J7MA 1VP6A 4HVQA 3LA2A 2IXCA 5KHJA 4H7LA 2PTMA 1YFYA 4I02A 3OCPA 4XFFA 4HMZA 3EHKA 3USSA 4XF4A 5T3NA 4IEXA 3TNQA 5AVPA 4PIZA 1OD5A 4N9HA 5JSPA 3NVCA 1SQ4A 2I45A 1SEFA 1ZNPA 3LA7A 5I93A 2OA2A 4UBGA 4X6QB 3SHRA 4LLOA 1YUDA 3IIAA 4E2SA 4BHPA 4IERA 2FQPA 2O8QA 1CAVA 4IETA 3D82A 5J48A 5C6CA 1IPKA 5I0TA 4J1WA 2OZJA 5EFUA 3UKTA 4QX5A 5FPZA 1RGSA 5KHHA 1VJ2A 1OI6A 1YHFA 2OYZA 4BYYA 2E9QA 2QDRA 4YYOA 1ZVFA 2F4PA 2H6BA 4I09A 3PLQA 3U0ZA 3KCCA 3HQXA 2Z2SB 1UPIA 2O1QA 1J3QA 1YWKA 3H9AA 4AXOA 5E1RA 3CO2A 3U11A 1ZRFA 3H1WA 2IXIA 3RPQA 4Q0PA 4FT8A 3IWZA 1LRHA 2Q0AA 4A2UA 3E5UA 4I0AA 2PFWA 3ACLA 4B29A 1I5ZA 5LRRA 1ZX5A 4LUMA 4O9GA 3FJSA 3U10A 3IDBB 3WW4A 1CAWA 4YSFA 3GBFA 1I6XA 1JUHA 3HIFA 1NZCA 4KWLA 1RUOA 4AQ6A 3E97A 2GC2A 3MZHA 2ET7A 2OZ6A 2GC1A 3BALA 2GZWA 4ZU7A 1SFNA 1O3QA 1J59A 1X8MA 3M3IA 4HBNA 3ZDSA 3DN7A 2BYVE 3MPBA 4F7ZA 1L3JA 1FT9A 4KWKA 3ROUA 1ZREA 4YRDA 1X82A 5LEJA 4ONUA 2UY9A 2ETEA 2QJVA 1O4TA 5FCCA 2XHKA 5LEKA 1Q5OA 1UD1A 2WC2A 5I0RA 2IXJA 1H1IA 4IEZA 4FAHA 3H1YA 3I7DA 2IXKA 3H3ZA 1NE6A 1PM7A 4L2NA 3KGLA
chains in the Genus database with same CATH superfamily
1W05A 4NUBA 5BV6A 1IQDC 2YROA 5CEHA 3JB4C 2DVBA 2VNRA 3NO8A 1WLDA 1N1SA 2Y33A 4EWAA 2W46A 1IPSA 3NSTA 4UI9L 4WZFA 3BUCA 1AHSA 2GH2A 3JD71 3OGSA 4KGGA 3RWNA 2YPDA 4M3CE 4YW6A 1UMHA 1UOJA 3OUIA 4XCAA 3USUB 4MH0E 3IPVA 1ST8A 4ZU5A 1CR7A 3HBZA 4L11A 3POSA 4ZHNA 4NMIA 3FLPA 2DUQA 1AJKA 1KXGA 1AYN3 2ZABA 1EAH1 1KDKA 3D4KA 1UY4A 5DAVA 1C8M3 4XE9A 1EYBA 4MHRA 2WNUA 4HSLA 2HEWF 5FYYA 1G9BA 1FMD3 2NZ9A 3AP6A 4XETA 5E16A 2D6LX 2RS12 2V09A 5KHGA 3SXWA 3M7AA 2CGOA 4RQPA 3AFKA 3GZAA 1W8WA 1WCDJ 1POV0 2WINB 3M4FA 4K3UA 4Q29A 3W59A 3WDVA 1O8SA 4YGBA 5LY1A 1DQ1A 1VB2A 3JCIA 4ZXKA 1UU6A 3NJZA 5J96B 3AL5A 1H8VA 1WMFA 2RM22 5FQ0A 1NT0A 2CTVA 1GZWA 1VBC3 2AEYA 1CAVB 1DGRA 1OUSA 4H55A 5FUIA 2ORZA 4FQ4A 4B8EA 2RJLA 4BQ1A 4Q27A 4LE3A 2JDKA 1RMU3 4AYUA 1LOFA 1W8HA 4CEWA 2VULA 2MPFA 4BH9A 3LPGA 1LODA 5JR7B 2DBIA 1DCSA 4UW3A 2PELA 4IE7A 4Q4V2 1O5LA 1QJEA 4YPJA 5F2WA 2HWD1 2QFEA 1DQ4A 1WW7A 3WG1A 4CUBA 1CAXA 2Q1ZB 2A1XA 2YBKA 3DECA 3T1MA 1NCQB 5HI0A 5DQ0A 1A78A 2E32A 2EXIA 3EQEA 1DZTA 4Y22A 3WQBA 5FMCA 5BY5A 3K48A 3O7OA 3WHTA 3RZLA 1WCKA 3CJIB 3FBYA 3AYEA 4FPJA 5A1LA 2XKOA 4CCJA 2B46X 2HKXA 5FYUA 4LTAA 3ZYFA 3R4DB 1MS3A 1OA4A 4LBLA 4N53C 5L7OA 3OTFA 5C4WB 1UNBA 3N4MA 5A3PA 4CDUB 2BJSA 5BXXA 4IV1C 1W0PA 1F35A 4AAXA 1UY2A 2YU1A 3B02A 3KS7A 2JG8B 4QB2A 2BPA2 3AB0A 3VD4A 1ND2A 1R091 1UU5A 3AKRA 4NWVA 2VQAA 3PVBB 2KD7A 3QD6A 2P3JA 1KS4A 3WNOA 1CAWB 4N8MA 5F3CA 5IT6A 5JZGB 5JXJA 4X6RB 3ZFEB 4AHWA 1RUH3 2UY8A 4GWJA 3TEXA 4AAPA 1GWKA 2DBNA 4QGNA 5L36A 4MUVA 3SCGA 2P5BA 1PVC3 4JHZA 1OKQA 2PLV2 2VAUA 1REFA 3MF6A 3N7MA 2R042 3J8F1 3WP6A 1W6OA 4PI2A 4CU9A 2VCAA 4XJWA 3NAPB 3HOBA 2VMHA 3PUIA 4QPYA 5K7PA 1E5HA 1F4AA 3QACA 4JGYB 1WCQA 3ENRA 4YLZA 2EXKA 5FP9A 3JBG3 2B4KA 3KV6A 1MR5A 3WF2A 2IWGB 3L2HA 3CKHA 4SLIA 4C90A 2HYXA 5FWJA 4I2OA 1EUTA 4RFRB 1LOBA 1IGOA 3OJBA 4WVMB 2CDPA 1WA4A 4RSUA 1WMDA 1HKDA 3DKWA 5E8AA 1W2NA 2VOKA 3WW1A 3E6BA 1RJ8A 3VBOA 1GP4A 3O1TA 2X09A 1C1FA 2WZPP 2CGNA 1SLTA 4IEWA 4GZ9A 1NYWA 2ZGSA 3VZOA 4AI8A 3B01A 1TME2 4XBLA 4GWNA 1JHJA 3AJZA 4YVWB 4CVUA 3KZ4C 4DUWA 4LIVA 4IXLA 3FWEA 1LECA 2D6KA 2A73B 3T2PA 5C5TA 1RUD1 2OUHA 3NW4A 4L99A 4XTPA 4CU7A 1OFNA 4AI3A 1RHI1 4Q8KA 3I3QA 2BVBA 5CFDC 2K9ZA 2WRAA 1YLLA 1FPN3 2D5FA 2VW0A 4LA2A 4KGQA 1IOAA 2MEV3 4W65A 2CAUA 3JD73 1HRV1 4YVSC 5FZ4A 5KC6A 1AVBA 2W87A 4LO4B 4QM9A 1YJKA 2VCBA 5BUVA 1IPJA 1FYUA 3MPPG 1Y4WA 4JKMA 2YY1A 2GMPA 2NLRA 2XJSA 2BGCA 5CKQA 4AI9A 1CX4A 4D8MA 2YYOA 4IW3A 3TWIA 3LQCA 3MIHA 3LDKA 4JC1A 4E4ZA 2WNVA 1PK6A 3U07A 1EAH3 3K77A 3NRUA 3ZXJA 3CJIC 1PO11 4QDSA 3ZXGA 5CADA 3J7MA 3RYRA 1Y9GA 4WBBA 3THCA 2B9UA 1G8WA 4IGOA 4JVAA 3K4ZA 1SLBA 2P6CA 1K12A 3POBA 2NMOA 2QVSB 5A3WA 4B4QA 3P1IA 4F3JA 4CDUC 3ZIWA 5I8SA 2CWMA 5GLZA 3CL1A 3KF3A 3VBFA 4AEMA 3IN9A 1L7RA 3MUY1 3ZXLA 1OF4A 4XZPA 3T08A 4LULA 5ANQA 3ZXDA 3A7QA 4DZGA 2JG8C 4P5YA 1SFPA 4ES9A 3GCXA 4I01A 2K0GA 1BQPA 2VQ0A 4QPGB 5L9BA 3ZOIA 3K3OA 1W90A 5FZIA 4AI2A 4CA9A 5JZGC 2XONA 2XL7A 3WUCA 2A6YA 2BRTA 3I59B 4XF3A 4FQZA 3ZFEC 3AZXA 1R1A3 1AR71 3LE0A 3TB0A 4Z8BA 5LCWL 5T5JA 1NLRA 1G7YA 3H42B 4UW6A 3VBSA 3H1MA 4TTGA 4JKLA 3ZPYA 3JXSA 1W6NA 4EN9B 2VZPA 4D7SA 2BNOA 3CLPA 3U4XA 1Y9MA 2P3IA 2VVEA 3NAPC 2WR9A 2ES3A 4WM8A 1RUJ3 2VQTA 1N1TA 1REDA 3WW2A 2WO1A 5IVCA 4I0BA 5KHKA 2JD4A 1RVF3 3NNMA 1FAYA 3WW3A 3X29B 1ZZCA 2ENRA 2E33A 2G9ZA 2R6QA 4Q4Y1 2Q1MA 1JI6A 2R30A 4LXLA 4FP3A 2C0ZA 4NE9A 1W8FA 4ZONA 3H8UA 3PDQA 1VAVA 2JDAA 2CHHA 2ZEZA 4CCMA 4HN1A 4XFHA 4XFCA 1PIV1 4CXYA 4LK7A 3MW4A 1H8TB 3CEWA 4YNIA 1OD3A 1MS0A 4IGPA 1GNHA 2DU1A 5H9QA 5I8TA 1CAUB 1PGSA 1BYHA 1RUF2 2TUNA 4NWWA 3MICA 1C8M2 2KXLA 4HLTA 5FREA 4KBBA 4MHUA 1UN1A 4AK3A 5FBZA 1DQ6A 1FV2A 4MO3M 2XL9A 2AUYA 2GMMA 1RJ7A 3ZN4A 3BYWA 3FC0A 1POV1 2QQWA 2QNKA 3UYJA 3IZOA 4YM0A 3Q8FA 5DDJ1 3POIA 3TNPB 1ZBA1 1X33A 4GIQA 1VBB2 1W06A 5BPXA 3HBKA 2N7GA 4Y3OA 2B5HA 4PHZA 3FMGA 1N3PA 1NY72 3S7IA 4N43B 5F3EA 4CDXB 1XYNA 3B00A 3IDEA 2D43A 4FPGA 1GFF2 3EYPA 4QB6A 4QXHA 3K75B 2LTNA 1O6UA 2WNEA 4N90A 4P9XA 3PL0A 5T5PA 3J7HA 3KT7A 1BMV2 2VE1A 2JE8A 5FP7A 2VOWA 3LEMA 1QDCA 5D8AB 3GDBA 3VBHB 4QWNA 1ZZ9A 3GF6A 2QZ2A 4GULA 2FD8A 3OYWA 2DF7A 4LOSA 5CA6A 4FXKB 2WDBA 4DB5A 3HD8B 2VGDA 3ZIXA 1J3PA 4CCDA 5LA0A 4DRRA 5ABJB 3LSEA 1QMJA 5FAXA 1US3A 3CDZB 4ARYA 2B42B 2ZEYA 5JIUA 3MUZ1 1OKOA 4Y20A 5F39A 3WF1A 5FYSA 1H6XA 4LK6A 4Z2WA 2RS11 3KGZA 1LGCA 3T2TA 3RZMA 2UURA 4XDOA 4LBMA 5L19A 4UW5A 4W8JA 5L9RA 1U12A 2JE7A 3IMNA 1OA3A 3PIGA 1EUUA 4IV3A 2RDQA 5F5AA 1QJX1 1RUD3 2RS52 2NYYA 4EE2A 3S5AA 1S55A 1OA2A 2RM21 1W8OA 1QOOA 2PHRA 4H2AA 1MPXA 4XF1A 2B7YA 1B35B 1PZ7A 3NJYA 3N9OA 4N53A 2OXBA 1MACA 1TQ5A 1UKGA 2Q5TA 1KFXL 2FZ1A 3ZYIB 3ACHA 4XFAA 1SACA 1C28A 1OLMA 2VBBA 3BU0A 4BM8A 2D40A 2J22A 1RXFA 1OLQA 2G1MA 1JZ5A 1RUH2 3LAGA 1W39A 2O8OA 3LF7A 1Q8QA 5GJ6A 4Q4V1 3ZXEA 3GM8A 5E6HA 4XTMA 5FYZA 3ILFA 2YFZA 1PVC2 3VDCA 1GUIA 4NHYA 1QIQA 1VP6A 4LHNA 5LBFA 2FDFA 2G9FA 3LA2A 2IXCA 5A3OA 1BKZA 3ON7A 3USUA 1O59A 2PTMA 4V1PA 5JMOA 4ZXEA 2DV9A 2YPJA 3FBMA 4PDWC 3P3NA 2JENA 1O4ZA 3OCPA 4LIUA 4TWTA 2YXSA 4Y4RA 3H8OA 1MS5A 3M1HA 2J1UA 4IEXA 3TNQA 5AVPA 5FZ8A 3FLTA 5BNOB 4PIZA 1QJZA 1OD5A 4RGKA 5FYTA 2VM9A 2ZEWA 3VD3A 4C1XA 1UX7A 4Z1VA 4AFMA 4GA9A 5FY5A 1HN0A 2W92A 4OHWA 3OPZA 2I45A 1WUVA 1HV0A 1HB4A 5FZAA 4Q26A 1JTZX 3NNFA 3WP4A 4UBGA 3SHRA 1ASJ1 3H0OA 4IE4A 4LLOA 2HWB3 3IIAA 1DU3D 1NCRC 4JDNA 4BISA 5FZFA 2VOXA 3SKVA 4BHPA 1F8VA 3WNPA 2FQPA 1CAVA 1O4YA 1W9TA 2XH6A 4LO6B 1ND3B 1FPN2 4IETA 4QXBA 2PLV1 2W3JA 2ZACA 2MEV2 1MEC3 5J48A 2R041 4DQAA 1M06G 1IPKA 3N9QA 4ISRA 1UZZA 2AC1A 2VCCA 5FPZA 4R9AA 5ABJC 5FBJA 2Y6KA 1PIV3 5KHHA 5C5UA 1DBNA 5FZDA 1AX1A 1YHFA 5SV5A 5EPAA 5JLVA 1UZ0A 4W6YA 5IFPA 2YGLA 3PURA 2IFWA 2W68A 3VHNA 1JYXA 1JYIA 1RUE1 1NCQA 4KMQA 5DAQA 3PLQA 4U36A 1A8DA 2C6SA 4URTA 4XOGA 1PNGA 3V56A 2RDNA 3AMPA 4AXOA 2R0HA 3CJIA 4JDMA 1Q8VA 2GP5A 5DDJ3 4PLMA 4XQDA 1ZBA3 2XHNA 5T54A 1TME1 1DP0A 2Q8CA 5KWRA 1B35C 4JGZB 5EYYA 1LNSA 4NRPA 5C4WA 5SV8A 4CDUA 2WWUA 1M4WA 1QKQA 1VRH1 4XIOA 3WNMA 2GNTA 1MQTC 5T5OA 5EJZB 1JMUB 1VMJA 4QPIB 3BOWA 2JG8A 2PHUA 3ACLA 3MW2A 2JXAA 3IT8A 1ZX5A 1R1A2 4CCKA 3WDTA 1GR3A 1BK0A 3RZGA 1YXWA 2E26A 1CAWA 1AJOA 1VBD2 2VNOA 4MGSA 2FDKA 3ZFEA 1C5HA 4GH4C 2GC2A 5GZEA 5FJHA 3VBRB 1ENRA 2GC1A 1RUJ2 5CFCB 4ZU7A 1SFNA 1ZBE2 2ZHLA 4XPVA 3ZDSA 4C0HA 4IUGA 4GWMA 3NAPA 4MADA 4JGYA 1L3JA 1UX6A 3ALQA 3ROUA 3ZFGC 3ZYHA 5IK5A 2EIGA 2YBPA 4Z2AA 2RS13 4A4AA 1ULEA 2G19A 2O0OA 4D6SA 2UY9A 3V64A 2W47A 4WVMA 1OQ1A 3PIJA 3I2KA 2XHKA 1W6MA 4OHZA 2LW8A 1UD1A 1N47A 1LGNA 1RUI3 1H1IA 2WC2A 4MXVA 4BPZA 1IS4A 2Y6HA 3BPSA 3I7DA 4QQ2A 4RA0A 1RITA 2W5FA 1YJLA 2WYSA 3K51A 5IJRA 2BU9A 2PHTA 1YQCA 1PM7A 3PUHA 3VDDC 3M3EA 1ZA4A 2J1AA 4YVWA 2P3YA 4L2NA 2JJ6A 1W2UA 3O0VA 1UYYA 2A75A 2Y60A 4NIIA 1N3OA 3MLLA 3WG3A 2VECA 4OHXA 1ZA7A 3POGA 1DGWA 5FY9A 5A7QA 3SKJE 1MVQA 4G4FA 2WLPA 1WZXA 1S0EA 1S0CA 3IAPA 5BNPB 1J1TA 1WLTA 3FHIB 4K7JA 2QZ3A 2YC2A 4MGZE 4Q4V3 4QHBA 3VKLA 5KXBA 3ZSMA 1BHGA 1KS5A 3DPRB 4RFT0 2BWCA 4FOWA 3O1OA 3OOXA 4CU6A 4FFFA 1QJU2 4HVRA 2UWAA 4LR4A 2C1FA 2CL2A 1HV1A 1VRBA 2PAEA 5FMDA 5FZKA 2W1SA 1OFSA 4OYUA 4PQ9A 4QKDA 5CG8A 2XJQA 2Y6JA 3AKPA 3D0JA 5LRSA 2A5ZA 1XSQA 1RUF1 1BVVA 1C8M1 2QQPA 2BGOA 5FXXA 4LKSA 1F9KA 1UQXA 3HT2A 3KV9A 4FOQA 2QQOA 1FMD1 5FWEA 3PMSA 5FO8B 3PJQA 1GV9A 4DXZA 3Q8CA 1VBB1 1PX3A 4CZSA 2DVFA 2ZMLA 3C3VA 1Z7S3 2HLEA 4AZZA 1PZ8A 4QPGA 2R072 2PQQA 4ZZ8A 1JZ2A 1P8JA 3I59A 4AVCA 5A3NA 4JX0A 2BBAA 1CJPA 3R05A 2B8MA 1IG0A 1E5IA 2R043 2VMFA 4G3YC 3H7JA 3BVCA 5LBCA 3VBRC 5J37A 3DL3A 1ULCA 1ZRIA 2J1EA 4UW4A 4AOCA 4URAA 1BMV1 4WM7B 4IEQA 1COV2 4HONA 2PAKA 3VHRA 4WVVA 4XVHA 3RFRA 2IFRA 2VUCA 5JDBA 1RUC2 2GSYA 2XLFA 4L0PA 4IDZA 2WO2A 5EHDA 3UT0A 2Q4SA 3SEEA 2Y0OA 2ARBA 1W04A 1GQGA 4KWJA 3JQWA 3WF4A 5J36A 1N3QA 2XLGA 3BOPA 5DUXA 3Q8EA 5A33B 5JWPA 2CNAA 4KG8A 4XQWA 1H9PA 2W9XA 3OG2A 1WMXA 1PMHX 2K2SA 1QH7A 2OQ6A 3M70A 3RG0A 1TME3 4K1ZA 4Q8LA 1H8TA 5FPXA 1NKGA 5EP9A 3CU7A 1XU2A 3R4SA 1CAUA 2HBTA 4LBQD 2ZHNA 4P9IA 2RS51 4Q5OA 1SCRA 1RTVA 1HRI2 4TYSA 1JXNA 2I2SA 2XGXA 4XUTA 3ATGA 2H0BA 1X7NA 2HBUA 2X10A 2TBVA 4C8DA 4ES8A 1UXXX 5BNPC 4NR1A 5FPAA 4EROA 1JH5A 5B2GB 1GZCA 5FZ9A 1E5RA 1E5SA 1LU2A 2AEZA 2RS33 2GU9A 3B93A 3VKFC 1UW8A 2Z79A 5GZGA 3RGBA 3S57A 4AR2A 4CDXA 4N43A 2VVFA 3BTAA 4HL0A 1YIFA 4FCAA 3NNLA 1RUH1 3BCWA 4M0NA 2BP6A 4TSVA 1YI9A 2YBSA 4Y5TA 5HCAA 1PVC1 3WD5A 3WP5A 5IAVA 3VBUC 4EQVA 3TEZA 1W8UA 1MZ5A 3RS6A 3AMHA 4QX1A 3C8XA 4JDOA 3I2HA 2WJSA 4FPOB 5D8AA 3VBHA 2A6XA 1GP6A 4O9EA 2D3PA 3G6JB 4A7YA 4DINB 3CZUA 5FZ0A 4CP9B 5I0UA 1A6CA 1VBA2 4F8AA 2XJPA 3J7NA 1GQHA 1PVXA 3ILRA 4LO7A 2VNGA 4LBJA 3RZZA 2ZX2A 5HCFA 3MGUA 5ABJA 4LA3A 3T4VA 3H8RA 3UV9A 1IS5A 4H7MA 5FIXA 3T30A 2WWSA 2EIBA 1R082 3V0BB 5FZ3A 1GU3A 3WF3A 1BXHA 4BK4A 3AP9A 4WZCA 3ACGA 1LU1A 4MSVA 1NG0A 4E2GA 3LB9A 4Z82A 4CRQA 4YGDA 4HXCA 3RZKA 1UIJA 2ZA9A 3MIBA 4FFGA 5DUUA 2F4LA 3LD8A 1LB2A 4IV1B 4OHYA 3ZVXA 4KBZA 2BTVC 4OUMA 5CU1A 4WM7C 2NP0A 5KXDA 4JZRA 4BCUA 3FLRA 3JZVA 1G9AA 1B35A 3VKOA 1FOD2 2DU0A 1FPN1 2VXRA 5I0SA 4XUNA 2MEV1 3TAYA 2VH9A 4O61A 2FDJA 3CF6E 3KT1A 2BNMA 4CDWB 2XUMA 4HKWA 3SMHA 1IZ3A 1DZRA 3MBWA 3ZDVA 2A70A 5K0UB 2W08A 4A7KA 1OXCA 5F7UA 5HPOA 2JDYA 5GLWA 1RUF3 1IS6A 4ORFA 4AE2A 4LBOA 4S2GA 4AQ2A 2EXJA 2K46A 5DXDA 2QQJA 4OI1A 4PQQA 4XJAA 4D6QA 4YARA 1ACCA 3IDCB 3OBRA 4L97A 3E5XA 4BXSV 2OS2A 3HT1A 2O14A 1O91A 5LW9A 1AYM2 3HAGA 5HCBA 1RL3A 4A44A 1X50A 2PHDA 1VBB3 4YZ1A 4B4PA 5BNOA 4HSJA 4M0HA 4E8DA 3VKMA 1PGL2 5T50A 3EJKA 5IK8A 1YIPA 1RUI2 5HXMA 3LOIA 4Y1UA 2D6PA 4X8PA 3WNNA 3MF9A 4WVWA 2RR13 3OF1A 5K8SA 1JU4A 1O5UA 4XIKA 4IEVA 4YW2A 3TN92 4ZPIA 2YUEA 4PBOA 1R1A1 1ZYBA 3FZ3A 1SZBA 2Y8KA 1U5YA 3A0NA 1S2KA 3TYJA 4C1WA 5F1RA 2IXLA 2JG9A 1VBD1 2WUHA 1HJGA 5CFDB 1RB8G 3WOGA 2BWAA 2RHPA 1WD3A 4AHYA 1O3RA 3B69A 4HZFA 4LBKA 5I8YA 3I2JA 4YVSB 2XJVA 1HLCA 1MVEA 4Y1XA 3ME2A 1ND3A 1RUJ1 1LHNA 3CIHA 4LO5B 1ZBE1 4XAEA 5FO7B 1VAKA 4CCLA 3S5QA 1RVF1 4FSJA 2UYBA 4NHKA 3OEAA 4OHVA 1W6QB 2W39A 5FLIA 3KV4A 3J26N 5CNAA 2IXHA 2JDUA 3VD9A 5HXVA 1UCXA 5DAXA 3AZZA 3TOJA 4LLFA 4P9GA 1Y9QA 3ASIA 3U78A 2YMZA 2BOIA 4PLOA 2XJTA 1ZZ6A 4IL7A 2RS53 3AMNA 3OPWA 1JZ4A 3ZYJB 4BQ4A 3HQRA 2C24A 5FUNA 1AR92 5FZCA 1UY0A 4P00B 2WIIB 2BV4A 5IFTA 4JGZA 2JKXA 3OY8B 4BIFA 4Q1RA 2BEOA 1NOVA 2BQPA 3FFZA 3BTXA 2Q8EA 1VR3A 5FY4A 1AR83 1C57A 1JOBA 4DUVA 5A6YA 3B5LB 3CJXA 1VLNA 1Z7S2 2DCJA 4UYBA 4CDWC 2LUWA 3M8LA 4ZY9A 1KFUL 1BLZA 1YQ2A 2X5IB 4P9JA 4QPIA 1PHMA 4MZUA 4EWEA 5FLHA 5K0UC 1NX9A 1HDKA 3PUSA 2FDIA 4IEPA 2HEYF 4HFSA 2ZMNA 4QPWA 1QJU1 5IK7A 5GLTA 2A6VA 1JHNA 2JD9A 2B45X 2TNFA 3HNYM 3KSCA 1LTEA 1R64A 3OGGA 4NOTA 3VBRA 1JODA 1VMHA 2JIJA 5CFCA 1HQWA 2XUEA 2Z4FA 4QGMA 3H3LA 3VZNA 5FPVA 2JKBA 1PNFA 1D4M2 1FXZA 1OMIA 5T52A 2PHXA 1CD3G 2WFF2 3AZVA 5LASA 1WCUA 3VL8A 4R52A 1E57A 4COZA 3A4UA 3N9MA 5H9RA 1XXNA 5JVVA 2LROA 3DV8A 3T4HB 2RG4A 3DXTA 3MYXA 4CUAA 5FPLA 2ZXQA 4RR3B 4EV0A 2ZX3A 1US2A 3IAQA 1GICA 4L92A 4OQ9A 1EP0A 2HEVF 4UBHA 4E4SA 3I3EA 1HIXA 5EZWA 3RRDA 5IVJA 3ZFFB 1CESA 2VMIA 4W6XA 4XDPA 4GD4A 3AXEA 1WBFA 4X8NA 1H2NA 4CUGA 3GBWA 1KJLA 4UXAA 1MZEA 4UFMA 3H8XA 1SLIA 3LZZA 2CDOA 4XFGA 5J3UA 5CVRA 5C71A 3AYDA 2DVDA 1COV1 3HJRA 3DEMA 4FP2A 2RS32 4R9DA 3BTZA 4QQOA 5BNPA 2GALA 2GC3A 1RUC1 2KR2A 4IESA 4ISQA 5CG9A 4J1XA 1ZZBA 2VD7A 1MS9A 3DPRA 1YI7A 4JAAA 2WZR2 3WDUA 2XVGA 4NJ4A 1XNBA 1W8ZA 2BDRA 2BGPA 5EYXA 5CYYA 4XQ4A 1UYZA 2EICA 1W0NA 2QQMA 1YFYA 4P14A 3F2ZA 1JBCA 2EF6A 4HKLA 5BNNC 3J4UH 2ZHKA 3VN4A 3USSA 5T3NA 1LOEA 2ARCA 1F4HA 1DZQA 2XR4A 4P02B 3FUQA 1POQA 3WHUA 1HRI1 5C7GA 4IE6A 1WD4A 3KQ4B 3ZN5A 1V00A 2J7MA 3W21A 2RDRA 4FTBA 5JSPA 2J1TA 1OLRA 5LBBA 5H9PA 2BFUS 3T0DA 2X5IC 3IIIA 4NAOA 4XILA 1ZNPA 1VBD3 1VBE2 2AR6A 1D2QA 1W0OA 1XQNA 5CISA 3VD7A 2HWB1 1YUDA 4F83A 2DFCA 4XJ9A 2XJRA 2VW1A 1ZBE3 1NAEA 2O8QA 3VZMA 2XQRA 1LGBA 1UMZA 1QU0A 4QQHA 1WA6X 1SDWA 1AX2A 3QBQA 4RGAA 3ZYGA 5F9TA 1HB1A 3OGRA 1VE0A 3D82A 1K5MC 2DURA 2XQXA 4WM7A 1MEC1 3O0WA 5IYYA 4NRMA 4BDVB 3ACFA 2XJUA 4OZXA 5I0TA 4YM3A 4J1WA 3UKTA 4ZS2A 4DFSA 5A6QA 5A3MA 1AX0A 2I07B 1RGSA 1VJ2A 1XU1A 3JB8A 3WLUA 3BI3A 2Z5WA 2OYZA 4RR3C 4BJ0A 1OURA 2FCUA 4BYYA 4MGTA 3MEPA 5JOZA 2QDRA 2KA3A 1ZVFA 3ACIA 5A33A 4PDWB 5HV0A 3ZFFC 4I09A 5C3QA 4CCNA 5BNQA 4XC9A 3HQXA 1H4HA 1R081 1VAMA 3RMYA 4COVA 1QXPA 2C9AA 1C3HA 3H9AA 4QX2A 5E1RA 3CO2A 2R1BA 3AL6A 1ZRFA 3GHNA 3AMMA 3H1WA 3RSJA 5DZEA 1UL9A 4XMAA 1OPOA 4FT8A 2QQNA 1TMF3 1X9PA 4COYA 4MG2A 2A3YA 5DN2A 1S1AA 4KG0A 3NV3A 4KI5M 4JCKA 5LY2A 4A2UA 1FOD1 2RR12 3ZN6B 2PFWA 2RMU2 5JIAA 2XBO2 1QJU3 1NCRB 1I5ZA 1SDDB 5DZFA 5LRRA 3HWJA 4B29A 2WA3A 3FJSA 4O9GA 4UF0B 2V4VA 3GBFA 1I6XA 4QDRA 3JUUA 2VUAA 4XDQA 4C91A 4A6OA 1RUOA 1S0JA 4AQ6A 1D4VB 2BZDA 5FOBB 2C26A 2E63A 2WO7A 2EALA 3LIGA 1SLLA 5FKCA 3Q8BA 2ZGLA 1OLME 4O65A 2BYVE 2ZAHA 1AXZA 5KXEA 4M00A 3ZYPA 3PVNA 5C8CC 4RS5B 3UETA 5FYBA 1GQPA 1AYM1 3C7GA 5FK8A 3HNMA 1OC1A 3VB9A 2R062 3ABZA 4ONUA 2X05A 4DPNA 5C3PA 2ZX1A 3I3BA 1PGL1 5J1XA 2R073 4A3XA 2WWJA 1GOFA 1Q5OA 1RUI1 2IXJA 4YM2A 4ATEA 3V0BA 3GNEA 2AH2A 5EXOA 1K3IA 2IXKA 1DGWX 4RGGA 1W2OA 2D97A 3H3ZA 1WWYA 3TN91 3QH6A 3TRSB 5A1FA 4NPRA 3ZX7A 1CZTA 5A6ZA 3D8CA 1W3XA 3E1F1 1Y43B 1COV3 4IV1A 4GMP0 3KQRA 1MQTB 1AR82 5J98B 1RUC3 1DHKB 1QJY2 3AX4A 4AQSA 4BMEA 1I9RA 2FCVA 3AP5A 4OFGA 4QB1A 5AC92 5GKAC 1BZWA 5GLUA 4ASKA 4EYUA 5FOJB 4NPLA 2W2IA 3AMQA 4XXPA 4MGYE 2BVVA 2ZCWA 2QCSB 5FP8A 4LKDA 4CDWA 2SBAA 3L9JT 5FXZA 3U37A 3VD5A 4GH4B 5A7SA 1JN2P 1XNTA 4AGRA 1JYNA 1RUNA 2CAVA 5GZFA 5K0UA 1ALYA 2GN7A 4DIQA 3KHBA 3FFQA 2CGPA 3GZTB 3O1RA 4FOYA 5LBEA 4PT6A 3WQ1A 2VZUA 5F5CA 1CX1A 1YO8A 1HRI3 2A7AA 3ZFGB 4XBQA 3HEIA 5IVVA 1QXJA 2V72A 4MYEA 5FKBA 5FZOB 1AR91 1LENA 4XUQA 3SCFA 3EBRA 3L2YA 1FNYA 1S0IA 5M0TA 1WCSA 1SBDA 1EV12 2A3WA 3WVJA 1UKRA 5TSWA 2YB7A 4K9SA 4PI0A 4DY5A 3TEWA 1Z7S1 3DYMA 4OMCA 3I2IA 1CIWA 3CZJA 4SBVA 3IKWA 4TXWA 3T3YA 3EO6A 2BW8A 3FE5A 5FY0A 3CHXA 3BB6A 4XUOA 3UKVA 4QU2A 3I49A 2IVJA 4BQ5A 3KHCA 4MLOA 1DF0A 1HW5A 1ZRDA 1VPHA 5FQ0B 2XPJA 1LJ7A 4M3CB 5CFDA 5FMOS 1XE8A 1JYWA 4YVSA 1Q8SA 1VBA3 2GN3A 1WGPA 1XE0A 2WAOA 1NLQA 3ORJA 2JB4A 4RS5C 1BCXA 4AI0A 1V6KA 2JEMA 1D4M1 2R0FA 5JSOA 2ZGQA 3WINE 1ZRCA 1ODMA 1KJRA 2WFF1 4CEWB 2PN5A 2P17A 2GAUA 4XJZA 3WR0A 1SMVA 4AFCA 2BBVA 4Q4X2 2B39A 2VVDA 1R083 3AVSA 3ZKUA 1STMA 2D93A 2G9GA 2R32A 5C33A 4CUCA 1H2MA 3GZEA 1H1MA 3NV4A 5DZGA 5JSRA 1WBLA 3GALA 5JXHA 1NQJA 2XXZA 1W2TA 3NNGA 1O7FA 3NWKA 1YYNA 4DXTA 1DIWA 1LKNA 5HCHA 2WBKA 4I3GA 1RC6A 1GNZA 2VZVA 2P6HA 2VY0A 2ZMKA 5D1IA 3SH3A 4EN8B 2Q8DA 4IGQA 1FOD3 1H0BA 4XF9A 3B9CA 4MGKE 5F3IA 3WT3A 3NKGA 4QT6A 1XE7A 3KT4A 3OY8A 1DLLA 3ZKYA 2DDUA 2ZGRA 5L7OB 1U5XA 3K3NA 4DEVA 2GMEA 1F15A 2ILMA 2Z42A 3KF5A 5JZGA 5K9YA 3RYKA 1FX5A 1SBEA 2D3SA 2RS31 3DGTA 1ULOA 2Q1FA 3AC0A 3NJXA 5IUQA 1XC6A 3LEKA 3OD0A 4MXWB 2X5IA 4LKEA 3MIDA 5I91A 5CKMA 3EXUA 5C3RA 2CYFA 1U5IA 4YZ5A 2WZR1 2XLAA 1J58A 2ZTNA 4XHBA 2DCTA 4AG4A 4E2QA 1ONAA 4YW1A 3ETPA 3LDRA 4FVVA 4LQRA 3WCSA 4DEQA 4GB32 2OPKA 2QQVA 5F2SA 1UOBA 2BERA 1WMEA 4CXWA 2VC9A 4CEYB 1AYM3 4E27A 5B4XA 1MZ6A 4UT5A 4JHTA 4S2DA 1PO22 4P9LA 1TNRA 1HN1A 1DQ0A 4W4ZA 4EWDA 1JZ3A 1H2LA 4HG6B 4EZHA 1QNWA 2NQYA 4BQYA 3VUOA 1Q43A 2VUDA 4FTEA 5B4NA 1S0BA 3AP7A 4GKYA 1PMJX 4YW5A 2HWD2 5FZBA 4RR3A 3MI8A 5DABA 2ID4A 3TN93 2MNGA 1SFYA 5LWBA 4LKFA 4Y5SA 2NN8A 1ENSA 1CPMA 2ET1A 2VQUA 5FP4A 1N1VA 4QGLA 1DGLA 2F17A 3ZFFA 4GWIA 4XURA 5F5IA 5IAXA 2DFBA 3UKNA 5A3UA 3LA3A 1C1LA 1LOGA 1UZYA 3N7KA 1TMF2 4XBNA 1V70A 4LBNA 1YC61 2JWPA 2W94A 3O5SA 5J09A 2ZZJA 1JZ7A 2PHLA 1PM4A 2J1SA 2YDEA 4AVTA 1YFWA 5JUVA 3VHPA 3AM2A 4AGGA 1UIKA 4Q0VA 2C4XA 1W9YA 4S2HA 4L9BA 1HJFA 3BTYA 2E53A 4PCRA 1CJDA 1LOFC 1JUIA 2R49A 4CEWC 2VTFA 3TEYA 3H50A 5JCTA 5IVFA 1GWLA 5IK4A 3ETQA 3VBUB 2DUOA 3IBMA 4TZDA 4R8HA 2Y0IA 4ASMB 3AKSA 2W1WA 5JXGA 1A34A 1AR93 4OQ8A 5HV4A 2RE9A 5A7OA 3SCHA 1YNAA 3INAA 2LM3A 3C2UA 3DF0A 4GJZA 1CIYA 1NUKA 1X36A 2DWRA 3MV01 1IQAA 5FP3A 3U14A 2CV6A 3U75A 3E6CC 1D0HA 2LALA 2UWCA 3B94A 4XJ8A 3GJBA 1HB2A 4ZU4A 5L7OC 3FUOA 1V6OA 1SG3A 2D5HA 5FLJA 3I2OA 4PJYA 1NY71 2RJKA 4Q4W2 3VBFB 2YC4A 4QX7A 1UOGA 1AF9A 5A1AA 2G4IA 4CDQB 2RR11 2JX9A 4GMP1 2AACA 4BQ3A 2XBO1 3OUHA 2FMYA 3THPA 3S0MA 3ST7A 2I74A 1EPWA 1Q56A 5KXCA 4ZS3A 2WS92 2VXJA 2HWF2 1D4M3 2PYTA 4CEYC 1UAIA 4KL1A 3GXUA 2IZWA 2WFF3 4JV4A 5FY7A 4YFZA 1AXKA 1UPSA 2VNVA 2VUJA 1RHI2 2PHWA 2E7AA 4UFKA 4WM8B 1CVNA 3C7HA 3KCXA 4KNCA 4N7UA 2H6CA 2LRPA 4DOUA 3LWCA 4IE0A 4IEUA 4Y33A 5FFOC 5JMCA 1BBT2 2R061 2ZS6B 4Y26A 1CONA 2ATFA 5LK7B 3N9NA 3QCWA 4U2AA 5IW0A 3WDWA 4PDWA 5C9AB 1DYPA 3N36A 1UF2C 2OQ7A 3LCPA 4Q0UA 4E4HA 1Q8OA 2X53S 3RVHA 3MLJA 1S2EA 1PO12 4YW4A 3ZSJA 4QXKA 2EIEA 3O12A 3I2FA 1DG6A 2VL4A 3SH5A 2VMGA 1DLCA 3NQHA 1SLCA 4TLFA 4EN0A 1DDLA 4ASLA 1SBFA 2P1BA 3POJA 5BYNA 1AR81 1B09A 5EWSA 4TN7A 2JECA 4FFHA 4BIOA 5AC91 1QQP2 3AVRA 2WZR3 4CYDA 2QQUA 1IKQA 4COUA 2VZ3A 1GZTA 3UL2A 3I2DA 1PMIA 1NCRA 1OT5A 2OVUA 2QUOA 3MIEA 4DY3A 4UF0A 3MLKA 4Q2FA 2WT2A 4OMDA 1XYPA 2WNVC 4D94A 2VJXA 1G9CA 4HK8A 1SCSA 3SH4A 3LEIA 4K1YA 1CZVA 4UFJA 4RHV2 1V6IA 3THDA 5FYMA 3WDYA 3QOPA 4CPBD 3A23A 1LOAA 1TZOA 2WSVA 2HWC2 2FBEA 4RS5A 3WQ0A 5FZ1A 4FBFA 2AREA 2WO3A 4I3PA 3VZJA 1OVSA 1EV11 3KLSA 1GANA 1XNKA 4YG0A 3VBFC 2HH9A 2EA7A 5HBAA 3THTA 3NMBA 1G6NA 1VBE3 3ZSEA 4CDQC 4PIYA 3IB3A 4AWDA 1VIWB 1S2BA 5FRAA 3M3OA 2DCZA 4YZ3A 1CQ9A 3RZJA 4QX0A 4BWOA 3R6SA 4OI2A 1T2XA 2Q30A 3PMEA 4N9IA 4CPBA 4XFIA 1UY1A 3HQUA 4FI9A 3VGIA 4FPYA 3ES4A 4K40A 4Y1VA 1UOFA 1C5IA 1PX4A 2XOMA 5AFEA 5EJ1B 4QM8A 2WLQA 3VBSC 4OCTA 4PIXA 3ES1A 4AEDB 5C8WA 4NN0A 1MQTA 4Z07A 3VDBA 3D0SA 1I5PA 1GOHA 1LHOA 2B9VA 2VOVA 3CMGA 4WM8C 5APAA 4K8FA 1W3VA 2VU9A 3C7EA 1OQEA 1V9U3 4IEYA 4KU7A 3H3UA 3M2MA 4DMIA 4V2VA 1CGPA 5FDBA 3GGLA 3PU3A 3VL9A 4GH4A 2WT0A 3KB5A 4LNVA 4Q4X1 4QHZA 3ZR5A 5J7MA 5A7WB 5C9AC 1AR63 3D5OA 4RYDA 4B4RA 5FXVA 4H7LA 3J7LA 5JI7A 4FFIA 1H1AA 4XYXA 5A3TA 1NZIA 1QOSA 2ZEXA 4I02A 3B9IA 4HMZA 4O7XA 4KWUA 5F8PA 4M3CF 3EHKA 3ZFGA 5G04L 4N7IA 2VMDA 4J25A 5FZOA 2ZX4A 1SHWB 2D6OX 1OH4A 2JE9A 1UMIA 5FK7A 1SPPB 3WCRA 5JOYA 4GMP3 4XCBA 4B7KA 2YU2A 3WF0A 2RVAA 1G86A 2RMU3 3CBNA 2WN3A 2X29A 1G9FA 2XBO3 2Y6FA 3I2GA 3NVCA 1SQ4A 3SC7X 4HOOA 2DCYA 3ZO0B 5F5QA 1SLAA 2BFUL 2P2KA 4PLNA 5I93A 4A41A 4X6QB 2HWE3 3ZLIA 4OVEA 3VDDA 1QOTA 3PHMA 4A3ZA 2W1UA 4E2SA 1IHMA 3LFIA 4XABA 3CNAA 2TEPA 3LDBA 1QJX2 1ULDA 4IERA 1UZWA 2D44A 2HYKA 2WZ8A 4KQ7A 4NIHA 3DYPA 3PVEA 4M3CA 1W9WA 4GB31 5FZLA 1H6YA 5GZCA 1HXS2 3KVBA 1JYVA 5EFUA 2OZJA 4UFHA 4AL9A 2R063 1XNAA 2UU8A 4QX5A 1PO21 3LOBA 2WSUA 5FV3A 1OI6A 4C0BA 1WW5A 3N9PA 5DAWA 4YYOA 4DO0A 1AZDA 1XPWA 5ACA3 2H6BA 1XNCA 1TE1B 2BUKA 2QTWB 5BNNB 2OIIA 3U0ZA 3KCCA 5A3LA 3WV6A 2Z2SB 2O1QA 1GLHA 3NJVA 3AZWA 1QHDA 3JU9A 4GQ7A 2DCKA 2F6BA 4IV3C 3U11A 1W6PB 4XW3A 4OI4A 1QJY3 2KM2A 2YV8A 4AEDC 1DFQA 4MVTA 1IKPA 2VMEA 4ITCA 1OOPB 5FTTC 1TMF1 1UYXA 3KVAA 5FZGA 1KEXA 5AC93 3MO4A 3V0AB 2YHJA 5DG1A 1OPMA 4GKXA 2NPIA 3NV2A 3RI8A 4JQTA 3E5UA 2VBDA 1H9WA 2ZGUA 1PZ9A 1NXD1 1UY3A 4G9SB 4TLGA 2GH8A 2VW2A 4QXCA 2RV9A 3WG4A 3ZYRA 3T09A 4HPKB 2FHRA 5C4WC 3UK9A 2ZPXA 2WNOA 3I8TA 1LOCA 3MW3A 4K8RB 4LUMA 3KM5A 3U10A 3U4SA 3ZYBA 3IDBB 1LULA 4MXWA 2QBXA 3N7LA 4EZ4A 4CU8A 1MS8A 1ASJ2 2ADDA 3HIFA 1NZCA 1VMFA 4KWLA 3W58A 1K5MB 1XYOA 3E97A 2VG9A 2VOTA 3MZHA 2ET7A 2RDSA 2GZWA 1J59A 1X8MA 1KRIA 4HT1T 4Y1YA 4CCCA 4CSWA 4ZZ5A 4CEYA 3W9AA 3MPBA 4PF5A 1ULPA 2VTXJ 3WP3A 1EV13 5FO9B 3B7MA 1ZREA 5FMBA 3T1LA 4NHMA 2FDGA 2PMWB 4YRDA 1X82A 4E8CA 5LEJA 1JS9A 2FZ2A 2WQ8A 1GOGA 3WY6A 1W2AX 3F95A 3ZXFA 2QJVA 1O4TA 3AFGA 4CXXA 4QQLA 3IMMA 2R071 3ZXKA 3HVDA 1GBGA 4LE4A 2GNDA 5I0RA 4Q4W1 3WNKA 4IEZA 5LA2A 4Z92B 2NMNA 1A3KA 3H1YA 3I4IA 1W6MB 5CKNA 1RUE2 3K4DA 1WLWA 1NE6A 3SNMA 5A80A 3LSDA 1L7QA 4AEKA 4JRLA 2OPWA 2VZ1A 4Y5Z0 2QKDA 1MZFA 5IVBA 1CPNA 4PF1A 3VZKA 1LAJA 1OVPA 3S7EA 2JIGA 2WS91 5JPNB 2HWF1 3LIHA 4R4ZA 2ZBJA 4P9YA 4Q0QA 1ULGA 4XACA 4V2WA 1V0AA 3N3HA 3P6BA 1VRH2 1Q8PA 3PTYA 2IVIB 4Y1ZA 2JDMA 2XWJB 4Q4X3 2Y64A 2Z69A 4BQWA 3N35A 3WG2A 2XMLA 5FY8A 4AQTA 4MV2A 1BBT1 2L9LA 1AL22 1BEV2 4FPCA 3A0KA 3VBUA 4ARXA 4DS0A 3FHQA 4NVPA 2FCTA 1W9FA 5T5LA 1LEDA 1H2KA 1NCQC 2WQZC 4YGCA 4WVZA 1W8TA 5C8CB 2CWSA 1KGYA 1NXMA 4QQPA 3LPFA 2WT1A 1DGRN 1OUXA 3AYAA 5FZEA 2P3KA 1REEA 1F31A 1BVP1 1NA1B 1OOPC 4HETA 2IC1A 3VDDB 2HJIA 5IVEA 1LR5A 4FO9A 3WUDA 5C3SA 4XZUG 1LESA 2ADEA 4IEOA 3DXUA 1JU3A 3M3QA 1TVGA 5EV7A 3K4AA 1AXYA 1WKYA 2AGSA 2J42A 3FHAA 4OI0A 3OBAA 1XRUA 2FMDA 5LK5A 1YFUA 4CDQA 3MFAA 1QQP1 5FR3A 1WW4A 4YZ2A 4K6BA 4JTNA 5LB6A 2R1DA 2QDNA 4GB33 1S0FA 1RUG2 1QNYA 2ERFA 4LEJA 3C7OA 3CQOA 4XEZA 5T55A 3S6PA 3H7YA 4AVAA 2VZTA 2ZGOA 3WEZA 1ENXA 1YQ6A 2WFPA 1FNZA 3BU7A 3OB8A 4A42A 1PO23 1RYYA 1VBA1 3PNAA 1F2NA 1V9U2 2A6ZA 4MGQA 1V6LA 5FMOL 4EN6B 3I54A 4RHV1 3NKTA 3K46A 4AVBA 1LHUA 3I3DA 5A32B 4JGYC 2QE3A 3TBDA 2E51A 4FOVA 5JAXA 1HQNA 2HWC1 2Y6LA 4E9KA 5CZKA 2HWD3 4PBPA 3OGVA 4HKOA 1AR62 1GYKA 1Q3EA 2VPVA 5CB7A 1YEWA 3NNJA 4AF9A 1K45A 2VR4A 3BGAA 4GAZA 2VMCA 4HANA 5C9AA 1OQDA 4NHLA 3ZSKA 1NE4A 1JOJA 1U5ZA 2VZRA 3DCQA 3FL7A 1OF3A 1V6JA 1K5JA 2XVLA 5EJ3A 1AYN2 1UWWA 1GSLA 4J6GA 4KU8A 4YVWC 4AGVA 4EJRA 5FYCA 5FYHA 3BIEA 3AK0A 3PTRB 1HQLA 2PQSA 3UJQA 4BQXA 4D69A 1J1LA 1FMD2 1BK1A 3BODA 1QEXA 1UU4A 2HWE2 1D7PM 4LHLA 1R093 2ZX0A 4NPMA 2E31A 3J9SA 1N1YA 2DTYA 2D6MA 3O1SA 4W50A 4LBQB 3MDPA 3ELNA 1GMMA 2DTWA 4LHSA 4QX3A 1XJAA 2WYFA 5JOWA 3KCYA 2ZGNA 3DUIA 3A22A 1VBC2 2ORXA 3N7JA 3J8F3 4CP9A 3APBA 4P9WA 1K42A 4RN5A 1YCIA 3POEA 1XNDA 2ZGMA 2UYAA 3BKZA 1D2SA 1NA1C 3RMXA 3VZLA 1RMU2 1Y3TA 4AFBA 1XBFA 3URFA 2V5DA 3SQOA 2AENA 2YGMA 5FYIA 5FZ6A 4Q4W3 3W5MA 1KD7A 4NIGA 2ZAAA 4NO4A 4D6RA 1O3TA 4LJHA 5FUPA 5ACA2 5KC5A 2ZGKA 5DPNA 1OBNA 4H14A 1QXRA 4UWDA 4FXGB 2OKXA 3SLIA 3W5NA 1TG7A 4R9CA 1UXZA 1OHFA 2Y34A 1RXGA 4QPGC 3FX3A 5EIYB 3BN6A 1APNA 2WS93 2HWF3 3MIGA 1EY2A 3O1VA 4LITA 2PA7A 3ZMOA 5LZ6A 2AYHA 2CU5A 1RINA 1RHI3 1ENQA 4DRVA 4AEDA 3POYA 2J1VA 2GC0A 5IATA 2ZZQA 1HRV3 3RQ0A 3GHMA 3WDXA 1JYTA 2VTXA 4BZ4A 1BBT3 5LATA 3T0AA 1HXS1 5D21A 3WX5A 2YC0A 1PGW2 4M4PA 2JICA 4CP2A 3T2QA 4D7TA 3BPZA 4FAGA 1XOYA 3LGRA 4K20A 3RYPA 1D0GA 2A3XA 1C8NA 2W91A 1MS4A 3RNSA 4INDA 5FJKA 2VZSA 4GXLA 4HVOA 4XJUA 3IPVB 2BOJA 1UO9A 3HPNA 5A7WA 1PO13 3OGJA 1ZZ7A 3O0XA 1NQDA 2BNNA 2C9KA 1DYKA 2ZHMA 4OULA 5AVAA 4AFAA 1H8TC 3O14A 4CCEA 5E88A 2J1RA 2OW4A 1VB4A 4BE3A 4DXRA 2CSGA 3UGFA 4FPHA 4GALA 2WNUB 4JTOA 1X9TA 5A7PA 4META 2WQ4A 4NROA 3JBG2 4LPLA 1QF3A 5DG2A 4IQPA 3A21A 4LUKA 3W20A 4OUSA 1SPPA 1QQP3 4QKBA 1Z78A 3GYDA 4BU2A 4RQPB 4AW7A 3E5QA 5DMYA 4RD7A 2CY6A 2OX0A 4XF0A 3POFA 1QWRA 4XXAA 1YQ5A 5A6XA 5F6KA 2P4EA 2ZKLA 5JOXA 1AR73 4CDXC 3S30A 4N43C 5ISLA 1GZWB 1ZZ8A 4UFIA 2ZOEB 4MGIE 4D7YA 2E7QA 2E7TA 4IE5A 4EN7B 1HX6A 2XKPA 5C70A 4QU1A 4RHV3 2JG9B 1UZVA 1JOPA 4GJYA 4YFWA 4BA6A 1GKBA 1X8EA 3WNXA 4M4RA 1O3SA 1W6QA 3QLQA 2HWC3 3T2OA 3NV1A 5D8AC 3VBHC 4CP1A 2XG3A 2Q8OA 3KWVA 4Q4Y3 3I3MA 1FATA 3DYOA 3JD72 2D98A 1QJFA 4FPLA 3VHOA 4HN0A 4P08A 5K4LA 1OSGA 3UGHA 1CAXB 4DXSA 5KBFA 4NHXA 3KD4A 2X8KA 5CAZA 5EQUA 4Y22B 3VDAA 3HNBM 3EB7A 5BNNA 3P5BA 3VLBB 3ECQA 2JDPA 3NL1A 1FI2A 3RDIA 1EAH2 5F6LB 4QHOA 3LKJA 4ATFA 4A45A 4BOWA 3WZ1A 1TEIA 5JXIA 3SEPA 1W6PA 3E6DA 2ARXA 2V5YA 2VO5A 1AL0G 3UESA 4AHXA 2W1QA 1POV3 5IVYA 1LCLA 4AI1A 3D3AA 1GZ9A 2WAAA 2MHFA 5DUVA 4AEJA 1OOPA 4RL7A 4LMFA 4CTEA 3VKNA 1J3RA 2VZOA 3V0AA 3IM0A 1I1EA 3OD4A 1LEMA 4OUEA 4WV8A 1EPZA 1QY4A 3C7FA 1ND2B 3SITA 5JI9A 4B1MA 2D7FA 4JKKA 4HPKA 2WZEA 4E4DX 4XHXA 2ZKNA 1AL21 1BEV1 4NRQA 2P34A 3HR9A 1K5MA 1OH3A 4AVSA 3EMRA 1W6OB 2W95A 4YG6A 1JW6A 3AP4A 2JB8A 2JDNA 5DAPA 1WLCA 3KMHA 1O8PA 3D6EA 1ZRRA 1IS3A 2WNUC 2EAAA 3OPTA 2WL1A 1TNFA 4FPKA 4YGEA 3RI9A 4ET7A 3P3PA 1HB3A 1RVF2 2ZGTA 4BMBA 2EIDA 1W9SA 2V4AA 2XWBB 2QQLA 4BLJA 1A8MA 1WW6A 4RQPC 2GP3A 5BNOC 2VBPA 4OLLA 1T6BX 1YQ8A 4M01A 4YWAA 4B1LA 1VBE1 1MS1A 5I0DA 5KHIA 3RZHA 4Q0SA 1S0GA 3VBOB 4CP0A 2WKKA 4K21A 1YFXA 2PHFA 2Y6GA 2E6VA 4QKFA 5FZMA 1KQRA 3PU8A 2ZGPA 3WNLA 2W52A 1QJX3 3AKTA 4MX3A 5FZHA 1QGLA 5FPUA 1CWPA 2RM23 1U0AA 3LEGA 1I3HA 1URXA 1ODNA 1RUG1 2D6NA 1W99A 1FV3A 2JG9C 3LFMA 1KITA 1BJQA 4NAMA 4XMIA 4B7EA 4NIDA 2EXHA 4OZOA 1HXS3 2H0VA 3PUAA 4FPFA 4KH9A 4YZ4A 4QX8A 3U1XA 4COWA 1Z0HA 5LA1A 3WSOA 2EVXA 3IDAA 1DQ2A 1ND3C 2DUPA 4H3WA 1JZ6A 3R0RA 1R092 3RWKX 1V9U1 2JDHA 2PAMA 3ZSLA 5A7NA 3G7DA 3AYCA 3I97A 4XFBA 4DNYA 2OT7A 3MIFA 2WNVB 4AHZA 4QMAA 1PK6B 5A70A 2YZ4A 4B3NA 4I0WB 5ERLA 1AR61 4HVQA 3J8F2 3OBTA 5F37A 4LT5A 3OEBA 1ZM1A 4P5HA 5KHJA 2XVKA 3ZMNA 2ARAA 1R1ZA 2GNBA 1RIRA 3GBGA 2VZQA 4S2FA 4XFFA 4A6SA 3K2OA 5C8CA 2R16A 2WA4A 1S0DA 3AKQA 4XF4A 5FY1A 4BK5A 3VV1A 3B3QE 1GNYA 1NA1A 2V73A 4HK9A 5L9VA 1AYN1 2IUWA 2D3RA 4LO8A 4JGZC 1J83A 4N9HA 2C5DA 2RMU1 2FDHA 2SLIA 2UWBA 1V6NA 1ND2C 4UAPA 3GCWA 3PJYA 1SEFA 3LA7A 3SISA 3GZUC 2OA2A 2QQKA 4FTSA 2HWE1 2XB6C 4A7ZA 1ASJ3 3N9LA 5F32A 4QPIC 1W8NA 3VBSB 4W6WA 4D0QA 5DUWA 1W6NB 3O1UA 1GWMA 1RUD2 3OSDA 4Y24A 4QDQA 2DVAA 5GLVA 4JRAA 2JDZA 4FPEA 2PLV3 3WQ7A 1VBC1 4QKNA 4LORA 1HRV2 3ZM8A 3MHZA 3MFCA 3RJRA 5CFCC 1CZSA 5C6CA 1F5JA 5KR7A 4R9BA 4BB3A 2OUJA 1JZ8A 2PXJA 4AVVA 5C3OA 2EAKA 1F5FA 1LHVA 1RMU1 3FN9A 5E89A 5A32A 5IHRA 1G9DA 4L8QA 4CE8A 4ZKTB 2XDVA 5H9SA 3HMYA 1LHWA 4LHKA 2GDFA 2E9QA 5CIRA 3VBOC 3R4UA 3Q9OA 2GNMA 1W03A 2F4PA 4YM1A 5ACA1 1RUE3 5LA9A 1L7LA 4DUXA 1UPIA 1J3QA 1YWKA 1QH6A 3PVOA 5L73A 4CCOA 1S4CA 4MOAA 4BQ2A 3ZPOA 2Y26A 1QDOA 3AXDA 3KV5A 4NIAA 3OUJA 1H4GA 2IXIA 3O1PA 4BLIA 5FXWA 3RPQA 1QJY1 4Q0PA 5F3GA 3T0BA 2DVGA 3IWZA 1LRHA 1XB9A 3AZYA 3BIWE 3ZN6A 1IG3A 3ILNA 4AFDA 4UOJA 2Q0AA 1VRH3 4JQRA 4QD2A 4I0AA 5FYVA 1C4RA 2Y38A 3PUQA 2A71A 1AR72 1AL23 1BEV3 1V6MA 5D2AA 1W28A 3WW4A 1PGW1 5GZDA 3QH7A 1PK6C 2ZJCA 4YSFA 1GP5A 3DPRC 3JQXA 1JUHA 4LBQA 1YRZA 3UJOA 4D3WA 1CN1A 2HWB2 1VALA 5ANNA 3RJ2X 2W0XA 3ZR6A 2OZ6A 3BALA 1XSRA 5FPBA 3DKQA 2QQIA 3OBZA 4Y4YA 4I30A 3GJAA 2DYCA 3M3IA 3OYWB 2YFUA 4HBNA 1KDMA 1O3QA 5G05L 1DYOA 3DN7A 5FZ7A 5GALA 4YW7A 4Q4Y2 4F7ZA 1MEC2 3V65A 1FT9A 3MV11 4KWKA 2AZ5A 2R7EB 1AUYA 1NLSA 3POWA 3WXPA 1JYCA 3ITQA 1T6GC 4UFLA 5CBLA 5AFBA 2NM1A 3JBG1 4Y20B 1PIV2 2ETEA 5GM0A 1ULFA 4XAAA 5FCCA 3HN1A 5LEKA 3Q8AA 2A6WA 4LOTA 4Q1PA 3O1MA 2RJ2A 4YW3A 4IV3B 4XUPA 4FAHA 4R4XA 2YG0A 1RUG3 4YG3A 3UNPA 5JR2A 3UGGA 3ZXAC 5JPMB 3AJYA 4BXFA 1UYPA 3HN3A 2P37A 2LS6A 2WABA 3KGLA 1Y7BA 2VCMA 1J84A 1H30A 5DDJ2 4QAWA 5IWFA 3M3CA 2WN2A 1ZBA2 4N53B 1DQ5A
chains in the Genus database with same CATH topology
5BV6A 2YROA 3JB4C 2DVBA 2VNRA 3NO8A 1WLDA 1N1SA 4EWAA 3NSTA 4WZFA 1AHSA 2GH2A 3JD71 3RWNA 4KGGA 4M3CE 3USUB 4MH0E 3IPVA 4ZU5A 1CR7A 3HBZA 4L11A 3POSA 3FLPA 2DUQA 1AJKA 1KXGA 1AYN3 2ZABA 1EAH1 1KDKA 3D4KA 1C8M3 4XE9A 1EYBA 2WNUA 4HSLA 2HEWF 1G9BA 1FMD3 2NZ9A 3AP6A 4XETA 5E16A 2D6LX 2RS12 2V09A 5KHGA 3SXWA 3M7AA 2CGOA 4RQPA 3AFKA 3GZAA 3W59A 1WCDJ 1POV0 2WINB 3M4FA 4K3UA 4Q29A 3WDVA 4YGBA 1DQ1A 1VB2A 3JCIA 4ZXKA 1UU6A 3NJZA 5J96B 1H8VA 1WMFA 2RM22 5FQ0A 2CTVA 1GZWA 1VBC3 1CAVB 1DGRA 4H55A 4FQ4A 4B8EA 2RJLA 4BQ1A 4Q27A 4LE3A 1RMU3 4AYUA 1LOFA 4CEWA 2VULA 2MPFA 4BH9A 1LODA 5JR7B 4UW3A 2PELA 4Q4V2 1O5LA 2HWD1 2QFEA 1DQ4A 1WW7A 3WG1A 1CAXA 2Q1ZB 3T1MA 5HI0A 1NCQB 1A78A 2EXIA 3EQEA 1DZTA 4Y22A 5BY5A 3K48A 3O7OA 3WHTA 1WCKA 3CJIB 3FBYA 3AYEA 4FPJA 2XKOA 2B46X 2HKXA 4LTAA 3R4DB 1MS3A 1OA4A 4LBLA 4N53C 5L7OA 3OTFA 5C4WB 3N4MA 4CDUB 5BXXA 4IV1C 1W0PA 3B02A 3KS7A 2JG8B 2BPA2 3AB0A 1ND2A 1R091 1UU5A 3AKRA 4NWVA 2VQAA 3PVBB 3QD6A 2P3JA 1KS4A 5IT6A 1CAWB 5JZGB 4X6RB 3ZFEB 4AHWA 1RUH3 2UY8A 4QGNA 5L36A 4MUVA 3SCGA 1PVC3 1OKQA 2PLV2 3N7MA 1REFA 3MF6A 2R042 3J8F1 3WP6A 1W6OA 4XJWA 3NAPB 5K7PA 2VMHA 4QPYA 3QACA 4JGYB 3ENRA 4YLZA 2EXKA 3JBG3 1MR5A 2IWGB 3L2HA 4SLIA 4C90A 4I2OA 1LOBA 1IGOA 3OJBA 4WVMB 1WA4A 4RSUA 1WMDA 1HKDA 3DKWA 5E8AA 2VOKA 3WW1A 3E6BA 1RJ8A 3VBOA 1C1FA 2WZPP 2CGNA 1SLTA 4IEWA 1NYWA 2ZGSA 3VZOA 4AI8A 3B01A 1TME2 4XBLA 4GWNA 3AJZA 4YVWB 3KZ4C 4IXLA 3FWEA 1LECA 2D6KA 2A73B 2CGPA 1RUD1 2OUHA 3NW4A 4L99A 4XTPA 4Q8KA 1OFNA 4AI3A 1RHI1 2BVBA 5CFDC 2K9ZA 1YLLA 1FPN3 2D5FA 2VW0A 4LA2A 4KGQA 1IOAA 2MEV3 4W65A 2CAUA 3JD73 1HRV1 4YVSC 5KC6A 1AVBA 4LO4B 4QM9A 1YJKA 5BUVA 1IPJA 1FYUA 3MPPG 2YY1A 2GMPA 2NLRA 2XJSA 2BGCA 1CX4A 2YYOA 3TWIA 3MIHA 4JC1A 4E4ZA 2WNVA 1PK6A 3U07A 1EAH3 3ZXJA 3CJIC 1PO11 3ZXGA 5CADA 3RYRA 4WBBA 2B9UA 1G8WA 4JVAA 1SLBA 2NMOA 2QVSB 4B4QA 4F3JA 4CDUC 3ZIWA 5I8SA 2CWMA 5GLZA 3CL1A 3VBFA 4AEMA 3IN9A 3ZXLA 4XZPA 4LULA 4DZGA 3ZXDA 2JG8C 4ES9A 4I01A 2K0GA 1BQPA 2VQ0A 4QPGB 4AI2A 5JZGC 2XL7A 3WUCA 2A6YA 3I59B 4XF3A 4FQZA 3ZFEC 3AZXA 1R1A3 1AR71 4Z8BA 3TB0A 5T5JA 1NLRA 1G7YA 4UW6A 3VBSA 3H1MA 1W6NA 4EN9B 4D7SA 2BNOA 3CLPA 3U4XA 2P3IA 2VVEA 3NAPC 4WM8A 2ES3A 1RUJ3 1N1TA 1REDA 3WW2A 4I0BA 5KHKA 2JD4A 1RVF3 3WW3A 1FAYA 3X29B 1ZZCA 2ENRA 4Q4Y1 2R6QA 2Q1MA 2R30A 4FP3A 2C0ZA 3H8UA 1VAVA 4HN1A 4XFHA 4XFCA 1PIV1 3MW4A 1H8TB 3CEWA 4YNIA 1MS0A 1GNHA 2DU1A 5H9QA 5I8TA 1CAUB 1PGSA 1BYHA 1RUF2 2TUNA 4NWWA 3MICA 1C8M2 2KXLA 4HLTA 5FREA 4KBBA 4AK3A 1UN1A 5FBZA 1DQ6A 1FV2A 2XL9A 2AUYA 2GMMA 1RJ7A 3ZN4A 3FC0A 1POV1 2QNKA 4YM0A 5DDJ1 3TNPB 1ZBA1 1X33A 4GIQA 1VBB2 5BPXA 2N7GA 2B5HA 3FMGA 1N3PA 1NY72 3S7IA 4N43B 4CDXB 1XYNA 3B00A 3IDEA 2D43A 4FPGA 1GFF2 2LTNA 2WNEA 4P9XA 4N90A 5T5PA 3KT7A 1BMV2 2VOWA 1QDCA 5D8AB 3VBHB 1ZZ9A 3GF6A 2QZ2A 4GULA 3OYWA 2DF7A 5CA6A 4FXKB 4DB5A 3HD8B 2VGDA 3ZIXA 1J3PA 4DRRA 5ABJB 3LSEA 1QMJA 5FAXA 5JIUA 2B42B 4Y20A 4Z2WA 2RS11 3KGZA 1LGCA 3T2TA 2UURA 4LBMA 5L19A 4UW5A 1U12A 2JE7A 3IMNA 1OA3A 4IV3A 1QJX1 1RUD3 2RS52 2NYYA 1S55A 1OA2A 2RM21 1QOOA 2PHRA 4XF1A 2B7YA 1B35B 1PZ7A 4N53A 1MACA 1TQ5A 1UKGA 2Q5TA 1KFXL 2FZ1A 3ZYIB 4XFAA 1SACA 1C28A 4BM8A 2D40A 1OLQA 1RUH2 3LAGA 1W39A 2O8OA 5GJ6A 1Q8QA 4Q4V1 3ZXEA 4XTMA 3ILFA 1PVC2 1VP6A 4LHNA 2G9FA 3LA2A 2IXCA 5KHJA 1BKZA 3USUA 2PTMA 4V1PA 2DV9A 2YPJA 3FBMA 4PDWC 3P3NA 2JENA 1O4ZA 3OCPA 4TWTA 2YXSA 1MS5A 3M1HA 4IEXA 3TNQA 5AVPA 3FLTA 5BNOB 4PIZA 1QJZA 1OD5A 4C1XA 4Z1VA 4AFMA 4GA9A 4OHWA 3OPZA 2I45A 1WUVA 1HV0A 4Q26A 1JTZX 3WP4A 4UBGA 3SHRA 1ASJ1 3H0OA 4LLOA 2HWB3 3IIAA 1DU3D 1NCRC 4JDNA 2VOXA 4BHPA 1F8VA 2FQPA 1CAVA 1O4YA 4LO6B 2XH6A 1ND3B 1FPN2 4IETA 2PLV1 2ZACA 2MEV2 1MEC3 5J48A 2R041 4DQAA 1M06G 1IPKA 4ISRA 1UZZA 5FPZA 4R9AA 5ABJC 1PIV3 5KHHA 1DBNA 1AX1A 1YHFA 5SV5A 5JLVA 4W6YA 2YGLA 2IFWA 2W68A 3VHNA 1JYIA 1RUE1 1NCQA 3PLQA 4U36A 1A8DA 4URTA 4XOGA 1PNGA 3V56A 3AMPA 4AXOA 2R0HA 3CJIA 4JDMA 1Q8VA 5DDJ3 4PLMA 4XQDA 1ZBA3 5T54A 1TME1 5KWRA 1B35C 4JGZB 5EYYA 5C4WA 5SV8A 4CDUA 1M4WA 1QKQA 1VRH1 4XIOA 2GNTA 1MQTC 5T5OA 4QPIB 3BOWA 2JG8A 2PHUA 3ACLA 3MW2A 2JXAA 3IT8A 1ZX5A 1R1A2 3WDTA 1GR3A 1YXWA 1CAWA 1AJOA 1VBD2 2VNOA 3ZFEA 1C5HA 4GH4C 2GC2A 5GZEA 3VBRB 1ENRA 2GC1A 1RUJ2 5CFCB 4ZU7A 1SFNA 1ZBE2 2ZHLA 4XPVA 3ZDSA 4C0HA 4GWMA 3NAPA 4JGYA 1L3JA 1UX6A 3ALQA 3ROUA 3ZFGC 5IK5A 2EIGA 2RS13 1ULEA 2O0OA 2UY9A 3V64A 4WVMA 1OQ1A 2XHKA 1W6MA 4OHZA 1UD1A 1N47A 1LGNA 1RUI3 1H1IA 2WC2A 4MXVA 4BPZA 1IS4A 4QQ2A 4RA0A 3I7DA 1RITA 1YJLA 3K51A 2PHTA 3VDDC 1PM7A 3M3EA 1ZA4A 4YVWA 4L2NA 2JJ6A 1W2UA 3O0VA 2A75A 1N3OA 3MLLA 3WG3A 2VECA 4OHXA 1DGWA 1MVQA 4G4FA 2WLPA 5BNPB 1S0EA 1S0CA 1J1TA 1WLTA 3FHIB 4K7JA 2QZ3A 4Q4V3 4MGZE 4QHBA 3VKLA 5KXBA 3ZSMA 1KS5A 3DPRB 4RFT0 2BWCA 4FOWA 1QJU2 4HVRA 2UWAA 4LR4A 2C1FA 2CL2A 1HV1A 2PAEA 1OFSA 4PQ9A 5CG8A 2XJQA 3AKPA 3D0JA 5LRSA 2A5ZA 1RUF1 1BVVA 1C8M1 2QQPA 1F9KA 3HT2A 4FOQA 1FMD1 3PMSA 5FO8B 3PJQA 1GV9A 4DXZA 1VBB1 4CZSA 2DVFA 2ZMLA 3C3VA 1Z7S3 1PZ8A 4QPGA 2R072 2PQQA 4AVCA 3I59A 1CJPA 3R05A 2B8MA 2R043 3VBRC 4G3YC 3H7JA 5J37A 3DL3A 1ULCA 4UW4A 1BMV1 4WM7B 4IEQA 1COV2 2PAKA 3VHRA 4WVVA 2IFRA 5JDBA 1RUC2 2GSYA 2XLFA 2Q4SA 2Y0OA 2ARBA 5J36A 1GQGA 4KWJA 3JQWA 1N3QA 2XLGA 3BOPA 5DUXA 5JWPA 5A33B 2CNAA 4KG8A 4XQWA 1H9PA 2K2SA 3M70A 1QH7A 3RG0A 1TME3 4K1ZA 4Q8LA 1H8TA 5FPXA 3CU7A 1XU2A 3R4SA 1CAUA 4LBQD 2ZHNA 4P9IA 2RS51 1SCRA 1RTVA 1HRI2 4TYSA 1JXNA 2I2SA 2XGXA 3ATGA 2H0BA 1X7NA 2TBVA 4ES8A 5BNPC 4NR1A 4EROA 1JH5A 5B2GB 1GZCA 1LU2A 2RS33 3B93A 2GU9A 3VKFC 1UW8A 2Z79A 5GZGA 4CDXA 4N43A 2VVFA 3BTAA 4HL0A 1YIFA 4FCAA 1RUH1 3BCWA 4M0NA 4TSVA 1YI9A 5HCAA 1PVC1 3WD5A 3WP5A 3VBUC 1MZ5A 3RS6A 3AMHA 4JDOA 4FPOB 2WJSA 5D8AA 3VBHA 2A6XA 4O9EA 2D3PA 3G6JB 4A7YA 4DINB 5I0UA 1A6CA 1VBA2 4F8AA 2XJPA 1GQHA 1PVXA 3ILRA 4LO7A 2VNGA 4LBJA 3RZZA 2ZX2A 5HCFA 3MGUA 5ABJA 4LA3A 3UV9A 1IS5A 4H7MA 2WWSA 3V0BB 1R082 1BXHA 3AP9A 4WZCA 4MSVA 1LU1A 4E2GA 1NG0A 3LB9A 4Z82A 4CRQA 4YGDA 1UIJA 2ZA9A 3MIBA 5DUUA 1LB2A 4IV1B 4OHYA 3ZVXA 2BTVC 4OUMA 5CU1A 4WM7C 2NP0A 5KXDA 4BCUA 3FLRA 3JZVA 1B35A 3VKOA 1FOD2 2DU0A 1FPN1 2VXRA 5I0SA 2MEV1 3TAYA 2VH9A 3CF6E 3KT1A 2BNMA 4CDWB 2XUMA 4HKWA 3SMHA 1IZ3A 1DZRA 2A70A 5K0UB 2W08A 4A7KA 5GLWA 1RUF3 1IS6A 4ORFA 4AE2A 4LBOA 4S2GA 4AQ2A 2EXJA 5DXDA 4OI1A 4YARA 4XJAA 3IDCB 3OBRA 4L97A 3E5XA 3HT1A 1O91A 1AYM2 3HAGA 5HCBA 1RL3A 1X50A 2PHDA 1VBB3 4YZ1A 4B4PA 5BNOA 4HSJA 4M0HA 3VKMA 1PGL2 5T50A 3EJKA 5IK8A 1YIPA 1RUI2 3LOIA 4Y1UA 2D6PA 4X8PA 3MF9A 4WVWA 2RR13 3OF1A 5K8SA 1O5UA 4XIKA 4IEVA 4YW2A 3TN92 2YUEA 4PBOA 1R1A1 1ZYBA 3FZ3A 3TYJA 1U5YA 3A0NA 1S2KA 4C1WA 5F1RA 2IXLA 2JG9A 1VBD1 5CFDB 1RB8G 3WOGA 2BWAA 2RHPA 1WD3A 4AHYA 1O3RA 3B69A 4HZFA 4LBKA 5I8YA 4YVSB 2XJVA 1HLCA 1MVEA 4Y1XA 3ME2A 1ND3A 1RUJ1 1LHNA 4LO5B 1ZBE1 5FO7B 1VAKA 1RVF1 4FSJA 2UYBA 4NHKA 4OHVA 1W6QB 2W39A 5FLIA 3J26N 5CNAA 2IXHA 5HXVA 1UCXA 3TOJA 3AZZA 4LLFA 4P9GA 1Y9QA 3ASIA 2YMZA 4PLOA 2XJTA 1ZZ6A 4IL7A 2RS53 3AMNA 3ZYJB 1AR92 2WIIB 4JGZA 3OY8B 4BIFA 4Q1RA 2BEOA 1NOVA 2BQPA 3FFZA 1VR3A 1AR83 1C57A 3B5LB 3CJXA 1VLNA 1Z7S2 2DCJA 4CDWC 2LUWA 3M8LA 1KFUL 4QPIA 2X5IB 4P9JA 1PHMA 4MZUA 4EWEA 5FLHA 5K0UC 1HDKA 4IEPA 2HEYF 4HFSA 2ZMNA 1QJU1 5IK7A 5GLTA 2A6VA 1JHNA 2TNFA 2B45X 3KSCA 1LTEA 3OGGA 4NOTA 3VBRA 5CFCA 1HQWA 4QGMA 3VZNA 2JKBA 1PNFA 1D4M2 1FXZA 1OMIA 5T52A 2PHXA 1CD3G 2WFF2 3AZVA 3VL8A 4R52A 1E57A 4COZA 3A4UA 5H9RA 1XXNA 5JVVA 3DV8A 3MYXA 4RR3B 4EV0A 2ZX3A 4L92A 1GICA 1EP0A 2HEVF 4UBHA 4E4SA 1HIXA 5EZWA 3RRDA 3ZFFB 1CESA 2VMIA 4W6XA 3AXEA 1WBFA 4X8NA 1H2NA 3GBWA 1KJLA 4UXAA 1MZEA 1SLIA 3LZZA 4XFGA 5J3UA 5CVRA 3AYDA 2DVDA 1COV1 4FP2A 2RS32 4R9DA 4QQOA 5BNPA 2GALA 2GC3A 1RUC1 4IESA 4ISQA 5CG9A 4J1XA 1ZZBA 1MS9A 3DPRA 1YI7A 4JAAA 2WZR2 3WDUA 2XVGA 1XNBA 5EYXA 4XQ4A 1YFYA 4P14A 1JBCA 2EF6A 4HKLA 5BNNC 3J4UH 2ZHKA 3VN4A 3USSA 5T3NA 1LOEA 1DZQA 3FUQA 3WHUA 1HRI1 1WD4A 3ZN5A 1V00A 4FTBA 5JSPA 1OLRA 5H9PA 2BFUS 2X5IC 4XILA 1ZNPA 1VBD3 1VBE2 2AR6A 1D2QA 1W0OA 1XQNA 2HWB1 1YUDA 4F83A 2DFCA 4XJ9A 2XJRA 2VW1A 1ZBE3 2O8QA 3VZMA 4QQHA 1LGBA 1UMZA 1QU0A 4RGAA 5F9TA 1SDWA 1AX2A 3QBQA 3ZYGA 3D82A 1K5MC 2DURA 4WM7A 1MEC1 3O0WA 2XJUA 4OZXA 5I0TA 4YM3A 4J1WA 3UKTA 4DFSA 5A3MA 1AX0A 2I07B 1RGSA 1VJ2A 1XU1A 3JB8A 3WLUA 2Z5WA 2OYZA 4RR3C 4BYYA 3MEPA 5JOZA 2QDRA 2KA3A 1ZVFA 5A33A 4PDWB 3ZFFC 4I09A 5BNQA 3HQXA 1H4HA 1R081 1VAMA 3RMYA 4COVA 1QXPA 2C9AA 1C3HA 3H9AA 5E1RA 3CO2A 2R1BA 1ZRFA 3GHNA 3AMMA 3H1WA 3RSJA 5DZEA 1UL9A 4XMAA 1OPOA 4FT8A 1TMF3 4COYA 2A3YA 1S1AA 4KG0A 3NV3A 4JCKA 4A2UA 1FOD1 2RR12 3ZN6B 2PFWA 2RMU2 5JIAA 2XBO2 1QJU3 1NCRB 1I5ZA 5DZFA 5LRRA 4B29A 3HWJA 2WA3A 3FJSA 4O9GA 3GBFA 1I6XA 3JUUA 2VUAA 4XDQA 4C91A 1RUOA 1S0JA 4AQ6A 1D4VB 5FOBB 2E63A 2EALA 1SLLA 2ZGLA 2BYVE 2ZAHA 1AXZA 5KXEA 4M00A 3ZYPA 3PVNA 5C8CC 4RS5B 1AYM1 2R062 4DPNA 4ONUA 2ZX1A 1PGL1 2R073 4A3XA 1Q5OA 1RUI1 2IXJA 4YM2A 4ATEA 3V0BA 3GNEA 2AH2A 5EXOA 2IXKA 4RGGA 1DGWX 2D97A 3TN91 3H3ZA 3QH6A 3TRSB 4NPRA 3ZX7A 3D8CA 1Y43B 1COV3 4IV1A 4GMP0 3KQRA 1MQTB 1AR82 5J98B 1RUC3 1DHKB 1QJY2 3AX4A 4AQSA 4BMEA 1I9RA 3AP5A 4OFGA 5AC92 5GKAC 1BZWA 5GLUA 5FOJB 4XXPA 3AMQA 4MGYE 2BVVA 2ZCWA 2QCSB 4CDWA 2SBAA 3L9JT 4GH4B 1JN2P 4AGRA 1RUNA 2CAVA 5GZFA 5K0UA 1ALYA 2GN7A 3FFQA 3GZTB 4FOYA 3WQ1A 1YO8A 1HRI3 2A7AA 3ZFGB 4XBQA 1QXJA 4MYEA 1AR91 1LENA 3SCFA 3EBRA 3L2YA 1FNYA 1S0IA 1WCSA 1SBDA 1EV12 2A3WA 3WVJA 1UKRA 5TSWA 4K9SA 4DY5A 1Z7S1 1CIWA 4SBVA 3VDDB 3IKWA 3ZPYA 1G9AA 3EO6A 2BW8A 3FE5A 3UKVA 3BB6A 4QU2A 4MLOA 1DF0A 1HW5A 1ZRDA 5FQ0B 2XPJA 1LJ7A 4M3CB 5CFDA 5FMOS 1XE8A 4YVSA 1Q8SA 1VBA3 2GN3A 1WGPA 4RS5C 1BCXA 4AI0A 1V6KA 2JEMA 1D4M1 2R0FA 5JSOA 2ZGQA 3WINE 1ZRCA 1KJRA 2WFF1 4CEWB 2PN5A 2P17A 2GAUA 4XJZA 3WR0A 1SMVA 4AFCA 2BBVA 4Q4X2 2B39A 2VVDA 1R083 2D93A 2G9GA 2R32A 5C33A 5JSRA 1H2MA 3NV4A 1H1MA 5DZGA 1WBLA 3GALA 1NQJA 1O7FA 3NWKA 1YYNA 1DIWA 1LKNA 4I3GA 1RC6A 1GNZA 2ZMKA 2VY0A 5D1IA 4EN8B 3SH3A 1FOD3 1H0BA 4XF9A 3B9CA 4MGKE 3WT3A 3NKGA 4QT6A 1XE7A 3KT4A 3OY8A 1DLLA 2ZGRA 5L7OB 1U5XA 2GMEA 2ILMA 5JZGA 2Z42A 5K9YA 3RYKA 1FX5A 1SBEA 2D3SA 2RS31 3DGTA 5IUQA 3OD0A 5I91A 4MXWB 2X5IA 3MIDA 3EXUA 2CYFA 1U5IA 4YZ5A 2WZR1 2XLAA 1J58A 2ZTNA 4XHBA 2DCTA 4AG4A 4E2QA 1ONAA 4YW1A 3WCSA 4FVVA 4GB32 2OPKA 1WMEA 4CEYB 1AYM3 4E27A 1MZ6A