1YWPA

Phospholipase cgamma1 sh3
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
62
structure length
62
Chain Sequence
b'SPTFKSAVKALFDYKAQREDELTFTKSAIIQNVEKQDGGWWRGDYGGKKQLWFPSNYVEEMI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase ga
publication title Structural Basis for Recognition of the T Cell Adaptor Protein SLP-76 by the SH3 Domain of Phospholipase Cgamma1
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 13
structure length 62
sequence length 62
ec nomenclature ec 3.1.4.11: Phosphoinositide phospholipase C.
pdb deposition date 2005-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ywpA00
1U3OA 2I0NA 4HVVA 1SSHA 2FO0A 3IQLA 2O9VA 1YP5A 2KRNA 5IHNA 2KEAA 3VS5A 1X27A 1I07A 2LMJA 1U5SA 1ZBJA 5FWCA 1GFDA 2BZ8A 2C0OA 4F16A 3H41A 2RMOA 2DJQA 2B86A 2J6OA 2LQNA 4J9DA 2CH4A 3PVLA 4M4ZA 2AZVA 2RQWA 1AVZC 2JXBA 1MUZA 2KXCA 1AWWA 2L3PA 2NWMA 1UHFA 1GFCA 4CC2A 1OEBA 1IO6A 1E6GA 1ABOA 1QKWA 1CKBA 3TSWA 2JM9A 5IXBA 1PWTA 2DYBA 2J05A 1X69A 2EBPA 4OMQA 1JQQA 1AZEA 1EFNA 2W0ZA 4RTYA 1K1ZA 1XOVA 2OI3A 2EW3A 2FPFA 2FRWA 3FJ5A 1AWJA 3VRYA 2FEIA 1SPKA 4CC7A 4J9CA 4Z88A 1CKAA 2EVRA 1FMKA 1SRMA 2DA9A 1M30A 2VVKA 1W70A 3I9QA 2DNUA 1WDXA 4CC3A 2RQVA 2YUOA 1WA7A 2M0YA 2DRKA 1E6HA 1QKXA 4D8KA 1T3SA 2RQRA 2J6FA 2JTEA 4CC4B 3ZL7C 2LZ6B 1GL5A 1RUWA 4ZNXA 3VRZA 1SHGA 2D8HA 2OAWA 1K9AA 4JZ4A 1PKSA 2C0IA 2PTKA 3EG3A 4AFSC 1UG1A 2ENMA 5IXFA 2DLPA 2MIOA 1W6XA 1JXOA 1YCSB 1TUCA 1H92A 1UECA 2RF0A 1T0JA 1WI7A 3TSZA 2CUBA 2GGRA 1QWFA 3JV3A 1ZUYA 2LCSA 5GJVB 1I0CA 1RLQC 1X2KA 4EIKA 2BTTA 4AG1C 2RPNA 5GJWB 1WLPB 1BK2A 3I5SA 4IIMA 3NGPA 2KYBA 3M0SA 1Z9ZA 2LQWA 1UJYA 1M27C 2DILA 1GCQC 3SHWA 1AZGB 4LNPA 2YDLA 3UA7A 2AK5A 2JT4A 2CSIA 2RQTA 1T0HA 3VS0A 4F14A 1YWPA 4IIOA 2RQUA 1J3TA 4JZ3A 2DX1A 1LCKA 2EGAA 1UE9A 1PRMC 1UDLA 1BBZA 3SEMA 2KE9A 4J9GA 4HCKA 2O9SA 2HBWA 2H8HA 4DEYA 3NPFA 1M3AA 3EHQA 2F2WA 1M8MA 1X2QA 4R0KA 2YUNA 4OMMA 1X43A 5I11A 2EYZA 2ROTA 4X1VA 2D8JA 3NMZC 1E7OA 3M0RA 2LX7A 1BU1A 2J7IA 1S1NA 2O31A 1NM7A 1QLYA 5HCKA 1SEMA 1PKTA 3H0HA 2G6FX 2YUPA 3VS1A 1JXMA 4GLMA 2AZSA 4KRTA 2JS0A 2F2XA 1JEGA 1QWEA 3KFVA 3I5RA 2LP5A 3GBQA 4HXJA 1Y0MA 2KT1A 2RNAA 4D8DA 2V1RA 1NEGA 2D0NA 1HSQA 2KBTA 1K0XA 2FPEA 3EG1A 1NEBA 4JPBW 3TVTA 1VYVA 1A0NB 1MV0B 4QT7A 1ZLMA 1VYTA 4AG2C 2C0TA 2A08A 2JMAA 2K3BA 1RLPC 1KFZA 1HD3A 2OJ2A 2AKKA 2L2PA 3H0IA 1H8KA 3R6NA 1X6GA 1UGVA 1OPLA 2DL5A 5IHIA 3VS7A 2EGEA 2L3SA 2A36A 4J9FA 5FWBA 1NYFA 2J6KA 2P4RA 2M51A 4RUGA 1GBRA 2D1XA 2O88A 1Y57A 1AD5A 3VS4A 2MCNA 3PE0A 1YWOA 3REAB 2EQIA 2YUQA 2ED1A 1WIEA 4RTXA 2A37A 1PRLC 3PVQA 1HJDA 5FW9A 2X3WD 4Y92A 2HCKA 1KSWA 3ULRB 2DRMA 5IH2A 3M0QA 2EPDA 2F2VA 2JW4A 2KRMA 5I22A 1B07A 1UHCA 1K0SA 1G83A 4RTUA 4J9IA 4RTVA 4OMLA 1U06A 2DE0X 2JMCA 2ED0A 1GRIA 2BZXA 4HVWA 4J9BA 2FRYA 3UATA 3QWXX 1SHFA 2LNHB 3I35A 3QWYA 2DL4A 2DBMA 1CSKA 3VS3A 3UF4A 2AKLA 1TUDA 2ESWA 2PZ1A 1OV3A 1VA7A 2CT3A 2YSQA 2PNIA 2BZYA 2J06A 2HSPA 4Z89A 1Z9QA 2DL8A 4RTWA 2GBQA 1KIKA 4RTZA 1K76A 1OOTA 3UA6A 1W1FA 3EGUA 4E6RA 1X6BA 2KROA 4J9EA 1V1CA 1KJWA 4DEXA 2HDAA 2KT8A 4ORZA 1VYUA 2GQIA 1I1JA 2QDLA 1M3BA 1ZSGA 3LH5A 4LE9A 2KR3A 2RN8A 2SEMA 4GBQA 2K7AA 1RI9A 2DL7A 2EGCA 2EYWA 1NLOC 1T3LA 1WX6A 2FG0A 3M0UA 1H3HA 1K4US 2K9GA 3A98A 4ESRA 2XMFA 2GNCA 3NHNA 4AFQC 2KYMA 2K79A 2HEQA 5IHKA 1AOJA 1WXBA 2L0AA 2ABLA 2LJ3A 1ZUUA 1AWXA 2ROLA 1PHTA 4JJDA 3RNJA 2LJ0A 1BB9A 1ZX6A 4LN2A 4K11A 3VS2A 4AFUC 5EC7A 3U23A 4A63B 4JJBA 2CSQA 4LUDA 1ZUKA 2SRCA 5L23A 1B3QA 3C0CA 1OPKA 4AFZC 2IIMA 4OMNA 4J9HA 4HVUA 1QCFA 3EG2A 1UTIA 1YNZA 2DL3A 1YN8A 4OMPA 2KRSA 2DVJA 3EG0A 1GBQA 2VKNA 1M3CA 2K2MA 2DBKA 3VS6A 2KGTA 2CREA 2VWFA 1GCPA 2EYXA 4RTTA 2DM1A 3THKA 1ARKA 1WXTA 3M0PA 2CDTA 4FSSA 3REBB 1AEYA 2DMOA 4OMOA 1UUEA 1WYXA 2X3XD 3EHRA 2E5KA 1UFFA 4Z8AA 1UJ0A 4F17A 2L3QA 2A28A 1FYNA 2LJ1A 3RBBB 1SRLA 1NG2A 2V1QA 5ECAA 2W10A 4JJCA 1WFWA 2NUZA 3CQTA 1NLPC 1JO8A 2CT4A 3M0TA 1N5ZA 4LUEA 2JM8A 2GTJA 2KNBB 2CH4W 2JS2A 3H0FA 1G2BA 2DF6A 1JU5C 2GTOA 2KXDA 1ABQA 2FPDA 3O5ZA 1PNJA 2O2OA 1WXUA 2CUDA 4WCIA 2YT6A 2EKHA 1GCQA 1MV3A 2K6DA 1AWOA 2ECZA 1TG0A 1NYGA 2MOXA 2EYYA
chains in the Genus database with same CATH superfamily
1U3OA 3FC3A 4HVVA 1SSHA 4NOYA 3IQLA 3OBYA 5GAN4 1YP5A 2HL3A 1N27A 2KEAA 3OYYA 3X24B 2LMJA 2WACA 1GFDA 2BZ8A 1Q7YU 2C0OA 4ELYC 1RAEB 1KHCA 4N4GA 2J6OA 1WHHA 4C8QF 1KC8C 3OY9A 4J9DA 1ACMB 2OTJT 4M4ZA 5GMKh 2PUOB 2XDPA 1AVZC 2EQJA 2L3PA 5CK9A 1RAAB 4N0AC 2YLBA 3JB9D 1IO6A 3FRNA 4M77B 2M02A 2JM9A 2DYBA 3EFRA 3CC7T 1G5VA 2E12A 3CMAQ 3CC4Q 1AZEA 3EG9B 2JNGA 3FJ5A 1AWJA 2FEIA 3CC2T 5LJ3g 3J7AF 4FT2A 2DD5A 1K9MU 3S3MA 1FMKA 3A8HB 2VXFA 2HBPA 1U1SA 4BUGA 4FU6A 3A8GB 2QASA 2A0FB 1KK7A 4RCBA 3A8MB 2DEUA 2EKOA 2EAYA 4KUIA 1YJNA 4BE1A 4RCCA 4ELZC 1UGRB 1UGQB 1YHQQ 1RABB 3ZL7C 1GL5A 3VRZA 1VUBA 4N4HA 2E6ZA 4JJNK 5FRNA 5KYUA 3PIOA 4IUTA 4JZ4A 1PKSA 1MHNA 5HKCA 2C0IA 4EMKC 2E1HA 2E6NA 3V8KA 3WVDB 2ENMA 5AT1B 1Q86U 3OYJA 2QTXA 5GAOr 1TUCA 1H92A 1UECA 1IB8A 1T0JA 2HD0A 2V26A 2OTJQ 3QDRB 2H3JA 3DLMA 1I0CA 4E7HA 5C6SA 5LJ3j 4EIKA 2E4HA 4M7DA 4A4HA 2BTTA 1WLPB 1BK2A 3EGXB 5GMKl 3KXTA 3OBWA 3CC7Q 3BW1A 1UJYA 2DILA 3TQ7P 3SHWA 1AZGB 1PM3A 2YDLA 3JCMP 1VQOA 1MNDA 3UA7A 2CSIA 3JB9H 2X35A 4II1A 3CC2Q 1Q7YR 5CQYA 4BY6C 2RQUA 1M8VA 4AMCA 1IGUA 3OSVA 3LH0A 1UE9A 3HHTB 4IURA 2JOYA 4M78G 1PRMC 1LPLA 1D0ZA 1OQKA 3L2QA 3CCLT 3M54A 2EJGA 2EQUA 3EFOB 5A0GA 2WSEE 4E7SA 1YIJA 4XTWA 4Y91A 1ZQ1A 2NUPA 3RKWA 4OMMA 1X43A 4BE2A 1B34A 2JTMA 2EYZA 4NL3A 2ROTA 1O75A 1JJ2P 2D8JA 3OB9A 3I56T 4BI8B 1FMWA 1QVGA 2O31A 4DOWA 1QLYA 5HCKA 3OYLA 1PKTA 3H0HA 1C6VX 4GLMA 1M1GA 3HKSA 2JS0A 2AIRB 2L3RA 3FIFA 1JEGA 3MP6A 4M78C 2D6FA 1X6OA 5GMKj 3VU3C 2H3EB 1NPPA 4D8DA 2D0NA 4MMLA 1EZZB 1M2OA 2KBTA 4N0AA 2BUDA 1OU9A 4GLKA 1VQ6T 1Q86R 1A0NB 3QYGB 3M55A 2VGNA 1KD1U 5FU7B 1RLPC 1AT1B 3O8VA 3M57A 2LQKA 5DY9A 3MCAB 1JB0E 2L2PA 1UGVA 1H3ZA 1OPLA 4X9DA 2DL5A 3CCLQ 5IHIA 3VS7A 2EGEA 3RKYA 1JJ2A 3GP8A 2L3SA 3NTHA 4E47A 1VQ8T 2EFIA 1NYFA 5D6WA 2M51A 1D09B 2P0QA 2KK4A 3CCST 4M7DF 3LWHA 3VS4A 3I56Q 2IVWA 1VQKA 5GANh 1S72T 2X51A 1RI0A 1OZ2A 1WIEA 2NUTB 1PRLC 4EMKA 1KG1A 4JLIA 3QSUA 2X3WD 2PU9B 3G6ET 5GAN8 2EPDA 2F2VA 1ZSZB 2JW4A 1D1BA 3JSCA 5I22A 3SWNC 4E7LA 5GAOl 3D7SB 1K0SA 1G83A 1LNXA 2LQ8A 3G4ST 4RTUA 4RTVA 4OMLA 1U06A 2DE0X 2JMCA 2M1HA 2XHCA 3HPWA 5J26A 1K8AC 3QBYA 2DIQA 2FRYA 1VQ5A 2LCCA 2YXYA 5CKDA 2LNHB 3EGDA 3UPUA 1OZ3A 2DL4A 1VQ6Q 2EQMA 2CYZB 2KAFA 3OS5A 5HK0A 3CPWP 1TUDA 2MF2A 3DB3A 1OV3A 2YSQA 1M90C 4QQDA 2J06A 3CMET 4AT1B 3EH2A 2QI2A 3X26B 2LCLA 4E2FB 2COYA 2DL8A 4ZN1A 1KIKA 1V76A 2E70A 4QVCA 1W1FA 4F04B 1X6BA 4J9EA 1WHLA 4DEXA 1VQ8Q 3V7RA 1VYUA 1QVPA 2GQIA 4JDSA 1I1JA 2MWPA 2QDLA 1SKUB 1VQ7T 1RAGB 3DKMA 1ZSGA 2VC8A 1QVFP 3CCSQ 2SEMA 3OYIA 4YTLA 4ESRA 1S72Q 2XMFA 2GNCA 4Q5WA 1W2BP 2KYMA 3BDLA 4PJOA 1MMAA 4J6XA 1AOJA 2QA4A 1WXBA 1K73U 2E10A 3OYBA 2L0AA 4J6WA 3G6EQ 4ZTJA 1VQPA 4HCZA 3V7SA 1BB9A 2ZPBB 1ZX6A 4K11A 3VS2A 4AFUC 1N9SA 2E3HA 1ZA2B 3QJ6A 4A63B 3G4SQ 1KC8R 1ZUKA 2SRCA 4M78A 5GAMg 4M77D 5KYUB 4A53A 1LOJA 2RI5A 3EG2A 2DL3A 2LRQA 4OB3B 2VKNA 2NLUA 4XTXA 2DBKA 3VS6A 3X25B 2L89A 4RTTA 4BB7A 5GAN3 2RA2A 1UGSB 2DXUA 4OMOA 3CMEQ 1WYXA 1VQMA 3JB9G 2MI6A 4BD3A 4KGVB 4F17A 1C1AA 2LVMA 4VUBA 5GAN5 1WHGA 2LJ1A 3CCRT 2HAXA 1VQ7Q 1YJNT 1Q81U 3L2RA 1W2BA 3CQTA 1YJWA 2YLCA 1JO8A 3M0TA 2GTJA 2CH4W 3H0FA 3P8DA 3L42A 1K9MC 3M9QA 4FM4B 5GAMj 5DM7R 4MDWA 3OYAA 1WXUA 2HKNA 1SG5A 1GCQA 2HQEA 3QXEB 2CP6A 1NYGA 2NUPB 2C06A 2QG9B 4BDYA 3MO8A 2O9VA 1VQLA 1YI2A 2A7YA 1RL2A 1YCYA 3BDUA 2K5IA 3JCMb 1X27A 1Q86C 1I07A 1VQOT 3OYMA 4F16A 5FU6C 3HFNA 2AT1B 3ER0A 2VUBA 4XU3A 4ZTFA 3PVLA 1HXDA 1D0XA 3QYHB 4PJOF 1UHFA 1XQHA 4HA8A 1E6GA 3MJXA 2J05A 5I2MA 3CCRQ 1Q82U 4M7AF 2HQHA 2ZPFB 1VQ8A 2GF7A 1YJNQ 1YIJT 1EFNA 2W0ZA 4EMHA 2OI3A 2FPFA 4QVDA 1M1FA 1Y07A 2KDSA 3ME9A 3TREA 4M78F 4E7JA 4A4GA 2RHIA 3L2VA 4J9CA 1B7TA 1UGPB 5CR2A 3RERA 1W70A 3I9QA 2DNUA 3H8ZA 1WDXA 2LC4A 4CC3A 1UB4A 3JCMg 1QKXA 2RQRA 2KI7A 1RUWA 4M75B 3S3OA 4ZGEB 2KSSA 2XKOC 2OAWA 2D8HA 1Q81R 1M90U 3RR6A 1K9AA 5KCOA 3OW2P 2JZ2A 2RJFA 2RJEA 4DBFA 4ZGJB 1NZ9A 2RHXA 9ATCB 2K3YA 2DLPA 4LDXA 5C0MA 1V29B 1BI3A 1VQ4A 1VQOQ 3JCMV 3MHXA 2CGHA 4LD6A 5GANf 2RF0A 3HTRA 4V2SA 4LDWA 3TSZA 5FROA 2CUBA 3GLXA 3TU4K 2LCSA 3QKJA 4FW2A 3HRTA 1RLQC 2CZ6B 2RPNA 1R77A 2GFUA 4IIMA 4Y28E 1RADB 1R0BG 2KYBA 3NGPA 8AT1B 1Z9ZA 2P0KA 1FMVA 5GAMd 2JT4A 2Y90A 4KGXB 1T0HA 3P8HA 3VS0A 2WSFE 3RMSA 4F14A 3LWIA 1KD1C 4IIOA 1J3TA 3QHSA 2DX1A 2HSEB 2Y4XA 5KYYA 1VQKT 4KGZB 3OYGA 1BBZA 2QDYB 4HCKA 2BE9B 2O9SA 4JS4A 1NJIU 1NE8A 3NPFA 3EHQA 3OW2A 3META 2DKGA 4R0KA 2DEQA 3HP9A 3JAME 3JCMQ 3NMZC 5IAYA 2EWNA 3LYIA 4R56A 2LX7A 1OULA 1VQ5T 3PFSA 1SEMA 4C5IA 1K8AR 4PJOB 1HK9A 3GPLA 1RAHB 2OTLA 3C12A 5KCHA 3JRZA 4X9CA 4M7AB 2LP5A 5FRMA 4JUVA 4OMFB 2KT1A 1IGQA 4A54A 2V1RA 1M90R 5GAOq 2RJCA 5D6XA 2FPEA 3EG1A 3CPWS 4JPBW 3CCRA 4PKCC 1VYVA 3PIPA 4QT7A 4AG2C 2A08A 4JRKA 3R6OA 1MGQA 1KFZA 1RAIB 2OJ2A 4FYYB 4WF2A 3G71A 1VQKQ 3QZ5B 4J7FA 2DXCA 2XICA 1KQ1A 3AHUA 4HT9A 3CBOA 1QVFS 3PT9A 2QA4T 2A36A 2DYIA 2R58A 1VQPT 2J6KA 2LTOA 4C0DB 1QVGP 1YJ9T 5CCAA 2LNVA 1GBRA 1Y57A 4IUPA 3JCMJ 1XJWB 2CP7A 2EQIA 3OSSC 2MPXC 4J5YA 2KMTA 5GAN6 5LJ5e 1IXDA 1VQ5Q 4L59A 4UC4A 1HJDA 1K73C 5D6YA 2HCKA 3OA6A 4KH0B 1NJIR 4FYXB 3JCMd 1UHCA 2YWWA 4C92B 4HT8A 4DBRA 5KYNA 4MMKA 5DLOA 1VQMT 3OYFA 3SDZA 3P8BB 1GRIA 4J9BA 3UATA 2ZCFB 4HCBA 4EMGA 2GFAA 2RHUA 1TOVA 2I2LA 3T9NA 3PNWC 3OMCA 3UF4A 4R55A 1YJWT 4CRIA 2BZYA 5GAOp 4Z89A 2CKKA 1AHJB 1IZ6A 1K76A 3UA6A 4C8QB 1FXXA 3EGUA 4C0GA 1SSFA 2KROA 4OB0B 4BI3A 1K9MR 1VQ9Q 4QQGA 2QA4Q 2HDAA 4ORZA 1D1CA 1VQPQ 5GANe 3MPUB 3CEYA 1I8FA 3LH5A 1M2VA 1MNEA 1YJ9Q 1Q81C 2RN8A 4KUDK 2E3IA 2EYWA 2K7AA 2EGCA 2FG0A 1K4US 4M77C 3CXCP 2DETA 2X9HA 4PJLA 1X01A 2FZCB 4X34A 1VQLT 1YI2T 4LD9K 2RB6A 2HEQA 2RK2A 5CKHA 5IHKA 1TU0B 2DFUA 2FYKA 3PMIA 1ZA1B 3HL8A 1AWXA 4OVAA 4A4KA 2DXBA 1PHTA 3M5AA 4J6YA 4J8OA 2Z0WA 3U23A 1VQMQ 2CSQA 1WPYA 2MWOA 4HCCA 1JRIA 4OMNA 4HVUA 1LVKA 2DTOA 1KQSP 2XDDA 2DVJA 4EDUA 3EG0A 5LJ3f 2KGTA 2EYXA 1YJWQ 2DM1A 3A8LB 2PUKB 2DMOA 4QVZA 3M53A 4KULA 1UJ0A 2L5QA 4WTOB 5GAMh 2L3QA 3CXCA 1FYNA 4PNOA 3RBBB 4BI4A 1NG2A 2Y4YA 1Q82C 2W10A 4JJCA 2AHJB 1IREB 4M75D 4BE0A 3E9GA 3GNGA 1BIAA 1NPRA 5CKFA 2KNBB 2CP2A 4O6JA 3HSBA 1VQLQ 5KYYB 1YI2Q 4FIBA 1JU5C 2FPDA 1MMNA 3C94A 2O2OA 1VQ4T 4WCIA 2JUFA 2RM4A 1TG0A 2MOXA 2DK3A 3OW2S 1KQSA 1Y96A 3MEAA 2FO0A 2VXEA 4PJMA 4OGCA 2KRNA 1WHMA 4F7UE 5LJ5g 1U5SA 3KUFA 1TSFA 1QCOA 2B86A 2VB6A 3QUIA 2LQNA 3MEWA 3RESA 4JLGA 5GMKm 2RQWA 1I4K1 2JXBA 2KXCA 2RK1A 1AWWA 2NWMA 4L5GA 1KD1R 1GFCA 4LDUA 4CC2A 1ABOA 5IXBA 2YRCA 1X69A 1D0YA 2EBPA 1VQ9A 2K5FA 2G3RA 5CKBA 3GF5A 2EW3A 1M4ZA 2FRWA 4FL6A 3FDRA 1YJ9A 3VRYA 1SPKA 4CC7A 5I21A 4Z88A 4E7ZA 3M58A 2ZPEB 3CD6Q 2DZCA 3VV0A 2M0YA 5FU7C 4PJOD 1E6HA 1VQ4Q 3EG9A 1NJIC 2KY9A 1T3SA 1PD0A 3FJPA 5LJ5j 2J6FA 4XU1A 2OTLT 1I5LA 4M75E 3ZFJA 4ZNXA 4M7AD 1WQWA 3I55A 2BKDN 4DBQA 4O5VA 2PTKA 3EG3A 1WJQA 3RUXA 4M7DB 4IUUA 2FVUA 4OGEA 5IXFA 3E1SA 2RO0A 3NTKA 1YCSB 3QZ9B 4BACA 1O9SA 3JCMh 2F69A 1N8RC 5I2SA 4RKUE 1RAFB 2NYSA 1QWFA 2GGRA 3A8OB 3G71T 1OX9A 3HFOA 5GJWB 4L6V5 2EIFA 3EAEA 2HZYA 3M0SA 2LQWA 1M27C 1ZSZC 4LNPA 5CQXA 1P92A 5KYXA 3A5ZB 2FZGB 3VJPA 3J81E 1YWPA 2DAQA 1VIEA 4JZ3A 3S3NA 4QQ6A 1B34B 3J80E 2DIGA 4PFPA 2JN0A 3SWNA 3M56A 2KE9A 1QVGS 4DEYA 3BY7A 3CCJA 2CZ1B 4DQ2A 3L1AA 1M3AA 1ZBXA 5LJ3e 1WGSA 2F2WA 4A4FA 2JJ9A 2OTLQ 3G1JA 2QTVA 4RG8A 1K73R 4C92D 4X1VA 2E41A 1M5Q1 4XAXB 4NL2A 1Q95G 2J7IA 5J39A 4M77E 1C0MA 1S1NA 3CCMA 4P5NA 2G6FX 4KBMB 2YUPA 1JXMA 3N5BB 3L2ZA 5GAOm 1JBMA 1G3WA 2CP0A 5HY6A 2AZSA 2EQKA 2JVVA 2M0OA 2EJ9A 1QWEA 3G71Q 4C0FA 2PQWA 1LJOA 3I5RA 4HXJA 3WXMB 1PCXA 1VOMA 4C8QD 2E5QA 5CAIA 2RNAA 1YFNA 1NEGA 1HSQA 2K5LA 5LL6S 1K0XA 2DPPB 1NEBA 1EIFA 2QQ9A 1MV0B 1VYTA 2XK0A 2C0TA 1JJ2S 1OYXA 2JMAA 3C4SA 2K3BA 5LJ5d 3L2UA 4C0ZA 1QP3A 3JB9J 1IHVA 4NS5A 2B8AA 4XTYA 3R6NA 3CD6A 3VYGA 3CCEA 4HKEA 3CCUQ 1R0CB 4ANJA 5GMKe 3BE3A 2ZPIB 3LGFA 4J9FA 2P4RA 4EMKB 4RUGA 1M1KC 2R5AA 5M9OA 4PLLA 2QEXA 5GAMf 3OYHA 2O88A 1PSFA 4IUVA 3FB9A 4TVRA 1WHKA 2YUQA 4PK4A 3QO3A 4F7UG 3UWNA 1W4SA 4XU0A 5GMKi 2DVEA 2P4TA 3QIIA 5FW9A 3FLGA 4Y92A 3EGDB 4FT4A 1KSWA 3ULRB 2L8DA 3CCQA 2RHZA 2KRMA 2COWA 4C92E 3CBPA 2NUTA 4J9IA 2ED0A 4HVWA 2BZXA 4BY6B 4JRPA 4XQ3A 4ZN3A 4DOVA 3I35A 3QWYA 2DBMA 3X28B 1ZSZA 1CSKA 4XTUA 3QJYA 2XG8D 3LW5E 2AKLA 2ESWA 2PZ1A 1Q82R 5J3BA 2F1LA 3ZEHA 2CT3A 2HSPA 3LLRA 3SD4A 4MZTA 2O4XA 4RTWA 2GBQA 4C8QE 4RTZA 6AT1B 3PMTA 2LX9A 4E6RA 3RIRA 3VUZA 1PSEA 2FHDA 2KT8A 5A0LA 2QK0A 3H9NA 3QPHA 1M3BA 4LE9A 1U1TA 1BI0A 4M75G 1N8RU 2ATCB 4N4IA 1D3BA 1RI9A 3F70A 3EH1A 1NLOC 1T3LA 3M0UA 5DLQE 3MP1A 1VQNA 1H3HA 4FCYA 5CKEA 2QGGA 4AFQC 2XD0A 4OB2B 2K79A 1IRXA 3TEEA 4M78B 4GY5A 1BKBA 3QG1A 2ABLA 2MMPA 3HRSA 1N6AA 1D1AA 1BCMA 1QCNA 2BE7D 4LN2A 4MDXA 5D7UA 5EC7A 4JS5A 3A1PA 4JJBA 4LUDA 5L23A 1B3QA 3M4GA 1OPKA 1IHWA 4AFZC 2IIMA 3E9FA 4J9HA 2XDBA 4M75C 3URGA 2F5KA 1YN8A 1VQ9T 1GBQA 1M3CA 2K2MA 2ZAEA 3CCVA 1GCPA 3THKA 2HL5C 4FYWB 1W2BS 1UUEA 3QDFA 4B9XA 2DTHA 1UFFA 2E5KA 3JCMf 1FWZA 2RJDA 2A28A 2XIDA 4A4EA 3CCUA 1SRLA 3L2WA 2V1QA 5ECAA 4OP0A 2VV5A 1WFWA 3OYKA 3V8JA 2NUZA 1NLPC 5KYXB 2CT4A 1N5ZA 4LUEA 4PJJA 2JM8A 2QQAA 1PG5B 3I55T 1G2BA 3M59A 2DF6A 2KQWA 4M77G 4MZPA 4XTZA 5KH6A 3RDVA 4M7DD 2GTOA 3O5ZA 3SWNB 4PLIA 4PJOG 1BI2A 4RMOA 4XTVA 1WZOA 1MV3A 2K6DA 2ECZA 3RKXA 3PTAA 4DA4A 2HMAA 4M7AG 3JB9F 3NFCA 2EYYA 1ABQA 3H6ZA 2I0NA 2R57A 3C95A 1N8RR 5GAOn 1I5OB 5KE2A 5GAN7 2RD1A 2F5TX 3UT1A 2ZPGB 5IHNA 2WSCE 3VS5A 5KE3A 2X4YA 1ZBJA 5FWCA 4FW1A 1YITA 2JTFA 3H41A 2RMOA 2DJQA 1M1KU 3DB4A 4E7KA 2CH4A 5GAMe 4MZMA 2AZVA 2ZPHB 5IN1A 2DXTA 2LT1A 1MUZA 4PJOC 2VGMA 2ZGWA 1OEBA 3TSWA 1QKWA 4F7UA 1CKBA 1PWTA 1MMDA 3MKDA 2K3XA 2M9UA 4OMQA 3CCJT 4C5EA 4M7AC 1JQQA 3UDCA 5LJ5h 4RTYA 1QP2A 1K1ZA 1XOVA 2K4YA 4XU2A 2QGFB 1UEBA 2LT4A 2IG0A 3I55Q 2XI9A 1CKAA 2EVRA 2DA9A 1SRMA 1M30A 2V8IA 2VVKA 4CI0C 3CCMT 2RQVA 2YUOA 1G3SA 2RI2A 2CP3A 1WA7A 2DRKA 5EG2A 4PFZA 4D8KA 3CMAA 3CC4A 2JTEA 5FLXE 4CC4B 3OQ5A 1BCOA 2LZ6B 4C92G 1SHGA 3DLLA 3GNFB 1DJ7B 2QQBA 3KBGA 4M7DE 4C0DC 4AFSC 1UG1A 2MIOA 2DJZA 1W6XA 1OI1A 1JXOA 1G3TA 4JRIA 2DO3A 4M75A 2K57A 1KC8U 4B6MA 1YHQA 1EX4A 2YRDA 1WI7A 4ME7A 2XU8A 3JV3A 1ZUYA 5GJVB 2CZ7B 3SB2A 1X2KA 2QYZA 4C8QG 4AG1C 3I5SA 3CD6T 5LJ3d 1F1BB 4LDVA 3CCET 1XTDA 1GCQC 3CCJQ 4OF1A 4C92C 5L8RE 3MP8A 1TWBA 2AK5A 1X75C 2BIVA 2E65A 3JCMX 1R8OB 2HKQB 2RQTA 2PVGB 2RH2A 2QEXT 2QXFA 2OTJA 2HQXA 1XNIA 2PVDB 5CO7A 1M1KR 1LCKA 3VUBA 2EGAA 3JB9I 3CCMQ 1UDLA 2CP5A 3ASKA 2O4XB 3SEMA 3CC7A 2IPOB 4J9GA 2HBWA 2H8HA 1KHIA 5KYWA 4RG2A 2X4JA 1Y71A 1M8MA 1G8XA 1X2QA 3CCQT 2YUNA 3OYEA 5I11A 1WQ7A 4C8QC 3CC2A 2A3LA 1D3BB 3OS2A 4F7UF 5FU6B 1E7OA 3M0RA 1BU1A 3JCMe 3OYCA 2LDMA 1NM7A 1KQ2A 3S6WA 2D0QB 4QW2A 2MK5A 2MYSA 4FYVB 1YBYA 1QW1A 3VS1A 3GOXA 3X20B 4KRTA 3M4YA 2F2XA 2R5MA 2GCXA 3KFVA 3GBQA 4KH1B 1Y0MA 4M77A 4E7IA 3VKIA 3CCEQ 2P0PA 2QAZA 4JRQA 1PD1A 4KT0E 2DTIA 3E2UA 1NBEB 3FEOA 4PL6A 3TVTA 4LDYA 2RHYA 1ZLMA 3NTIA 1RACB 4M7AA 1G3YA 5CIUA 2QEXQ 1VQNT 1HD3A 5GANg 3CPFA 2AKKA 2DD4A 4J7IA 3OMGA 3H0IA 1TH7A 2FB7A 1H8KA 3CPWA 1X6GA 4ZGDB 4M78D 1I81A 4M75F 3CBMA 1Q7YC 3GIBA 2E64A 5FWBA 4DBHA 3CCQQ 4IUQA 2D1XA 1AD5A 2FZKB 2MCNA 3PE0A 1YWOA 3REAB 2PVOB 2DZ9A 1QVFA 4ATOA 3Q1JA 1QQJA 2P84A 2ED1A 3OS0A 4RTXA 2A37A 1BIBA 3PVQA 3CCLA 1VIFA 5AYFA 2DRMA 5IH2A 3M0QA 3CCVT 2CZ0B 3INZA 1B07A 1TUGB 2V8JA 3EGXA 3V8LA 3I56A 5GANj 3MEVA 3OYDA 3JCMW 1TTHB 2COZA 1WHJA 2RI3A 3QWXX 1SHFA 2YHTA 3SFMA 3CCUT 1WJSA 1N9RA 3VS3A 4C92A 8ATCB 4FSXA 1VQNQ 1M2VB 1VA7A 2PNIA 3OS1A 2DERA 4XK8E 1Z9QA 4C5HA 1OOTA 4C5GA 3EFOA 1Y7XA 4J83A 1V1CA 1KJWA 4OB1B 4EPCA 4F7UB 3MEUA 2D9TA 4PJOE 2X4WA 3VYHB 1VQ6A 3BFMA 2KR3A 2OX7A 2V8KA 5A2QE 1WNLA 4GBQA 4M77F 1WX6A 2K9GA 4M7AE 3HRUA 3A98A 3G7ZA 4C8QA 2CS7A 2GQVA 3NHNA 2OAUA 4M7DG 5LJ5f 1TXQA 3LGLA 1HYOA 4Z02A 4M78E 1MMGA 5IT9E 3V7CA 4QKUA 1BI1A 5A0DA 2LJ3A 1YITT 1ZUUA 2ROLA 4B9WA 3CCVQ 4JJDA 3RNJA 4IKFA 2LJ0A 2KVQG 3CCSA 2M16A 3RMQA 2QQRA 2ZZDA 3TCJA 1U8RA 1BYMA 1S72A 1FX7A 3C0CA 1K8AU 1QCFA 2FL7A 1UTIA 1YNZA 4OMPA 2KRSA 2VYTA 3G6EA 3CXCS 1OX8A 4LXCA 2CREA 2VWFA 2X4XA 1WJRA 1ARKA 1WXTA 3M0PA 2CDTA 4FSSA 4M7DC 3REBB 1AEYA 4D6WA 1QMCA 5LJ3h 2VASA 2X3XD 3G4SA 3EHRA 4BDZA 4Z8AA 3AT1B 3JCMc 3PGGA 3EFSA 5HK3A 3CMAT 3CC4T 2O01E 5CVIA 3LX7A 2EJFA 4PFOA 4PJNA 5GAN2 3OYNA 2JS2A 3CMEA 1OU8A 3WVEB 2K2VA 1Y96B 1ZHIA 2HNIA 1GXIE 1KQSS 1TS9A 2KXDA 1H641 1PC0A 1PNJA 2EYQA 5GANd 7AT1B 1SF9A 4C92F 1YIJQ 2CUDA 1YITQ 2MAMA 3ZBDA 2YT6A 2YRVA 2EKHA 1VQ7A 3E19A 1AWOA 5KYWB 1M9SA 1YHQT 2QQSA 2DL7A
chains in the Genus database with same CATH topology
1U3OA 2I0NA 4HVVA 1SSHA 2FO0A 3IQLA 2O9VA 1YP5A 2KRNA 5IHNA 2KEAA 3VS5A 1X27A 1I07A 2LMJA 1U5SA 1ZBJA 5FWCA 1GFDA 2BZ8A 2C0OA 4F16A 3H41A 2RMOA 2DJQA 2B86A 2J6OA 2LQNA 4J9DA 2CH4A 3PVLA 4M4ZA 2AZVA 2RQWA 1AVZC 2JXBA 1MUZA 2KXCA 1AWWA 2L3PA 2NWMA 1UHFA 1GFCA 4CC2A 1OEBA 1IO6A 1E6GA 1ABOA 1QKWA 1CKBA 3TSWA 2JM9A 5IXBA 1PWTA 2DYBA 2J05A 1X69A 2EBPA 4OMQA 1JQQA 1AZEA 1EFNA 2W0ZA 4RTYA 1K1ZA 1XOVA 2OI3A 2EW3A 2FPFA 2FRWA 3FJ5A 1AWJA 3VRYA 2FEIA 1SPKA 4CC7A 4J9CA 4Z88A 1CKAA 2EVRA 1FMKA 1SRMA 2DA9A 1M30A 2VVKA 1W70A 3I9QA 2DNUA 1WDXA 4CC3A 2RQVA 2YUOA 1WA7A 2M0YA 2DRKA 1E6HA 1QKXA 4D8KA 1T3SA 2RQRA 2J6FA 2JTEA 4CC4B 3ZL7C 2LZ6B 1GL5A 1RUWA 4ZNXA 3VRZA 1SHGA 2D8HA 2OAWA 1K9AA 4JZ4A 1PKSA 2C0IA 2PTKA 3EG3A 4AFSC 1UG1A 2ENMA 5IXFA 2DLPA 2MIOA 1W6XA 1JXOA 1YCSB 1TUCA 1H92A 1UECA 2RF0A 1T0JA 1WI7A 3TSZA 2CUBA 2GGRA 1QWFA 3JV3A 1ZUYA 2LCSA 5GJVB 1I0CA 1RLQC 1X2KA 4EIKA 2BTTA 4AG1C 2RPNA 5GJWB 1WLPB 1BK2A 3I5SA 4IIMA 3NGPA 2KYBA 3M0SA 1Z9ZA 2LQWA 1UJYA 1M27C 2DILA 1GCQC 3SHWA 1AZGB 4LNPA 2YDLA 3UA7A 2AK5A 2JT4A 2CSIA 2RQTA 1T0HA 3VS0A 4F14A 1YWPA 4IIOA 2RQUA 1J3TA 4JZ3A 2DX1A 1LCKA 2EGAA 1UE9A 1PRMC 1UDLA 1BBZA 3SEMA 2KE9A 4J9GA 4HCKA 2O9SA 2HBWA 2H8HA 4DEYA 3NPFA 1M3AA 3EHQA 2F2WA 1M8MA 1X2QA 4R0KA 2YUNA 4OMMA 1X43A 5I11A 2EYZA 2ROTA 4X1VA 2D8JA 3NMZC 1E7OA 3M0RA 2LX7A 1BU1A 2J7IA 1S1NA 2O31A 1NM7A 1QLYA 5HCKA 1SEMA 1PKTA 3H0HA 2G6FX 2YUPA 3VS1A 1JXMA 4GLMA 2AZSA 4KRTA 2JS0A 2F2XA 1JEGA 1QWEA 3KFVA 3I5RA 2LP5A 3GBQA 4HXJA 1Y0MA 2KT1A 2RNAA 4D8DA 2V1RA 1NEGA 2D0NA 1HSQA 2KBTA 1K0XA 2FPEA 3EG1A 1NEBA 4JPBW 3TVTA 1VYVA 1A0NB 1MV0B 4QT7A 1ZLMA 1VYTA 4AG2C 2C0TA 2A08A 2JMAA 2K3BA 1RLPC 1KFZA 1HD3A 2OJ2A 2AKKA 2L2PA 3H0IA 1H8KA 3R6NA 1X6GA 1UGVA 1OPLA 2DL5A 5IHIA 3VS7A 2EGEA 2L3SA 2A36A 4J9FA 5FWBA 1NYFA 2J6KA 2P4RA 2M51A 4RUGA 1GBRA 2D1XA 2O88A 1Y57A 1AD5A 3VS4A 2MCNA 3PE0A 1YWOA 3REAB 2EQIA 2YUQA 2ED1A 1WIEA 4RTXA 2A37A 1PRLC 3PVQA 1HJDA 5FW9A 2X3WD 4Y92A 2HCKA 1KSWA 3ULRB 2DRMA 5IH2A 3M0QA 2EPDA 2F2VA 2JW4A 2KRMA 5I22A 1B07A 1UHCA 1K0SA 1G83A 4RTUA 4J9IA 4RTVA 4OMLA 1U06A 2DE0X 2JMCA 2ED0A 1GRIA 2BZXA 4HVWA 4J9BA 2FRYA 3UATA 3QWXX 1SHFA 2LNHB 3I35A 3QWYA 2DL4A 2DBMA 1CSKA 3VS3A 3UF4A 2AKLA 1TUDA 2ESWA 2PZ1A 1OV3A 1VA7A 2CT3A 2YSQA 2PNIA 2BZYA 2J06A 2HSPA 4Z89A 1Z9QA 2DL8A 4RTWA 2GBQA 1KIKA 4RTZA 1K76A 1OOTA 3UA6A 1W1FA 3EGUA 4E6RA 1X6BA 2KROA 4J9EA 1V1CA 1KJWA 4DEXA 2HDAA 2KT8A 4ORZA 1VYUA 2GQIA 1I1JA 2QDLA 1M3BA 1ZSGA 3LH5A 4LE9A 2KR3A 2RN8A 2SEMA 4GBQA 2K7AA 1RI9A 2DL7A 2EGCA 2EYWA 1NLOC 1T3LA 1WX6A 2FG0A 3M0UA 1H3HA 1K4US 2K9GA 3A98A 4ESRA 2XMFA 2GNCA 3NHNA 4AFQC 2KYMA 2K79A 2HEQA 5IHKA 1AOJA 1WXBA 2L0AA 2ABLA 2LJ3A 1ZUUA 1AWXA 2ROLA 1PHTA 4JJDA 3RNJA 2LJ0A 1BB9A 1ZX6A 4LN2A 4K11A 3VS2A 4AFUC 5EC7A 3U23A 4A63B 4JJBA 2CSQA 4LUDA 1ZUKA 2SRCA 5L23A 1B3QA 3C0CA 1OPKA 4AFZC 2IIMA 4OMNA 4J9HA 4HVUA 1QCFA 3EG2A 1UTIA 1YNZA 2DL3A 1YN8A 4OMPA 2KRSA 2DVJA 3EG0A 1GBQA 2VKNA 1M3CA 2K2MA 2DBKA 3VS6A 2KGTA 2CREA 2VWFA 1GCPA 2EYXA 4RTTA 2DM1A 3THKA 1ARKA 1WXTA 3M0PA 2CDTA 4FSSA 3REBB 1AEYA 2DMOA 4OMOA 1UUEA 1WYXA 2X3XD 3EHRA 2E5KA 1UFFA 4Z8AA 1UJ0A 4F17A 2L3QA 2A28A 1FYNA 2LJ1A 3RBBB 1SRLA 1NG2A 2V1QA 5ECAA 2W10A 4JJCA 1WFWA 2NUZA 3CQTA 1NLPC 1JO8A 2CT4A 3M0TA 1N5ZA 4LUEA 2JM8A 2GTJA 2KNBB 2CH4W 2JS2A 3H0FA 1G2BA 2DF6A 1JU5C 2GTOA 2KXDA 1ABQA 2FPDA 3O5ZA 1PNJA 2O2OA 1WXUA 2CUDA 4WCIA 2YT6A 2EKHA 1GCQA 1MV3A 2K6DA 1AWOA 2ECZA 1TG0A 1NYGA 2MOXA 2EYYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U3O A;  2I0N A;  4HVV A;  1SSH A;  2FO0 A;  3IQL A;  2O9V A;  1YP5 A;  2KRN A;  5IHN A;  2KEA A;  3VS5 A;  1X27 A;  1I07 A;  2LMJ A;  1U5S A;  1ZBJ A;  5FWC A;  1GFD A;  2BZ8 A;  2C0O A;  4F16 A;  3H41 A;  2RMO A;  2DJQ A;  2B86 A;  2J6O A;  2LQN A;  4J9D A;  2CH4 A;  3PVL A;  4M4Z A;  2AZV A;  2RQW A;  1AVZ C;  2JXB A;  1MUZ A;  2KXC A;  1AWW A;  2L3P A;  2NWM A;  1UHF A;  1GFC A;  4CC2 A;  1OEB A;  1IO6 A;  1E6G A;  1ABO A;  1QKW A;  1CKB A;  3TSW A;  2JM9 A;  5IXB A;  1PWT A;  2DYB A;  2J05 A;  1X69 A;  2EBP A;  4OMQ A;  1JQQ A;  1AZE A;  1EFN A;  2W0Z A;  4RTY A;  1K1Z A;  1XOV A;  2OI3 A;  2EW3 A;  2FPF A;  2FRW A;  3FJ5 A;  1AWJ A;  3VRY A;  2FEI A;  1SPK A;  4CC7 A;  4J9C A;  4Z88 A;  1CKA A;  2EVR A;  1FMK A;  1SRM A;  2DA9 A;  1M30 A;  2VVK A;  1W70 A;  3I9Q A;  2DNU A;  1WDX A;  4CC3 A;  2RQV A;  2YUO A;  1WA7 A;  2M0Y A;  2DRK A;  1E6H A;  1QKX A;  4D8K A;  1T3S A;  2RQR A;  2J6F A;  2JTE A;  4CC4 B;  3ZL7 C;  2LZ6 B;  1GL5 A;  1RUW A;  4ZNX A;  3VRZ A;  1SHG A;  2D8H A;  2OAW A;  1K9A A;  4JZ4 A;  1PKS A;  2C0I A;  2PTK A;  3EG3 A;  4AFS C;  1UG1 A;  2ENM A;  5IXF A;  2DLP A;  2MIO A;  1W6X A;  1JXO A;  1YCS B;  1TUC A;  1H92 A;  1UEC A;  2RF0 A;  1T0J A;  1WI7 A;  3TSZ A;  2CUB A;  2GGR A;  1QWF A;  3JV3 A;  1ZUY A;  2LCS A;  5GJV B;  1I0C A;  1RLQ C;  1X2K A;  4EIK A;  2BTT A;  4AG1 C;  2RPN A;  5GJW B;  1WLP B;  1BK2 A;  3I5S A;  4IIM A;  3NGP A;  2KYB A;  3M0S A;  1Z9Z A;  2LQW A;  1UJY A;  1M27 C;  2DIL A;  1GCQ C;  3SHW A;  1AZG B;  4LNP A;  2YDL A;  3UA7 A;  2AK5 A;  2JT4 A;  2CSI A;  2RQT A;  1T0H A;  3VS0 A;  4F14 A;  1YWP A;  4IIO A;  2RQU A;  1J3T A;  4JZ3 A;  2DX1 A;  1LCK A;  2EGA A;  1UE9 A;  1PRM C;  1UDL A;  1BBZ A;  3SEM A;  2KE9 A;  4J9G A;  4HCK A;  2O9S A;  2HBW A;  2H8H A;  4DEY A;  3NPF A;  1M3A A;  3EHQ A;  2F2W A;  1M8M A;  1X2Q A;  4R0K A;  2YUN A;  4OMM A;  1X43 A;  5I11 A;  2EYZ A;  2ROT A;  4X1V A;  2D8J A;  3NMZ C;  1E7O A;  3M0R A;  2LX7 A;  1BU1 A;  2J7I A;  1S1N A;  2O31 A;  1NM7 A;  1QLY A;  5HCK A;  1SEM A;  1PKT A;  3H0H A;  2G6F X;  2YUP A;  3VS1 A;  1JXM A;  4GLM A;  2AZS A;  4KRT A;  2JS0 A;  2F2X A;  1JEG A;  1QWE A;  3KFV A;  3I5R A;  2LP5 A;  3GBQ A;  4HXJ A;  1Y0M A;  2KT1 A;  2RNA A;  4D8D A;  2V1R A;  1NEG A;  2D0N A;  1HSQ A;  2KBT A;  1K0X A;  2FPE A;  3EG1 A;  1NEB A;  4JPB W;  3TVT A;  1VYV A;  1A0N B;  1MV0 B;  4QT7 A;  1ZLM A;  1VYT A;  4AG2 C;  2C0T A;  2A08 A;  2JMA A;  2K3B A;  1RLP C;  1KFZ A;  1HD3 A;  2OJ2 A;  2AKK A;  2L2P A;  3H0I A;  1H8K A;  3R6N A;  1X6G A;  1UGV A;  1OPL A;  2DL5 A;  5IHI A;  3VS7 A;  2EGE A;  2L3S A;  2A36 A;  4J9F A;  5FWB A;  1NYF A;  2J6K A;  2P4R A;  2M51 A;  4RUG A;  1GBR A;  2D1X A;  2O88 A;  1Y57 A;  1AD5 A;  3VS4 A;  2MCN A;  3PE0 A;  1YWO A;  3REA B;  2EQI A;  2YUQ A;  2ED1 A;  1WIE A;  4RTX A;  2A37 A;  1PRL C;  3PVQ A;  1HJD A;  5FW9 A;  2X3W D;  4Y92 A;  2HCK A;  1KSW A;  3ULR B;  2DRM A;  5IH2 A;  3M0Q A;  2EPD A;  2F2V A;  2JW4 A;  2KRM A;  5I22 A;  1B07 A;  1UHC A;  1K0S A;  1G83 A;  4RTU A;  4J9I A;  4RTV A;  4OML A;  1U06 A;  2DE0 X;  2JMC A;  2ED0 A;  1GRI A;  2BZX A;  4HVW A;  4J9B A;  2FRY A;  3UAT A;  3QWX X;  1SHF A;  2LNH B;  3I35 A;  3QWY A;  2DL4 A;  2DBM A;  1CSK A;  3VS3 A;  3UF4 A;  2AKL A;  1TUD A;  2ESW A;  2PZ1 A;  1OV3 A;  1VA7 A;  2CT3 A;  2YSQ A;  2PNI A;  2BZY A;  2J06 A;  2HSP A;  4Z89 A;  1Z9Q A;  2DL8 A;  4RTW A;  2GBQ A;  1KIK A;  4RTZ A;  1K76 A;  1OOT A;  3UA6 A;  1W1F A;  3EGU A;  4E6R A;  1X6B A;  2KRO A;  4J9E A;  1V1C A;  1KJW A;  4DEX A;  2HDA A;  2KT8 A;  4ORZ A;  1VYU A;  2GQI A;  1I1J A;  2QDL A;  1M3B A;  1ZSG A;  3LH5 A;  4LE9 A;  2KR3 A;  2RN8 A;  2SEM A;  4GBQ A;  2K7A A;  1RI9 A;  2DL7 A;  2EGC A;  2EYW A;  1NLO C;  1T3L A;  1WX6 A;  2FG0 A;  3M0U A;  1H3H A;  1K4U S;  2K9G A;  3A98 A;  4ESR A;  2XMF A;  2GNC A;  3NHN A;  4AFQ C;  2KYM A;  2K79 A;  2HEQ A;  5IHK A;  1AOJ A;  1WXB A;  2L0A A;  2ABL A;  2LJ3 A;  1ZUU A;  1AWX A;  2ROL A;  1PHT A;  4JJD A;  3RNJ A;  2LJ0 A;  1BB9 A;  1ZX6 A;  4LN2 A;  4K11 A;  3VS2 A;  4AFU C;  5EC7 A;  3U23 A;  4A63 B;  4JJB A;  2CSQ A;  4LUD A;  1ZUK A;  2SRC A;  5L23 A;  1B3Q A;  3C0C A;  1OPK A;  4AFZ C;  2IIM A;  4OMN A;  4J9H A;  4HVU A;  1QCF A;  3EG2 A;  1UTI A;  1YNZ A;  2DL3 A;  1YN8 A;  4OMP A;  2KRS A;  2DVJ A;  3EG0 A;  1GBQ A;  2VKN A;  1M3C A;  2K2M A;  2DBK A;  3VS6 A;  2KGT A;  2CRE A;  2VWF A;  1GCP A;  2EYX A;  4RTT A;  2DM1 A;  3THK A;  1ARK A;  1WXT A;  3M0P A;  2CDT A;  4FSS A;  3REB B;  1AEY A;  2DMO A;  4OMO A;  1UUE A;  1WYX A;  2X3X D;  3EHR A;  2E5K A;  1UFF A;  4Z8A A;  1UJ0 A;  4F17 A;  2L3Q A;  2A28 A;  1FYN A;  2LJ1 A;  3RBB B;  1SRL A;  1NG2 A;  2V1Q A;  5ECA A;  2W10 A;  4JJC A;  1WFW A;  2NUZ A;  3CQT A;  1NLP C;  1JO8 A;  2CT4 A;  3M0T A;  1N5Z A;  4LUE A;  2JM8 A;  2GTJ A;  2KNB B;  2CH4 W;  2JS2 A;  3H0F A;  1G2B A;  2DF6 A;  1JU5 C;  2GTO A;  2KXD A;  1ABQ A;  2FPD A;  3O5Z A;  1PNJ A;  2O2O A;  1WXU A;  2CUD A;  4WCI A;  2YT6 A;  2EKH A;  1GCQ A;  1MV3 A;  2K6D A;  1AWO A;  2ECZ A;  1TG0 A;  1NYG A;  2MOX A;  2EYY A; 
#chains in the Genus database with same CATH topology
 1U3O A;  3FC3 A;  4HVV A;  1SSH A;  4NOY A;  3IQL A;  3OBY A;  5GAN 4;  1YP5 A;  2HL3 A;  1N27 A;  2KEA A;  3OYY A;  3X24 B;  2LMJ A;  2WAC A;  1GFD A;  2BZ8 A;  1Q7Y U;  2C0O A;  4ELY C;  1RAE B;  1KHC A;  4N4G A;  2J6O A;  1WHH A;  4C8Q F;  1KC8 C;  3OY9 A;  4J9D A;  1ACM B;  2OTJ T;  4M4Z A;  5GMK h;  2PUO B;  2XDP A;  1AVZ C;  2EQJ A;  2L3P A;  5CK9 A;  1RAA B;  4N0A C;  2YLB A;  3JB9 D;  1IO6 A;  3FRN A;  4M77 B;  2M02 A;  2JM9 A;  2DYB A;  3EFR A;  3CC7 T;  1G5V A;  2E12 A;  3CMA Q;  3CC4 Q;  1AZE A;  3EG9 B;  2JNG A;  3FJ5 A;  1AWJ A;  2FEI A;  3CC2 T;  5LJ3 g;  3J7A F;  4FT2 A;  2DD5 A;  1K9M U;  3S3M A;  1FMK A;  3A8H B;  2VXF A;  2HBP A;  1U1S A;  4BUG A;  4FU6 A;  3A8G B;  2QAS A;  2A0F B;  1KK7 A;  4RCB A;  3A8M B;  2DEU A;  2EKO A;  2EAY A;  4KUI A;  1YJN A;  4BE1 A;  4RCC A;  4ELZ C;  1UGR B;  1UGQ B;  1YHQ Q;  1RAB B;  3ZL7 C;  1GL5 A;  3VRZ A;  1VUB A;  4N4H A;  2E6Z A;  4JJN K;  5FRN A;  5KYU A;  3PIO A;  4IUT A;  4JZ4 A;  1PKS A;  1MHN A;  5HKC A;  2C0I A;  4EMK C;  2E1H A;  2E6N A;  3V8K A;  3WVD B;  2ENM A;  5AT1 B;  1Q86 U;  3OYJ A;  2QTX A;  5GAO r;  1TUC A;  1H92 A;  1UEC A;  1IB8 A;  1T0J A;  2HD0 A;  2V26 A;  2OTJ Q;  3QDR B;  2H3J A;  3DLM A;  1I0C A;  4E7H A;  5C6S A;  5LJ3 j;  4EIK A;  2E4H A;  4M7D A;  4A4H A;  2BTT A;  1WLP B;  1BK2 A;  3EGX B;  5GMK l;  3KXT A;  3OBW A;  3CC7 Q;  3BW1 A;  1UJY A;  2DIL A;  3TQ7 P;  3SHW A;  1AZG B;  1PM3 A;  2YDL A;  3JCM P;  1VQO A;  1MND A;  3UA7 A;  2CSI A;  3JB9 H;  2X35 A;  4II1 A;  3CC2 Q;  1Q7Y R;  5CQY A;  4BY6 C;  2RQU A;  1M8V A;  4AMC A;  1IGU A;  3OSV A;  3LH0 A;  1UE9 A;  3HHT B;  4IUR A;  2JOY A;  4M78 G;  1PRM C;  1LPL A;  1D0Z A;  1OQK A;  3L2Q A;  3CCL T;  3M54 A;  2EJG A;  2EQU A;  3EFO B;  5A0G A;  2WSE E;  4E7S A;  1YIJ A;  4XTW A;  4Y91 A;  1ZQ1 A;  2NUP A;  3RKW A;  4OMM A;  1X43 A;  4BE2 A;  1B34 A;  2JTM A;  2EYZ A;  4NL3 A;  2ROT A;  1O75 A;  1JJ2 P;  2D8J A;  3OB9 A;  3I56 T;  4BI8 B;  1FMW A;  1QVG A;  2O31 A;  4DOW A;  1QLY A;  5HCK A;  3OYL A;  1PKT A;  3H0H A;  1C6V X;  4GLM A;  1M1G A;  3HKS A;  2JS0 A;  2AIR B;  2L3R A;  3FIF A;  1JEG A;  3MP6 A;  4M78 C;  2D6F A;  1X6O A;  5GMK j;  3VU3 C;  2H3E B;  1NPP A;  4D8D A;  2D0N A;  4MML A;  1EZZ B;  1M2O A;  2KBT A;  4N0A A;  2BUD A;  1OU9 A;  4GLK A;  1VQ6 T;  1Q86 R;  1A0N B;  3QYG B;  3M55 A;  2VGN A;  1KD1 U;  5FU7 B;  1RLP C;  1AT1 B;  3O8V A;  3M57 A;  2LQK A;  5DY9 A;  3MCA B;  1JB0 E;  2L2P A;  1UGV A;  1H3Z A;  1OPL A;  4X9D A;  2DL5 A;  3CCL Q;  5IHI A;  3VS7 A;  2EGE A;  3RKY A;  1JJ2 A;  3GP8 A;  2L3S A;  3NTH A;  4E47 A;  1VQ8 T;  2EFI A;  1NYF A;  5D6W A;  2M51 A;  1D09 B;  2P0Q A;  2KK4 A;  3CCS T;  4M7D F;  3LWH A;  3VS4 A;  3I56 Q;  2IVW A;  1VQK A;  5GAN h;  1S72 T;  2X51 A;  1RI0 A;  1OZ2 A;  1WIE A;  2NUT B;  1PRL C;  4EMK A;  1KG1 A;  4JLI A;  3QSU A;  2X3W D;  2PU9 B;  3G6E T;  5GAN 8;  2EPD A;  2F2V A;  1ZSZ B;  2JW4 A;  1D1B A;  3JSC A;  5I22 A;  3SWN C;  4E7L A;  5GAO l;  3D7S B;  1K0S A;  1G83 A;  1LNX A;  2LQ8 A;  3G4S T;  4RTU A;  4RTV A;  4OML A;  1U06 A;  2DE0 X;  2JMC A;  2M1H A;  2XHC A;  3HPW A;  5J26 A;  1K8A C;  3QBY A;  2DIQ A;  2FRY A;  1VQ5 A;  2LCC A;  2YXY A;  5CKD A;  2LNH B;  3EGD A;  3UPU A;  1OZ3 A;  2DL4 A;  1VQ6 Q;  2EQM A;  2CYZ B;  2KAF A;  3OS5 A;  5HK0 A;  3CPW P;  1TUD A;  2MF2 A;  3DB3 A;  1OV3 A;  2YSQ A;  1M90 C;  4QQD A;  2J06 A;  3CME T;  4AT1 B;  3EH2 A;  2QI2 A;  3X26 B;  2LCL A;  4E2F B;  2COY A;  2DL8 A;  4ZN1 A;  1KIK A;  1V76 A;  2E70 A;  4QVC A;  1W1F A;  4F04 B;  1X6B A;  4J9E A;  1WHL A;  4DEX A;  1VQ8 Q;  3V7R A;  1VYU A;  1QVP A;  2GQI A;  4JDS A;  1I1J A;  2MWP A;  2QDL A;  1SKU B;  1VQ7 T;  1RAG B;  3DKM A;  1ZSG A;  2VC8 A;  1QVF P;  3CCS Q;  2SEM A;  3OYI A;  4YTL A;  4ESR A;  1S72 Q;  2XMF A;  2GNC A;  4Q5W A;  1W2B P;  2KYM A;  3BDL A;  4PJO A;  1MMA A;  4J6X A;  1AOJ A;  2QA4 A;  1WXB A;  1K73 U;  2E10 A;  3OYB A;  2L0A A;  4J6W A;  3G6E Q;  4ZTJ A;  1VQP A;  4HCZ A;  3V7S A;  1BB9 A;  2ZPB B;  1ZX6 A;  4K11 A;  3VS2 A;  4AFU C;  1N9S A;  2E3H A;  1ZA2 B;  3QJ6 A;  4A63 B;  3G4S Q;  1KC8 R;  1ZUK A;  2SRC A;  4M78 A;  5GAM g;  4M77 D;  5KYU B;  4A53 A;  1LOJ A;  2RI5 A;  3EG2 A;  2DL3 A;  2LRQ A;  4OB3 B;  2VKN A;  2NLU A;  4XTX A;  2DBK A;  3VS6 A;  3X25 B;  2L89 A;  4RTT A;  4BB7 A;  5GAN 3;  2RA2 A;  1UGS B;  2DXU A;  4OMO A;  3CME Q;  1WYX A;  1VQM A;  3JB9 G;  2MI6 A;  4BD3 A;  4KGV B;  4F17 A;  1C1A A;  2LVM A;  4VUB A;  5GAN 5;  1WHG A;  2LJ1 A;  3CCR T;  2HAX A;  1VQ7 Q;  1YJN T;  1Q81 U;  3L2R A;  1W2B A;  3CQT A;  1YJW A;  2YLC A;  1JO8 A;  3M0T A;  2GTJ A;  2CH4 W;  3H0F A;  3P8D A;  3L42 A;  1K9M C;  3M9Q A;  4FM4 B;  5GAM j;  5DM7 R;  4MDW A;  3OYA A;  1WXU A;  2HKN A;  1SG5 A;  1GCQ A;  2HQE A;  3QXE B;  2CP6 A;  1NYG A;  2NUP B;  2C06 A;  2QG9 B;  4BDY A;  3MO8 A;  2O9V A;  1VQL A;  1YI2 A;  2A7Y A;  1RL2 A;  1YCY A;  3BDU A;  2K5I A;  3JCM b;  1X27 A;  1Q86 C;  1I07 A;  1VQO T;  3OYM A;  4F16 A;  5FU6 C;  3HFN A;  2AT1 B;  3ER0 A;  2VUB A;  4XU3 A;  4ZTF A;  3PVL A;  1HXD A;  1D0X A;  3QYH B;  4PJO F;  1UHF A;  1XQH A;  4HA8 A;  1E6G A;  3MJX A;  2J05 A;  5I2M A;  3CCR Q;  1Q82 U;  4M7A F;  2HQH A;  2ZPF B;  1VQ8 A;  2GF7 A;  1YJN Q;  1YIJ T;  1EFN A;  2W0Z A;  4EMH A;  2OI3 A;  2FPF A;  4QVD A;  1M1F A;  1Y07 A;  2KDS A;  3ME9 A;  3TRE A;  4M78 F;  4E7J A;  4A4G A;  2RHI A;  3L2V A;  4J9C A;  1B7T A;  1UGP B;  5CR2 A;  3RER A;  1W70 A;  3I9Q A;  2DNU A;  3H8Z A;  1WDX A;  2LC4 A;  4CC3 A;  1UB4 A;  3JCM g;  1QKX A;  2RQR A;  2KI7 A;  1RUW A;  4M75 B;  3S3O A;  4ZGE B;  2KSS A;  2XKO C;  2OAW A;  2D8H A;  1Q81 R;  1M90 U;  3RR6 A;  1K9A A;  5KCO A;  3OW2 P;  2JZ2 A;  2RJF A;  2RJE A;  4DBF A;  4ZGJ B;  1NZ9 A;  2RHX A;  9ATC B;  2K3Y A;  2DLP A;  4LDX A;  5C0M A;  1V29 B;  1BI3 A;  1VQ4 A;  1VQO Q;  3JCM V;  3MHX A;  2CGH A;  4LD6 A;  5GAN f;  2RF0 A;  3HTR A;  4V2S A;  4LDW A;  3TSZ A;  5FRO A;  2CUB A;  3GLX A;  3TU4 K;  2LCS A;  3QKJ A;  4FW2 A;  3HRT A;  1RLQ C;  2CZ6 B;  2RPN A;  1R77 A;  2GFU A;  4IIM A;  4Y28 E;  1RAD B;  1R0B G;  2KYB A;  3NGP A;  8AT1 B;  1Z9Z A;  2P0K A;  1FMV A;  5GAM d;  2JT4 A;  2Y90 A;  4KGX B;  1T0H A;  3P8H A;  3VS0 A;  2WSF E;  3RMS A;  4F14 A;  3LWI A;  1KD1 C;  4IIO A;  1J3T A;  3QHS A;  2DX1 A;  2HSE B;  2Y4X A;  5KYY A;  1VQK T;  4KGZ B;  3OYG A;  1BBZ A;  2QDY B;  4HCK A;  2BE9 B;  2O9S A;  4JS4 A;  1NJI U;  1NE8 A;  3NPF A;  3EHQ A;  3OW2 A;  3MET A;  2DKG A;  4R0K A;  2DEQ A;  3HP9 A;  3JAM E;  3JCM Q;  3NMZ C;  5IAY A;  2EWN A;  3LYI A;  4R56 A;  2LX7 A;  1OUL A;  1VQ5 T;  3PFS A;  1SEM A;  4C5I A;  1K8A R;  4PJO B;  1HK9 A;  3GPL A;  1RAH B;  2OTL A;  3C12 A;  5KCH A;  3JRZ A;  4X9C A;  4M7A B;  2LP5 A;  5FRM A;  4JUV A;  4OMF B;  2KT1 A;  1IGQ A;  4A54 A;  2V1R A;  1M90 R;  5GAO q;  2RJC A;  5D6X A;  2FPE A;  3EG1 A;  3CPW S;  4JPB W;  3CCR A;  4PKC C;  1VYV A;  3PIP A;  4QT7 A;  4AG2 C;  2A08 A;  4JRK A;  3R6O A;  1MGQ A;  1KFZ A;  1RAI B;  2OJ2 A;  4FYY B;  4WF2 A;  3G71 A;  1VQK Q;  3QZ5 B;  4J7F A;  2DXC A;  2XIC A;  1KQ1 A;  3AHU A;  4HT9 A;  3CBO A;  1QVF S;  3PT9 A;  2QA4 T;  2A36 A;  2DYI A;  2R58 A;  1VQP T;  2J6K A;  2LTO A;  4C0D B;  1QVG P;  1YJ9 T;  5CCA A;  2LNV A;  1GBR A;  1Y57 A;  4IUP A;  3JCM J;  1XJW B;  2CP7 A;  2EQI A;  3OSS C;  2MPX C;  4J5Y A;  2KMT A;  5GAN 6;  5LJ5 e;  1IXD A;  1VQ5 Q;  4L59 A;  4UC4 A;  1HJD A;  1K73 C;  5D6Y A;  2HCK A;  3OA6 A;  4KH0 B;  1NJI R;  4FYX B;  3JCM d;  1UHC A;  2YWW A;  4C92 B;  4HT8 A;  4DBR A;  5KYN A;  4MMK A;  5DLO A;  1VQM T;  3OYF A;  3SDZ A;  3P8B B;  1GRI A;  4J9B A;  3UAT A;  2ZCF B;  4HCB A;  4EMG A;  2GFA A;  2RHU A;  1TOV A;  2I2L A;  3T9N A;  3PNW C;  3OMC A;  3UF4 A;  4R55 A;  1YJW T;  4CRI A;  2BZY A;  5GAO p;  4Z89 A;  2CKK A;  1AHJ B;  1IZ6 A;  1K76 A;  3UA6 A;  4C8Q B;  1FXX A;  3EGU A;  4C0G A;  1SSF A;  2KRO A;  4OB0 B;  4BI3 A;  1K9M R;  1VQ9 Q;  4QQG A;  2QA4 Q;  2HDA A;  4ORZ A;  1D1C A;  1VQP Q;  5GAN e;  3MPU B;  3CEY A;  1I8F A;  3LH5 A;  1M2V A;  1MNE A;  1YJ9 Q;  1Q81 C;  2RN8 A;  4KUD K;  2E3I A;  2EYW A;  2K7A A;  2EGC A;  2FG0 A;  1K4U S;  4M77 C;  3CXC P;  2DET A;  2X9H A;  4PJL A;  1X01 A;  2FZC B;  4X34 A;  1VQL T;  1YI2 T;  4LD9 K;  2RB6 A;  2HEQ A;  2RK2 A;  5CKH A;  5IHK A;  1TU0 B;  2DFU A;  2FYK A;  3PMI A;  1ZA1 B;  3HL8 A;  1AWX A;  4OVA A;  4A4K A;  2DXB A;  1PHT A;  3M5A A;  4J6Y A;  4J8O A;  2Z0W A;  3U23 A;  1VQM Q;  2CSQ A;  1WPY A;  2MWO A;  4HCC A;  1JRI A;  4OMN A;  4HVU A;  1LVK A;  2DTO A;  1KQS P;  2XDD A;  2DVJ A;  4EDU A;  3EG0 A;  5LJ3 f;  2KGT A;  2EYX A;  1YJW Q;  2DM1 A;  3A8L B;  2PUK B;  2DMO A;  4QVZ A;  3M53 A;  4KUL A;  1UJ0 A;  2L5Q A;  4WTO B;  5GAM h;  2L3Q A;  3CXC A;  1FYN A;  4PNO A;  3RBB B;  4BI4 A;  1NG2 A;  2Y4Y A;  1Q82 C;  2W10 A;  4JJC A;  2AHJ B;  1IRE B;  4M75 D;  4BE0 A;  3E9G A;  3GNG A;  1BIA A;  1NPR A;  5CKF A;  2KNB B;  2CP2 A;  4O6J A;  3HSB A;  1VQL Q;  5KYY B;  1YI2 Q;  4FIB A;  1JU5 C;  2FPD A;  1MMN A;  3C94 A;  2O2O A;  1VQ4 T;  4WCI A;  2JUF A;  2RM4 A;  1TG0 A;  2MOX A;  2DK3 A;  3OW2 S;  1KQS A;  1Y96 A;  3MEA A;  2FO0 A;  2VXE A;  4PJM A;  4OGC A;  2KRN A;  1WHM A;  4F7U E;  5LJ5 g;  1U5S A;  3KUF A;  1TSF A;  1QCO A;  2B86 A;  2VB6 A;  3QUI A;  2LQN A;  3MEW A;  3RES A;  4JLG A;  5GMK m;  2RQW A;  1I4K 1;  2JXB A;  2KXC A;  2RK1 A;  1AWW A;  2NWM A;  4L5G A;  1KD1 R;  1GFC A;  4LDU A;  4CC2 A;  1ABO A;  5IXB A;  2YRC A;  1X69 A;  1D0Y A;  2EBP A;  1VQ9 A;  2K5F A;  2G3R A;  5CKB A;  3GF5 A;  2EW3 A;  1M4Z A;  2FRW A;  4FL6 A;  3FDR A;  1YJ9 A;  3VRY A;  1SPK A;  4CC7 A;  5I21 A;  4Z88 A;  4E7Z A;  3M58 A;  2ZPE B;  3CD6 Q;  2DZC A;  3VV0 A;  2M0Y A;  5FU7 C;  4PJO D;  1E6H A;  1VQ4 Q;  3EG9 A;  1NJI C;  2KY9 A;  1T3S A;  1PD0 A;  3FJP A;  5LJ5 j;  2J6F A;  4XU1 A;  2OTL T;  1I5L A;  4M75 E;  3ZFJ A;  4ZNX A;  4M7A D;  1WQW A;  3I55 A;  2BKD N;  4DBQ A;  4O5V A;  2PTK A;  3EG3 A;  1WJQ A;  3RUX A;  4M7D B;  4IUU A;  2FVU A;  4OGE A;  5IXF A;  3E1S A;  2RO0 A;  3NTK A;  1YCS B;  3QZ9 B;  4BAC A;  1O9S A;  3JCM h;  2F69 A;  1N8R C;  5I2S A;  4RKU E;  1RAF B;  2NYS A;  1QWF A;  2GGR A;  3A8O B;  3G71 T;  1OX9 A;  3HFO A;  5GJW B;  4L6V 5;  2EIF A;  3EAE A;  2HZY A;  3M0S A;  2LQW A;  1M27 C;  1ZSZ C;  4LNP A;  5CQX A;  1P92 A;  5KYX A;  3A5Z B;  2FZG B;  3VJP A;  3J81 E;  1YWP A;  2DAQ A;  1VIE A;  4JZ3 A;  3S3N A;  4QQ6 A;  1B34 B;  3J80 E;  2DIG A;  4PFP A;  2JN0 A;  3SWN A;  3M56 A;  2KE9 A;  1QVG S;  4DEY A;  3BY7 A;  3CCJ A;  2CZ1 B;  4DQ2 A;  3L1A A;  1M3A A;  1ZBX A;  5LJ3 e;  1WGS A;  2F2W A;  4A4F A;  2JJ9 A;  2OTL Q;  3G1J A;  2QTV A;  4RG8 A;  1K73 R;  4C92 D;  4X1V A;  2E41 A;  1M5Q 1;  4XAX B;  4NL2 A;  1Q95 G;  2J7I A;  5J39 A;  4M77 E;  1C0M A;  1S1N A;  3CCM A;  4P5N A;  2G6F X;  4KBM B;  2YUP A;  1JXM A;  3N5B B;  3L2Z A;  5GAO m;  1JBM A;  1G3W A;  2CP0 A;  5HY6 A;  2AZS A;  2EQK A;  2JVV A;  2M0O A;  2EJ9 A;  1QWE A;  3G71 Q;  4C0F A;  2PQW A;  1LJO A;  3I5R A;  4HXJ A;  3WXM B;  1PCX A;  1VOM A;  4C8Q D;  2E5Q A;  5CAI A;  2RNA A;  1YFN A;  1NEG A;  1HSQ A;  2K5L A;  5LL6 S;  1K0X A;  2DPP B;  1NEB A;  1EIF A;  2QQ9 A;  1MV0 B;  1VYT A;  2XK0 A;  2C0T A;  1JJ2 S;  1OYX A;  2JMA A;  3C4S A;  2K3B A;  5LJ5 d;  3L2U A;  4C0Z A;  1QP3 A;  3JB9 J;  1IHV A;  4NS5 A;  2B8A A;  4XTY A;  3R6N A;  3CD6 A;  3VYG A;  3CCE A;  4HKE A;  3CCU Q;  1R0C B;  4ANJ A;  5GMK e;  3BE3 A;  2ZPI B;  3LGF A;  4J9F A;  2P4R A;  4EMK B;  4RUG A;  1M1K C;  2R5A A;  5M9O A;  4PLL A;  2QEX A;  5GAM f;  3OYH A;  2O88 A;  1PSF A;  4IUV A;  3FB9 A;  4TVR A;  1WHK A;  2YUQ A;  4PK4 A;  3QO3 A;  4F7U G;  3UWN A;  1W4S A;  4XU0 A;  5GMK i;  2DVE A;  2P4T A;  3QII A;  5FW9 A;  3FLG A;  4Y92 A;  3EGD B;  4FT4 A;  1KSW A;  3ULR B;  2L8D A;  3CCQ A;  2RHZ A;  2KRM A;  2COW A;  4C92 E;  3CBP A;  2NUT A;  4J9I A;  2ED0 A;  4HVW A;  2BZX A;  4BY6 B;  4JRP A;  4XQ3 A;  4ZN3 A;  4DOV A;  3I35 A;  3QWY A;  2DBM A;  3X28 B;  1ZSZ A;  1CSK A;  4XTU A;  3QJY A;  2XG8 D;  3LW5 E;  2AKL A;  2ESW A;  2PZ1 A;  1Q82 R;  5J3B A;  2F1L A;  3ZEH A;  2CT3 A;  2HSP A;  3LLR A;  3SD4 A;  4MZT A;  2O4X A;  4RTW A;  2GBQ A;  4C8Q E;  4RTZ A;  6AT1 B;  3PMT A;  2LX9 A;  4E6R A;  3RIR A;  3VUZ A;  1PSE A;  2FHD A;  2KT8 A;  5A0L A;  2QK0 A;  3H9N A;  3QPH A;  1M3B A;  4LE9 A;  1U1T A;  1BI0 A;  4M75 G;  1N8R U;  2ATC B;  4N4I A;  1D3B A;  1RI9 A;  3F70 A;  3EH1 A;  1NLO C;  1T3L A;  3M0U A;  5DLQ E;  3MP1 A;  1VQN A;  1H3H A;  4FCY A;  5CKE A;  2QGG A;  4AFQ C;  2XD0 A;  4OB2 B;  2K79 A;  1IRX A;  3TEE A;  4M78 B;  4GY5 A;  1BKB A;  3QG1 A;  2ABL A;  2MMP A;  3HRS A;  1N6A A;  1D1A A;  1BCM A;  1QCN A;  2BE7 D;  4LN2 A;  4MDX A;  5D7U A;  5EC7 A;  4JS5 A;  3A1P A;  4JJB A;  4LUD A;  5L23 A;  1B3Q A;  3M4G A;  1OPK A;  1IHW A;  4AFZ C;  2IIM A;  3E9F A;  4J9H A;  2XDB A;  4M75 C;  3URG A;  2F5K A;  1YN8 A;  1VQ9 T;  1GBQ A;  1M3C A;  2K2M A;  2ZAE A;  3CCV A;  1GCP A;  3THK A;  2HL5 C;  4FYW B;  1W2B S;  1UUE A;  3QDF A;  4B9X A;  2DTH A;  1UFF A;  2E5K A;  3JCM f;  1FWZ A;  2RJD A;  2A28 A;  2XID A;  4A4E A;  3CCU A;  1SRL A;  3L2W A;  2V1Q A;  5ECA A;  4OP0 A;  2VV5 A;  1WFW A;  3OYK A;  3V8J A;  2NUZ A;  1NLP C;  5KYX B;  2CT4 A;  1N5Z A;  4LUE A;  4PJJ A;  2JM8 A;  2QQA A;  1PG5 B;  3I55 T;  1G2B A;  3M59 A;  2DF6 A;  2KQW A;  4M77 G;  4MZP A;  4XTZ A;  5KH6 A;  3RDV A;  4M7D D;  2GTO A;  3O5Z A;  3SWN B;  4PLI A;  4PJO G;  1BI2 A;  4RMO A;  4XTV A;  1WZO A;  1MV3 A;  2K6D A;  2ECZ A;  3RKX A;  3PTA A;  4DA4 A;  2HMA A;  4M7A G;  3JB9 F;  3NFC A;  2EYY A;  1ABQ A;  3H6Z A;  2I0N A;  2R57 A;  3C95 A;  1N8R R;  5GAO n;  1I5O B;  5KE2 A;  5GAN 7;  2RD1 A;  2F5T X;  3UT1 A;  2ZPG B;  5IHN A;  2WSC E;  3VS5 A;  5KE3 A;  2X4Y A;  1ZBJ A;  5FWC A;  4FW1 A;  1YIT A;  2JTF A;  3H41 A;  2RMO A;  2DJQ A;  1M1K U;  3DB4 A;  4E7K A;  2CH4 A;  5GAM e;  4MZM A;  2AZV A;  2ZPH B;  5IN1 A;  2DXT A;  2LT1 A;  1MUZ A;  4PJO C;  2VGM A;  2ZGW A;  1OEB A;  3TSW A;  1QKW A;  4F7U A;  1CKB A;  1PWT A;  1MMD A;  3MKD A;  2K3X A;  2M9U A;  4OMQ A;  3CCJ T;  4C5E A;  4M7A C;  1JQQ A;  3UDC A;  5LJ5 h;  4RTY A;  1QP2 A;  1K1Z A;  1XOV A;  2K4Y A;  4XU2 A;  2QGF B;  1UEB A;  2LT4 A;  2IG0 A;  3I55 Q;  2XI9 A;  1CKA A;  2EVR A;  2DA9 A;  1SRM A;  1M30 A;  2V8I A;  2VVK A;  4CI0 C;  3CCM T;  2RQV A;  2YUO A;  1G3S A;  2RI2 A;  2CP3 A;  1WA7 A;  2DRK A;  5EG2 A;  4PFZ A;  4D8K A;  3CMA A;  3CC4 A;  2JTE A;  5FLX E;  4CC4 B;  3OQ5 A;  1BCO A;  2LZ6 B;  4C92 G;  1SHG A;  3DLL A;  3GNF B;  1DJ7 B;  2QQB A;  3KBG A;  4M7D E;  4C0D C;  4AFS C;  1UG1 A;  2MIO A;  2DJZ A;  1W6X A;  1OI1 A;  1JXO A;  1G3T A;  4JRI A;  2DO3 A;  4M75 A;  2K57 A;  1KC8 U;  4B6M A;  1YHQ A;  1EX4 A;  2YRD A;  1WI7 A;  4ME7 A;  2XU8 A;  3JV3 A;  1ZUY A;  5GJV B;  2CZ7 B;  3SB2 A;  1X2K A;  2QYZ A;  4C8Q G;  4AG1 C;  3I5S A;  3CD6 T;  5LJ3 d;  1F1B B;  4LDV A;  3CCE T;  1XTD A;  1GCQ C;  3CCJ Q;  4OF1 A;  4C92 C;  5L8R E;  3MP8 A;  1TWB A;  2AK5 A;  1X75 C;  2BIV A;  2E65 A;  3JCM X;  1R8O B;  2HKQ B;  2RQT A;  2PVG B;  2RH2 A;  2QEX T;  2QXF A;  2OTJ A;  2HQX A;  1XNI A;  2PVD B;  5CO7 A;  1M1K R;  1LCK A;  3VUB A;  2EGA A;  3JB9 I;  3CCM Q;  1UDL A;  2CP5 A;  3ASK A;  2O4X B;  3SEM A;  3CC7 A;  2IPO B;  4J9G A;  2HBW A;  2H8H A;  1KHI A;  5KYW A;  4RG2 A;  2X4J A;  1Y71 A;  1M8M A;  1G8X A;  1X2Q A;  3CCQ T;  2YUN A;  3OYE A;  5I11 A;  1WQ7 A;  4C8Q C;  3CC2 A;  2A3L A;  1D3B B;  3OS2 A;  4F7U F;  5FU6 B;  1E7O A;  3M0R A;  1BU1 A;  3JCM e;  3OYC A;  2LDM A;  1NM7 A;  1KQ2 A;  3S6W A;  2D0Q B;  4QW2 A;  2MK5 A;  2MYS A;  4FYV B;  1YBY A;  1QW1 A;  3VS1 A;  3GOX A;  3X20 B;  4KRT A;  3M4Y A;  2F2X A;  2R5M A;  2GCX A;  3KFV A;  3GBQ A;  4KH1 B;  1Y0M A;  4M77 A;  4E7I A;  3VKI A;  3CCE Q;  2P0P A;  2QAZ A;  4JRQ A;  1PD1 A;  4KT0 E;  2DTI A;  3E2U A;  1NBE B;  3FEO A;  4PL6 A;  3TVT A;  4LDY A;  2RHY A;  1ZLM A;  3NTI A;  1RAC B;  4M7A A;  1G3Y A;  5CIU A;  2QEX Q;  1VQN T;  1HD3 A;  5GAN g;  3CPF A;  2AKK A;  2DD4 A;  4J7I A;  3OMG A;  3H0I A;  1TH7 A;  2FB7 A;  1H8K A;  3CPW A;  1X6G A;  4ZGD B;  4M78 D;  1I81 A;  4M75 F;  3CBM A;  1Q7Y C;  3GIB A;  2E64 A;  5FWB A;  4DBH A;  3CCQ Q;  4IUQ A;  2D1X A;  1AD5 A;  2FZK B;  2MCN A;  3PE0 A;  1YWO A;  3REA B;  2PVO B;  2DZ9 A;  1QVF A;  4ATO A;  3Q1J A;  1QQJ A;  2P84 A;  2ED1 A;  3OS0 A;  4RTX A;  2A37 A;  1BIB A;  3PVQ A;  3CCL A;  1VIF A;  5AYF A;  2DRM A;  5IH2 A;  3M0Q A;  3CCV T;  2CZ0 B;  3INZ A;  1B07 A;  1TUG B;  2V8J A;  3EGX A;  3V8L A;  3I56 A;  5GAN j;  3MEV A;  3OYD A;  3JCM W;  1TTH B;  2COZ A;  1WHJ A;  2RI3 A;  3QWX X;  1SHF A;  2YHT A;  3SFM A;  3CCU T;  1WJS A;  1N9R A;  3VS3 A;  4C92 A;  8ATC B;  4FSX A;  1VQN Q;  1M2V B;  1VA7 A;  2PNI A;  3OS1 A;  2DER A;  4XK8 E;  1Z9Q A;  4C5H A;  1OOT A;  4C5G A;  3EFO A;  1Y7X A;  4J83 A;  1V1C A;  1KJW A;  4OB1 B;  4EPC A;  4F7U B;  3MEU A;  2D9T A;  4PJO E;  2X4W A;  3VYH B;  1VQ6 A;  3BFM A;  2KR3 A;  2OX7 A;  2V8K A;  5A2Q E;  1WNL A;  4GBQ A;  4M77 F;  1WX6 A;  2K9G A;  4M7A E;  3HRU A;  3A98 A;  3G7Z A;  4C8Q A;  2CS7 A;  2GQV A;  3NHN A;  2OAU A;  4M7D G;  5LJ5 f;  1TXQ A;  3LGL A;  1HYO A;  4Z02 A;  4M78 E;  1MMG A;  5IT9 E;  3V7C A;  4QKU A;  1BI1 A;  5A0D A;  2LJ3 A;  1YIT T;  1ZUU A;  2ROL A;  4B9W A;  3CCV Q;  4JJD A;  3RNJ A;  4IKF A;  2LJ0 A;  2KVQ G;  3CCS A;  2M16 A;  3RMQ A;  2QQR A;  2ZZD A;  3TCJ A;  1U8R A;  1BYM A;  1S72 A;  1FX7 A;  3C0C A;  1K8A U;  1QCF A;  2FL7 A;  1UTI A;  1YNZ A;  4OMP A;  2KRS A;  2VYT A;  3G6E A;  3CXC S;  1OX8 A;  4LXC A;  2CRE A;  2VWF A;  2X4X A;  1WJR A;  1ARK A;  1WXT A;  3M0P A;  2CDT A;  4FSS A;  4M7D C;  3REB B;  1AEY A;  4D6W A;  1QMC A;  5LJ3 h;  2VAS A;  2X3X D;  3G4S A;  3EHR A;  4BDZ A;  4Z8A A;  3AT1 B;  3JCM c;  3PGG A;  3EFS A;  5HK3 A;  3CMA T;  3CC4 T;  2O01 E;  5CVI A;  3LX7 A;  2EJF A;  4PFO A;  4PJN A;  5GAN 2;  3OYN A;  2JS2 A;  3CME A;  1OU8 A;  3WVE B;  2K2V A;  1Y96 B;  1ZHI A;  2HNI A;  1GXI E;  1KQS S;  1TS9 A;  2KXD A;  1H64 1;  1PC0 A;  1PNJ A;  2EYQ A;  5GAN d;  7AT1 B;  1SF9 A;  4C92 F;  1YIJ Q;  2CUD A;  1YIT Q;  2MAM A;  3ZBD A;  2YT6 A;  2YRV A;  2EKH A;  1VQ7 A;  3E19 A;  1AWO A;  5KYW B;  1M9S A;  1YHQ T;  2QQS A;  2DL7 A; 
#chains in the Genus database with same CATH homology
 1U3O A;  2I0N A;  4HVV A;  1SSH A;  2FO0 A;  3IQL A;  2O9V A;  1YP5 A;  2KRN A;  5IHN A;  2KEA A;  3VS5 A;  1X27 A;  1I07 A;  2LMJ A;  1U5S A;  1ZBJ A;  5FWC A;  1GFD A;  2BZ8 A;  2C0O A;  4F16 A;  3H41 A;  2RMO A;  2DJQ A;  2B86 A;  2J6O A;  2LQN A;  4J9D A;  2CH4 A;  3PVL A;  4M4Z A;  2AZV A;  2RQW A;  1AVZ C;  2JXB A;  1MUZ A;  2KXC A;  1AWW A;  2L3P A;  2NWM A;  1UHF A;  1GFC A;  4CC2 A;  1OEB A;  1IO6 A;  1E6G A;  1ABO A;  1QKW A;  1CKB A;  3TSW A;  2JM9 A;  5IXB A;  1PWT A;  2DYB A;  2J05 A;  1X69 A;  2EBP A;  4OMQ A;  1JQQ A;  1AZE A;  1EFN A;  2W0Z A;  4RTY A;  1K1Z A;  1XOV A;  2OI3 A;  2EW3 A;  2FPF A;  2FRW A;  3FJ5 A;  1AWJ A;  3VRY A;  2FEI A;  1SPK A;  4CC7 A;  4J9C A;  4Z88 A;  1CKA A;  2EVR A;  1FMK A;  1SRM A;  2DA9 A;  1M30 A;  2VVK A;  1W70 A;  3I9Q A;  2DNU A;  1WDX A;  4CC3 A;  2RQV A;  2YUO A;  1WA7 A;  2M0Y A;  2DRK A;  1E6H A;  1QKX A;  4D8K A;  1T3S A;  2RQR A;  2J6F A;  2JTE A;  4CC4 B;  3ZL7 C;  2LZ6 B;  1GL5 A;  1RUW A;  4ZNX A;  3VRZ A;  1SHG A;  2D8H A;  2OAW A;  1K9A A;  4JZ4 A;  1PKS A;  2C0I A;  2PTK A;  3EG3 A;  4AFS C;  1UG1 A;  2ENM A;  5IXF A;  2DLP A;  2MIO A;  1W6X A;  1JXO A;  1YCS B;  1TUC A;  1H92 A;  1UEC A;  2RF0 A;  1T0J A;  1WI7 A;  3TSZ A;  2CUB A;  2GGR A;  1QWF A;  3JV3 A;  1ZUY A;  2LCS A;  5GJV B;  1I0C A;  1RLQ C;  1X2K A;  4EIK A;  2BTT A;  4AG1 C;  2RPN A;  5GJW B;  1WLP B;  1BK2 A;  3I5S A;  4IIM A;  3NGP A;  2KYB A;  3M0S A;  1Z9Z A;  2LQW A;  1UJY A;  1M27 C;  2DIL A;  1GCQ C;  3SHW A;  1AZG B;  4LNP A;  2YDL A;  3UA7 A;  2AK5 A;  2JT4 A;  2CSI A;  2RQT A;  1T0H A;  3VS0 A;  4F14 A;  1YWP A;  4IIO A;  2RQU A;  1J3T A;  4JZ3 A;  2DX1 A;  1LCK A;  2EGA A;  1UE9 A;  1PRM C;  1UDL A;  1BBZ A;  3SEM A;  2KE9 A;  4J9G A;  4HCK A;  2O9S A;  2HBW A;  2H8H A;  4DEY A;  3NPF A;  1M3A A;  3EHQ A;  2F2W A;  1M8M A;  1X2Q A;  4R0K A;  2YUN A;  4OMM A;  1X43 A;  5I11 A;  2EYZ A;  2ROT A;  4X1V A;  2D8J A;  3NMZ C;  1E7O A;  3M0R A;  2LX7 A;  1BU1 A;  2J7I A;  1S1N A;  2O31 A;  1NM7 A;  1QLY A;  5HCK A;  1SEM A;  1PKT A;  3H0H A;  2G6F X;  2YUP A;  3VS1 A;  1JXM A;  4GLM A;  2AZS A;  4KRT A;  2JS0 A;  2F2X A;  1JEG A;  1QWE A;  3KFV A;  3I5R A;  2LP5 A;  3GBQ A;  4HXJ A;  1Y0M A;  2KT1 A;  2RNA A;  4D8D A;  2V1R A;  1NEG A;  2D0N A;  1HSQ A;  2KBT A;  1K0X A;  2FPE A;  3EG1 A;  1NEB A;  4JPB W;  3TVT A;  1VYV A;  1A0N B;  1MV0 B;  4QT7 A;  1ZLM A;  1VYT A;  4AG2 C;  2C0T A;  2A08 A;  2JMA A;  2K3B A;  1RLP C;  1KFZ A;  1HD3 A;  2OJ2 A;  2AKK A;  2L2P A;  3H0I A;  1H8K A;  3R6N A;  1X6G A;  1UGV A;  1OPL A;  2DL5 A;  5IHI A;  3VS7 A;  2EGE A;  2L3S A;  2A36 A;  4J9F A;  5FWB A;  1NYF A;  2J6K A;  2P4R A;  2M51 A;  4RUG A;  1GBR A;  2D1X A;  2O88 A;  1Y57 A;  1AD5 A;  3VS4 A;  2MCN A;  3PE0 A;  1YWO A;  3REA B;  2EQI A;  2YUQ A;  2ED1 A;  1WIE A;  4RTX A;  2A37 A;  1PRL C;  3PVQ A;  1HJD A;  5FW9 A;  2X3W D;  4Y92 A;  2HCK A;  1KSW A;  3ULR B;  2DRM A;  5IH2 A;  3M0Q A;  2EPD A;  2F2V A;  2JW4 A;  2KRM A;  5I22 A;  1B07 A;  1UHC A;  1K0S A;  1G83 A;  4RTU A;  4J9I A;  4RTV A;  4OML A;  1U06 A;  2DE0 X;  2JMC A;  2ED0 A;  1GRI A;  2BZX A;  4HVW A;  4J9B A;  2FRY A;  3UAT A;  3QWX X;  1SHF A;  2LNH B;  3I35 A;  3QWY A;  2DL4 A;  2DBM A;  1CSK A;  3VS3 A;  3UF4 A;  2AKL A;  1TUD A;  2ESW A;  2PZ1 A;  1OV3 A;  1VA7 A;  2CT3 A;  2YSQ A;  2PNI A;  2BZY A;  2J06 A;  2HSP A;  4Z89 A;  1Z9Q A;  2DL8 A;  4RTW A;  2GBQ A;  1KIK A;  4RTZ A;  1K76 A;  1OOT A;  3UA6 A;  1W1F A;  3EGU A;  4E6R A;  1X6B A;  2KRO A;  4J9E A;  1V1C A;  1KJW A;  4DEX A;  2HDA A;  2KT8 A;  4ORZ A;  1VYU A;  2GQI A;  1I1J A;  2QDL A;  1M3B A;  1ZSG A;  3LH5 A;  4LE9 A;  2KR3 A;  2RN8 A;  2SEM A;  4GBQ A;  2K7A A;  1RI9 A;  2DL7 A;  2EGC A;  2EYW A;  1NLO C;  1T3L A;  1WX6 A;  2FG0 A;  3M0U A;  1H3H A;  1K4U S;  2K9G A;  3A98 A;  4ESR A;  2XMF A;  2GNC A;  3NHN A;  4AFQ C;  2KYM A;  2K79 A;  2HEQ A;  5IHK A;  1AOJ A;  1WXB A;  2L0A A;  2ABL A;  2LJ3 A;  1ZUU A;  1AWX A;  2ROL A;  1PHT A;  4JJD A;  3RNJ A;  2LJ0 A;  1BB9 A;  1ZX6 A;  4LN2 A;  4K11 A;  3VS2 A;  4AFU C;  5EC7 A;  3U23 A;  4A63 B;  4JJB A;  2CSQ A;  4LUD A;  1ZUK A;  2SRC A;  5L23 A;  1B3Q A;  3C0C A;  1OPK A;  4AFZ C;  2IIM A;  4OMN A;  4J9H A;  4HVU A;  1QCF A;  3EG2 A;  1UTI A;  1YNZ A;  2DL3 A;  1YN8 A;  4OMP A;  2KRS A;  2DVJ A;  3EG0 A;  1GBQ A;  2VKN A;  1M3C A;  2K2M A;  2DBK A;  3VS6 A;  2KGT A;  2CRE A;  2VWF A;  1GCP A;  2EYX A;  4RTT A;  2DM1 A;  3THK A;  1ARK A;  1WXT A;  3M0P A;  2CDT A;  4FSS A;  3REB B;  1AEY A;  2DMO A;  4OMO A;  1UUE A;  1WYX A;  2X3X D;  3EHR A;  2E5K A;  1UFF A;  4Z8A A;  1UJ0 A;  4F17 A;  2L3Q A;  2A28 A;  1FYN A;  2LJ1 A;  3RBB B;  1SRL A;  1NG2 A;  2V1Q A;  5ECA A;  2W10 A;  4JJC A;  1WFW A;  2NUZ A;  3CQT A;  1NLP C;  1JO8 A;  2CT4 A;  3M0T A;  1N5Z A;  4LUE A;  2JM8 A;  2GTJ A;  2KNB B;  2CH4 W;  2JS2 A;  3H0F A;  1G2B A;  2DF6 A;  1JU5 C;  2GTO A;  2KXD A;  1ABQ A;  2FPD A;  3O5Z A;  1PNJ A;  2O2O A;  1WXU A;  2CUD A;  4WCI A;  2YT6 A;  2EKH A;  1GCQ A;  1MV3 A;  2K6D A;  1AWO A;  2ECZ A;  1TG0 A;  1NYG A;  2MOX A;  2EYY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...