1YWPA

Phospholipase cgamma1 sh3
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
62
structure length
62
Chain Sequence
SPTFKSAVKALFDYKAQREDELTFTKSAIIQNVEKQDGGWWRGDYGGKKQLWFPSNYVEEMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase ga
publication title Structural Basis for Recognition of the T Cell Adaptor Protein SLP-76 by the SH3 Domain of Phospholipase Cgamma1
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 13
structure length 62
sequence length 62
ec nomenclature ec 3.1.4.11: Phosphoinositide phospholipase C.
pdb deposition date 2005-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ywpA00
2B86A 4WCIA 1GCPA 2RQUA 3M0TA 1UG1A 1OOTA 2DM1A 1PRMC 1JXMA 2CT4A 4JZ3A 3UF4A 4AFZC 1YN8A 4K11A 1QWEA 1SPKA 2DBKA 1W1FA 4J9HA 1JQQA 1WXTA 3UA6A 2PTKA 3NPFA 2GBQA 1SSHA 2DRMA 3PVQA 2YDLA 2K6DA 4IIMA 1CKAA 2ECZA 3CQTA 1JU5C 3I5SA 1VYUA 5HCKA 4J9DA 2J6FA 1YWOA 2EGAA 1WDXA 2ROTA 2CDTA 1QKXA 2JXBA 1M30A 2FPDA 3EG0A 3IQLA 1K0XA 2CH4A 2GTJA 3FJ5A 2CH4W 1AWOA 1M27C 2FPEA 2RPNA 4FSSA 3TSZA 1UHFA 1FMKA 1X27A 2EBPA 2EPDA 2KR3A 4RUGA 1HSQA 2BZXA 4ZNXA 4GBQA 2F2WA 3VS1A 2LJ1A 1S1NA 1BB9A 2KT8A 2A28A 2O31A 2EQIA 1MUZA 1XOVA 3VS6A 2SEMA 2DLPA 3H0IA 4AFSC 3M0SA 5ECAA 2LCSA 2D0NA 2JS0A 2E5KA 1MV0B 1U06A 1TUCA 1AD5A 2NUZA 4LE9A 1Z9ZA 2LNHB 4CC7A 1GBRA 1N5ZA 4RTVA 2KRMA 4JJBA 1VYTA 4AG2C 2P4RA 2DL4A 3VS7A 1NEGA 1IO6A 2DF6A 2D8JA 1KFZA 2A36A 1QKWA 3PVLA 1WIEA 3M0RA 2OJ2A 1M8MA 1ABQA 1PKSA 2J05A 3NGPA 2K7AA 2EKHA 3EGUA 1GCQA 4QT7A 2C0TA 1Y0MA 2MCNA 2VVKA 3U23A 2HEQA 3ZL7C 2K2MA 2JT4A 2KXCA 1VA7A 1YWPA 2VWFA 5FWBA 2FEIA 2A37A 1NYGA 4F14A 1Y57A 4J9GA 4J9BA 2RQVA 2CUBA 2HSPA 4RTYA 3THKA 2DE0X 3A98A 1ZBJA 4KRTA 1AWXA 2L0AA 2AKKA 4ORZA 2D8HA 2O9SA 3H0HA 4JJDA 2JM8A 4OMQA 5GJWB 1LCKA 2CREA 1FYNA 2OAWA 2V1QA 1OV3A 2K9GA 1K9AA 3NHNA 2ED1A 3VS2A 1JXOA 4J9FA 4OMPA 2QDLA 1WXBA 3EHRA 4D8DA 1W6XA 1X2QA 2C0IA 1K4US 2D1XA 2RNAA 2V1RA 2YSQA 1SRLA 2YUPA 3RNJA 5I11A 2RQRA 4CC2A 1YP5A 2W10A 2JMCA 4OMLA 1BBZA 4AG1C 1UFFA 1UE9A 2LP5A 3EG1A 1TUDA 2DL7A 2FPFA 1X2KA 1ZUUA 1UECA 2KGTA 3QWYA 1I0CA 2AZSA 1GBQA 2RMOA 2O2OA 4AFUC 3VS0A 4JZ4A 1UTIA 1KJWA 3VS3A 2LQNA 1U5SA 4CC4B 1SEMA 1H8KA 1B3QA 3TVTA 2KE9A 5IHIA 3EHQA 2DL8A 1RLQC 1ARKA 3M0UA 2DMOA 4A63B 3I5RA 2M0YA 2CSIA 3R6NA 3O5ZA 1GFCA 2CSQA 3JV3A 1M3AA 4RTZA 2LMJA 2FRYA 1AZEA 3VS5A 2O88A 1UJYA 2RQWA 2A08A 4E6RA 1H92A 1I07A 2J06A 4JPBW 4RTXA 1PHTA 1OPKA 1G83A 1GRIA 2YUNA 2EYZA 2G6FX 2KT1A 1EFNA 4F17A 2EYXA 2LX7A 4RTUA 2L3SA 2RN8A 2EYWA 2LZ6B 2IIMA 2RQTA 4LUEA 4OMMA 1JEGA 1GCQC 1RLPC 2RF0A 1AOJA 2F2XA 2PNIA 1UUEA 4X1VA 2FO0A 4CC3A 1TG0A 2HBWA 2KBTA 1OPLA 4RTTA 1OEBA 3M0QA 1BK2A 2EVRA 3H41A 2KROA 4Z88A 2JMAA 4F16A 1AVZC 4DEYA 1B07A 1QWFA 1WYXA 1E6GA 1K0SA 1ZSGA 1YCSB 2CUDA 1K1ZA 1PKTA 3TSWA 3UATA 1ZX6A 3H0FA 1NEBA 2LJ0A 4M4ZA 2ABLA 4OMOA 1UHCA 4ESRA 1UDLA 1J3TA 5GJVB 2F2VA 1GL5A 2JW4A 3NMZC 1ZUYA 4Y92A 1E6HA 1YNZA 2J7IA 1X6BA 3I35A 2L2PA 2BZYA 2DJQA 1ZLMA 4Z8AA 1H3HA 5EC7A 4JJCA 2KYBA 1T0HA 1WLPB 2GTOA 2ROLA 2AK5A 3ULRB 3RBBB 1PNJA 2OI3A 2YUOA 1KIKA 2C0OA 1CKBA 2KEAA 2KXDA 1X43A 2JTEA 2J6OA 4IIOA 2M51A 1QCFA 2KNBB 1UJ0A 1WA7A 4EIKA 2DVJA 1SRMA 2VKNA 1MV3A 3KFVA 1UGVA 2EGCA 2FG0A 4HCKA 1NYFA 1RUWA 3VRZA 2HDAA 3EG2A 1T0JA 2KYMA 5IH2A 2K3BA 1VYVA 2K79A 2ESWA 4HVUA 4HVVA 2DL5A 2O9VA 1AWWA 3PE0A 2X3WD 1M3BA 1QLYA 1SHFA 2DRKA 2YT6A 4Z89A 2L3PA 1K76A 1AWJA 2XMFA 5IXBA 1SHGA 3I9QA 4D8KA 2PZ1A 1PRLC 2SRCA 2DYBA 5IHNA 2X3XD 2GNCA 1M3CA 1A0NB 2DILA 2KRSA 5FW9A 1X69A 1ABOA 2EGEA 3VS4A 2KRNA 2L3QA 2AZVA 3SHWA 3UA7A 2JM9A 2LQWA 1WFWA 2GGRA 1HJDA 3QWXX 4LN2A 1WXUA 3REAB 2EYYA 3C0CA 3EG3A 2MOXA 1KSWA 1CSKA 2GQIA 4LNPA 4J9EA 2LJ3A 4LUDA 5FWCA 1WI7A 2BZ8A 4J9IA 1AZGB 1PWTA 2J6KA 1U3OA 5IXFA 2DA9A 2ENMA 4HXJA 2AKLA 2YUQA 3M0PA 2CT3A 2NWMA 1JO8A 2JS2A 1E7OA 1T3LA 2DNUA 4HVWA 5IHKA 1X6GA 1T3SA 3LH5A 1HD3A 4AFQC 1BU1A 1WX6A 3REBB 3SEMA 1ZUKA 4RTWA 1RI9A 4OMNA 2BTTA 2DBMA 1NM7A 4GLMA 4DEXA 5L23A 1NLPC 1GFDA 2EW3A 2HCKA 1G2BA 1V1CA 1NLOC 2W0ZA 4J9CA 2DL3A 2ED0A 4R0KA 1I1JA 2MIOA 2H8HA 1Z9QA 2I0NA 1NG2A 3VRYA 1AEYA 2DX1A 1W70A 5I22A 2FRWA 3GBQA
chains in the Genus database with same CATH superfamily
5KYWB 1SSFA 1JJ2S 3ER0A 1IHWA 4C8QF 1RI0A 1WPYA 3MEWA 3M9QA 3G71T 4HT9A 5KCOA 3M55A 3GLXA 3CMEQ 3UF4A 1QWEA 2VXFA 1W1FA 2DAQA 1MNEA 1TH7A 3UA6A 1RAGB 2GBQA 3JCMg 2K6DA 1YJ9Q 4M7DG 1N9RA 2EJFA 1KQSS 1JU5C 1TUGB 5HCKA 1WDXA 2E1HA 4C5GA 1VQ7A 3VJPA 1F1BB 1NJIC 2NUPA 3VKIA 2K57A 4BD3A 3E19A 3IQLA 4AMCA 5GAMh 2R57A 3FJ5A 2FPEA 4DBQA 4FSSA 3ZFJA 1UHFA 2MYSA 2ZZDA 4M7DF 1Q86R 2FL7A 1UGSB 1WQWA 2BZXA 1Q82R 2LJ1A 1ZSZA 1IGQA 2XICA 4OB0B 3MCAB 1Q86U 3PIPA 3P8DA 2A28A 2O31A 2LTOA 2EQIA 1Q82U 1YI2T 5M9OA 3VS6A 9ATCB 3A8LB 4C5HA 2D0NA 1WZOA 4PJOG 3X26B 2JS0A 3EGDB 2PVGB 1U06A 1AD5A 5KCHA 5GAN7 2NUZA 4FIBA 5FU6B 4M7AC 2LNHB 1VQPT 2OX7A 5KE3A 4OMFB 4RTVA 4E7SA 1M1FA 5GAMe 2XU8A 4FYXB 3KXTA 4KUDK 3CC7Q 1OQKA 1WIEA 1TSFA 5KYUA 1PKSA 4BDZA 2K7AA 4MMLA 2EKHA 3EGUA 2MCNA 2C0TA 1Y0MA 1YHQA 1M2VB 4PJOF 1IZ6A 2VVKA 3ZL7C 3CCQQ 4BUGA 3SB2A 1BI2A 1VA7A 3OA6A 1YWPA 3A8GB 4AT1B 3D7SB 3EGXA 4IUQA 1D0ZA 1NYGA 2VGNA 3JB9D 4M7DC 2HKNA 3PMTA 2CUBA 3EH1A 2IG0A 1I5LA 2P0PA 3FIFA 3A98A 1Q81R 4FYVB 2AIRB 3RIRA 5CKEA 5KE2A 2P0KA 2D8HA 2O9SA 2JM8A 2ZPBB 5GJWB 3ME9A 5GAOm 1Q81U 2CREA 1FYNA 2V1QA 1VQ7T 2ED1A 4M7AE 3HRSA 3CCUA 1NBEB 3OYHA 1WXBA 4D8DA 3FRNA 2C0IA 5GMKl 1C1AA 1X6OA 5GAN5 3OBYA 1Y96A 5GMKm 4PJMA 2BKDN 1D09B 1BBZA 3OYBA 4M7AD 4LD9K 2AZSA 1GBQA 1VUBA 2O2OA 4AFUC 1TXQA 2VYTA 1TOVA 4M7DE 1B34A 1B3QA 3E9FA 5GAN2 1C0MA 3P8HA 1RLQC 3HTRA 4F7UB 1I5OB 3R6NA 2M1HA 2VASA 3M54A 2CSQA 3L2QA 4PJJA 3JV3A 1M3AA 3M4GA 2QEXA 4JRIA 4M7DD 2M02A 2LMJA 2FRYA 3VS5A 3JCMf 3I56Q 2O88A 2DD4A 1EZZB 2HBPA 1VIFA 1H92A 1NZ9A 2OTLA 1OPKA 3LYIA 4QVZA 5I21A 4F17A 3CC2Q 2LX7A 3V8KA 2RN8A 2LZ6B 5CKBA 1WHGA 1YHQT 3CD6Q 1D1CA 1JEGA 3LH0A 1K73R 3QUIA 2PNIA 3MEAA 4X1VA 5LJ3g 3CCSA 1XTDA 2M0OA 2KBTA 4J6XA 2LDMA 1OPLA 2XDDA 1BK2A 1K73U 1RADB 3HFNA 1VQPQ 4LXCA 2P0QA 1DJ7B 2KQWA 3J81E 1YCSB 1K1ZA 3VUZA 5IT9E 1PKTA 3L2ZA 4OGCA 2D0QB 3H0FA 1D1BA 3UDCA 2QQRA 2AT1B 3CCUT 1KC8R 4FYYB 1BCOA 1WGSA 3VYGA 1WHJA 2LT1A 2XI9A 1UHCA 3CCRQ 1UDLA 3BFMA 2NUPB 4TVRA 4C0ZA 1M1GA 4KGXB 3OYMA 2VXEA 2RI2A 2L2PA 1Q81C 5GANf 3JCMh 2KYBA 1T0HA 4FL6A 1WLPB 4PJLA 3CBPA 1R0CB 1QW1A 2ROLA 2PU9B 4DQ2A 2YUOA 1KIKA 4FU6A 2KEAA 1VQ7Q 3OYAA 2M51A 2ZPGB 1UJ0A 2RO0A 3OS0A 3CMEA 1MV3A 2RI3A 3GIBA 4PFPA 5DLQE 4HCKA 2LQ8A 4D6WA 2BE9B 3HRTA 1NYFA 2QEXT 2MPXC 4KT0E 2KYMA 1XNIA 2K3BA 3RKWA 5LJ5j 4BB7A 4QW2A 3PE0A 2DETA 2OTLT 2YT6A 4NOYA 5GAN6 2E12A 2WACA 2XMFA 1VOMA 3OS5A 1YJWQ 1VQNA 5IXBA 1SHGA 2DYBA 2KSSA 2X3XD 1M3CA 1RAFB 2V26A 5KYUB 2X51A 5FW9A 3CCST 3FC3A 1FMWA 2ZAEA 4N0AC 3H8ZA 3X24B 3OYFA 3TU4K 3ASKA 3LWHA 2ATCB 5CIUA 3EGXB 4A4KA 4ANJA 5GANh 2GGRA 4GY5A 3OYEA 5HK3A 1CSKA 3SWNC 4J9EA 5HKCA 5FWCA 1WI7A 3JCMV 5GAN3 1AZGB 1PWTA 3L2RA 1K73C 1D0XA 1YHQQ 2DO3A 2ENMA 2KMTA 3M0PA 1T3LA 4HVWA 4E7HA 4N4HA 4PFZA 1X6GA 1T3SA 3LH5A 1HD3A 3CEYA 4AFQC 1BU1A 1Y96B 2RI5A 2X9HA 4CRIA 2BTTA 1W2BA 2DBMA 4DEXA 5L23A 2QGGA 3INZA 2KI7A 1RL2A 1V1CA 2NUTA 1FX7A 4R56A 1BKBA 1QCNA 2DL3A 3L42A 1KC8C 2ED0A 5GANe 2I0NA 1KD1R 1OZ2A 1WHMA 3CCQA 1W70A 3CMET 3QDFA 3GBQA 2B86A 2RD1A 4WCIA 4ZTJA 1KD1U 1GCPA 5J39A 3M4YA 3TREA 3MPUB 2ZPFB 3CPWS 2PUKB 1D0YA 4MDXA 1PRMC 4JZ3A 1QVGA 4AFZC 1WQ7A 1YN8A 2K5IA 4L59A 3PGGA 5KYXA 4J9HA 1JQQA 1VQNT 1WXTA 5GAOp 1VQ8Q 1OZ3A 1MMGA 4WTOB 5CVIA 3PTAA 4IIMA 1CKAA 3WVEB 3ZBDA 4LDUA 4WF2A 4J9DA 2J6FA 1QQJA 1WJRA 2CDTA 2QEXQ 2JXBA 4M78F 2FPDA 3EG0A 5CQYA 3HKSA 3OYJA 2VB6A 2MMPA 2OTLQ 4RKUE 1AWOA 1RAHB 2RPNA 3QSUA 3PFSA 1FMKA 2EBPA 1U8RA 3OSSC 4Y91A 1KHIA 1S1NA 1BB9A 2MI6A 1JJ2A 2HMAA 2E4HA 5GMKe 2E3IA 3X28B 1H641 1MUZA 3RKXA 1XOVA 4DBHA 3JCMc 1Y7XA 3BW1A 3H0IA 3I56A 3M0SA 4HKEA 4ZN1A 2LCSA 2EQKA 2DERA 1VQKA 2E5KA 2E6NA 1QP2A 3CC7T 4OB3B 1BI0A 1VQ5Q 3CC2A 2DK3A 4FW2A 1M4ZA 1YIJA 4CC7A 1KQSA 3CC4A 5A2QE 3DB4A 3J80E 3CD6A 5AT1B 2P4RA 3CCQT 2L8DA 3PMIA 3VS7A 4FM4B 2LQKA 2JUFA 1KFZA 2A36A 3PVLA 4PLIA 1OU9A 5L8RE 3M0RA 2OJ2A 4M78C 1ABQA 2DVEA 3META 4OP0A 4E2FB 3RMQA 3TCJA 3J7AF 1GCQA 2HEQA 2RJCA 2KXCA 3CXCS 2VWFA 1WHHA 1QVFS 1KG1A 1MGQA 4M7AG 2PVDB 5KH6A 2MAMA 2K4YA 4J9GA 4J9BA 2X35A 2RQVA 2DXBA 3WVDB 2DE0X 1ZBJA 1BYMA 4EMHA 4ORZA 4JJDA 2ZPIB 1AHJB 3HPWA 4E7IA 3OYLA 3CCRA 4OF1A 4BI8B 1IREB 2OAWA 3S3MA 1OV3A 4OMPA 4J9FA 4JLGA 2QDLA 3EHRA 1W6XA 1K4US 2RNAA 2V1RA 4B6MA 4M7AF 3OW2S 4CC2A 1D3BA 2W10A 2ZCFB 3O8VA 5IAYA 1UE9A 4M77A 4M78E 1VQNQ 4C92G 4VUBA 1X2KA 3MP8A 3OY9A 2KGTA 3NTKA 2RMOA 5CCAA 2M16A 3HL8A 2ZPEB 1KJWA 2QDYB 4JRKA 2QASA 4A4EA 2HKQB 4M78D 2NLUA 6AT1B 3N5BB 5LJ3j 1TWBA 2KE9A 3I56T 2K5FA 4J7FA 1UB4A 2DL8A 3M5AA 1ARKA 3M0UA 1VQKT 2Y90A 2V8IA 3I5RA 3OBWA 4BE2A 4RTZA 3CC2T 4C92F 1YJWA 3QO3A 1AZEA 2KK4A 1YIJT 4JUVA 3CC4T 2NUTB 1UJYA 2RQWA 3CD6T 4M75A 4E6RA 1X75C 2J06A 3GF5A 4E47A 1G83A 3MP1A 2YUNA 5LJ5d 3JCMW 2G6FX 1EFNA 2EYXA 4RTUA 1UGQB 2FVUA 1RACB 4JLIA 2IIMA 3LLRA 4OMMA 3TEEA 1C6VX 3CCJA 2YLBA 5GANg 2A3LA 2YRVA 3QZ5B 3FDRA 4O6JA 1QVPA 4J7IA 3LX7A 2PQWA 3H41A 2GF7A 3HRUA 2G3RA 2D6FA 2WSCE 2XDBA 5KYXB 4IUUA 1AVZC 3LW5E 4X34A 3CCRT 1ZSGA 2CUDA 3HP9A 1LVKA 2COWA 4XAXB 3T9NA 2DKGA 3OYNA 2DTOA 2LJ0A 3A8HB 4M4ZA 4LDWA 5KYYA 1VQ4A 3RMSA 4KULA 4BI3A 1OX9A 2F69A 3QYGB 3DKMA 5GJVB 4C92C 5GAOl 2XKOC 3NMZC 1XQHA 5D7UA 2J7IA 1X6BA 2PVOB 2BZYA 3CBMA 4A4GA 3JB9H 2DD5A 1K9MR 4DOVA 4CI0C 2V8KA 2AK5A 4NL3A 3ULRB 3RBBB 2HSEB 2OI3A 1M8VA 3JB9J 2C0OA 1K9MU 1ZHIA 2E10A 3RERA 3GPLA 5FU7B 2J6OA 1QCFA 5GAMj 3CCLA 2VUBA 3EFRA 2GFAA 2KNBB 2CP0A 1SRMA 2VKNA 3KFVA 3C12A 3C94A 3EG2A 1YJWT 3OMCA 1VYVA 1VQ8A 2K79A 3BDLA 2O9VA 4B9XA 2GFUA 3HHTB 4QVDA 2K2VA 2L3PA 1K76A 4C92E 1AWJA 1EIFA 3G6EA 2CGHA 4R55A 1MHNA 3JCMb 4D8KA 1G8XA 2SRCA 8ATCB 3X25B 3L2UA 1Q86C 3CCJT 4NS5A 3JCMQ 1VQKQ 2D9TA 1Q82C 4C92D 4Z02A 1N27A 2DXUA 2AZVA 2E3HA 1PSFA 2FZGB 3QBYA 1YIJQ 3A8MB 1MMDA 2LQWA 3CC4Q 3QWXX 1G5VA 1WXUA 2JZ2A 4LNPA 5FROA 1FWZA 2JOYA 4LDXA 4IKFA 2BIVA 2EWNA 2XIDA 4ATOA 2YLCA 2EQJA 1VQ4T 5IXFA 2DA9A 5C6SA 4C8QA 2YUQA 2CT3A 2NWMA 2JS2A 3OMGA 4QVCA 2RK1A 2GQVA 3CMAA 1VQ5A 3SEMA 1WX6A 1ZUKA 3WXMB 4XK8E 3RDVA 1UGRB 2F1LA 1D3BB 3V8LA 4GLMA 1HXDA 1GFDA 2HCKA 4M77B 4F7UG 1NLOC 1ZBXA 5FU6C 1RAEB 4DOWA 2MWPA 1HK9A 2FB7A 4FW1A 5HY6A 5GAOn 1Z9QA 3CCLT 3S6WA 4DA4A 1AEYA 2DX1A 2XG8D 5I22A 2FRWA 1N8RR 2RQUA 1VQ8T 1OOTA 1W4SA 5C0MA 1N8RU 1ZSZB 4F7UF 1JXMA 2CT4A 2WSFE 4ELYC 3QZ9B 4M7DA 2QA4A 3G6ET 4M75B 4NL2A 3JB9I 2DRMA 2CZ1B 3DB3A 2BUDA 3CQTA 2O4XA 4P5NA 2EGAA 3V7CA 3OYDA 5HK0A 2K5LA 1QKXA 2RH2A 2IPOB 1M30A 1G3YA 1M1KR 1OI1A 2CKKA 4X9CA 1K0XA 2GTJA 2CH4W 3QPHA 1M27C 4EMGA 3JSCA 3GNGA 1X27A 1LOJA 1M1KU 4XU3A 2KR3A 1EX4A 4RUGA 1HSQA 4GBQA 2F2WA 2P4TA 2KT8A 3MO8A 2CS7A 3CCJQ 3P8BB 3CBOA 5KYYB 4PKCC 3CPWA 2DFUA 5J3BA 4PJOA 1VQ5T 3CMAT 3QJ6A 2LT4A 4KGVB 3RKYA 2HAXA 3H9NA 2DLPA 4AFSC 2QQSA 2DEQA 2QGFB 4BDYA 5LJ3d 4J83A 4J5YA 1Q7YR 1TUCA 1JRIA 1Z9ZA 3MEUA 1GBRA 1N5ZA 1S72Q 2C06A 2KRMA 1Q7YU 1VYTA 3FEOA 3M56A 4RG2A 2DL4A 1VQ4Q 1IO6A 2EQUA 2DF6A 2D8JA 5DY9A 2MWOA 3E9GA 4X9DA 1W2BP 3OS1A 2J05A 2KAFA 3NGPA 3A5ZB 1NPPA 3U23A 2K2MA 2HQHA 4KH0B 2JTMA 1B34B 4O5VA 2QA4T 1UEBA 4F14A 1Y57A 1M5Q1 2YRCA 2HSPA 3BDUA 3THKA 4F7UE 2RHIA 2IVWA 4KRTA 5GAN4 2L0AA 5KYNA 1MMAA 2AKKA 3CCLQ 4OMQA 4M78G 1N8RC 2K9GA 4M77C 3JCMJ 2GCXA 2YWWA 4C5IA 2FZKB 5GMKh 3G1JA 1X2QA 1QVGP 2D1XA 3E2UA 1SRLA 4Q5WA 4JS5A 1BIBA 2YUPA 3RNJA 2M9UA 3VU3C 2JMCA 2QQBA 4AG1C 3QDRB 1UFFA 3EG1A 3GOXA 3G6EQ 1TUDA 1O75A 4EPCA 2DL7A 2FPFA 2CZ7B 5GMKi 1UECA 3M53A 3QWYA 1I0CA 4JJNK 3VS0A 2EFIA 4JZ4A 1ZSZC 3CCMA 2F5KA 4A53A 3VS3A 2LQNA 2E5QA 1SEMA 1H8KA 1RABB 3SFMA 5CR2A 4C8QB 5A0GA 1BI3A 1VQMQ 4M75C 3CXCA 1QVFA 5J26A 1NJIU 4A63B 1M1KC 2M0YA 2CSIA 2EAYA 3O5ZA 2COYA 4V2SA 2E6ZA 4PLLA 5GAMd 4UC4A 1BIAA 1PM3A 1JJ2P 2JNGA 2A08A 3QXEB 4JPBW 1M9SA 2RHYA 1PHTA 2EYZA 4XU0A 2L3SA 1Y07A 4EMKA 2EYWA 3OYYA 3CMAQ 2RQTA 4LUEA 5LJ5g 3OW2A 2OTJA 1RLPC 4CC3A 2F2XA 1UUEA 2FO0A 4N0AA 5CKHA 4RCCA 1G3WA 1TG0A 2HBWA 2EYQA 1Q7YC 4JS4A 1KQSP 4Y28E 1OEBA 3M0QA 2JJ9A 2EVRA 2QK0A 2JMAA 2DPPB 3A8OB 4ELZC 1P92A 4PK4A 5CKDA 3EFOA 3UPUA 4M7DB 1IHVA 1I81A 3MEVA 4DEYA 1KQ1A 1WYXA 1E6GA 3SWNA 1IGUA 3E1SA 1K0SA 3V7SA 4XTXA 1GXIE 5D6YA 3TSWA 3UATA 1ZX6A 2O4XB 4ZGJB 1PD1A 2RJDA 2V8JA 4BI4A 5CAIA 3QJYA 1VQLQ 2R5AA 4ESRA 1KD1C 4F04B 1J3TA 2X4WA 3L1AA 4FYWB 4Y92A 3M58A 2QYZA 1PG5B 5D6WA 2QA4Q 1O9SA 4EDUA 2XK0A 3BE3A 1ZLMA 5EC7A 3CCVA 4RCBA 3EH2A 2GTOA 3CCMT 2DIQA 2K3YA 5AYFA 1CKBA 2KXDA 4JRPA 3RR6A 3NFCA 2JTEA 1PCXA 2CP6A 3LGLA 1RAIB 4KGZB 4PJOB 1WA7A 4EIKA 1UGVA 1HYOA 2EGCA 2FG0A 3VYHB 8AT1B 4C0FA 1RUWA 3VRZA 2HDAA 1QMCA 2FZCB 1WHLA 1QP3A 2F5TX 2ESWA 2HL3A 4HVUA 4HVVA 2RJFA 1G3TA 1VIEA 3OYGA 1SHFA 2DRKA 4Z89A 4ZGDB 1KK7A 2FHDA 3OS2A 2R58A 1I8FA 2DZ9A 2VGMA 1PRLC 1SG5A 2Z0WA 5A0LA 2OTJT 4GLKA 2QI2A 1M2OA 4XTUA 1A0NB 2KRSA 2P84A 2CP5A 1X69A 1ABOA 3L2VA 3VS4A 5CQXA 2L3QA 2NYSA 4MMKA 3SHWA 2LVMA 3UA7A 3CCEA 1HJDA 2E41A 4C8QC 3G4SA 2EYYA 4E7ZA 2MOXA 4BE0A 2GQIA 3TQ7P 2LCCA 4LUDA 3UT1A 3AT1B 2BZ8A 3I55Q 1U3OA 3EAEA 1E7OA 2CP3A 5LL6S 2KVQG 4RTWA 4OMNA 1YITA 1D1AA 3CCVT 1S72A 1NLPC 2QG9B 2OAUA 2Y4XA 4KH1B 1FMVA 2W0ZA 1VQOA 4J9CA 1OX8A 1YJNA 1ZA1B 4IUVA 3SDZA 1KQ2A 3QG1A 4R0KA 2MIOA 4JRQA 2H8HA 1U1TA 5LJ5f 5GAN8 4C8QE 4JDSA 3H6ZA 4M78A 3F70A 5CO7A 3JAME 3M0TA 4C0DB 3OYKA 1UG1A 1ZA2B 2DM1A 4A4FA 1U1SA 4J8OA 4A4HA 1VQ9Q 4C8QD 1WNLA 4K11A 3JCMd 1SPKA 1VQ6A 2DBKA 5IN1A 2BE7D 1Q95G 3CCMQ 4A54A 3VV0A 1NPRA 2PTKA 3EG9A 4QKUA 1R8OB 3NPFA 1SSHA 4XU2A 2EIFA 3PVQA 3G71Q 2YDLA 3M57A 4YTLA 5DM7R 2ECZA 1YFNA 2KDSA 4N4GA 3I5SA 1VYUA 4EMKB 1YWOA 3PNWC 3HFOA 2ROTA 1V29B 3MHXA 1R0BG 3FJPA 4BY6B 3VUBA 4B9WA 3CCET 4LD6A 3ZEHA 5CKFA 3G4ST 2CH4A 3QKJA 3EFOB 1LPLA 4PJOC 2DXCA 4J6WA 3NTHA 3TSZA 2YHTA 1R77A 5FRNA 4QQGA 3SWNB 2EPDA 4RG8A 1X01A 1VQMA 1TTHB 4ZNXA 3RUXA 3VS1A 5LJ5h 3V7RA 2OTJQ 2O01E 2YRDA 4DBRA 1AT1B 4OVAA 3EFSA 3QHSA 1TS9A 4L6V5 2FYKA 1WHKA 3OYIA 2SEMA 1YITT 4E7LA 4HT8A 5ECAA 4PNOA 1S72T 1ZQ1A 4DBFA 1OU8A 1VQOT 1KHCA 3S3NA 2WSEE 1IRXA 5GANd 1MV0B 4HCCA 1YJNT 3BY7A 4E7KA 4LE9A 4IURA 1YI2Q 3JRZA 4JJBA 3DLMA 4AG2C 1NEGA 2DTHA 1FXXA 2RHUA 1QKWA 4KBMB 2HQXA 3LWIA 3KBGA 4PJOE 3UWNA 1M8MA 2RB6A 4M7AA 4FT2A 5LJ5e 4QT7A 4ZN3A 4XQ3A 2JT4A 2L3RA 3CCVQ 1VQ6T 5FWBA 2H3JA 3GNFB 2FEIA 1UGPB 3HSBA 2A37A 3MP6A 1YBYA 4PJOD 2QQ9A 4RTYA 2A0FB 2CZ0B 1XJWB 1AWXA 1KC8U 2X4XA 1BCMA 4MDWA 3H0HA 4C5EA 1VQLA 3GP8A 4II1A 1K9MC 1LCKA 1B7TA 2A7YA 1K9AA 3NHNA 2DYIA 1M90R 3SD4A 3VS2A 3OQ5A 1WJSA 1JXOA 2DEUA 4QQDA 2YSQA 1Y71A 2LCLA 1M90U 4C92A 5I11A 1MNDA 2RQRA 4KUIA 1YP5A 4LDYA 4OMLA 2LP5A 1ACMB 2ZGWA 4ZGEB 2YXYA 4HCBA 1ZUUA 1VQMT 4C0DC 2R5MA 2E64A 5FLXE 1IXDA 4M77G 1UTIA 5FU7C 7AT1B 1U5SA 4CC4B 2LRQA 5EG2A 3R6OA 1YJ9A 3TVTA 5KYWA 5IHIA 3EHQA 2E65A 2CP2A 2DMOA 3CCEQ 3DLLA 3NTIA 1GFCA 3URGA 1K8AR 3G4SQ 3JCMe 4ZTFA 1G3SA 3X20B 4EMKC 2DTIA 4MZMA 5I2SA 1K8AU 4M77F 1QCOA 4N4IA 5GAMg 1I07A 3CPWP 4RTXA 1NE8A 1TU0B 4BY6C 1GRIA 4QQ6A 2K3XA 2KT1A 1YCYA 4M75G 2DJZA 2PUOB 2RM4A 1LNXA 4HA8A 4M78B 1YITQ 1GCQC 1LJOA 2RF0A 1AOJA 3OYCA 2EKOA 1VQOQ 4RTTA 2DXTA 1YJNQ 2JVVA 2KROA 3Q1JA 4Z88A 2QQAA 4F16A 3I55A 1VQLT 1B07A 1QWFA 2CYZB 3EG9B 4M75F 4XTYA 2MF2A 1V76A 1NEBA 4FCYA 2ZPHB 4XTZA 5FRMA 2ABLA 3V8JA 2QAZA 2QTVA 4OMOA 3CC7A 3OB9A 2RJEA 2F2VA 1GL5A 2JW4A 3KUFA 1ZUYA 2X4JA 3FLGA 1VQ6Q 2HZYA 2MK5A 3CCUQ 1E6HA 1YNZA 4OB1B 3I35A 1H3HA 2DJQA 3EGDA 4Z8AA 5LJ3f 4JJCA 1RAAB 2RA2A 2VC8A 5I2MA 3OSVA 2LX9A 5GAOr 1I4K1 3JCMX 1PNJA 5GAOq 1M90C 3G7ZA 2XHCA 1PSEA 1OULA 1YJ9T 1X43A 4IUPA 1N6AA 4IIOA 3A1PA 4BE1A 2EJ9A 2DVJA 4RMOA 2LC4A 1SKUB 1VQ9A 1M2VA 2HL5C 1T0JA 4FSXA 5IH2A 1NJIR 4OB2B 2DL5A 2QTXA 4MZTA 1AWWA 3G71A 1PC0A 5GANj 4PJNA 1M3BA 1QLYA 2X3WD 4IUTA 3S3OA 2CZ6B 2DIGA 5D6XA 1W2BS 2HQEA 4LDVA 2XD0A 3CXCP 1QVFP 3I9QA 4XU1A 2PZ1A 2HNIA 4M77E 5IHNA 2QXFA 2H3EB 2GNCA 2DILA 1MMNA 2JN0A 4MZPA 2I2LA 2L89A 4M7AB 1K8AC 2EGEA 2RK2A 1SF9A 2RHZA 3AHUA 5DLOA 1H3ZA 3QIIA 2KRNA 1JB0E 4C0GA 3L2WA 4M77D 2JM9A 5LJ3h 3I55T 3JCMP 1WFWA 3MJXA 2DZCA 2CP7A 2EJGA 2X4YA 4LN2A 2HD0A 3LGFA 3CPFA 3REAB 3C0CA 5CK9A 3EG3A 3CCSQ 1KSWA 4XTWA 3PIOA 3MKDA 2JTFA 2LJ3A 3FB9A 1QVGS 4BACA 3RESA 3OW2P 3M59A 3C95A 4ME7A 2KY9A 4J9IA 3JB9G 4HCZA 2J6KA 1WJQA 1IB8A 4M75E 4HXJA 2AKLA 4L5GA 1JO8A 1JBMA 2DNUA 4J6YA 1BI1A 5IHKA 4FT4A 2AHJB 4F7UA 3C4SA 4C92B 4E7JA 3REBB 1YI2A 1RI9A 4C8QG 3PT9A 1OYXA 2LNVA 1NM7A 2Y4YA 5GAMf 2VV5A 1N9SA 2EW3A 1G2BA 2RHXA 4M75D 1PD0A 5A0DA 4PL6A 2XDPA 5GMKj 4PFOA 3JB9F 1VQPA 2COZA 1I1JA 4XTVA 5LJ3e 2L5QA 1NG2A 3VRYA 2EQMA 3QYHB 2E70A 1VQ9T 4OGEA 2B8AA
chains in the Genus database with same CATH topology
2B86A 4WCIA 1GCPA 2RQUA 3M0TA 1UG1A 1OOTA 2DM1A 1PRMC 1JXMA 2CT4A 4JZ3A 3UF4A 4AFZC 1YN8A 4K11A 1QWEA 1SPKA 2DBKA 1W1FA 4J9HA 1JQQA 1WXTA 3UA6A 2PTKA 3NPFA 2GBQA 1SSHA 2DRMA 3PVQA 2YDLA 2K6DA 4IIMA 1CKAA 2ECZA 3CQTA 1JU5C 3I5SA 1VYUA 5HCKA 4J9DA 2J6FA 1YWOA 2EGAA 1WDXA 2ROTA 2CDTA 1QKXA 2JXBA 1M30A 2FPDA 3EG0A 3IQLA 1K0XA 2CH4A 2GTJA 3FJ5A 2CH4W 1AWOA 1M27C 2FPEA 2RPNA 4FSSA 3TSZA 1UHFA 1FMKA 1X27A 2EBPA 2EPDA 2KR3A 4RUGA 1HSQA 2BZXA 4ZNXA 4GBQA 2F2WA 3VS1A 2LJ1A 1S1NA 1BB9A 2KT8A 2A28A 2O31A 2EQIA 1MUZA 1XOVA 3VS6A 2SEMA 2DLPA 3H0IA 4AFSC 3M0SA 5ECAA 2LCSA 2D0NA 2JS0A 2E5KA 1MV0B 1U06A 1TUCA 1AD5A 2NUZA 4LE9A 1Z9ZA 2LNHB 4CC7A 1GBRA 1N5ZA 4RTVA 2KRMA 4JJBA 1VYTA 4AG2C 2P4RA 2DL4A 3VS7A 1NEGA 1IO6A 2DF6A 2D8JA 1KFZA 2A36A 1QKWA 3PVLA 1WIEA 3M0RA 2OJ2A 1M8MA 1ABQA 1PKSA 2J05A 3NGPA 2K7AA 2EKHA 3EGUA 1GCQA 4QT7A 2C0TA 1Y0MA 2MCNA 2VVKA 3U23A 2HEQA 3ZL7C 2K2MA 2JT4A 2KXCA 1VA7A 1YWPA 2VWFA 5FWBA 2FEIA 2A37A 1NYGA 4F14A 1Y57A 4J9GA 4J9BA 2RQVA 2CUBA 2HSPA 4RTYA 3THKA 2DE0X 3A98A 1ZBJA 4KRTA 1AWXA 2L0AA 2AKKA 4ORZA 2D8HA 2O9SA 3H0HA 4JJDA 2JM8A 4OMQA 5GJWB 1LCKA 2CREA 1FYNA 2OAWA 2V1QA 1OV3A 2K9GA 1K9AA 3NHNA 2ED1A 3VS2A 1JXOA 4J9FA 4OMPA 2QDLA 1WXBA 3EHRA 4D8DA 1W6XA 1X2QA 2C0IA 1K4US 2D1XA 2RNAA 2V1RA 2YSQA 1SRLA 2YUPA 3RNJA 5I11A 2RQRA 4CC2A 1YP5A 2W10A 2JMCA 4OMLA 1BBZA 4AG1C 1UFFA 1UE9A 2LP5A 3EG1A 1TUDA 2DL7A 2FPFA 1X2KA 1ZUUA 1UECA 2KGTA 3QWYA 1I0CA 2AZSA 1GBQA 2RMOA 2O2OA 4AFUC 3VS0A 4JZ4A 1UTIA 1KJWA 3VS3A 2LQNA 1U5SA 4CC4B 1SEMA 1H8KA 1B3QA 3TVTA 2KE9A 5IHIA 3EHQA 2DL8A 1RLQC 1ARKA 3M0UA 2DMOA 4A63B 3I5RA 2M0YA 2CSIA 3R6NA 3O5ZA 1GFCA 2CSQA 3JV3A 1M3AA 4RTZA 2LMJA 2FRYA 1AZEA 3VS5A 2O88A 1UJYA 2RQWA 2A08A 4E6RA 1H92A 1I07A 2J06A 4JPBW 4RTXA 1PHTA 1OPKA 1G83A 1GRIA 2YUNA 2EYZA 2G6FX 2KT1A 1EFNA 4F17A 2EYXA 2LX7A 4RTUA 2L3SA 2RN8A 2EYWA 2LZ6B 2IIMA 2RQTA 4LUEA 4OMMA 1JEGA 1GCQC 1RLPC 2RF0A 1AOJA 2F2XA 2PNIA 1UUEA 4X1VA 2FO0A 4CC3A 1TG0A 2HBWA 2KBTA 1OPLA 4RTTA 1OEBA 3M0QA 1BK2A 2EVRA 3H41A 2KROA 4Z88A 2JMAA 4F16A 1AVZC 4DEYA 1B07A 1QWFA 1WYXA 1E6GA 1K0SA 1ZSGA 1YCSB 2CUDA 1K1ZA 1PKTA 3TSWA 3UATA 1ZX6A 3H0FA 1NEBA 2LJ0A 4M4ZA 2ABLA 4OMOA 1UHCA 4ESRA 1UDLA 1J3TA 5GJVB 2F2VA 1GL5A 2JW4A 3NMZC 1ZUYA 4Y92A 1E6HA 1YNZA 2J7IA 1X6BA 3I35A 2L2PA 2BZYA 2DJQA 1ZLMA 4Z8AA 1H3HA 5EC7A 4JJCA 2KYBA 1T0HA 1WLPB 2GTOA 2ROLA 2AK5A 3ULRB 3RBBB 1PNJA 2OI3A 2YUOA 1KIKA 2C0OA 1CKBA 2KEAA 2KXDA 1X43A 2JTEA 2J6OA 4IIOA 2M51A 1QCFA 2KNBB 1UJ0A 1WA7A 4EIKA 2DVJA 1SRMA 2VKNA 1MV3A 3KFVA 1UGVA 2EGCA 2FG0A 4HCKA 1NYFA 1RUWA 3VRZA 2HDAA 3EG2A 1T0JA 2KYMA 5IH2A 2K3BA 1VYVA 2K79A 2ESWA 4HVUA 4HVVA 2DL5A 2O9VA 1AWWA 3PE0A 2X3WD 1M3BA 1QLYA 1SHFA 2DRKA 2YT6A 4Z89A 2L3PA 1K76A 1AWJA 2XMFA 5IXBA 1SHGA 3I9QA 4D8KA 2PZ1A 1PRLC 2SRCA 2DYBA 5IHNA 2X3XD 2GNCA 1M3CA 1A0NB 2DILA 2KRSA 5FW9A 1X69A 1ABOA 2EGEA 3VS4A 2KRNA 2L3QA 2AZVA 3SHWA 3UA7A 2JM9A 2LQWA 1WFWA 2GGRA 1HJDA 3QWXX 4LN2A 1WXUA 3REAB 2EYYA 3C0CA 3EG3A 2MOXA 1KSWA 1CSKA 2GQIA 4LNPA 4J9EA 2LJ3A 4LUDA 5FWCA 1WI7A 2BZ8A 4J9IA 1AZGB 1PWTA 2J6KA 1U3OA 5IXFA 2DA9A 2ENMA 4HXJA 2AKLA 2YUQA 3M0PA 2CT3A 2NWMA 1JO8A 2JS2A 1E7OA 1T3LA 2DNUA 4HVWA 5IHKA 1X6GA 1T3SA 3LH5A 1HD3A 4AFQC 1BU1A 1WX6A 3REBB 3SEMA 1ZUKA 4RTWA 1RI9A 4OMNA 2BTTA 2DBMA 1NM7A 4GLMA 4DEXA 5L23A 1NLPC 1GFDA 2EW3A 2HCKA 1G2BA 1V1CA 1NLOC 2W0ZA 4J9CA 2DL3A 2ED0A 4R0KA 1I1JA 2MIOA 2H8HA 1Z9QA 2I0NA 1NG2A 3VRYA 1AEYA 2DX1A 1W70A 5I22A 2FRWA 3GBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B86 A;  4WCI A;  1GCP A;  2RQU A;  3M0T A;  1UG1 A;  1OOT A;  2DM1 A;  1PRM C;  1JXM A;  2CT4 A;  4JZ3 A;  3UF4 A;  4AFZ C;  1YN8 A;  4K11 A;  1QWE A;  1SPK A;  2DBK A;  1W1F A;  4J9H A;  1JQQ A;  1WXT A;  3UA6 A;  2PTK A;  3NPF A;  2GBQ A;  1SSH A;  2DRM A;  3PVQ A;  2YDL A;  2K6D A;  4IIM A;  1CKA A;  2ECZ A;  3CQT A;  1JU5 C;  3I5S A;  1VYU A;  5HCK A;  4J9D A;  2J6F A;  1YWO A;  2EGA A;  1WDX A;  2ROT A;  2CDT A;  1QKX A;  2JXB A;  1M30 A;  2FPD A;  3EG0 A;  3IQL A;  1K0X A;  2CH4 A;  2GTJ A;  3FJ5 A;  2CH4 W;  1AWO A;  1M27 C;  2FPE A;  2RPN A;  4FSS A;  3TSZ A;  1UHF A;  1FMK A;  1X27 A;  2EBP A;  2EPD A;  2KR3 A;  4RUG A;  1HSQ A;  2BZX A;  4ZNX A;  4GBQ A;  2F2W A;  3VS1 A;  2LJ1 A;  1S1N A;  1BB9 A;  2KT8 A;  2A28 A;  2O31 A;  2EQI A;  1MUZ A;  1XOV A;  3VS6 A;  2SEM A;  2DLP A;  3H0I A;  4AFS C;  3M0S A;  5ECA A;  2LCS A;  2D0N A;  2JS0 A;  2E5K A;  1MV0 B;  1U06 A;  1TUC A;  1AD5 A;  2NUZ A;  4LE9 A;  1Z9Z A;  2LNH B;  4CC7 A;  1GBR A;  1N5Z A;  4RTV A;  2KRM A;  4JJB A;  1VYT A;  4AG2 C;  2P4R A;  2DL4 A;  3VS7 A;  1NEG A;  1IO6 A;  2DF6 A;  2D8J A;  1KFZ A;  2A36 A;  1QKW A;  3PVL A;  1WIE A;  3M0R A;  2OJ2 A;  1M8M A;  1ABQ A;  1PKS A;  2J05 A;  3NGP A;  2K7A A;  2EKH A;  3EGU A;  1GCQ A;  4QT7 A;  2C0T A;  1Y0M A;  2MCN A;  2VVK A;  3U23 A;  2HEQ A;  3ZL7 C;  2K2M A;  2JT4 A;  2KXC A;  1VA7 A;  1YWP A;  2VWF A;  5FWB A;  2FEI A;  2A37 A;  1NYG A;  4F14 A;  1Y57 A;  4J9G A;  4J9B A;  2RQV A;  2CUB A;  2HSP A;  4RTY A;  3THK A;  2DE0 X;  3A98 A;  1ZBJ A;  4KRT A;  1AWX A;  2L0A A;  2AKK A;  4ORZ A;  2D8H A;  2O9S A;  3H0H A;  4JJD A;  2JM8 A;  4OMQ A;  5GJW B;  1LCK A;  2CRE A;  1FYN A;  2OAW A;  2V1Q A;  1OV3 A;  2K9G A;  1K9A A;  3NHN A;  2ED1 A;  3VS2 A;  1JXO A;  4J9F A;  4OMP A;  2QDL A;  1WXB A;  3EHR A;  4D8D A;  1W6X A;  1X2Q A;  2C0I A;  1K4U S;  2D1X A;  2RNA A;  2V1R A;  2YSQ A;  1SRL A;  2YUP A;  3RNJ A;  5I11 A;  2RQR A;  4CC2 A;  1YP5 A;  2W10 A;  2JMC A;  4OML A;  1BBZ A;  4AG1 C;  1UFF A;  1UE9 A;  2LP5 A;  3EG1 A;  1TUD A;  2DL7 A;  2FPF A;  1X2K A;  1ZUU A;  1UEC A;  2KGT A;  3QWY A;  1I0C A;  2AZS A;  1GBQ A;  2RMO A;  2O2O A;  4AFU C;  3VS0 A;  4JZ4 A;  1UTI A;  1KJW A;  3VS3 A;  2LQN A;  1U5S A;  4CC4 B;  1SEM A;  1H8K A;  1B3Q A;  3TVT A;  2KE9 A;  5IHI A;  3EHQ A;  2DL8 A;  1RLQ C;  1ARK A;  3M0U A;  2DMO A;  4A63 B;  3I5R A;  2M0Y A;  2CSI A;  3R6N A;  3O5Z A;  1GFC A;  2CSQ A;  3JV3 A;  1M3A A;  4RTZ A;  2LMJ A;  2FRY A;  1AZE A;  3VS5 A;  2O88 A;  1UJY A;  2RQW A;  2A08 A;  4E6R A;  1H92 A;  1I07 A;  2J06 A;  4JPB W;  4RTX A;  1PHT A;  1OPK A;  1G83 A;  1GRI A;  2YUN A;  2EYZ A;  2G6F X;  2KT1 A;  1EFN A;  4F17 A;  2EYX A;  2LX7 A;  4RTU A;  2L3S A;  2RN8 A;  2EYW A;  2LZ6 B;  2IIM A;  2RQT A;  4LUE A;  4OMM A;  1JEG A;  1GCQ C;  1RLP C;  2RF0 A;  1AOJ A;  2F2X A;  2PNI A;  1UUE A;  4X1V A;  2FO0 A;  4CC3 A;  1TG0 A;  2HBW A;  2KBT A;  1OPL A;  4RTT A;  1OEB A;  3M0Q A;  1BK2 A;  2EVR A;  3H41 A;  2KRO A;  4Z88 A;  2JMA A;  4F16 A;  1AVZ C;  4DEY A;  1B07 A;  1QWF A;  1WYX A;  1E6G A;  1K0S A;  1ZSG A;  1YCS B;  2CUD A;  1K1Z A;  1PKT A;  3TSW A;  3UAT A;  1ZX6 A;  3H0F A;  1NEB A;  2LJ0 A;  4M4Z A;  2ABL A;  4OMO A;  1UHC A;  4ESR A;  1UDL A;  1J3T A;  5GJV B;  2F2V A;  1GL5 A;  2JW4 A;  3NMZ C;  1ZUY A;  4Y92 A;  1E6H A;  1YNZ A;  2J7I A;  1X6B A;  3I35 A;  2L2P A;  2BZY A;  2DJQ A;  1ZLM A;  4Z8A A;  1H3H A;  5EC7 A;  4JJC A;  2KYB A;  1T0H A;  1WLP B;  2GTO A;  2ROL A;  2AK5 A;  3ULR B;  3RBB B;  1PNJ A;  2OI3 A;  2YUO A;  1KIK A;  2C0O A;  1CKB A;  2KEA A;  2KXD A;  1X43 A;  2JTE A;  2J6O A;  4IIO A;  2M51 A;  1QCF A;  2KNB B;  1UJ0 A;  1WA7 A;  4EIK A;  2DVJ A;  1SRM A;  2VKN A;  1MV3 A;  3KFV A;  1UGV A;  2EGC A;  2FG0 A;  4HCK A;  1NYF A;  1RUW A;  3VRZ A;  2HDA A;  3EG2 A;  1T0J A;  2KYM A;  5IH2 A;  2K3B A;  1VYV A;  2K79 A;  2ESW A;  4HVU A;  4HVV A;  2DL5 A;  2O9V A;  1AWW A;  3PE0 A;  2X3W D;  1M3B A;  1QLY A;  1SHF A;  2DRK A;  2YT6 A;  4Z89 A;  2L3P A;  1K76 A;  1AWJ A;  2XMF A;  5IXB A;  1SHG A;  3I9Q A;  4D8K A;  2PZ1 A;  1PRL C;  2SRC A;  2DYB A;  5IHN A;  2X3X D;  2GNC A;  1M3C A;  1A0N B;  2DIL A;  2KRS A;  5FW9 A;  1X69 A;  1ABO A;  2EGE A;  3VS4 A;  2KRN A;  2L3Q A;  2AZV A;  3SHW A;  3UA7 A;  2JM9 A;  2LQW A;  1WFW A;  2GGR A;  1HJD A;  3QWX X;  4LN2 A;  1WXU A;  3REA B;  2EYY A;  3C0C A;  3EG3 A;  2MOX A;  1KSW A;  1CSK A;  2GQI A;  4LNP A;  4J9E A;  2LJ3 A;  4LUD A;  5FWC A;  1WI7 A;  2BZ8 A;  4J9I A;  1AZG B;  1PWT A;  2J6K A;  1U3O A;  5IXF A;  2DA9 A;  2ENM A;  4HXJ A;  2AKL A;  2YUQ A;  3M0P A;  2CT3 A;  2NWM A;  1JO8 A;  2JS2 A;  1E7O A;  1T3L A;  2DNU A;  4HVW A;  5IHK A;  1X6G A;  1T3S A;  3LH5 A;  1HD3 A;  4AFQ C;  1BU1 A;  1WX6 A;  3REB B;  3SEM A;  1ZUK A;  4RTW A;  1RI9 A;  4OMN A;  2BTT A;  2DBM A;  1NM7 A;  4GLM A;  4DEX A;  5L23 A;  1NLP C;  1GFD A;  2EW3 A;  2HCK A;  1G2B A;  1V1C A;  1NLO C;  2W0Z A;  4J9C A;  2DL3 A;  2ED0 A;  4R0K A;  1I1J A;  2MIO A;  2H8H A;  1Z9Q A;  2I0N A;  1NG2 A;  3VRY A;  1AEY A;  2DX1 A;  1W70 A;  5I22 A;  2FRW A;  3GBQ A; 
#chains in the Genus database with same CATH topology
 5KYW B;  1SSF A;  1JJ2 S;  3ER0 A;  1IHW A;  4C8Q F;  1RI0 A;  1WPY A;  3MEW A;  3M9Q A;  3G71 T;  4HT9 A;  5KCO A;  3M55 A;  3GLX A;  3CME Q;  3UF4 A;  1QWE A;  2VXF A;  1W1F A;  2DAQ A;  1MNE A;  1TH7 A;  3UA6 A;  1RAG B;  2GBQ A;  3JCM g;  2K6D A;  1YJ9 Q;  4M7D G;  1N9R A;  2EJF A;  1KQS S;  1JU5 C;  1TUG B;  5HCK A;  1WDX A;  2E1H A;  4C5G A;  1VQ7 A;  3VJP A;  1F1B B;  1NJI C;  2NUP A;  3VKI A;  2K57 A;  4BD3 A;  3E19 A;  3IQL A;  4AMC A;  5GAM h;  2R57 A;  3FJ5 A;  2FPE A;  4DBQ A;  4FSS A;  3ZFJ A;  1UHF A;  2MYS A;  2ZZD A;  4M7D F;  1Q86 R;  2FL7 A;  1UGS B;  1WQW A;  2BZX A;  1Q82 R;  2LJ1 A;  1ZSZ A;  1IGQ A;  2XIC A;  4OB0 B;  3MCA B;  1Q86 U;  3PIP A;  3P8D A;  2A28 A;  2O31 A;  2LTO A;  2EQI A;  1Q82 U;  1YI2 T;  5M9O A;  3VS6 A;  9ATC B;  3A8L B;  4C5H A;  2D0N A;  1WZO A;  4PJO G;  3X26 B;  2JS0 A;  3EGD B;  2PVG B;  1U06 A;  1AD5 A;  5KCH A;  5GAN 7;  2NUZ A;  4FIB A;  5FU6 B;  4M7A C;  2LNH B;  1VQP T;  2OX7 A;  5KE3 A;  4OMF B;  4RTV A;  4E7S A;  1M1F A;  5GAM e;  2XU8 A;  4FYX B;  3KXT A;  4KUD K;  3CC7 Q;  1OQK A;  1WIE A;  1TSF A;  5KYU A;  1PKS A;  4BDZ A;  2K7A A;  4MML A;  2EKH A;  3EGU A;  2MCN A;  2C0T A;  1Y0M A;  1YHQ A;  1M2V B;  4PJO F;  1IZ6 A;  2VVK A;  3ZL7 C;  3CCQ Q;  4BUG A;  3SB2 A;  1BI2 A;  1VA7 A;  3OA6 A;  1YWP A;  3A8G B;  4AT1 B;  3D7S B;  3EGX A;  4IUQ A;  1D0Z A;  1NYG A;  2VGN A;  3JB9 D;  4M7D C;  2HKN A;  3PMT A;  2CUB A;  3EH1 A;  2IG0 A;  1I5L A;  2P0P A;  3FIF A;  3A98 A;  1Q81 R;  4FYV B;  2AIR B;  3RIR A;  5CKE A;  5KE2 A;  2P0K A;  2D8H A;  2O9S A;  2JM8 A;  2ZPB B;  5GJW B;  3ME9 A;  5GAO m;  1Q81 U;  2CRE A;  1FYN A;  2V1Q A;  1VQ7 T;  2ED1 A;  4M7A E;  3HRS A;  3CCU A;  1NBE B;  3OYH A;  1WXB A;  4D8D A;  3FRN A;  2C0I A;  5GMK l;  1C1A A;  1X6O A;  5GAN 5;  3OBY A;  1Y96 A;  5GMK m;  4PJM A;  2BKD N;  1D09 B;  1BBZ A;  3OYB A;  4M7A D;  4LD9 K;  2AZS A;  1GBQ A;  1VUB A;  2O2O A;  4AFU C;  1TXQ A;  2VYT A;  1TOV A;  4M7D E;  1B34 A;  1B3Q A;  3E9F A;  5GAN 2;  1C0M A;  3P8H A;  1RLQ C;  3HTR A;  4F7U B;  1I5O B;  3R6N A;  2M1H A;  2VAS A;  3M54 A;  2CSQ A;  3L2Q A;  4PJJ A;  3JV3 A;  1M3A A;  3M4G A;  2QEX A;  4JRI A;  4M7D D;  2M02 A;  2LMJ A;  2FRY A;  3VS5 A;  3JCM f;  3I56 Q;  2O88 A;  2DD4 A;  1EZZ B;  2HBP A;  1VIF A;  1H92 A;  1NZ9 A;  2OTL A;  1OPK A;  3LYI A;  4QVZ A;  5I21 A;  4F17 A;  3CC2 Q;  2LX7 A;  3V8K A;  2RN8 A;  2LZ6 B;  5CKB A;  1WHG A;  1YHQ T;  3CD6 Q;  1D1C A;  1JEG A;  3LH0 A;  1K73 R;  3QUI A;  2PNI A;  3MEA A;  4X1V A;  5LJ3 g;  3CCS A;  1XTD A;  2M0O A;  2KBT A;  4J6X A;  2LDM A;  1OPL A;  2XDD A;  1BK2 A;  1K73 U;  1RAD B;  3HFN A;  1VQP Q;  4LXC A;  2P0Q A;  1DJ7 B;  2KQW A;  3J81 E;  1YCS B;  1K1Z A;  3VUZ A;  5IT9 E;  1PKT A;  3L2Z A;  4OGC A;  2D0Q B;  3H0F A;  1D1B A;  3UDC A;  2QQR A;  2AT1 B;  3CCU T;  1KC8 R;  4FYY B;  1BCO A;  1WGS A;  3VYG A;  1WHJ A;  2LT1 A;  2XI9 A;  1UHC A;  3CCR Q;  1UDL A;  3BFM A;  2NUP B;  4TVR A;  4C0Z A;  1M1G A;  4KGX B;  3OYM A;  2VXE A;  2RI2 A;  2L2P A;  1Q81 C;  5GAN f;  3JCM h;  2KYB A;  1T0H A;  4FL6 A;  1WLP B;  4PJL A;  3CBP A;  1R0C B;  1QW1 A;  2ROL A;  2PU9 B;  4DQ2 A;  2YUO A;  1KIK A;  4FU6 A;  2KEA A;  1VQ7 Q;  3OYA A;  2M51 A;  2ZPG B;  1UJ0 A;  2RO0 A;  3OS0 A;  3CME A;  1MV3 A;  2RI3 A;  3GIB A;  4PFP A;  5DLQ E;  4HCK A;  2LQ8 A;  4D6W A;  2BE9 B;  3HRT A;  1NYF A;  2QEX T;  2MPX C;  4KT0 E;  2KYM A;  1XNI A;  2K3B A;  3RKW A;  5LJ5 j;  4BB7 A;  4QW2 A;  3PE0 A;  2DET A;  2OTL T;  2YT6 A;  4NOY A;  5GAN 6;  2E12 A;  2WAC A;  2XMF A;  1VOM A;  3OS5 A;  1YJW Q;  1VQN A;  5IXB A;  1SHG A;  2DYB A;  2KSS A;  2X3X D;  1M3C A;  1RAF B;  2V26 A;  5KYU B;  2X51 A;  5FW9 A;  3CCS T;  3FC3 A;  1FMW A;  2ZAE A;  4N0A C;  3H8Z A;  3X24 B;  3OYF A;  3TU4 K;  3ASK A;  3LWH A;  2ATC B;  5CIU A;  3EGX B;  4A4K A;  4ANJ A;  5GAN h;  2GGR A;  4GY5 A;  3OYE A;  5HK3 A;  1CSK A;  3SWN C;  4J9E A;  5HKC A;  5FWC A;  1WI7 A;  3JCM V;  5GAN 3;  1AZG B;  1PWT A;  3L2R A;  1K73 C;  1D0X A;  1YHQ Q;  2DO3 A;  2ENM A;  2KMT A;  3M0P A;  1T3L A;  4HVW A;  4E7H A;  4N4H A;  4PFZ A;  1X6G A;  1T3S A;  3LH5 A;  1HD3 A;  3CEY A;  4AFQ C;  1BU1 A;  1Y96 B;  2RI5 A;  2X9H A;  4CRI A;  2BTT A;  1W2B A;  2DBM A;  4DEX A;  5L23 A;  2QGG A;  3INZ A;  2KI7 A;  1RL2 A;  1V1C A;  2NUT A;  1FX7 A;  4R56 A;  1BKB A;  1QCN A;  2DL3 A;  3L42 A;  1KC8 C;  2ED0 A;  5GAN e;  2I0N A;  1KD1 R;  1OZ2 A;  1WHM A;  3CCQ A;  1W70 A;  3CME T;  3QDF A;  3GBQ A;  2B86 A;  2RD1 A;  4WCI A;  4ZTJ A;  1KD1 U;  1GCP A;  5J39 A;  3M4Y A;  3TRE A;  3MPU B;  2ZPF B;  3CPW S;  2PUK B;  1D0Y A;  4MDX A;  1PRM C;  4JZ3 A;  1QVG A;  4AFZ C;  1WQ7 A;  1YN8 A;  2K5I A;  4L59 A;  3PGG A;  5KYX A;  4J9H A;  1JQQ A;  1VQN T;  1WXT A;  5GAO p;  1VQ8 Q;  1OZ3 A;  1MMG A;  4WTO B;  5CVI A;  3PTA A;  4IIM A;  1CKA A;  3WVE B;  3ZBD A;  4LDU A;  4WF2 A;  4J9D A;  2J6F A;  1QQJ A;  1WJR A;  2CDT A;  2QEX Q;  2JXB A;  4M78 F;  2FPD A;  3EG0 A;  5CQY A;  3HKS A;  3OYJ A;  2VB6 A;  2MMP A;  2OTL Q;  4RKU E;  1AWO A;  1RAH B;  2RPN A;  3QSU A;  3PFS A;  1FMK A;  2EBP A;  1U8R A;  3OSS C;  4Y91 A;  1KHI A;  1S1N A;  1BB9 A;  2MI6 A;  1JJ2 A;  2HMA A;  2E4H A;  5GMK e;  2E3I A;  3X28 B;  1H64 1;  1MUZ A;  3RKX A;  1XOV A;  4DBH A;  3JCM c;  1Y7X A;  3BW1 A;  3H0I A;  3I56 A;  3M0S A;  4HKE A;  4ZN1 A;  2LCS A;  2EQK A;  2DER A;  1VQK A;  2E5K A;  2E6N A;  1QP2 A;  3CC7 T;  4OB3 B;  1BI0 A;  1VQ5 Q;  3CC2 A;  2DK3 A;  4FW2 A;  1M4Z A;  1YIJ A;  4CC7 A;  1KQS A;  3CC4 A;  5A2Q E;  3DB4 A;  3J80 E;  3CD6 A;  5AT1 B;  2P4R A;  3CCQ T;  2L8D A;  3PMI A;  3VS7 A;  4FM4 B;  2LQK A;  2JUF A;  1KFZ A;  2A36 A;  3PVL A;  4PLI A;  1OU9 A;  5L8R E;  3M0R A;  2OJ2 A;  4M78 C;  1ABQ A;  2DVE A;  3MET A;  4OP0 A;  4E2F B;  3RMQ A;  3TCJ A;  3J7A F;  1GCQ A;  2HEQ A;  2RJC A;  2KXC A;  3CXC S;  2VWF A;  1WHH A;  1QVF S;  1KG1 A;  1MGQ A;  4M7A G;  2PVD B;  5KH6 A;  2MAM A;  2K4Y A;  4J9G A;  4J9B A;  2X35 A;  2RQV A;  2DXB A;  3WVD B;  2DE0 X;  1ZBJ A;  1BYM A;  4EMH A;  4ORZ A;  4JJD A;  2ZPI B;  1AHJ B;  3HPW A;  4E7I A;  3OYL A;  3CCR A;  4OF1 A;  4BI8 B;  1IRE B;  2OAW A;  3S3M A;  1OV3 A;  4OMP A;  4J9F A;  4JLG A;  2QDL A;  3EHR A;  1W6X A;  1K4U S;  2RNA A;  2V1R A;  4B6M A;  4M7A F;  3OW2 S;  4CC2 A;  1D3B A;  2W10 A;  2ZCF B;  3O8V A;  5IAY A;  1UE9 A;  4M77 A;  4M78 E;  1VQN Q;  4C92 G;  4VUB A;  1X2K A;  3MP8 A;  3OY9 A;  2KGT A;  3NTK A;  2RMO A;  5CCA A;  2M16 A;  3HL8 A;  2ZPE B;  1KJW A;  2QDY B;  4JRK A;  2QAS A;  4A4E A;  2HKQ B;  4M78 D;  2NLU A;  6AT1 B;  3N5B B;  5LJ3 j;  1TWB A;  2KE9 A;  3I56 T;  2K5F A;  4J7F A;  1UB4 A;  2DL8 A;  3M5A A;  1ARK A;  3M0U A;  1VQK T;  2Y90 A;  2V8I A;  3I5R A;  3OBW A;  4BE2 A;  4RTZ A;  3CC2 T;  4C92 F;  1YJW A;  3QO3 A;  1AZE A;  2KK4 A;  1YIJ T;  4JUV A;  3CC4 T;  2NUT B;  1UJY A;  2RQW A;  3CD6 T;  4M75 A;  4E6R A;  1X75 C;  2J06 A;  3GF5 A;  4E47 A;  1G83 A;  3MP1 A;  2YUN A;  5LJ5 d;  3JCM W;  2G6F X;  1EFN A;  2EYX A;  4RTU A;  1UGQ B;  2FVU A;  1RAC B;  4JLI A;  2IIM A;  3LLR A;  4OMM A;  3TEE A;  1C6V X;  3CCJ A;  2YLB A;  5GAN g;  2A3L A;  2YRV A;  3QZ5 B;  3FDR A;  4O6J A;  1QVP A;  4J7I A;  3LX7 A;  2PQW A;  3H41 A;  2GF7 A;  3HRU A;  2G3R A;  2D6F A;  2WSC E;  2XDB A;  5KYX B;  4IUU A;  1AVZ C;  3LW5 E;  4X34 A;  3CCR T;  1ZSG A;  2CUD A;  3HP9 A;  1LVK A;  2COW A;  4XAX B;  3T9N A;  2DKG A;  3OYN A;  2DTO A;  2LJ0 A;  3A8H B;  4M4Z A;  4LDW A;  5KYY A;  1VQ4 A;  3RMS A;  4KUL A;  4BI3 A;  1OX9 A;  2F69 A;  3QYG B;  3DKM A;  5GJV B;  4C92 C;  5GAO l;  2XKO C;  3NMZ C;  1XQH A;  5D7U A;  2J7I A;  1X6B A;  2PVO B;  2BZY A;  3CBM A;  4A4G A;  3JB9 H;  2DD5 A;  1K9M R;  4DOV A;  4CI0 C;  2V8K A;  2AK5 A;  4NL3 A;  3ULR B;  3RBB B;  2HSE B;  2OI3 A;  1M8V A;  3JB9 J;  2C0O A;  1K9M U;  1ZHI A;  2E10 A;  3RER A;  3GPL A;  5FU7 B;  2J6O A;  1QCF A;  5GAM j;  3CCL A;  2VUB A;  3EFR A;  2GFA A;  2KNB B;  2CP0 A;  1SRM A;  2VKN A;  3KFV A;  3C12 A;  3C94 A;  3EG2 A;  1YJW T;  3OMC A;  1VYV A;  1VQ8 A;  2K79 A;  3BDL A;  2O9V A;  4B9X A;  2GFU A;  3HHT B;  4QVD A;  2K2V A;  2L3P A;  1K76 A;  4C92 E;  1AWJ A;  1EIF A;  3G6E A;  2CGH A;  4R55 A;  1MHN A;  3JCM b;  4D8K A;  1G8X A;  2SRC A;  8ATC B;  3X25 B;  3L2U A;  1Q86 C;  3CCJ T;  4NS5 A;  3JCM Q;  1VQK Q;  2D9T A;  1Q82 C;  4C92 D;  4Z02 A;  1N27 A;  2DXU A;  2AZV A;  2E3H A;  1PSF A;  2FZG B;  3QBY A;  1YIJ Q;  3A8M B;  1MMD A;  2LQW A;  3CC4 Q;  3QWX X;  1G5V A;  1WXU A;  2JZ2 A;  4LNP A;  5FRO A;  1FWZ A;  2JOY A;  4LDX A;  4IKF A;  2BIV A;  2EWN A;  2XID A;  4ATO A;  2YLC A;  2EQJ A;  1VQ4 T;  5IXF A;  2DA9 A;  5C6S A;  4C8Q A;  2YUQ A;  2CT3 A;  2NWM A;  2JS2 A;  3OMG A;  4QVC A;  2RK1 A;  2GQV A;  3CMA A;  1VQ5 A;  3SEM A;  1WX6 A;  1ZUK A;  3WXM B;  4XK8 E;  3RDV A;  1UGR B;  2F1L A;  1D3B B;  3V8L A;  4GLM A;  1HXD A;  1GFD A;  2HCK A;  4M77 B;  4F7U G;  1NLO C;  1ZBX A;  5FU6 C;  1RAE B;  4DOW A;  2MWP A;  1HK9 A;  2FB7 A;  4FW1 A;  5HY6 A;  5GAO n;  1Z9Q A;  3CCL T;  3S6W A;  4DA4 A;  1AEY A;  2DX1 A;  2XG8 D;  5I22 A;  2FRW A;  1N8R R;  2RQU A;  1VQ8 T;  1OOT A;  1W4S A;  5C0M A;  1N8R U;  1ZSZ B;  4F7U F;  1JXM A;  2CT4 A;  2WSF E;  4ELY C;  3QZ9 B;  4M7D A;  2QA4 A;  3G6E T;  4M75 B;  4NL2 A;  3JB9 I;  2DRM A;  2CZ1 B;  3DB3 A;  2BUD A;  3CQT A;  2O4X A;  4P5N A;  2EGA A;  3V7C A;  3OYD A;  5HK0 A;  2K5L A;  1QKX A;  2RH2 A;  2IPO B;  1M30 A;  1G3Y A;  1M1K R;  1OI1 A;  2CKK A;  4X9C A;  1K0X A;  2GTJ A;  2CH4 W;  3QPH A;  1M27 C;  4EMG A;  3JSC A;  3GNG A;  1X27 A;  1LOJ A;  1M1K U;  4XU3 A;  2KR3 A;  1EX4 A;  4RUG A;  1HSQ A;  4GBQ A;  2F2W A;  2P4T A;  2KT8 A;  3MO8 A;  2CS7 A;  3CCJ Q;  3P8B B;  3CBO A;  5KYY B;  4PKC C;  3CPW A;  2DFU A;  5J3B A;  4PJO A;  1VQ5 T;  3CMA T;  3QJ6 A;  2LT4 A;  4KGV B;  3RKY A;  2HAX A;  3H9N A;  2DLP A;  4AFS C;  2QQS A;  2DEQ A;  2QGF B;  4BDY A;  5LJ3 d;  4J83 A;  4J5Y A;  1Q7Y R;  1TUC A;  1JRI A;  1Z9Z A;  3MEU A;  1GBR A;  1N5Z A;  1S72 Q;  2C06 A;  2KRM A;  1Q7Y U;  1VYT A;  3FEO A;  3M56 A;  4RG2 A;  2DL4 A;  1VQ4 Q;  1IO6 A;  2EQU A;  2DF6 A;  2D8J A;  5DY9 A;  2MWO A;  3E9G A;  4X9D A;  1W2B P;  3OS1 A;  2J05 A;  2KAF A;  3NGP A;  3A5Z B;  1NPP A;  3U23 A;  2K2M A;  2HQH A;  4KH0 B;  2JTM A;  1B34 B;  4O5V A;  2QA4 T;  1UEB A;  4F14 A;  1Y57 A;  1M5Q 1;  2YRC A;  2HSP A;  3BDU A;  3THK A;  4F7U E;  2RHI A;  2IVW A;  4KRT A;  5GAN 4;  2L0A A;  5KYN A;  1MMA A;  2AKK A;  3CCL Q;  4OMQ A;  4M78 G;  1N8R C;  2K9G A;  4M77 C;  3JCM J;  2GCX A;  2YWW A;  4C5I A;  2FZK B;  5GMK h;  3G1J A;  1X2Q A;  1QVG P;  2D1X A;  3E2U A;  1SRL A;  4Q5W A;  4JS5 A;  1BIB A;  2YUP A;  3RNJ A;  2M9U A;  3VU3 C;  2JMC A;  2QQB A;  4AG1 C;  3QDR B;  1UFF A;  3EG1 A;  3GOX A;  3G6E Q;  1TUD A;  1O75 A;  4EPC A;  2DL7 A;  2FPF A;  2CZ7 B;  5GMK i;  1UEC A;  3M53 A;  3QWY A;  1I0C A;  4JJN K;  3VS0 A;  2EFI A;  4JZ4 A;  1ZSZ C;  3CCM A;  2F5K A;  4A53 A;  3VS3 A;  2LQN A;  2E5Q A;  1SEM A;  1H8K A;  1RAB B;  3SFM A;  5CR2 A;  4C8Q B;  5A0G A;  1BI3 A;  1VQM Q;  4M75 C;  3CXC A;  1QVF A;  5J26 A;  1NJI U;  4A63 B;  1M1K C;  2M0Y A;  2CSI A;  2EAY A;  3O5Z A;  2COY A;  4V2S A;  2E6Z A;  4PLL A;  5GAM d;  4UC4 A;  1BIA A;  1PM3 A;  1JJ2 P;  2JNG A;  2A08 A;  3QXE B;  4JPB W;  1M9S A;  2RHY A;  1PHT A;  2EYZ A;  4XU0 A;  2L3S A;  1Y07 A;  4EMK A;  2EYW A;  3OYY A;  3CMA Q;  2RQT A;  4LUE A;  5LJ5 g;  3OW2 A;  2OTJ A;  1RLP C;  4CC3 A;  2F2X A;  1UUE A;  2FO0 A;  4N0A A;  5CKH A;  4RCC A;  1G3W A;  1TG0 A;  2HBW A;  2EYQ A;  1Q7Y C;  4JS4 A;  1KQS P;  4Y28 E;  1OEB A;  3M0Q A;  2JJ9 A;  2EVR A;  2QK0 A;  2JMA A;  2DPP B;  3A8O B;  4ELZ C;  1P92 A;  4PK4 A;  5CKD A;  3EFO A;  3UPU A;  4M7D B;  1IHV A;  1I81 A;  3MEV A;  4DEY A;  1KQ1 A;  1WYX A;  1E6G A;  3SWN A;  1IGU A;  3E1S A;  1K0S A;  3V7S A;  4XTX A;  1GXI E;  5D6Y A;  3TSW A;  3UAT A;  1ZX6 A;  2O4X B;  4ZGJ B;  1PD1 A;  2RJD A;  2V8J A;  4BI4 A;  5CAI A;  3QJY A;  1VQL Q;  2R5A A;  4ESR A;  1KD1 C;  4F04 B;  1J3T A;  2X4W A;  3L1A A;  4FYW B;  4Y92 A;  3M58 A;  2QYZ A;  1PG5 B;  5D6W A;  2QA4 Q;  1O9S A;  4EDU A;  2XK0 A;  3BE3 A;  1ZLM A;  5EC7 A;  3CCV A;  4RCB A;  3EH2 A;  2GTO A;  3CCM T;  2DIQ A;  2K3Y A;  5AYF A;  1CKB A;  2KXD A;  4JRP A;  3RR6 A;  3NFC A;  2JTE A;  1PCX A;  2CP6 A;  3LGL A;  1RAI B;  4KGZ B;  4PJO B;  1WA7 A;  4EIK A;  1UGV A;  1HYO A;  2EGC A;  2FG0 A;  3VYH B;  8AT1 B;  4C0F A;  1RUW A;  3VRZ A;  2HDA A;  1QMC A;  2FZC B;  1WHL A;  1QP3 A;  2F5T X;  2ESW A;  2HL3 A;  4HVU A;  4HVV A;  2RJF A;  1G3T A;  1VIE A;  3OYG A;  1SHF A;  2DRK A;  4Z89 A;  4ZGD B;  1KK7 A;  2FHD A;  3OS2 A;  2R58 A;  1I8F A;  2DZ9 A;  2VGM A;  1PRL C;  1SG5 A;  2Z0W A;  5A0L A;  2OTJ T;  4GLK A;  2QI2 A;  1M2O A;  4XTU A;  1A0N B;  2KRS A;  2P84 A;  2CP5 A;  1X69 A;  1ABO A;  3L2V A;  3VS4 A;  5CQX A;  2L3Q A;  2NYS A;  4MMK A;  3SHW A;  2LVM A;  3UA7 A;  3CCE A;  1HJD A;  2E41 A;  4C8Q C;  3G4S A;  2EYY A;  4E7Z A;  2MOX A;  4BE0 A;  2GQI A;  3TQ7 P;  2LCC A;  4LUD A;  3UT1 A;  3AT1 B;  2BZ8 A;  3I55 Q;  1U3O A;  3EAE A;  1E7O A;  2CP3 A;  5LL6 S;  2KVQ G;  4RTW A;  4OMN A;  1YIT A;  1D1A A;  3CCV T;  1S72 A;  1NLP C;  2QG9 B;  2OAU A;  2Y4X A;  4KH1 B;  1FMV A;  2W0Z A;  1VQO A;  4J9C A;  1OX8 A;  1YJN A;  1ZA1 B;  4IUV A;  3SDZ A;  1KQ2 A;  3QG1 A;  4R0K A;  2MIO A;  4JRQ A;  2H8H A;  1U1T A;  5LJ5 f;  5GAN 8;  4C8Q E;  4JDS A;  3H6Z A;  4M78 A;  3F70 A;  5CO7 A;  3JAM E;  3M0T A;  4C0D B;  3OYK A;  1UG1 A;  1ZA2 B;  2DM1 A;  4A4F A;  1U1S A;  4J8O A;  4A4H A;  1VQ9 Q;  4C8Q D;  1WNL A;  4K11 A;  3JCM d;  1SPK A;  1VQ6 A;  2DBK A;  5IN1 A;  2BE7 D;  1Q95 G;  3CCM Q;  4A54 A;  3VV0 A;  1NPR A;  2PTK A;  3EG9 A;  4QKU A;  1R8O B;  3NPF A;  1SSH A;  4XU2 A;  2EIF A;  3PVQ A;  3G71 Q;  2YDL A;  3M57 A;  4YTL A;  5DM7 R;  2ECZ A;  1YFN A;  2KDS A;  4N4G A;  3I5S A;  1VYU A;  4EMK B;  1YWO A;  3PNW C;  3HFO A;  2ROT A;  1V29 B;  3MHX A;  1R0B G;  3FJP A;  4BY6 B;  3VUB A;  4B9W A;  3CCE T;  4LD6 A;  3ZEH A;  5CKF A;  3G4S T;  2CH4 A;  3QKJ A;  3EFO B;  1LPL A;  4PJO C;  2DXC A;  4J6W A;  3NTH A;  3TSZ A;  2YHT A;  1R77 A;  5FRN A;  4QQG A;  3SWN B;  2EPD A;  4RG8 A;  1X01 A;  1VQM A;  1TTH B;  4ZNX A;  3RUX A;  3VS1 A;  5LJ5 h;  3V7R A;  2OTJ Q;  2O01 E;  2YRD A;  4DBR A;  1AT1 B;  4OVA A;  3EFS A;  3QHS A;  1TS9 A;  4L6V 5;  2FYK A;  1WHK A;  3OYI A;  2SEM A;  1YIT T;  4E7L A;  4HT8 A;  5ECA A;  4PNO A;  1S72 T;  1ZQ1 A;  4DBF A;  1OU8 A;  1VQO T;  1KHC A;  3S3N A;  2WSE E;  1IRX A;  5GAN d;  1MV0 B;  4HCC A;  1YJN T;  3BY7 A;  4E7K A;  4LE9 A;  4IUR A;  1YI2 Q;  3JRZ A;  4JJB A;  3DLM A;  4AG2 C;  1NEG A;  2DTH A;  1FXX A;  2RHU A;  1QKW A;  4KBM B;  2HQX A;  3LWI A;  3KBG A;  4PJO E;  3UWN A;  1M8M A;  2RB6 A;  4M7A A;  4FT2 A;  5LJ5 e;  4QT7 A;  4ZN3 A;  4XQ3 A;  2JT4 A;  2L3R A;  3CCV Q;  1VQ6 T;  5FWB A;  2H3J A;  3GNF B;  2FEI A;  1UGP B;  3HSB A;  2A37 A;  3MP6 A;  1YBY A;  4PJO D;  2QQ9 A;  4RTY A;  2A0F B;  2CZ0 B;  1XJW B;  1AWX A;  1KC8 U;  2X4X A;  1BCM A;  4MDW A;  3H0H A;  4C5E A;  1VQL A;  3GP8 A;  4II1 A;  1K9M C;  1LCK A;  1B7T A;  2A7Y A;  1K9A A;  3NHN A;  2DYI A;  1M90 R;  3SD4 A;  3VS2 A;  3OQ5 A;  1WJS A;  1JXO A;  2DEU A;  4QQD A;  2YSQ A;  1Y71 A;  2LCL A;  1M90 U;  4C92 A;  5I11 A;  1MND A;  2RQR A;  4KUI A;  1YP5 A;  4LDY A;  4OML A;  2LP5 A;  1ACM B;  2ZGW A;  4ZGE B;  2YXY A;  4HCB A;  1ZUU A;  1VQM T;  4C0D C;  2R5M A;  2E64 A;  5FLX E;  1IXD A;  4M77 G;  1UTI A;  5FU7 C;  7AT1 B;  1U5S A;  4CC4 B;  2LRQ A;  5EG2 A;  3R6O A;  1YJ9 A;  3TVT A;  5KYW A;  5IHI A;  3EHQ A;  2E65 A;  2CP2 A;  2DMO A;  3CCE Q;  3DLL A;  3NTI A;  1GFC A;  3URG A;  1K8A R;  3G4S Q;  3JCM e;  4ZTF A;  1G3S A;  3X20 B;  4EMK C;  2DTI A;  4MZM A;  5I2S A;  1K8A U;  4M77 F;  1QCO A;  4N4I A;  5GAM g;  1I07 A;  3CPW P;  4RTX A;  1NE8 A;  1TU0 B;  4BY6 C;  1GRI A;  4QQ6 A;  2K3X A;  2KT1 A;  1YCY A;  4M75 G;  2DJZ A;  2PUO B;  2RM4 A;  1LNX A;  4HA8 A;  4M78 B;  1YIT Q;  1GCQ C;  1LJO A;  2RF0 A;  1AOJ A;  3OYC A;  2EKO A;  1VQO Q;  4RTT A;  2DXT A;  1YJN Q;  2JVV A;  2KRO A;  3Q1J A;  4Z88 A;  2QQA A;  4F16 A;  3I55 A;  1VQL T;  1B07 A;  1QWF A;  2CYZ B;  3EG9 B;  4M75 F;  4XTY A;  2MF2 A;  1V76 A;  1NEB A;  4FCY A;  2ZPH B;  4XTZ A;  5FRM A;  2ABL A;  3V8J A;  2QAZ A;  2QTV A;  4OMO A;  3CC7 A;  3OB9 A;  2RJE A;  2F2V A;  1GL5 A;  2JW4 A;  3KUF A;  1ZUY A;  2X4J A;  3FLG A;  1VQ6 Q;  2HZY A;  2MK5 A;  3CCU Q;  1E6H A;  1YNZ A;  4OB1 B;  3I35 A;  1H3H A;  2DJQ A;  3EGD A;  4Z8A A;  5LJ3 f;  4JJC A;  1RAA B;  2RA2 A;  2VC8 A;  5I2M A;  3OSV A;  2LX9 A;  5GAO r;  1I4K 1;  3JCM X;  1PNJ A;  5GAO q;  1M90 C;  3G7Z A;  2XHC A;  1PSE A;  1OUL A;  1YJ9 T;  1X43 A;  4IUP A;  1N6A A;  4IIO A;  3A1P A;  4BE1 A;  2EJ9 A;  2DVJ A;  4RMO A;  2LC4 A;  1SKU B;  1VQ9 A;  1M2V A;  2HL5 C;  1T0J A;  4FSX A;  5IH2 A;  1NJI R;  4OB2 B;  2DL5 A;  2QTX A;  4MZT A;  1AWW A;  3G71 A;  1PC0 A;  5GAN j;  4PJN A;  1M3B A;  1QLY A;  2X3W D;  4IUT A;  3S3O A;  2CZ6 B;  2DIG A;  5D6X A;  1W2B S;  2HQE A;  4LDV A;  2XD0 A;  3CXC P;  1QVF P;  3I9Q A;  4XU1 A;  2PZ1 A;  2HNI A;  4M77 E;  5IHN A;  2QXF A;  2H3E B;  2GNC A;  2DIL A;  1MMN A;  2JN0 A;  4MZP A;  2I2L A;  2L89 A;  4M7A B;  1K8A C;  2EGE A;  2RK2 A;  1SF9 A;  2RHZ A;  3AHU A;  5DLO A;  1H3Z A;  3QII A;  2KRN A;  1JB0 E;  4C0G A;  3L2W A;  4M77 D;  2JM9 A;  5LJ3 h;  3I55 T;  3JCM P;  1WFW A;  3MJX A;  2DZC A;  2CP7 A;  2EJG A;  2X4Y A;  4LN2 A;  2HD0 A;  3LGF A;  3CPF A;  3REA B;  3C0C A;  5CK9 A;  3EG3 A;  3CCS Q;  1KSW A;  4XTW A;  3PIO A;  3MKD A;  2JTF A;  2LJ3 A;  3FB9 A;  1QVG S;  4BAC A;  3RES A;  3OW2 P;  3M59 A;  3C95 A;  4ME7 A;  2KY9 A;  4J9I A;  3JB9 G;  4HCZ A;  2J6K A;  1WJQ A;  1IB8 A;  4M75 E;  4HXJ A;  2AKL A;  4L5G A;  1JO8 A;  1JBM A;  2DNU A;  4J6Y A;  1BI1 A;  5IHK A;  4FT4 A;  2AHJ B;  4F7U A;  3C4S A;  4C92 B;  4E7J A;  3REB B;  1YI2 A;  1RI9 A;  4C8Q G;  3PT9 A;  1OYX A;  2LNV A;  1NM7 A;  2Y4Y A;  5GAM f;  2VV5 A;  1N9S A;  2EW3 A;  1G2B A;  2RHX A;  4M75 D;  1PD0 A;  5A0D A;  4PL6 A;  2XDP A;  5GMK j;  4PFO A;  3JB9 F;  1VQP A;  2COZ A;  1I1J A;  4XTV A;  5LJ3 e;  2L5Q A;  1NG2 A;  3VRY A;  2EQM A;  3QYH B;  2E70 A;  1VQ9 T;  4OGE A;  2B8A A; 
#chains in the Genus database with same CATH homology
 2B86 A;  4WCI A;  1GCP A;  2RQU A;  3M0T A;  1UG1 A;  1OOT A;  2DM1 A;  1PRM C;  1JXM A;  2CT4 A;  4JZ3 A;  3UF4 A;  4AFZ C;  1YN8 A;  4K11 A;  1QWE A;  1SPK A;  2DBK A;  1W1F A;  4J9H A;  1JQQ A;  1WXT A;  3UA6 A;  2PTK A;  3NPF A;  2GBQ A;  1SSH A;  2DRM A;  3PVQ A;  2YDL A;  2K6D A;  4IIM A;  1CKA A;  2ECZ A;  3CQT A;  1JU5 C;  3I5S A;  1VYU A;  5HCK A;  4J9D A;  2J6F A;  1YWO A;  2EGA A;  1WDX A;  2ROT A;  2CDT A;  1QKX A;  2JXB A;  1M30 A;  2FPD A;  3EG0 A;  3IQL A;  1K0X A;  2CH4 A;  2GTJ A;  3FJ5 A;  2CH4 W;  1AWO A;  1M27 C;  2FPE A;  2RPN A;  4FSS A;  3TSZ A;  1UHF A;  1FMK A;  1X27 A;  2EBP A;  2EPD A;  2KR3 A;  4RUG A;  1HSQ A;  2BZX A;  4ZNX A;  4GBQ A;  2F2W A;  3VS1 A;  2LJ1 A;  1S1N A;  1BB9 A;  2KT8 A;  2A28 A;  2O31 A;  2EQI A;  1MUZ A;  1XOV A;  3VS6 A;  2SEM A;  2DLP A;  3H0I A;  4AFS C;  3M0S A;  5ECA A;  2LCS A;  2D0N A;  2JS0 A;  2E5K A;  1MV0 B;  1U06 A;  1TUC A;  1AD5 A;  2NUZ A;  4LE9 A;  1Z9Z A;  2LNH B;  4CC7 A;  1GBR A;  1N5Z A;  4RTV A;  2KRM A;  4JJB A;  1VYT A;  4AG2 C;  2P4R A;  2DL4 A;  3VS7 A;  1NEG A;  1IO6 A;  2DF6 A;  2D8J A;  1KFZ A;  2A36 A;  1QKW A;  3PVL A;  1WIE A;  3M0R A;  2OJ2 A;  1M8M A;  1ABQ A;  1PKS A;  2J05 A;  3NGP A;  2K7A A;  2EKH A;  3EGU A;  1GCQ A;  4QT7 A;  2C0T A;  1Y0M A;  2MCN A;  2VVK A;  3U23 A;  2HEQ A;  3ZL7 C;  2K2M A;  2JT4 A;  2KXC A;  1VA7 A;  1YWP A;  2VWF A;  5FWB A;  2FEI A;  2A37 A;  1NYG A;  4F14 A;  1Y57 A;  4J9G A;  4J9B A;  2RQV A;  2CUB A;  2HSP A;  4RTY A;  3THK A;  2DE0 X;  3A98 A;  1ZBJ A;  4KRT A;  1AWX A;  2L0A A;  2AKK A;  4ORZ A;  2D8H A;  2O9S A;  3H0H A;  4JJD A;  2JM8 A;  4OMQ A;  5GJW B;  1LCK A;  2CRE A;  1FYN A;  2OAW A;  2V1Q A;  1OV3 A;  2K9G A;  1K9A A;  3NHN A;  2ED1 A;  3VS2 A;  1JXO A;  4J9F A;  4OMP A;  2QDL A;  1WXB A;  3EHR A;  4D8D A;  1W6X A;  1X2Q A;  2C0I A;  1K4U S;  2D1X A;  2RNA A;  2V1R A;  2YSQ A;  1SRL A;  2YUP A;  3RNJ A;  5I11 A;  2RQR A;  4CC2 A;  1YP5 A;  2W10 A;  2JMC A;  4OML A;  1BBZ A;  4AG1 C;  1UFF A;  1UE9 A;  2LP5 A;  3EG1 A;  1TUD A;  2DL7 A;  2FPF A;  1X2K A;  1ZUU A;  1UEC A;  2KGT A;  3QWY A;  1I0C A;  2AZS A;  1GBQ A;  2RMO A;  2O2O A;  4AFU C;  3VS0 A;  4JZ4 A;  1UTI A;  1KJW A;  3VS3 A;  2LQN A;  1U5S A;  4CC4 B;  1SEM A;  1H8K A;  1B3Q A;  3TVT A;  2KE9 A;  5IHI A;  3EHQ A;  2DL8 A;  1RLQ C;  1ARK A;  3M0U A;  2DMO A;  4A63 B;  3I5R A;  2M0Y A;  2CSI A;  3R6N A;  3O5Z A;  1GFC A;  2CSQ A;  3JV3 A;  1M3A A;  4RTZ A;  2LMJ A;  2FRY A;  1AZE A;  3VS5 A;  2O88 A;  1UJY A;  2RQW A;  2A08 A;  4E6R A;  1H92 A;  1I07 A;  2J06 A;  4JPB W;  4RTX A;  1PHT A;  1OPK A;  1G83 A;  1GRI A;  2YUN A;  2EYZ A;  2G6F X;  2KT1 A;  1EFN A;  4F17 A;  2EYX A;  2LX7 A;  4RTU A;  2L3S A;  2RN8 A;  2EYW A;  2LZ6 B;  2IIM A;  2RQT A;  4LUE A;  4OMM A;  1JEG A;  1GCQ C;  1RLP C;  2RF0 A;  1AOJ A;  2F2X A;  2PNI A;  1UUE A;  4X1V A;  2FO0 A;  4CC3 A;  1TG0 A;  2HBW A;  2KBT A;  1OPL A;  4RTT A;  1OEB A;  3M0Q A;  1BK2 A;  2EVR A;  3H41 A;  2KRO A;  4Z88 A;  2JMA A;  4F16 A;  1AVZ C;  4DEY A;  1B07 A;  1QWF A;  1WYX A;  1E6G A;  1K0S A;  1ZSG A;  1YCS B;  2CUD A;  1K1Z A;  1PKT A;  3TSW A;  3UAT A;  1ZX6 A;  3H0F A;  1NEB A;  2LJ0 A;  4M4Z A;  2ABL A;  4OMO A;  1UHC A;  4ESR A;  1UDL A;  1J3T A;  5GJV B;  2F2V A;  1GL5 A;  2JW4 A;  3NMZ C;  1ZUY A;  4Y92 A;  1E6H A;  1YNZ A;  2J7I A;  1X6B A;  3I35 A;  2L2P A;  2BZY A;  2DJQ A;  1ZLM A;  4Z8A A;  1H3H A;  5EC7 A;  4JJC A;  2KYB A;  1T0H A;  1WLP B;  2GTO A;  2ROL A;  2AK5 A;  3ULR B;  3RBB B;  1PNJ A;  2OI3 A;  2YUO A;  1KIK A;  2C0O A;  1CKB A;  2KEA A;  2KXD A;  1X43 A;  2JTE A;  2J6O A;  4IIO A;  2M51 A;  1QCF A;  2KNB B;  1UJ0 A;  1WA7 A;  4EIK A;  2DVJ A;  1SRM A;  2VKN A;  1MV3 A;  3KFV A;  1UGV A;  2EGC A;  2FG0 A;  4HCK A;  1NYF A;  1RUW A;  3VRZ A;  2HDA A;  3EG2 A;  1T0J A;  2KYM A;  5IH2 A;  2K3B A;  1VYV A;  2K79 A;  2ESW A;  4HVU A;  4HVV A;  2DL5 A;  2O9V A;  1AWW A;  3PE0 A;  2X3W D;  1M3B A;  1QLY A;  1SHF A;  2DRK A;  2YT6 A;  4Z89 A;  2L3P A;  1K76 A;  1AWJ A;  2XMF A;  5IXB A;  1SHG A;  3I9Q A;  4D8K A;  2PZ1 A;  1PRL C;  2SRC A;  2DYB A;  5IHN A;  2X3X D;  2GNC A;  1M3C A;  1A0N B;  2DIL A;  2KRS A;  5FW9 A;  1X69 A;  1ABO A;  2EGE A;  3VS4 A;  2KRN A;  2L3Q A;  2AZV A;  3SHW A;  3UA7 A;  2JM9 A;  2LQW A;  1WFW A;  2GGR A;  1HJD A;  3QWX X;  4LN2 A;  1WXU A;  3REA B;  2EYY A;  3C0C A;  3EG3 A;  2MOX A;  1KSW A;  1CSK A;  2GQI A;  4LNP A;  4J9E A;  2LJ3 A;  4LUD A;  5FWC A;  1WI7 A;  2BZ8 A;  4J9I A;  1AZG B;  1PWT A;  2J6K A;  1U3O A;  5IXF A;  2DA9 A;  2ENM A;  4HXJ A;  2AKL A;  2YUQ A;  3M0P A;  2CT3 A;  2NWM A;  1JO8 A;  2JS2 A;  1E7O A;  1T3L A;  2DNU A;  4HVW A;  5IHK A;  1X6G A;  1T3S A;  3LH5 A;  1HD3 A;  4AFQ C;  1BU1 A;  1WX6 A;  3REB B;  3SEM A;  1ZUK A;  4RTW A;  1RI9 A;  4OMN A;  2BTT A;  2DBM A;  1NM7 A;  4GLM A;  4DEX A;  5L23 A;  1NLP C;  1GFD A;  2EW3 A;  2HCK A;  1G2B A;  1V1C A;  1NLO C;  2W0Z A;  4J9C A;  2DL3 A;  2ED0 A;  4R0K A;  1I1J A;  2MIO A;  2H8H A;  1Z9Q A;  2I0N A;  1NG2 A;  3VRY A;  1AEY A;  2DX1 A;  1W70 A;  5I22 A;  2FRW A;  3GBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...