1YWPA

Phospholipase cgamma1 sh3
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
62
structure length
62
Chain Sequence
SPTFKSAVKALFDYKAQREDELTFTKSAIIQNVEKQDGGWWRGDYGGKKQLWFPSNYVEEMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase ga
publication title Structural Basis for Recognition of the T Cell Adaptor Protein SLP-76 by the SH3 Domain of Phospholipase Cgamma1
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 13
structure length 62
sequence length 62
ec nomenclature ec 3.1.4.11: Phosphoinositide phospholipase C.
pdb deposition date 2005-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ywpA00
3VRYA 2CT3A 2AZSA 1WXTA 2DBMA 2O2OA 4Z89A 4Y92A 2D1XA 1JXMA 4WCIA 3M0UA 2ED0A 2J6FA 4FSSA 2V1RA 3I35A 2NUZA 2F2VA 1I0CA 2JMCA 3CQTA 2J6KA 3PE0A 1PRMC 2VWFA 1AWJA 2J06A 3THKA 5GJVB 1HJDA 2K3BA 1CKAA 2DMOA 3VS6A 2D8JA 1AVZC 2RQVA 2O9SA 3EG3A 1GBQA 1AD5A 4JJCA 2B86A 1JXOA 1BBZA 2DL4A 1CSKA 2CH4A 2HEQA 1JQQA 2FPFA 3UF4A 2DL5A 5FWBA 1U06A 2OJ2A 4CC7A 1WIEA 2YDLA 2J6OA 2YUOA 2FO0A 4CC2A 1GFDA 1OEBA 1TUDA 1CKBA 2SEMA 1GRIA 1V1CA 1KSWA 2GTOA 2X3XD 1OPKA 2KROA 1UGVA 4M4ZA 4JJBA 1X43A 3O5ZA 4J9DA 3VS0A 2OI3A 3H0FA 4J9HA 1GFCA 2EQIA 1T0JA 4J9FA 1AWWA 5ECAA 2LQNA 2DILA 1HD3A 2CSIA 2V1QA 2CSQA 1N5ZA 2L2PA 1PHTA 3QWXX 4J9GA 4LE9A 2CDTA 1PWTA 2A08A 2PZ1A 2YUNA 1PNJA 3NMZC 5IXBA 2W10A 1U3OA 3ULRB 4RTWA 4KRTA 2DL3A 4J9EA 2JXBA 4IIMA 3RBBB 1SHGA 1UFFA 1XOVA 2RQWA 2EYZA 1JU5C 2DNUA 4OMPA 4E6RA 4JJDA 2FG0A 1MV3A 1QKXA 2LP5A 5EC7A 1MV0B 2KXDA 5I11A 1IO6A 1FYNA 2H8HA 2RN8A 1B3QA 2YUPA 4F17A 2BZ8A 2PTKA 1OOTA 4OMMA 1K76A 2HDAA 1BK2A 2FRWA 2XMFA 3TVTA 2EBPA 2EYXA 3UA6A 3VS5A 1K1ZA 2JS0A 4RTXA 2F2WA 1UHFA 2D8HA 3NPFA 2K2MA 2KT1A 4LN2A 1UJ0A 4J9BA 1UJYA 2JTEA 4EIKA 2JM9A 1NEBA 4HVUA 2FPDA 2OAWA 2X3WD 2A28A 5IHIA 1Z9ZA 2RQTA 1X27A 3VS2A 3QWYA 4RTUA 3SHWA 2YSQA 3NHNA 2AZVA 2EYWA 4HXJA 3M0RA 1K0XA 1AWXA 1WFWA 1SPKA 2ED1A 1ZLMA 1ZX6A 4AG2C 2P4RA 2GNCA 3NGPA 1SRLA 2DL7A 2K6DA 1VYVA 2BZXA 2DE0X 2JM8A 3EGUA 2LCSA 1M27C 4LNPA 1WX6A 1YWOA 2KYMA 2DL8A 2LX7A 2SRCA 1WXBA 2RNAA 2MCNA 1WYXA 1T0HA 1A0NB 4GBQA 2A36A 1OV3A 2CH4W 4R0KA 1NYGA 1H8KA 4Z88A 1UUEA 2IIMA 1GCQA 2AKLA 1NLPC 2EW3A 3VS3A 2LJ0A 1G83A 4CC3A 4F16A 1RUWA 2DRKA 1G2BA 4DEYA 1NLOC 1E7OA 2EPDA 2BZYA 1ZSGA 2ESWA 1M8MA 4AFZC 1YNZA 2KGTA 3KFVA 1RLQC 2G6FX 5FWCA 3UATA 4OMLA 1J3TA 1PKSA 1RLPC 1UECA 1M30A 4A63B 4AFQC 2K9GA 5FW9A 1YN8A 4IIOA 1H92A 1TUCA 4RTZA 1QKWA 2RF0A 2L3QA 5IHKA 1E6GA 1ABQA 1NM7A 2D0NA 2FRYA 4OMOA 2CUDA 1NEGA 1VYTA 1BB9A 2KE9A 2KR3A 1GCQC 1YP5A 1KFZA 1YWPA 1WA7A 2KXCA 2DX1A 1WDXA 1KJWA 3PVLA 1X2KA 5IXFA 2JMAA 2RMOA 2K79A 4AFSC 2LJ3A 1VA7A 2W0ZA 1M3BA 2KRNA 2EVRA 1AOJA 3I9QA 2LJ1A 1YCSB 2KBTA 2GTJA 1Z9QA 1LCKA 4AG1C 2C0IA 1Y57A 1UDLA 4ORZA 1GCPA 2AKKA 1BU1A 1W1FA 1ZUYA 2BTTA 2YUQA 4GLMA 1K9AA 1NYFA 2L0AA 5IHNA 3VRZA 3EG2A 3REAB 4RTYA 4JPBW 2F2XA 1K4US 3H0IA 2KRSA 4QT7A 5HCKA 1QLYA 2C0OA 2LQWA 4JZ4A 2CT4A 2FPEA 3EHQA 4AFUC 1AZEA 1FMKA 1X6BA 1PRLC 2DYBA 2GGRA 1WI7A 1X6GA 1JEGA 1PKTA 3M0SA 3PVQA 2KT8A 3JV3A 1JO8A 2DJQA 1Y0MA 3RNJA 4Z8AA 4D8DA 5IH2A 3M0PA 2JT4A 1ZUKA 2J7IA 2EGCA 1EFNA 1TG0A 1SHFA 1I07A 4RTVA 2FEIA 2DM1A 1NG2A 1GBRA 1T3LA 3ZL7C 2EGEA 2L3SA 2M0YA 2J05A 1AEYA 4RUGA 1ABOA 1QWFA 4HCKA 4OMQA 3EG0A 2PNIA 2HBWA 5L23A 1SRMA 4J9CA 1MUZA 3REBB 3I5SA 1QWEA 1W6XA 2E5KA 1K0SA 4OMNA 5I22A 3C0CA 1X2QA 2A37A 2JW4A 2RPNA 1M3AA 1UHCA 1ZBJA 2KNBB 2NWMA 2LZ6B 3U23A 2DRMA 2O9VA 1KIKA 2CREA 3SEMA 4ESRA 1WXUA 1SSHA 2MIOA 3UA7A 2LMJA 1X69A 2O31A 2JS2A 4JZ3A 5GJWB 3M0TA 2EKHA 4K11A 2GBQA 4HVWA 2I0NA 2HCKA 1B07A 4CC4B 3VS1A 4F14A 2DLPA 1WLPB 1S1NA 1T3SA 2GQIA 1I1JA 2ROTA 3R6NA 1ZUUA 4RTTA 1UE9A 2LNHB 3VS7A 2EGAA 2K7AA 2KRMA 3EG1A 3TSWA 2KEAA 4HVVA 2AK5A 2O88A 1UG1A 2HSPA 4ZNXA 3H0HA 3GBQA 1U5SA 2C0TA 1QCFA 3EHRA 3IQLA 2L3PA 4J9IA 2DBKA 1VYUA 4LUDA 3I5RA 2RQRA 1OPLA 1ARKA 3M0QA 1UTIA 4D8KA 2ECZA 3LH5A 1SEMA 3TSZA 2DVJA 3H41A 2CUBA 2ENMA 2M51A 1W70A 1HSQA 3A98A 1AWOA 2ROLA 2EYYA 2ABLA 1M3CA 2DF6A 4X1VA 2YT6A 2MOXA 2QDLA 4LUEA 4DEXA 2VKNA 2DA9A 3VS4A 1AZGB 1H3HA 3FJ5A 1RI9A 2VVKA 1E6HA 1GL5A 2KYBA 2RQUA
chains in the Genus database with same CATH superfamily
1R0BG 1D09B 3S3OA 2X51A 1U1SA 5KE3A 2R5AA 3MCAB 1B34A 2V26A 3E9GA 4ZTFA 4FSSA 2V1RA 4FL6A 1I0CA 1ZBXA 3QYHB 1AHJB 3CQTA 4QQDA 5GMKi 4GY5A 2VWFA 4KUIA 5KYWB 4OF1A 4NL2A 3HRUA 3H9NA 2DMOA 3V8KA 3UDCA 2DERA 1WJSA 2O9SA 3EG3A 1GBQA 4PJOE 2MF2A 5D7UA 4JJCA 3G1JA 3OS1A 4E7SA 2DXCA 2DL4A 2GFAA 4Y28E 5J26A 2HEQA 1JQQA 2CP2A 4HCZA 4PJMA 4L6V5 5LJ3h 3CCEQ 5FWBA 2E10A 3ZEHA 3G71A 2IPOB 2I2LA 3RMQA 2J6OA 2YUOA 2FO0A 1VQPA 1CKBA 1YHQT 1B7TA 2A7YA 4J9DA 4JJBA 2EQIA 4F7UE 2DILA 1LJOA 1BCMA 4M7DA 2KY9A 2L2PA 4A4GA 1PHTA 4LE9A 2CDTA 3CMAT 3NMZC 1MMDA 4LD9K 4M75C 4M78G 1VQ5A 3HPWA 2K2VA 1SHGA 1OZ2A 1XOVA 2RQWA 1N6AA 3RKWA 3CCVT 2KK4A 3FIFA 4OMPA 2FG0A 1TTHB 4M7AD 3JB9G 3DB4A 2LP5A 3OYAA 1ZSZC 2KXDA 3UWNA 3KBGA 2NYSA 3A8LB 1RI0A 1IO6A 2L5QA 1K73R 2NLUA 3I55T 2RN8A 2K5FA 4F17A 4M7DC 4OMMA 5CKEA 1VQPQ 2XMFA 4PJOA 1WHJA 3MHXA 3TEEA 4M7DF 3G4SA 2QASA 4RTXA 1D0ZA 1UHFA 2D8HA 2K2MA 2BE7D 1VQ8A 2E4HA 4RCBA 2QTVA 4C5EA 1MMAA 4II1A 2VXFA 3WXMB 4EMGA 1M1GA 5KH6A 2RQTA 3QWYA 4M77G 1VQ5Q 4Y91A 1H641 3OYCA 2ZCFB 4F7UA 2XICA 2KSSA 3M59A 2RHZA 1YIJA 5L8RE 3EG9B 4PJOC 2P4RA 4OGCA 5LJ3f 2OTLA 3NGPA 4C92G 1SRLA 4XTWA 3M5AA 2DL7A 3JCMh 2K6DA 4BI3A 2DE0X 2LCSA 1M27C 1FX7A 4PJOF 2LX7A 3JRZA 2SRCA 4RKUE 3LH0A 1G3YA 5I2SA 1M90R 1A0NB 3CMEA 2A36A 2PQWA 2CH4W 4R0KA 2DETA 3GIBA 1UUEA 3G4SQ 1GCQA 4WF2A 3QSUA 1Q95G 3CC4Q 5FU6C 3VS3A 5A0LA 1UEBA 4C0GA 1VQ8Q 3QZ5B 1K9MC 3JCMJ 2DVEA 3SWNC 1ZSGA 3AHUA 2KGTA 4LXCA 4HA8A 4F7UF 3HL8A 4ATOA 1M30A 2EJGA 5DY9A 4V2SA 2O01E 1H92A 4HKEA 1RACB 1R0CB 1QKWA 2CZ0B 3EFRA 3G6EA 2FRYA 2OTLQ 2CUDA 2FB7A 1VYTA 1VQ9T 1BB9A 2KR3A 2QQRA 1GCQC 4C0ZA 1N9SA 4BDZA 2D9TA 1YWPA 1Q7YU 3UPUA 3MP6A 2KXCA 1Q86U 1YJWT 3PVLA 1KJWA 4BDYA 4Z02A 2JNGA 5GAOq 5FRNA 4FT4A 3MPUB 2RH2A 1VA7A 3CXCA 4C0DB 3CMEQ 1VQ4A 2DO3A 1SG5A 3I9QA 3CD6A 2PVOB 2KBTA 3CXCS 1NE8A 1Z9QA 1LCKA 4OB0B 1JJ2A 5GAMg 3JB9J 4ORZA 5J3BA 1JJ2S 1BU1A 1Q81U 4ME7A 2EWNA 1W1FA 2YUQA 4E7LA 2JUFA 3GF5A 5IHNA 3VRZA 2E3HA 3SDZA 2DAQA 4JPBW 2F2XA 1Q7YR 3H0IA 2LCLA 1Q86R 5HCKA 5KYYB 4C0FA 7AT1B 1G8XA 4JZ4A 2CT4A 3JCMf 3FC3A 4AFUC 2P0QA 3QXEB 2XD0A 5FU7C 3CCJT 2LT4A 3JCMb 4M75D 4AMCA 2DJQA 1W2BS 4Z8AA 2GQVA 1K8AC 2CZ1B 1ZUKA 1TG0A 1Q81R 3GP8A 1I07A 4RTVA 3OYNA 2DM1A 1NG2A 1GBRA 2L3SA 4C5HA 5LJ3g 2M0YA 2M16A 3SB2A 1TH7A 1QWFA 4M7DE 3CD6Q 4O6JA 2PNIA 3L2WA 1KQSA 5GAOr 5LJ5d 3RESA 4EMKB 3I5SA 2K5LA 2E5KA 4LD6A 5CK9A 3RERA 1HXDA 2RI5A 1M5Q1 1H3ZA 1M3AA 2KNBB 2NWMA 2CREA 4ESRA 3OBYA 2MIOA 1N8RC 3PMTA 1YHQA 2JS2A 1O75A 4QVZA 5CCAA 4M7AE 2GBQA 3G71T 4C8QC 3JCMW 5C6SA 2X9HA 4IUTA 4F14A 1FMWA 4M77B 3CMAA 1T3SA 2ROTA 1UE9A 2RI3A 4MZMA 1VQ6T 2JJ9A 2KRMA 2LQKA 2DIGA 3V7CA 1U1TA 3GLXA 1UG1A 3QKJA 4ELYC 1WZOA 3HTRA 1NJIU 1TUGB 2V8JA 3IQLA 3EHRA 2L3PA 3I55A 2EIFA 4JDSA 4LUDA 2RQRA 2QTXA 2CKKA 4D8KA 3RKXA 4BE0A 1M2VA 5A0GA 4F04B 3S3MA 1LOJA 1W70A 4LDYA 3L2ZA 2DEQA 1D0YA 2LRQA 2DF6A 3E1SA 2YT6A 3OSVA 4DBQA 2L89A 4LUEA 3TU4K 4F7UG 1H3HA 3CMAQ 4AT1B 3JCMP 1TU0B 4N0AA 3ZBDA 3TREA 1WJRA 3VYGA 2MK5A 1BIBA 1QVFP 4M7AA 2HKNA 2QA4Q 2AZSA 2YRVA 4KULA 3CCVQ 2DBMA 2CP7A 4Z89A 1LNXA 4Y92A 4FYXB 1JXMA 3VV0A 2RHIA 3OYIA 4XTZA 2AIRB 3OYJA 2ED0A 2FZGB 1BKBA 3M4YA 5GMKh 2GFUA 1S72Q 2NUZA 2ATCB 1XTDA 3A8HB 3OMGA 4EPCA 5CR2A 3F70A 3PE0A 2NUTA 2RM4A 1PRMC 2MMPA 4N0AC 4QKUA 3THKA 2LQ8A 4GLKA 5GJVB 1HJDA 3FB9A 2H3JA 4XU3A 5KYUA 4OB1B 3VS6A 4E7JA 2HL5C 2D8JA 3FLGA 3MEVA 1AVZC 2RQVA 1KD1U 3V7SA 3CPWA 1B34B 2PU9B 5GAMe 1QVGP 4OMFB 3CPFA 1G3SA 3CPWS 5M9OA 1BBZA 1M4ZA 4JLGA 2EJ9A 4M7AF 1CSKA 3HSBA 3VU3C 3CC7Q 3ZFJA 1X01A 1KK7A 4PLLA 3NTKA 1OZ3A 3A5ZB 4PL6A 4YTLA 1UGQB 2SEMA 1GRIA 3L2UA 1V1CA 4ZN3A 1KSWA 4XU1A 1OPKA 3OYMA 3VS0A 1VQOA 1EZZB 1GFCA 1VQ9A 3OSSC 1Q82U 2LQNA 5KCOA 1HD3A 2DXUA 2HQHA 4IUQA 1YJWA 1KD1R 3QWXX 1PWTA 4E2FB 2PZ1A 4JRPA 5IXBA 3E19A 1O9SA 3G6ET 2E6ZA 3ULRB 2DFUA 3EGDA 4RTWA 4KBMB 3C95A 1JRIA 5LJ3e 3NTHA 3LWHA 1W4SA 4PFPA 2JXBA 1MNDA 4IIMA 3EFSA 2YLBA 1UFFA 2X4YA 2XDDA 1Q7YC 2EYZA 2YHTA 1Q86C 2DNUA 4JJDA 2D0QB 1QKXA 5EC7A 2F5KA 4M75E 2QEXT 2H8HA 4XTVA 4M7DB 2YUPA 2MWOA 3UT1A 1OOTA 2VYTA 9ATCB 1WQWA 4NS5A 2VUBA 2LC4A 2HDAA 3OW2P 1BK2A 4ELZC 4C8QD 1Q81C 3PGGA 3VS5A 2P0PA 1X75C 1UJ0A 1UJYA 1NEBA 1YJWQ 2HL3A 2A28A 3T9NA 5AYFA 3C12A 4QQGA 1G5VA 2YRDA 4RTUA 2EYWA 3M0RA 5GANh 1AWXA 3URGA 1WFWA 4PJOB 3H8ZA 4B9WA 1SPKA 2ED1A 1QVPA 3DLLA 4BE1A 4AG2C 2DTOA 5CKFA 3VUZA 2MI6A 2JM8A 2HAXA 1YWOA 2CP3A 2YRCA 3JCMd 3EH2A 5EG2A 1MGQA 4N4HA 4M75A 3CCLT 1OV3A 1H8KA 3MKDA 3GNGA 5FU6B 4F7UB 1BYMA 3CCJQ 3PT9A 2EW3A 1NLPC 2JZ2A 4TVRA 2E41A 1BI2A 1G2BA 1NZ9A 4DEYA 1NLOC 3JB9H 1ZSZA 2EPDA 2BZYA 3A1PA 1VQMA 4J8OA 3Q1JA 1M8MA 2MWPA 1K73U 4FYWB 4E7HA 1ACMB 1VQ6A 5FROA 4OMLA 1J3TA 1PKSA 1UECA 2DKGA 3SD4A 4A63B 4AFQC 1YN8A 3PNWC 1YJ9T 1I5LA 3L2RA 4IIOA 5IHKA 2LNVA 1ABQA 2QQAA 4M78D 3HFNA 3PFSA 2KE9A 1PD0A 1YP5A 4FW1A 1IRXA 2Y90A 3VYHB 1QQJA 4M75F 2NUPA 5CQYA 2RMOA 2LJ3A 2HD0A 1NJIC 4FW2A 4BY6C 2EYQA 5GAN6 3S6WA 2EVRA 1UGPB 1YCSB 1QMCA 3LYIA 1HK9A 4AG1C 5GANj 2RJEA 3G71Q 3RIRA 1VQ7T 2C0IA 1Y57A 1UDLA 4M7AG 4WTOB 2AKKA 3D7SB 3QUIA 2C06A 1R8OB 1ZUYA 1K9AA 3OS5A 1KC8U 1NYFA 3HKSA 5GANf 3EG2A 4J7FA 3REAB 1BI1A 1VQ6Q 5LJ5g 1VQKA 4QT7A 3OYKA 2L3RA 1FXXA 3QG1A 1AZEA 1C0MA 4E47A 3KUFA 4DQ2A 1M90U 2GGRA 5FU7B 1NBEB 1X6GA 1PKTA 3M0SA 3PVQA 2KT8A 3JV3A 5KYNA 4X9CA 2DK3A 3RNJA 2JT4A 3MO8A 2J7IA 4DOWA 2EGCA 2IVWA 2QK0A 4R56A 1EFNA 4RG8A 3SWNA 1SHFA 2XK0A 1KC8R 1WGSA 3ZL7C 5IAYA 3V7RA 2J05A 1YITT 3CC2T 2K4YA 4HCBA 4HCKA 1D0XA 2HBWA 1EIFA 2OTJT 4J9CA 1MMGA 4KGZB 4A4EA 1QWEA 4PFZA 5I22A 3C0CA 4QW2A 5GMKl 2RPNA 3OYBA 1UHCA 1ZBJA 2YXYA 1I5OB 3QJYA 1VIEA 1KD1C 1OI1A 1SSHA 1WXUA 2M9UA 3QJ6A 3OYGA 5CO7A 4PFOA 3M53A 2IG0A 4N4GA 2EKHA 5CIUA 1LVKA 4MZTA 4FSXA 4B9XA 2XDPA 1G3WA 5A2QE 2CYZB 3QDFA 4RG2A 3VS1A 2DLPA 4PJJA 1YIJQ 6AT1B 1S1NA 2CS7A 5FLXE 1VQOT 2EGAA 2ZZDA 2CZ7B 1Q82C 4C8QE 4BE2A 2JVVA 3QZ9B 4PJLA 1UGSB 2O88A 5DLOA 3FRNA 3GBQA 1KQ2A 3OYDA 2C0TA 2QEXA 1NPRA 4J9IA 3L2VA 1VYUA 3I5RA 2FVUA 2HMAA 3I56A 4EDUA 1OPLA 2COYA 2E5QA 4IUVA 2EKOA 2DEUA 3OS0A 2LDMA 1SEMA 2E1HA 1RL2A 4MMLA 3H41A 5GAN4 2CUBA 2M51A 2COWA 2QQSA 1AWOA 2ROLA 2ABLA 1RAEB 1M3CA 2CZ6B 1KQ1A 2M0OA 1I4K1 2A3LA 3VS4A 2ZPGB 4IURA 5GAOn 1RI9A 2VVKA 3G6EQ 1E6HA 2EJFA 3VRYA 3OYLA 3ER0A 1WXTA 2F1LA 1M2VB 2O2OA 3E2UA 4J6WA 5CAIA 1BI0A 2D1XA 1M1KU 3M55A 4XU0A 4HT8A 2QEXQ 1WHKA 2ZPBB 1VQ4Q 4M75G 5KYXA 4C8QA 3I35A 3CXCP 2DYIA 2JMCA 4PNOA 1KQSS 5DLQE 1JJ2P 4UC4A 3CCLA 1WJQA 1D1CA 5CVIA 4M7AB 1YJNT 1PD1A 5KCHA 2K3BA 1CKAA 4BD3A 2RJFA 4M78E 3GOXA 4M7DG 1G3TA 2B86A 1M1KR 2M02A 4LDXA 2QI2A 3VUBA 3SFMA 3UF4A 5GMKe 4PK4A 2VB6A 5LJ5e 1U8RA 3A8MB 3MP8A 2PUKB 1W2BP 4CC7A 1YJ9A 1D1BA 4CC2A 1GFDA 1VQMT 2NUTB 3X26B 2WACA 4M4ZA 1ZA1B 3JCMV 1K73C 1T0JA 4OVAA 2OAUA 4J9FA 4C8QF 1AWWA 5CKDA 5KYUB 2ZGWA 1WHGA 3FEOA 2CSIA 3P8DA 2A08A 4DA4A 2YUNA 1P92A 3LWIA 3PIPA 2XU8A 1Y96A 1SKUB 1MHNA 5CQXA 4KRTA 4PJOG 3CCLQ 5C0MA 2QYZA 2DL3A 1V76A 4J9EA 2F5TX 1QCNA 1QCOA 1JU5C 3G7ZA 1VQ7A 4OB2B 3ASKA 2WSEE 5I11A 4ZGJB 1YHQQ 1OULA 5FRMA 3EFOA 3CCST 2BKDN 3X20B 1Y07A 5GAOl 2EQJA 2BZ8A 3OB9A 1UGRB 4C92E 3CCRT 3C94A 4C5GA 1YJ9Q 3OQ5A 4M78A 3J80E 2Y4XA 1Y7XA 4J5YA 3EGDB 3JCMg 1KC8C 2EYXA 3UA6A 3DB3A 2QDYB 2F2WA 1VQKT 2KT1A 4J9BA 2JTEA 4J6XA 4MDWA 4HVUA 4FYVB 2OAWA 3CCQT 3A8GB 4OB3B 2COZA 5D6XA 3NTIA 5IHIA 1M90C 1XQHA 1IREB 4Q5WA 4DBRA 1X27A 2O4XA 2YSQA 1YITA 3CC2A 3I55Q 4PKCC 3GNFB 3QIIA 2OTJA 4M78C 1TS9A 1VQ7Q 2LVMA 5GANd 5GAN7 1ZLMA 1ZX6A 4IUUA 2GNCA 2ZPHB 2PVDB 2MPXC 1VYVA 2BZXA 2PVGB 3V8LA 1WX6A 3CBPA 4M78F 1IHWA 4BUGA 2DL8A 3AT1B 4DBHA 5IN1A 1WXBA 2DXBA 3EAEA 2MCNA 2EAYA 1Y71A 4CI0C 4GBQA 1NYGA 2EQUA 5CKBA 1HYOA 3MEUA 2LJ0A 1PSEA 1OQKA 1RUWA 1UB4A 2DRKA 3LGFA 1K9MU 4C92A 4KT0E 2QAZA 2ESWA 3CCJA 1M2OA 3EGXA 1RLQC 2G6FX 1PSFA 5FWCA 4FYYB 1YITQ 2RD1A 1M9SA 3OY9A 4RTZA 2OTJQ 4IKFA 2RF0A 2L3QA 4M75B 4M77C 4JRKA 2E70A 1IB8A 1NM7A 2D0NA 2BUDA 3S3NA 2DPPB 4LDVA 2CP5A 1FMVA 2DX1A 1WDXA 1ZSZB 1MNEA 1K9MR 1X2KA 3X25B 4C92C 5IXFA 2CP0A 1OX8A 2K79A 2XDBA 4BY6B 1OU8A 3CPWP 1BI3A 1M3BA 3BY7A 3WVDB 3I56T 1AOJA 2LJ1A 2GTJA 2R5MA 2X4WA 1V29B 3P8BB 3N5BB 2RA2A 3PIOA 1C6VX 2BTTA 4GLMA 1JB0E 2L0AA 3NFCA 1VQOQ 1VQ9Q 1IHVA 2E3IA 3JB9I 1K4US 2KRSA 1QLYA 2C0OA 1C1AA 1YCYA 2LQWA 4JRIA 2NUPB 3JCMX 5GAOp 2K3XA 2VGMA 4XTYA 4C8QG 2FPEA 3EHQA 4QQ6A 3MJXA 3FJPA 1D1AA 1WPYA 4DBFA 1JEGA 2Y4YA 2JN0A 4HCCA 3OMCA 1JO8A 2E64A 3J81E 4BI4A 4D8DA 1K8AU 3M0PA 2P4TA 4KH0B 1VQLT 1AT1B 4NOYA 3X24B 5GAMh 3TQ7P 1M1KC 2EGEA 4RUGA 4FU6A 1YJNA 4HT9A 1PCXA 2P84A 2QGFB 4L5GA 5AT1B 4J83A 3REBB 4VUBA 1K0SA 1D3BA 4OMNA 3DLMA 1FWZA 1X2QA 2JW4A 2BE9B 4ZGDB 1K8AR 3INZA 2O9VA 1RADB 3QBYA 1YI2T 3SWNB 3SEMA 2WSFE 1N8RU 2LMJA 3JCMe 1X69A 1RAHB 4XK8E 3J7AF 2KI7A 5GJWB 1RAAB 4PJNA 3M0TA 3FDRA 2HQEA 3E9FA 2EQMA 4CC4B 1WLPB 2KMTA 1I1JA 3JSCA 4RTTA 4FM4B 1OU9A 3OYHA 4J6YA 3MEAA 2BIVA 2K7AA 2DZ9A 4OP0A 5HK0A 1RAFB 1YJNQ 3EG1A 3P8HA 3TSWA 2E6NA 2KEAA 3LGLA 2AK5A 1M1FA 3JB9D 4ZNXA 2FHDA 1N8RR 5GAN5 4ZTJA 2KDSA 2RJCA 3CCSA 2DBKA 3O8VA 2QA4T 4ZGEB 1VQNT 3OYFA 4A4FA 3QHSA 2ECZA 3CCRA 2M1HA 3LH5A 2XIDA 1VQMQ 3HFOA 2ENMA 5GAMj 1HSQA 2FZKB 2JTFA 3A98A 3M56A 2R58A 1IZ6A 3CBMA 2DD4A 1S72T 4E7IA 4D6WA 2YLCA 2LT1A 4XQ3A 4C5IA 2H3EB 2MOXA 3WVEB 5GAMf 4DEXA 3BFMA 3CCQA 1AZGB 3FJ5A 3EH1A 3CCUT 2QXFA 3VKIA 3CEYA 1GL5A 2DXTA 2K5IA 2RHUA 4KGVB 4M77D 4RCCA 5KYWA 3CC4A 1WHHA 2CT3A 4FT2A 3M57A 3KXTA 1TOVA 4A4KA 2RB6A 3JCMc 2HSEB 4A53A 2A0FB 5IT9E 3L42A 1RABB 4C92D 4WCIA 3M0UA 3CC7T 2J6FA 3CCSQ 5LJ3j 3GPLA 3OA6A 2F2VA 4X34A 2XKOC 2OX7A 3CCRQ 2J6KA 2EFIA 1AWJA 2KQWA 2J06A 3M58A 1I8FA 1VQKQ 1KHCA 2X4JA 1TXQA 1AD5A 4XTXA 3CCQQ 2VXEA 1JXOA 1KG1A 2CH4A 2FPFA 2DL5A 3CCMT 5KYXB 4C8QB 4FCYA 2ZAEA 2EQKA 1U06A 2OJ2A 2K3YA 1WIEA 2YDLA 1OEBA 1TUDA 1QP3A 3L2QA 2GTOA 2X3XD 2KROA 1UGVA 3PMIA 1X43A 1RAIB 3O5ZA 2OI3A 3H0FA 4J9HA 5D6YA 5ECAA 2V1QA 2X35A 2CSQA 1N5ZA 4XTUA 2CP6A 4J9GA 1PNJA 3RR6A 2FL7A 2W10A 2F69A 1U3OA 2YWWA 1BIAA 1XNIA 3L1AA 2KVQG 2GCXA 5I21A 4PLIA 3RBBB 3C4SA 3X28B 4E6RA 1MV3A 5LL6S 1ZA2B 3QDRB 1MV0B 2KAFA 1QW1A 2ZPEB 1NPPA 4ANJA 1FYNA 5GANg 3R6OA 4OGEA 1B3QA 4O5VA 2PTKA 4JRQA 1K76A 1WHMA 2FRWA 3TVTA 3EG9A 1Y96B 2HKQB 2EBPA 2RJDA 5GAN2 1K1ZA 1M8VA 2JS0A 3V8JA 3JAME 3NPFA 4LN2A 1VIFA 5DM7R 4EIKA 2JM9A 2HQXA 2FPDA 2X3WD 1VQLA 3HRTA 2RO0A 2DJZA 4JS4A 1Z9ZA 3EFOB 3TCJA 4R55A 1X6OA 3VS2A 1YBYA 3SHWA 3NHNA 2LX9A 1W2BA 3CCET 2FZCB 1TSFA 2AZVA 4HXJA 2XI9A 3I56Q 1K0XA 1IGQA 4BI8B 2R57A 3LW5E 5GMKm 5D6WA 2X4XA 4M78B 2RK2A 4XU2A 2HNIA 2E12A 2DIQA 3OBWA 1XJWB 3LX7A 1N9RA 3HHTB 3EGUA 4LNPA 2GF7A 4QVCA 1YFNA 2KYMA 1DJ7B 1YI2A 2PUOB 4M7DD 2RNAA 1WYXA 1T0HA 4IUPA 2LCCA 2O4XB 4Z88A 4LDUA 2HBPA 2IIMA 2QQ9A 2AKLA 1OYXA 1G83A 4CC3A 3CBOA 4F16A 5HK3A 1LPLA 1E7OA 2K57A 1JBMA 1YNZA 4AFZC 1VQLQ 3KFVA 3UATA 1RLPC 2DZCA 4KH1B 2K9GA 5FW9A 1VQPT 1TUCA 4FIBA 3VJPA 2VV5A 3RUXA 1WHLA 1E6GA 1QVFA 3RMSA 2WSCE 1KQSP 4OMOA 4E7KA 1NEGA 4PJOD 1QVFS 2VC8A 4P5NA 3QPHA 1N27A 2QA4A 4KUDK 1KFZA 1VQNA 4JS5A 1WA7A 2FYKA 3CCVA 4C92B 5KYYA 4M77E 3QO3A 1YI2Q 3BDLA 2JMAA 4RMOA 4MDXA 3EGXB 4AFSC 3PTAA 1WQ7A 2DD5A 1VQ5T 2W0ZA 2KRNA 4C0DC 1S72A 1PC0A 1MMNA 1IXDA 1QP2A 1IGUA 4EMHA 2RHYA 1GCPA 2Z0WA 3DKMA 8ATCB 2DTIA 3CCUA 2QQBA 3A8OB 2MYSA 8AT1B 4JJNK 5CKHA 4RTYA 4JUVA 2XG8D 1GXIE 1QVGA 2G3RA 1ZHIA 1QVGS 4DOVA 3JCMQ 4N4IA 4A4HA 2V8KA 3RKYA 1FMKA 1VUBA 1X6BA 2E65A 1PRLC 2DYBA 1NJIR 4EMKA 1WI7A 3G4ST 4BB7A 3CC4T 3CC7A 1Y0MA 1R77A 1VQ8T 4XAXB 4A54A 5IH2A 1VQNQ 4X9DA 5HKCA 2FEIA 1T3LA 2VGNA 2MAMA 2DTHA 1F1BB 5HY6A 1AEYA 5GAMd 1ABOA 3M4GA 4OMQA 4MZPA 2JOYA 3EG0A 4BACA 1YIJT 5LJ5h 3BE3A 2RI2A 2L8DA 5L23A 1SRMA 2D6FA 1MUZA 4M77A 3RDVA 4LDWA 2OTLT 5J39A 1W6XA 3JB9F 4EMKC 3CCUQ 2ZPIB 1ZQ1A 5GANe 2A37A 5I2MA 3CCMA 4M7AC 3ME9A 1VOMA 2LZ6B 3U23A 2DRMA 1KIKA 1PG5B 3UA7A 1WNLA 2O31A 3CMET 4JZ3A 3M9QA 5GAN3 4CRIA 4K11A 3OW2A 3CC2Q 3QYGB 4B6MA 2RK1A 1OX9A 4HVWA 2I0NA 2VASA 2HCKA 1B07A 3OW2S 3HRSA 3MEWA 5LJ3d 2GQIA 3R6NA 1ZUUA 3OS2A 1D3BB 2LNHB 3VS7A 1I81A 1EX4A 3BW1A 5GAN8 3MP1A 1RAGB 1TWBA 2ZPFB 4HVVA 4M77F 5GAOm 2HSPA 2P0KA 3LLRA 3H0HA 1U5SA 1QCFA 3META 2RHXA 1SF9A 5KE2A 2XHCA 4ZN1A 4QVDA 4C92F 1ARKA 3M0QA 1UTIA 3CCMQ 4JLIA 1PM3A 1BCOA 4MMKA 3TSZA 2DVJA 3BDUA 2QG9B 1VQ4T 3OYEA 2LTOA 2EYYA 3H6ZA 4J7IA 3OYYA 4E7ZA 1SSFA 3CD6T 2AT1B 1Q82R 4KGXB 2HZYA 5A0DA 3M54A 4X1VA 2AHJB 2JTMA 2QDLA 4L59A 5GMKj 2VKNA 5LJ5j 2DA9A 2B8AA 4NL3A 1KHIA 2QGGA 2V8IA 3HP9A 2KYBA 3CCEA 5LJ5f 2CGHA 2RQUA
chains in the Genus database with same CATH topology
3VRYA 2CT3A 2AZSA 1WXTA 2DBMA 2O2OA 4Z89A 4Y92A 2D1XA 1JXMA 4WCIA 3M0UA 2ED0A 2J6FA 4FSSA 2V1RA 3I35A 2NUZA 2F2VA 1I0CA 2JMCA 3CQTA 2J6KA 3PE0A 1PRMC 2VWFA 1AWJA 2J06A 3THKA 5GJVB 1HJDA 2K3BA 1CKAA 2DMOA 3VS6A 2D8JA 1AVZC 2RQVA 2O9SA 3EG3A 1GBQA 1AD5A 4JJCA 2B86A 1JXOA 1BBZA 2DL4A 1CSKA 2CH4A 2HEQA 1JQQA 2FPFA 3UF4A 2DL5A 5FWBA 1U06A 2OJ2A 4CC7A 1WIEA 2YDLA 2J6OA 2YUOA 2FO0A 4CC2A 1GFDA 1OEBA 1TUDA 1CKBA 2SEMA 1GRIA 1V1CA 1KSWA 2GTOA 2X3XD 1OPKA 2KROA 1UGVA 4M4ZA 4JJBA 1X43A 3O5ZA 4J9DA 3VS0A 2OI3A 3H0FA 4J9HA 1GFCA 2EQIA 1T0JA 4J9FA 1AWWA 5ECAA 2LQNA 2DILA 1HD3A 2CSIA 2V1QA 2CSQA 1N5ZA 2L2PA 1PHTA 3QWXX 4J9GA 4LE9A 2CDTA 1PWTA 2A08A 2PZ1A 2YUNA 1PNJA 3NMZC 5IXBA 2W10A 1U3OA 3ULRB 4RTWA 4KRTA 2DL3A 4J9EA 2JXBA 4IIMA 3RBBB 1SHGA 1UFFA 1XOVA 2RQWA 2EYZA 1JU5C 2DNUA 4OMPA 4E6RA 4JJDA 2FG0A 1MV3A 1QKXA 2LP5A 5EC7A 1MV0B 2KXDA 5I11A 1IO6A 1FYNA 2H8HA 2RN8A 1B3QA 2YUPA 4F17A 2BZ8A 2PTKA 1OOTA 4OMMA 1K76A 2HDAA 1BK2A 2FRWA 2XMFA 3TVTA 2EBPA 2EYXA 3UA6A 3VS5A 1K1ZA 2JS0A 4RTXA 2F2WA 1UHFA 2D8HA 3NPFA 2K2MA 2KT1A 4LN2A 1UJ0A 4J9BA 1UJYA 2JTEA 4EIKA 2JM9A 1NEBA 4HVUA 2FPDA 2OAWA 2X3WD 2A28A 5IHIA 1Z9ZA 2RQTA 1X27A 3VS2A 3QWYA 4RTUA 3SHWA 2YSQA 3NHNA 2AZVA 2EYWA 4HXJA 3M0RA 1K0XA 1AWXA 1WFWA 1SPKA 2ED1A 1ZLMA 1ZX6A 4AG2C 2P4RA 2GNCA 3NGPA 1SRLA 2DL7A 2K6DA 1VYVA 2BZXA 2DE0X 2JM8A 3EGUA 2LCSA 1M27C 4LNPA 1WX6A 1YWOA 2KYMA 2DL8A 2LX7A 2SRCA 1WXBA 2RNAA 2MCNA 1WYXA 1T0HA 1A0NB 4GBQA 2A36A 1OV3A 2CH4W 4R0KA 1NYGA 1H8KA 4Z88A 1UUEA 2IIMA 1GCQA 2AKLA 1NLPC 2EW3A 3VS3A 2LJ0A 1G83A 4CC3A 4F16A 1RUWA 2DRKA 1G2BA 4DEYA 1NLOC 1E7OA 2EPDA 2BZYA 1ZSGA 2ESWA 1M8MA 4AFZC 1YNZA 2KGTA 3KFVA 1RLQC 2G6FX 5FWCA 3UATA 4OMLA 1J3TA 1PKSA 1RLPC 1UECA 1M30A 4A63B 4AFQC 2K9GA 5FW9A 1YN8A 4IIOA 1H92A 1TUCA 4RTZA 1QKWA 2RF0A 2L3QA 5IHKA 1E6GA 1ABQA 1NM7A 2D0NA 2FRYA 4OMOA 2CUDA 1NEGA 1VYTA 1BB9A 2KE9A 2KR3A 1GCQC 1YP5A 1KFZA 1YWPA 1WA7A 2KXCA 2DX1A 1WDXA 1KJWA 3PVLA 1X2KA 5IXFA 2JMAA 2RMOA 2K79A 4AFSC 2LJ3A 1VA7A 2W0ZA 1M3BA 2KRNA 2EVRA 1AOJA 3I9QA 2LJ1A 1YCSB 2KBTA 2GTJA 1Z9QA 1LCKA 4AG1C 2C0IA 1Y57A 1UDLA 4ORZA 1GCPA 2AKKA 1BU1A 1W1FA 1ZUYA 2BTTA 2YUQA 4GLMA 1K9AA 1NYFA 2L0AA 5IHNA 3VRZA 3EG2A 3REAB 4RTYA 4JPBW 2F2XA 1K4US 3H0IA 2KRSA 4QT7A 5HCKA 1QLYA 2C0OA 2LQWA 4JZ4A 2CT4A 2FPEA 3EHQA 4AFUC 1AZEA 1FMKA 1X6BA 1PRLC 2DYBA 2GGRA 1WI7A 1X6GA 1JEGA 1PKTA 3M0SA 3PVQA 2KT8A 3JV3A 1JO8A 2DJQA 1Y0MA 3RNJA 4Z8AA 4D8DA 5IH2A 3M0PA 2JT4A 1ZUKA 2J7IA 2EGCA 1EFNA 1TG0A 1SHFA 1I07A 4RTVA 2FEIA 2DM1A 1NG2A 1GBRA 1T3LA 3ZL7C 2EGEA 2L3SA 2M0YA 2J05A 1AEYA 4RUGA 1ABOA 1QWFA 4HCKA 4OMQA 3EG0A 2PNIA 2HBWA 5L23A 1SRMA 4J9CA 1MUZA 3REBB 3I5SA 1QWEA 1W6XA 2E5KA 1K0SA 4OMNA 5I22A 3C0CA 1X2QA 2A37A 2JW4A 2RPNA 1M3AA 1UHCA 1ZBJA 2KNBB 2NWMA 2LZ6B 3U23A 2DRMA 2O9VA 1KIKA 2CREA 3SEMA 4ESRA 1WXUA 1SSHA 2MIOA 3UA7A 2LMJA 1X69A 2O31A 2JS2A 4JZ3A 5GJWB 3M0TA 2EKHA 4K11A 2GBQA 4HVWA 2I0NA 2HCKA 1B07A 4CC4B 3VS1A 4F14A 2DLPA 1WLPB 1S1NA 1T3SA 2GQIA 1I1JA 2ROTA 3R6NA 1ZUUA 4RTTA 1UE9A 2LNHB 3VS7A 2EGAA 2K7AA 2KRMA 3EG1A 3TSWA 2KEAA 4HVVA 2AK5A 2O88A 1UG1A 2HSPA 4ZNXA 3H0HA 3GBQA 1U5SA 2C0TA 1QCFA 3EHRA 3IQLA 2L3PA 4J9IA 2DBKA 1VYUA 4LUDA 3I5RA 2RQRA 1OPLA 1ARKA 3M0QA 1UTIA 4D8KA 2ECZA 3LH5A 1SEMA 3TSZA 2DVJA 3H41A 2CUBA 2ENMA 2M51A 1W70A 1HSQA 3A98A 1AWOA 2ROLA 2EYYA 2ABLA 1M3CA 2DF6A 4X1VA 2YT6A 2MOXA 2QDLA 4LUEA 4DEXA 2VKNA 2DA9A 3VS4A 1AZGB 1H3HA 3FJ5A 1RI9A 2VVKA 1E6HA 1GL5A 2KYBA 2RQUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VRY A;  2CT3 A;  2AZS A;  1WXT A;  2DBM A;  2O2O A;  4Z89 A;  4Y92 A;  2D1X A;  1JXM A;  4WCI A;  3M0U A;  2ED0 A;  2J6F A;  4FSS A;  2V1R A;  3I35 A;  2NUZ A;  2F2V A;  1I0C A;  2JMC A;  3CQT A;  2J6K A;  3PE0 A;  1PRM C;  2VWF A;  1AWJ A;  2J06 A;  3THK A;  5GJV B;  1HJD A;  2K3B A;  1CKA A;  2DMO A;  3VS6 A;  2D8J A;  1AVZ C;  2RQV A;  2O9S A;  3EG3 A;  1GBQ A;  1AD5 A;  4JJC A;  2B86 A;  1JXO A;  1BBZ A;  2DL4 A;  1CSK A;  2CH4 A;  2HEQ A;  1JQQ A;  2FPF A;  3UF4 A;  2DL5 A;  5FWB A;  1U06 A;  2OJ2 A;  4CC7 A;  1WIE A;  2YDL A;  2J6O A;  2YUO A;  2FO0 A;  4CC2 A;  1GFD A;  1OEB A;  1TUD A;  1CKB A;  2SEM A;  1GRI A;  1V1C A;  1KSW A;  2GTO A;  2X3X D;  1OPK A;  2KRO A;  1UGV A;  4M4Z A;  4JJB A;  1X43 A;  3O5Z A;  4J9D A;  3VS0 A;  2OI3 A;  3H0F A;  4J9H A;  1GFC A;  2EQI A;  1T0J A;  4J9F A;  1AWW A;  5ECA A;  2LQN A;  2DIL A;  1HD3 A;  2CSI A;  2V1Q A;  2CSQ A;  1N5Z A;  2L2P A;  1PHT A;  3QWX X;  4J9G A;  4LE9 A;  2CDT A;  1PWT A;  2A08 A;  2PZ1 A;  2YUN A;  1PNJ A;  3NMZ C;  5IXB A;  2W10 A;  1U3O A;  3ULR B;  4RTW A;  4KRT A;  2DL3 A;  4J9E A;  2JXB A;  4IIM A;  3RBB B;  1SHG A;  1UFF A;  1XOV A;  2RQW A;  2EYZ A;  1JU5 C;  2DNU A;  4OMP A;  4E6R A;  4JJD A;  2FG0 A;  1MV3 A;  1QKX A;  2LP5 A;  5EC7 A;  1MV0 B;  2KXD A;  5I11 A;  1IO6 A;  1FYN A;  2H8H A;  2RN8 A;  1B3Q A;  2YUP A;  4F17 A;  2BZ8 A;  2PTK A;  1OOT A;  4OMM A;  1K76 A;  2HDA A;  1BK2 A;  2FRW A;  2XMF A;  3TVT A;  2EBP A;  2EYX A;  3UA6 A;  3VS5 A;  1K1Z A;  2JS0 A;  4RTX A;  2F2W A;  1UHF A;  2D8H A;  3NPF A;  2K2M A;  2KT1 A;  4LN2 A;  1UJ0 A;  4J9B A;  1UJY A;  2JTE A;  4EIK A;  2JM9 A;  1NEB A;  4HVU A;  2FPD A;  2OAW A;  2X3W D;  2A28 A;  5IHI A;  1Z9Z A;  2RQT A;  1X27 A;  3VS2 A;  3QWY A;  4RTU A;  3SHW A;  2YSQ A;  3NHN A;  2AZV A;  2EYW A;  4HXJ A;  3M0R A;  1K0X A;  1AWX A;  1WFW A;  1SPK A;  2ED1 A;  1ZLM A;  1ZX6 A;  4AG2 C;  2P4R A;  2GNC A;  3NGP A;  1SRL A;  2DL7 A;  2K6D A;  1VYV A;  2BZX A;  2DE0 X;  2JM8 A;  3EGU A;  2LCS A;  1M27 C;  4LNP A;  1WX6 A;  1YWO A;  2KYM A;  2DL8 A;  2LX7 A;  2SRC A;  1WXB A;  2RNA A;  2MCN A;  1WYX A;  1T0H A;  1A0N B;  4GBQ A;  2A36 A;  1OV3 A;  2CH4 W;  4R0K A;  1NYG A;  1H8K A;  4Z88 A;  1UUE A;  2IIM A;  1GCQ A;  2AKL A;  1NLP C;  2EW3 A;  3VS3 A;  2LJ0 A;  1G83 A;  4CC3 A;  4F16 A;  1RUW A;  2DRK A;  1G2B A;  4DEY A;  1NLO C;  1E7O A;  2EPD A;  2BZY A;  1ZSG A;  2ESW A;  1M8M A;  4AFZ C;  1YNZ A;  2KGT A;  3KFV A;  1RLQ C;  2G6F X;  5FWC A;  3UAT A;  4OML A;  1J3T A;  1PKS A;  1RLP C;  1UEC A;  1M30 A;  4A63 B;  4AFQ C;  2K9G A;  5FW9 A;  1YN8 A;  4IIO A;  1H92 A;  1TUC A;  4RTZ A;  1QKW A;  2RF0 A;  2L3Q A;  5IHK A;  1E6G A;  1ABQ A;  1NM7 A;  2D0N A;  2FRY A;  4OMO A;  2CUD A;  1NEG A;  1VYT A;  1BB9 A;  2KE9 A;  2KR3 A;  1GCQ C;  1YP5 A;  1KFZ A;  1YWP A;  1WA7 A;  2KXC A;  2DX1 A;  1WDX A;  1KJW A;  3PVL A;  1X2K A;  5IXF A;  2JMA A;  2RMO A;  2K79 A;  4AFS C;  2LJ3 A;  1VA7 A;  2W0Z A;  1M3B A;  2KRN A;  2EVR A;  1AOJ A;  3I9Q A;  2LJ1 A;  1YCS B;  2KBT A;  2GTJ A;  1Z9Q A;  1LCK A;  4AG1 C;  2C0I A;  1Y57 A;  1UDL A;  4ORZ A;  1GCP A;  2AKK A;  1BU1 A;  1W1F A;  1ZUY A;  2BTT A;  2YUQ A;  4GLM A;  1K9A A;  1NYF A;  2L0A A;  5IHN A;  3VRZ A;  3EG2 A;  3REA B;  4RTY A;  4JPB W;  2F2X A;  1K4U S;  3H0I A;  2KRS A;  4QT7 A;  5HCK A;  1QLY A;  2C0O A;  2LQW A;  4JZ4 A;  2CT4 A;  2FPE A;  3EHQ A;  4AFU C;  1AZE A;  1FMK A;  1X6B A;  1PRL C;  2DYB A;  2GGR A;  1WI7 A;  1X6G A;  1JEG A;  1PKT A;  3M0S A;  3PVQ A;  2KT8 A;  3JV3 A;  1JO8 A;  2DJQ A;  1Y0M A;  3RNJ A;  4Z8A A;  4D8D A;  5IH2 A;  3M0P A;  2JT4 A;  1ZUK A;  2J7I A;  2EGC A;  1EFN A;  1TG0 A;  1SHF A;  1I07 A;  4RTV A;  2FEI A;  2DM1 A;  1NG2 A;  1GBR A;  1T3L A;  3ZL7 C;  2EGE A;  2L3S A;  2M0Y A;  2J05 A;  1AEY A;  4RUG A;  1ABO A;  1QWF A;  4HCK A;  4OMQ A;  3EG0 A;  2PNI A;  2HBW A;  5L23 A;  1SRM A;  4J9C A;  1MUZ A;  3REB B;  3I5S A;  1QWE A;  1W6X A;  2E5K A;  1K0S A;  4OMN A;  5I22 A;  3C0C A;  1X2Q A;  2A37 A;  2JW4 A;  2RPN A;  1M3A A;  1UHC A;  1ZBJ A;  2KNB B;  2NWM A;  2LZ6 B;  3U23 A;  2DRM A;  2O9V A;  1KIK A;  2CRE A;  3SEM A;  4ESR A;  1WXU A;  1SSH A;  2MIO A;  3UA7 A;  2LMJ A;  1X69 A;  2O31 A;  2JS2 A;  4JZ3 A;  5GJW B;  3M0T A;  2EKH A;  4K11 A;  2GBQ A;  4HVW A;  2I0N A;  2HCK A;  1B07 A;  4CC4 B;  3VS1 A;  4F14 A;  2DLP A;  1WLP B;  1S1N A;  1T3S A;  2GQI A;  1I1J A;  2ROT A;  3R6N A;  1ZUU A;  4RTT A;  1UE9 A;  2LNH B;  3VS7 A;  2EGA A;  2K7A A;  2KRM A;  3EG1 A;  3TSW A;  2KEA A;  4HVV A;  2AK5 A;  2O88 A;  1UG1 A;  2HSP A;  4ZNX A;  3H0H A;  3GBQ A;  1U5S A;  2C0T A;  1QCF A;  3EHR A;  3IQL A;  2L3P A;  4J9I A;  2DBK A;  1VYU A;  4LUD A;  3I5R A;  2RQR A;  1OPL A;  1ARK A;  3M0Q A;  1UTI A;  4D8K A;  2ECZ A;  3LH5 A;  1SEM A;  3TSZ A;  2DVJ A;  3H41 A;  2CUB A;  2ENM A;  2M51 A;  1W70 A;  1HSQ A;  3A98 A;  1AWO A;  2ROL A;  2EYY A;  2ABL A;  1M3C A;  2DF6 A;  4X1V A;  2YT6 A;  2MOX A;  2QDL A;  4LUE A;  4DEX A;  2VKN A;  2DA9 A;  3VS4 A;  1AZG B;  1H3H A;  3FJ5 A;  1RI9 A;  2VVK A;  1E6H A;  1GL5 A;  2KYB A;  2RQU A; 
#chains in the Genus database with same CATH topology
 1R0B G;  1D09 B;  3S3O A;  2X51 A;  1U1S A;  5KE3 A;  2R5A A;  3MCA B;  1B34 A;  2V26 A;  3E9G A;  4ZTF A;  4FSS A;  2V1R A;  4FL6 A;  1I0C A;  1ZBX A;  3QYH B;  1AHJ B;  3CQT A;  4QQD A;  5GMK i;  4GY5 A;  2VWF A;  4KUI A;  5KYW B;  4OF1 A;  4NL2 A;  3HRU A;  3H9N A;  2DMO A;  3V8K A;  3UDC A;  2DER A;  1WJS A;  2O9S A;  3EG3 A;  1GBQ A;  4PJO E;  2MF2 A;  5D7U A;  4JJC A;  3G1J A;  3OS1 A;  4E7S A;  2DXC A;  2DL4 A;  2GFA A;  4Y28 E;  5J26 A;  2HEQ A;  1JQQ A;  2CP2 A;  4HCZ A;  4PJM A;  4L6V 5;  5LJ3 h;  3CCE Q;  5FWB A;  2E10 A;  3ZEH A;  3G71 A;  2IPO B;  2I2L A;  3RMQ A;  2J6O A;  2YUO A;  2FO0 A;  1VQP A;  1CKB A;  1YHQ T;  1B7T A;  2A7Y A;  4J9D A;  4JJB A;  2EQI A;  4F7U E;  2DIL A;  1LJO A;  1BCM A;  4M7D A;  2KY9 A;  2L2P A;  4A4G A;  1PHT A;  4LE9 A;  2CDT A;  3CMA T;  3NMZ C;  1MMD A;  4LD9 K;  4M75 C;  4M78 G;  1VQ5 A;  3HPW A;  2K2V A;  1SHG A;  1OZ2 A;  1XOV A;  2RQW A;  1N6A A;  3RKW A;  3CCV T;  2KK4 A;  3FIF A;  4OMP A;  2FG0 A;  1TTH B;  4M7A D;  3JB9 G;  3DB4 A;  2LP5 A;  3OYA A;  1ZSZ C;  2KXD A;  3UWN A;  3KBG A;  2NYS A;  3A8L B;  1RI0 A;  1IO6 A;  2L5Q A;  1K73 R;  2NLU A;  3I55 T;  2RN8 A;  2K5F A;  4F17 A;  4M7D C;  4OMM A;  5CKE A;  1VQP Q;  2XMF A;  4PJO A;  1WHJ A;  3MHX A;  3TEE A;  4M7D F;  3G4S A;  2QAS A;  4RTX A;  1D0Z A;  1UHF A;  2D8H A;  2K2M A;  2BE7 D;  1VQ8 A;  2E4H A;  4RCB A;  2QTV A;  4C5E A;  1MMA A;  4II1 A;  2VXF A;  3WXM B;  4EMG A;  1M1G A;  5KH6 A;  2RQT A;  3QWY A;  4M77 G;  1VQ5 Q;  4Y91 A;  1H64 1;  3OYC A;  2ZCF B;  4F7U A;  2XIC A;  2KSS A;  3M59 A;  2RHZ A;  1YIJ A;  5L8R E;  3EG9 B;  4PJO C;  2P4R A;  4OGC A;  5LJ3 f;  2OTL A;  3NGP A;  4C92 G;  1SRL A;  4XTW A;  3M5A A;  2DL7 A;  3JCM h;  2K6D A;  4BI3 A;  2DE0 X;  2LCS A;  1M27 C;  1FX7 A;  4PJO F;  2LX7 A;  3JRZ A;  2SRC A;  4RKU E;  3LH0 A;  1G3Y A;  5I2S A;  1M90 R;  1A0N B;  3CME A;  2A36 A;  2PQW A;  2CH4 W;  4R0K A;  2DET A;  3GIB A;  1UUE A;  3G4S Q;  1GCQ A;  4WF2 A;  3QSU A;  1Q95 G;  3CC4 Q;  5FU6 C;  3VS3 A;  5A0L A;  1UEB A;  4C0G A;  1VQ8 Q;  3QZ5 B;  1K9M C;  3JCM J;  2DVE A;  3SWN C;  1ZSG A;  3AHU A;  2KGT A;  4LXC A;  4HA8 A;  4F7U F;  3HL8 A;  4ATO A;  1M30 A;  2EJG A;  5DY9 A;  4V2S A;  2O01 E;  1H92 A;  4HKE A;  1RAC B;  1R0C B;  1QKW A;  2CZ0 B;  3EFR A;  3G6E A;  2FRY A;  2OTL Q;  2CUD A;  2FB7 A;  1VYT A;  1VQ9 T;  1BB9 A;  2KR3 A;  2QQR A;  1GCQ C;  4C0Z A;  1N9S A;  4BDZ A;  2D9T A;  1YWP A;  1Q7Y U;  3UPU A;  3MP6 A;  2KXC A;  1Q86 U;  1YJW T;  3PVL A;  1KJW A;  4BDY A;  4Z02 A;  2JNG A;  5GAO q;  5FRN A;  4FT4 A;  3MPU B;  2RH2 A;  1VA7 A;  3CXC A;  4C0D B;  3CME Q;  1VQ4 A;  2DO3 A;  1SG5 A;  3I9Q A;  3CD6 A;  2PVO B;  2KBT A;  3CXC S;  1NE8 A;  1Z9Q A;  1LCK A;  4OB0 B;  1JJ2 A;  5GAM g;  3JB9 J;  4ORZ A;  5J3B A;  1JJ2 S;  1BU1 A;  1Q81 U;  4ME7 A;  2EWN A;  1W1F A;  2YUQ A;  4E7L A;  2JUF A;  3GF5 A;  5IHN A;  3VRZ A;  2E3H A;  3SDZ A;  2DAQ A;  4JPB W;  2F2X A;  1Q7Y R;  3H0I A;  2LCL A;  1Q86 R;  5HCK A;  5KYY B;  4C0F A;  7AT1 B;  1G8X A;  4JZ4 A;  2CT4 A;  3JCM f;  3FC3 A;  4AFU C;  2P0Q A;  3QXE B;  2XD0 A;  5FU7 C;  3CCJ T;  2LT4 A;  3JCM b;  4M75 D;  4AMC A;  2DJQ A;  1W2B S;  4Z8A A;  2GQV A;  1K8A C;  2CZ1 B;  1ZUK A;  1TG0 A;  1Q81 R;  3GP8 A;  1I07 A;  4RTV A;  3OYN A;  2DM1 A;  1NG2 A;  1GBR A;  2L3S A;  4C5H A;  5LJ3 g;  2M0Y A;  2M16 A;  3SB2 A;  1TH7 A;  1QWF A;  4M7D E;  3CD6 Q;  4O6J A;  2PNI A;  3L2W A;  1KQS A;  5GAO r;  5LJ5 d;  3RES A;  4EMK B;  3I5S A;  2K5L A;  2E5K A;  4LD6 A;  5CK9 A;  3RER A;  1HXD A;  2RI5 A;  1M5Q 1;  1H3Z A;  1M3A A;  2KNB B;  2NWM A;  2CRE A;  4ESR A;  3OBY A;  2MIO A;  1N8R C;  3PMT A;  1YHQ A;  2JS2 A;  1O75 A;  4QVZ A;  5CCA A;  4M7A E;  2GBQ A;  3G71 T;  4C8Q C;  3JCM W;  5C6S A;  2X9H A;  4IUT A;  4F14 A;  1FMW A;  4M77 B;  3CMA A;  1T3S A;  2ROT A;  1UE9 A;  2RI3 A;  4MZM A;  1VQ6 T;  2JJ9 A;  2KRM A;  2LQK A;  2DIG A;  3V7C A;  1U1T A;  3GLX A;  1UG1 A;  3QKJ A;  4ELY C;  1WZO A;  3HTR A;  1NJI U;  1TUG B;  2V8J A;  3IQL A;  3EHR A;  2L3P A;  3I55 A;  2EIF A;  4JDS A;  4LUD A;  2RQR A;  2QTX A;  2CKK A;  4D8K A;  3RKX A;  4BE0 A;  1M2V A;  5A0G A;  4F04 B;  3S3M A;  1LOJ A;  1W70 A;  4LDY A;  3L2Z A;  2DEQ A;  1D0Y A;  2LRQ A;  2DF6 A;  3E1S A;  2YT6 A;  3OSV A;  4DBQ A;  2L89 A;  4LUE A;  3TU4 K;  4F7U G;  1H3H A;  3CMA Q;  4AT1 B;  3JCM P;  1TU0 B;  4N0A A;  3ZBD A;  3TRE A;  1WJR A;  3VYG A;  2MK5 A;  1BIB A;  1QVF P;  4M7A A;  2HKN A;  2QA4 Q;  2AZS A;  2YRV A;  4KUL A;  3CCV Q;  2DBM A;  2CP7 A;  4Z89 A;  1LNX A;  4Y92 A;  4FYX B;  1JXM A;  3VV0 A;  2RHI A;  3OYI A;  4XTZ A;  2AIR B;  3OYJ A;  2ED0 A;  2FZG B;  1BKB A;  3M4Y A;  5GMK h;  2GFU A;  1S72 Q;  2NUZ A;  2ATC B;  1XTD A;  3A8H B;  3OMG A;  4EPC A;  5CR2 A;  3F70 A;  3PE0 A;  2NUT A;  2RM4 A;  1PRM C;  2MMP A;  4N0A C;  4QKU A;  3THK A;  2LQ8 A;  4GLK A;  5GJV B;  1HJD A;  3FB9 A;  2H3J A;  4XU3 A;  5KYU A;  4OB1 B;  3VS6 A;  4E7J A;  2HL5 C;  2D8J A;  3FLG A;  3MEV A;  1AVZ C;  2RQV A;  1KD1 U;  3V7S A;  3CPW A;  1B34 B;  2PU9 B;  5GAM e;  1QVG P;  4OMF B;  3CPF A;  1G3S A;  3CPW S;  5M9O A;  1BBZ A;  1M4Z A;  4JLG A;  2EJ9 A;  4M7A F;  1CSK A;  3HSB A;  3VU3 C;  3CC7 Q;  3ZFJ A;  1X01 A;  1KK7 A;  4PLL A;  3NTK A;  1OZ3 A;  3A5Z B;  4PL6 A;  4YTL A;  1UGQ B;  2SEM A;  1GRI A;  3L2U A;  1V1C A;  4ZN3 A;  1KSW A;  4XU1 A;  1OPK A;  3OYM A;  3VS0 A;  1VQO A;  1EZZ B;  1GFC A;  1VQ9 A;  3OSS C;  1Q82 U;  2LQN A;  5KCO A;  1HD3 A;  2DXU A;  2HQH A;  4IUQ A;  1YJW A;  1KD1 R;  3QWX X;  1PWT A;  4E2F B;  2PZ1 A;  4JRP A;  5IXB A;  3E19 A;  1O9S A;  3G6E T;  2E6Z A;  3ULR B;  2DFU A;  3EGD A;  4RTW A;  4KBM B;  3C95 A;  1JRI A;  5LJ3 e;  3NTH A;  3LWH A;  1W4S A;  4PFP A;  2JXB A;  1MND A;  4IIM A;  3EFS A;  2YLB A;  1UFF A;  2X4Y A;  2XDD A;  1Q7Y C;  2EYZ A;  2YHT A;  1Q86 C;  2DNU A;  4JJD A;  2D0Q B;  1QKX A;  5EC7 A;  2F5K A;  4M75 E;  2QEX T;  2H8H A;  4XTV A;  4M7D B;  2YUP A;  2MWO A;  3UT1 A;  1OOT A;  2VYT A;  9ATC B;  1WQW A;  4NS5 A;  2VUB A;  2LC4 A;  2HDA A;  3OW2 P;  1BK2 A;  4ELZ C;  4C8Q D;  1Q81 C;  3PGG A;  3VS5 A;  2P0P A;  1X75 C;  1UJ0 A;  1UJY A;  1NEB A;  1YJW Q;  2HL3 A;  2A28 A;  3T9N A;  5AYF A;  3C12 A;  4QQG A;  1G5V A;  2YRD A;  4RTU A;  2EYW A;  3M0R A;  5GAN h;  1AWX A;  3URG A;  1WFW A;  4PJO B;  3H8Z A;  4B9W A;  1SPK A;  2ED1 A;  1QVP A;  3DLL A;  4BE1 A;  4AG2 C;  2DTO A;  5CKF A;  3VUZ A;  2MI6 A;  2JM8 A;  2HAX A;  1YWO A;  2CP3 A;  2YRC A;  3JCM d;  3EH2 A;  5EG2 A;  1MGQ A;  4N4H A;  4M75 A;  3CCL T;  1OV3 A;  1H8K A;  3MKD A;  3GNG A;  5FU6 B;  4F7U B;  1BYM A;  3CCJ Q;  3PT9 A;  2EW3 A;  1NLP C;  2JZ2 A;  4TVR A;  2E41 A;  1BI2 A;  1G2B A;  1NZ9 A;  4DEY A;  1NLO C;  3JB9 H;  1ZSZ A;  2EPD A;  2BZY A;  3A1P A;  1VQM A;  4J8O A;  3Q1J A;  1M8M A;  2MWP A;  1K73 U;  4FYW B;  4E7H A;  1ACM B;  1VQ6 A;  5FRO A;  4OML A;  1J3T A;  1PKS A;  1UEC A;  2DKG A;  3SD4 A;  4A63 B;  4AFQ C;  1YN8 A;  3PNW C;  1YJ9 T;  1I5L A;  3L2R A;  4IIO A;  5IHK A;  2LNV A;  1ABQ A;  2QQA A;  4M78 D;  3HFN A;  3PFS A;  2KE9 A;  1PD0 A;  1YP5 A;  4FW1 A;  1IRX A;  2Y90 A;  3VYH B;  1QQJ A;  4M75 F;  2NUP A;  5CQY A;  2RMO A;  2LJ3 A;  2HD0 A;  1NJI C;  4FW2 A;  4BY6 C;  2EYQ A;  5GAN 6;  3S6W A;  2EVR A;  1UGP B;  1YCS B;  1QMC A;  3LYI A;  1HK9 A;  4AG1 C;  5GAN j;  2RJE A;  3G71 Q;  3RIR A;  1VQ7 T;  2C0I A;  1Y57 A;  1UDL A;  4M7A G;  4WTO B;  2AKK A;  3D7S B;  3QUI A;  2C06 A;  1R8O B;  1ZUY A;  1K9A A;  3OS5 A;  1KC8 U;  1NYF A;  3HKS A;  5GAN f;  3EG2 A;  4J7F A;  3REA B;  1BI1 A;  1VQ6 Q;  5LJ5 g;  1VQK A;  4QT7 A;  3OYK A;  2L3R A;  1FXX A;  3QG1 A;  1AZE A;  1C0M A;  4E47 A;  3KUF A;  4DQ2 A;  1M90 U;  2GGR A;  5FU7 B;  1NBE B;  1X6G A;  1PKT A;  3M0S A;  3PVQ A;  2KT8 A;  3JV3 A;  5KYN A;  4X9C A;  2DK3 A;  3RNJ A;  2JT4 A;  3MO8 A;  2J7I A;  4DOW A;  2EGC A;  2IVW A;  2QK0 A;  4R56 A;  1EFN A;  4RG8 A;  3SWN A;  1SHF A;  2XK0 A;  1KC8 R;  1WGS A;  3ZL7 C;  5IAY A;  3V7R A;  2J05 A;  1YIT T;  3CC2 T;  2K4Y A;  4HCB A;  4HCK A;  1D0X A;  2HBW A;  1EIF A;  2OTJ T;  4J9C A;  1MMG A;  4KGZ B;  4A4E A;  1QWE A;  4PFZ A;  5I22 A;  3C0C A;  4QW2 A;  5GMK l;  2RPN A;  3OYB A;  1UHC A;  1ZBJ A;  2YXY A;  1I5O B;  3QJY A;  1VIE A;  1KD1 C;  1OI1 A;  1SSH A;  1WXU A;  2M9U A;  3QJ6 A;  3OYG A;  5CO7 A;  4PFO A;  3M53 A;  2IG0 A;  4N4G A;  2EKH A;  5CIU A;  1LVK A;  4MZT A;  4FSX A;  4B9X A;  2XDP A;  1G3W A;  5A2Q E;  2CYZ B;  3QDF A;  4RG2 A;  3VS1 A;  2DLP A;  4PJJ A;  1YIJ Q;  6AT1 B;  1S1N A;  2CS7 A;  5FLX E;  1VQO T;  2EGA A;  2ZZD A;  2CZ7 B;  1Q82 C;  4C8Q E;  4BE2 A;  2JVV A;  3QZ9 B;  4PJL A;  1UGS B;  2O88 A;  5DLO A;  3FRN A;  3GBQ A;  1KQ2 A;  3OYD A;  2C0T A;  2QEX A;  1NPR A;  4J9I A;  3L2V A;  1VYU A;  3I5R A;  2FVU A;  2HMA A;  3I56 A;  4EDU A;  1OPL A;  2COY A;  2E5Q A;  4IUV A;  2EKO A;  2DEU A;  3OS0 A;  2LDM A;  1SEM A;  2E1H A;  1RL2 A;  4MML A;  3H41 A;  5GAN 4;  2CUB A;  2M51 A;  2COW A;  2QQS A;  1AWO A;  2ROL A;  2ABL A;  1RAE B;  1M3C A;  2CZ6 B;  1KQ1 A;  2M0O A;  1I4K 1;  2A3L A;  3VS4 A;  2ZPG B;  4IUR A;  5GAO n;  1RI9 A;  2VVK A;  3G6E Q;  1E6H A;  2EJF A;  3VRY A;  3OYL A;  3ER0 A;  1WXT A;  2F1L A;  1M2V B;  2O2O A;  3E2U A;  4J6W A;  5CAI A;  1BI0 A;  2D1X A;  1M1K U;  3M55 A;  4XU0 A;  4HT8 A;  2QEX Q;  1WHK A;  2ZPB B;  1VQ4 Q;  4M75 G;  5KYX A;  4C8Q A;  3I35 A;  3CXC P;  2DYI A;  2JMC A;  4PNO A;  1KQS S;  5DLQ E;  1JJ2 P;  4UC4 A;  3CCL A;  1WJQ A;  1D1C A;  5CVI A;  4M7A B;  1YJN T;  1PD1 A;  5KCH A;  2K3B A;  1CKA A;  4BD3 A;  2RJF A;  4M78 E;  3GOX A;  4M7D G;  1G3T A;  2B86 A;  1M1K R;  2M02 A;  4LDX A;  2QI2 A;  3VUB A;  3SFM A;  3UF4 A;  5GMK e;  4PK4 A;  2VB6 A;  5LJ5 e;  1U8R A;  3A8M B;  3MP8 A;  2PUK B;  1W2B P;  4CC7 A;  1YJ9 A;  1D1B A;  4CC2 A;  1GFD A;  1VQM T;  2NUT B;  3X26 B;  2WAC A;  4M4Z A;  1ZA1 B;  3JCM V;  1K73 C;  1T0J A;  4OVA A;  2OAU A;  4J9F A;  4C8Q F;  1AWW A;  5CKD A;  5KYU B;  2ZGW A;  1WHG A;  3FEO A;  2CSI A;  3P8D A;  2A08 A;  4DA4 A;  2YUN A;  1P92 A;  3LWI A;  3PIP A;  2XU8 A;  1Y96 A;  1SKU B;  1MHN A;  5CQX A;  4KRT A;  4PJO G;  3CCL Q;  5C0M A;  2QYZ A;  2DL3 A;  1V76 A;  4J9E A;  2F5T X;  1QCN A;  1QCO A;  1JU5 C;  3G7Z A;  1VQ7 A;  4OB2 B;  3ASK A;  2WSE E;  5I11 A;  4ZGJ B;  1YHQ Q;  1OUL A;  5FRM A;  3EFO A;  3CCS T;  2BKD N;  3X20 B;  1Y07 A;  5GAO l;  2EQJ A;  2BZ8 A;  3OB9 A;  1UGR B;  4C92 E;  3CCR T;  3C94 A;  4C5G A;  1YJ9 Q;  3OQ5 A;  4M78 A;  3J80 E;  2Y4X A;  1Y7X A;  4J5Y A;  3EGD B;  3JCM g;  1KC8 C;  2EYX A;  3UA6 A;  3DB3 A;  2QDY B;  2F2W A;  1VQK T;  2KT1 A;  4J9B A;  2JTE A;  4J6X A;  4MDW A;  4HVU A;  4FYV B;  2OAW A;  3CCQ T;  3A8G B;  4OB3 B;  2COZ A;  5D6X A;  3NTI A;  5IHI A;  1M90 C;  1XQH A;  1IRE B;  4Q5W A;  4DBR A;  1X27 A;  2O4X A;  2YSQ A;  1YIT A;  3CC2 A;  3I55 Q;  4PKC C;  3GNF B;  3QII A;  2OTJ A;  4M78 C;  1TS9 A;  1VQ7 Q;  2LVM A;  5GAN d;  5GAN 7;  1ZLM A;  1ZX6 A;  4IUU A;  2GNC A;  2ZPH B;  2PVD B;  2MPX C;  1VYV A;  2BZX A;  2PVG B;  3V8L A;  1WX6 A;  3CBP A;  4M78 F;  1IHW A;  4BUG A;  2DL8 A;  3AT1 B;  4DBH A;  5IN1 A;  1WXB A;  2DXB A;  3EAE A;  2MCN A;  2EAY A;  1Y71 A;  4CI0 C;  4GBQ A;  1NYG A;  2EQU A;  5CKB A;  1HYO A;  3MEU A;  2LJ0 A;  1PSE A;  1OQK A;  1RUW A;  1UB4 A;  2DRK A;  3LGF A;  1K9M U;  4C92 A;  4KT0 E;  2QAZ A;  2ESW A;  3CCJ A;  1M2O A;  3EGX A;  1RLQ C;  2G6F X;  1PSF A;  5FWC A;  4FYY B;  1YIT Q;  2RD1 A;  1M9S A;  3OY9 A;  4RTZ A;  2OTJ Q;  4IKF A;  2RF0 A;  2L3Q A;  4M75 B;  4M77 C;  4JRK A;  2E70 A;  1IB8 A;  1NM7 A;  2D0N A;  2BUD A;  3S3N A;  2DPP B;  4LDV A;  2CP5 A;  1FMV A;  2DX1 A;  1WDX A;  1ZSZ B;  1MNE A;  1K9M R;  1X2K A;  3X25 B;  4C92 C;  5IXF A;  2CP0 A;  1OX8 A;  2K79 A;  2XDB A;  4BY6 B;  1OU8 A;  3CPW P;  1BI3 A;  1M3B A;  3BY7 A;  3WVD B;  3I56 T;  1AOJ A;  2LJ1 A;  2GTJ A;  2R5M A;  2X4W A;  1V29 B;  3P8B B;  3N5B B;  2RA2 A;  3PIO A;  1C6V X;  2BTT A;  4GLM A;  1JB0 E;  2L0A A;  3NFC A;  1VQO Q;  1VQ9 Q;  1IHV A;  2E3I A;  3JB9 I;  1K4U S;  2KRS A;  1QLY A;  2C0O A;  1C1A A;  1YCY A;  2LQW A;  4JRI A;  2NUP B;  3JCM X;  5GAO p;  2K3X A;  2VGM A;  4XTY A;  4C8Q G;  2FPE A;  3EHQ A;  4QQ6 A;  3MJX A;  3FJP A;  1D1A A;  1WPY A;  4DBF A;  1JEG A;  2Y4Y A;  2JN0 A;  4HCC A;  3OMC A;  1JO8 A;  2E64 A;  3J81 E;  4BI4 A;  4D8D A;  1K8A U;  3M0P A;  2P4T A;  4KH0 B;  1VQL T;  1AT1 B;  4NOY A;  3X24 B;  5GAM h;  3TQ7 P;  1M1K C;  2EGE A;  4RUG A;  4FU6 A;  1YJN A;  4HT9 A;  1PCX A;  2P84 A;  2QGF B;  4L5G A;  5AT1 B;  4J83 A;  3REB B;  4VUB A;  1K0S A;  1D3B A;  4OMN A;  3DLM A;  1FWZ A;  1X2Q A;  2JW4 A;  2BE9 B;  4ZGD B;  1K8A R;  3INZ A;  2O9V A;  1RAD B;  3QBY A;  1YI2 T;  3SWN B;  3SEM A;  2WSF E;  1N8R U;  2LMJ A;  3JCM e;  1X69 A;  1RAH B;  4XK8 E;  3J7A F;  2KI7 A;  5GJW B;  1RAA B;  4PJN A;  3M0T A;  3FDR A;  2HQE A;  3E9F A;  2EQM A;  4CC4 B;  1WLP B;  2KMT A;  1I1J A;  3JSC A;  4RTT A;  4FM4 B;  1OU9 A;  3OYH A;  4J6Y A;  3MEA A;  2BIV A;  2K7A A;  2DZ9 A;  4OP0 A;  5HK0 A;  1RAF B;  1YJN Q;  3EG1 A;  3P8H A;  3TSW A;  2E6N A;  2KEA A;  3LGL A;  2AK5 A;  1M1F A;  3JB9 D;  4ZNX A;  2FHD A;  1N8R R;  5GAN 5;  4ZTJ A;  2KDS A;  2RJC A;  3CCS A;  2DBK A;  3O8V A;  2QA4 T;  4ZGE B;  1VQN T;  3OYF A;  4A4F A;  3QHS A;  2ECZ A;  3CCR A;  2M1H A;  3LH5 A;  2XID A;  1VQM Q;  3HFO A;  2ENM A;  5GAM j;  1HSQ A;  2FZK B;  2JTF A;  3A98 A;  3M56 A;  2R58 A;  1IZ6 A;  3CBM A;  2DD4 A;  1S72 T;  4E7I A;  4D6W A;  2YLC A;  2LT1 A;  4XQ3 A;  4C5I A;  2H3E B;  2MOX A;  3WVE B;  5GAM f;  4DEX A;  3BFM A;  3CCQ A;  1AZG B;  3FJ5 A;  3EH1 A;  3CCU T;  2QXF A;  3VKI A;  3CEY A;  1GL5 A;  2DXT A;  2K5I A;  2RHU A;  4KGV B;  4M77 D;  4RCC A;  5KYW A;  3CC4 A;  1WHH A;  2CT3 A;  4FT2 A;  3M57 A;  3KXT A;  1TOV A;  4A4K A;  2RB6 A;  3JCM c;  2HSE B;  4A53 A;  2A0F B;  5IT9 E;  3L42 A;  1RAB B;  4C92 D;  4WCI A;  3M0U A;  3CC7 T;  2J6F A;  3CCS Q;  5LJ3 j;  3GPL A;  3OA6 A;  2F2V A;  4X34 A;  2XKO C;  2OX7 A;  3CCR Q;  2J6K A;  2EFI A;  1AWJ A;  2KQW A;  2J06 A;  3M58 A;  1I8F A;  1VQK Q;  1KHC A;  2X4J A;  1TXQ A;  1AD5 A;  4XTX A;  3CCQ Q;  2VXE A;  1JXO A;  1KG1 A;  2CH4 A;  2FPF A;  2DL5 A;  3CCM T;  5KYX B;  4C8Q B;  4FCY A;  2ZAE A;  2EQK A;  1U06 A;  2OJ2 A;  2K3Y A;  1WIE A;  2YDL A;  1OEB A;  1TUD A;  1QP3 A;  3L2Q A;  2GTO A;  2X3X D;  2KRO A;  1UGV A;  3PMI A;  1X43 A;  1RAI B;  3O5Z A;  2OI3 A;  3H0F A;  4J9H A;  5D6Y A;  5ECA A;  2V1Q A;  2X35 A;  2CSQ A;  1N5Z A;  4XTU A;  2CP6 A;  4J9G A;  1PNJ A;  3RR6 A;  2FL7 A;  2W10 A;  2F69 A;  1U3O A;  2YWW A;  1BIA A;  1XNI A;  3L1A A;  2KVQ G;  2GCX A;  5I21 A;  4PLI A;  3RBB B;  3C4S A;  3X28 B;  4E6R A;  1MV3 A;  5LL6 S;  1ZA2 B;  3QDR B;  1MV0 B;  2KAF A;  1QW1 A;  2ZPE B;  1NPP A;  4ANJ A;  1FYN A;  5GAN g;  3R6O A;  4OGE A;  1B3Q A;  4O5V A;  2PTK A;  4JRQ A;  1K76 A;  1WHM A;  2FRW A;  3TVT A;  3EG9 A;  1Y96 B;  2HKQ B;  2EBP A;  2RJD A;  5GAN 2;  1K1Z A;  1M8V A;  2JS0 A;  3V8J A;  3JAM E;  3NPF A;  4LN2 A;  1VIF A;  5DM7 R;  4EIK A;  2JM9 A;  2HQX A;  2FPD A;  2X3W D;  1VQL A;  3HRT A;  2RO0 A;  2DJZ A;  4JS4 A;  1Z9Z A;  3EFO B;  3TCJ A;  4R55 A;  1X6O A;  3VS2 A;  1YBY A;  3SHW A;  3NHN A;  2LX9 A;  1W2B A;  3CCE T;  2FZC B;  1TSF A;  2AZV A;  4HXJ A;  2XI9 A;  3I56 Q;  1K0X A;  1IGQ A;  4BI8 B;  2R57 A;  3LW5 E;  5GMK m;  5D6W A;  2X4X A;  4M78 B;  2RK2 A;  4XU2 A;  2HNI A;  2E12 A;  2DIQ A;  3OBW A;  1XJW B;  3LX7 A;  1N9R A;  3HHT B;  3EGU A;  4LNP A;  2GF7 A;  4QVC A;  1YFN A;  2KYM A;  1DJ7 B;  1YI2 A;  2PUO B;  4M7D D;  2RNA A;  1WYX A;  1T0H A;  4IUP A;  2LCC A;  2O4X B;  4Z88 A;  4LDU A;  2HBP A;  2IIM A;  2QQ9 A;  2AKL A;  1OYX A;  1G83 A;  4CC3 A;  3CBO A;  4F16 A;  5HK3 A;  1LPL A;  1E7O A;  2K57 A;  1JBM A;  1YNZ A;  4AFZ C;  1VQL Q;  3KFV A;  3UAT A;  1RLP C;  2DZC A;  4KH1 B;  2K9G A;  5FW9 A;  1VQP T;  1TUC A;  4FIB A;  3VJP A;  2VV5 A;  3RUX A;  1WHL A;  1E6G A;  1QVF A;  3RMS A;  2WSC E;  1KQS P;  4OMO A;  4E7K A;  1NEG A;  4PJO D;  1QVF S;  2VC8 A;  4P5N A;  3QPH A;  1N27 A;  2QA4 A;  4KUD K;  1KFZ A;  1VQN A;  4JS5 A;  1WA7 A;  2FYK A;  3CCV A;  4C92 B;  5KYY A;  4M77 E;  3QO3 A;  1YI2 Q;  3BDL A;  2JMA A;  4RMO A;  4MDX A;  3EGX B;  4AFS C;  3PTA A;  1WQ7 A;  2DD5 A;  1VQ5 T;  2W0Z A;  2KRN A;  4C0D C;  1S72 A;  1PC0 A;  1MMN A;  1IXD A;  1QP2 A;  1IGU A;  4EMH A;  2RHY A;  1GCP A;  2Z0W A;  3DKM A;  8ATC B;  2DTI A;  3CCU A;  2QQB A;  3A8O B;  2MYS A;  8AT1 B;  4JJN K;  5CKH A;  4RTY A;  4JUV A;  2XG8 D;  1GXI E;  1QVG A;  2G3R A;  1ZHI A;  1QVG S;  4DOV A;  3JCM Q;  4N4I A;  4A4H A;  2V8K A;  3RKY A;  1FMK A;  1VUB A;  1X6B A;  2E65 A;  1PRL C;  2DYB A;  1NJI R;  4EMK A;  1WI7 A;  3G4S T;  4BB7 A;  3CC4 T;  3CC7 A;  1Y0M A;  1R77 A;  1VQ8 T;  4XAX B;  4A54 A;  5IH2 A;  1VQN Q;  4X9D A;  5HKC A;  2FEI A;  1T3L A;  2VGN A;  2MAM A;  2DTH A;  1F1B B;  5HY6 A;  1AEY A;  5GAM d;  1ABO A;  3M4G A;  4OMQ A;  4MZP A;  2JOY A;  3EG0 A;  4BAC A;  1YIJ T;  5LJ5 h;  3BE3 A;  2RI2 A;  2L8D A;  5L23 A;  1SRM A;  2D6F A;  1MUZ A;  4M77 A;  3RDV A;  4LDW A;  2OTL T;  5J39 A;  1W6X A;  3JB9 F;  4EMK C;  3CCU Q;  2ZPI B;  1ZQ1 A;  5GAN e;  2A37 A;  5I2M A;  3CCM A;  4M7A C;  3ME9 A;  1VOM A;  2LZ6 B;  3U23 A;  2DRM A;  1KIK A;  1PG5 B;  3UA7 A;  1WNL A;  2O31 A;  3CME T;  4JZ3 A;  3M9Q A;  5GAN 3;  4CRI A;  4K11 A;  3OW2 A;  3CC2 Q;  3QYG B;  4B6M A;  2RK1 A;  1OX9 A;  4HVW A;  2I0N A;  2VAS A;  2HCK A;  1B07 A;  3OW2 S;  3HRS A;  3MEW A;  5LJ3 d;  2GQI A;  3R6N A;  1ZUU A;  3OS2 A;  1D3B B;  2LNH B;  3VS7 A;  1I81 A;  1EX4 A;  3BW1 A;  5GAN 8;  3MP1 A;  1RAG B;  1TWB A;  2ZPF B;  4HVV A;  4M77 F;  5GAO m;  2HSP A;  2P0K A;  3LLR A;  3H0H A;  1U5S A;  1QCF A;  3MET A;  2RHX A;  1SF9 A;  5KE2 A;  2XHC A;  4ZN1 A;  4QVD A;  4C92 F;  1ARK A;  3M0Q A;  1UTI A;  3CCM Q;  4JLI A;  1PM3 A;  1BCO A;  4MMK A;  3TSZ A;  2DVJ A;  3BDU A;  2QG9 B;  1VQ4 T;  3OYE A;  2LTO A;  2EYY A;  3H6Z A;  4J7I A;  3OYY A;  4E7Z A;  1SSF A;  3CD6 T;  2AT1 B;  1Q82 R;  4KGX B;  2HZY A;  5A0D A;  3M54 A;  4X1V A;  2AHJ B;  2JTM A;  2QDL A;  4L59 A;  5GMK j;  2VKN A;  5LJ5 j;  2DA9 A;  2B8A A;  4NL3 A;  1KHI A;  2QGG A;  2V8I A;  3HP9 A;  2KYB A;  3CCE A;  5LJ5 f;  2CGH A;  2RQU A; 
#chains in the Genus database with same CATH homology
 3VRY A;  2CT3 A;  2AZS A;  1WXT A;  2DBM A;  2O2O A;  4Z89 A;  4Y92 A;  2D1X A;  1JXM A;  4WCI A;  3M0U A;  2ED0 A;  2J6F A;  4FSS A;  2V1R A;  3I35 A;  2NUZ A;  2F2V A;  1I0C A;  2JMC A;  3CQT A;  2J6K A;  3PE0 A;  1PRM C;  2VWF A;  1AWJ A;  2J06 A;  3THK A;  5GJV B;  1HJD A;  2K3B A;  1CKA A;  2DMO A;  3VS6 A;  2D8J A;  1AVZ C;  2RQV A;  2O9S A;  3EG3 A;  1GBQ A;  1AD5 A;  4JJC A;  2B86 A;  1JXO A;  1BBZ A;  2DL4 A;  1CSK A;  2CH4 A;  2HEQ A;  1JQQ A;  2FPF A;  3UF4 A;  2DL5 A;  5FWB A;  1U06 A;  2OJ2 A;  4CC7 A;  1WIE A;  2YDL A;  2J6O A;  2YUO A;  2FO0 A;  4CC2 A;  1GFD A;  1OEB A;  1TUD A;  1CKB A;  2SEM A;  1GRI A;  1V1C A;  1KSW A;  2GTO A;  2X3X D;  1OPK A;  2KRO A;  1UGV A;  4M4Z A;  4JJB A;  1X43 A;  3O5Z A;  4J9D A;  3VS0 A;  2OI3 A;  3H0F A;  4J9H A;  1GFC A;  2EQI A;  1T0J A;  4J9F A;  1AWW A;  5ECA A;  2LQN A;  2DIL A;  1HD3 A;  2CSI A;  2V1Q A;  2CSQ A;  1N5Z A;  2L2P A;  1PHT A;  3QWX X;  4J9G A;  4LE9 A;  2CDT A;  1PWT A;  2A08 A;  2PZ1 A;  2YUN A;  1PNJ A;  3NMZ C;  5IXB A;  2W10 A;  1U3O A;  3ULR B;  4RTW A;  4KRT A;  2DL3 A;  4J9E A;  2JXB A;  4IIM A;  3RBB B;  1SHG A;  1UFF A;  1XOV A;  2RQW A;  2EYZ A;  1JU5 C;  2DNU A;  4OMP A;  4E6R A;  4JJD A;  2FG0 A;  1MV3 A;  1QKX A;  2LP5 A;  5EC7 A;  1MV0 B;  2KXD A;  5I11 A;  1IO6 A;  1FYN A;  2H8H A;  2RN8 A;  1B3Q A;  2YUP A;  4F17 A;  2BZ8 A;  2PTK A;  1OOT A;  4OMM A;  1K76 A;  2HDA A;  1BK2 A;  2FRW A;  2XMF A;  3TVT A;  2EBP A;  2EYX A;  3UA6 A;  3VS5 A;  1K1Z A;  2JS0 A;  4RTX A;  2F2W A;  1UHF A;  2D8H A;  3NPF A;  2K2M A;  2KT1 A;  4LN2 A;  1UJ0 A;  4J9B A;  1UJY A;  2JTE A;  4EIK A;  2JM9 A;  1NEB A;  4HVU A;  2FPD A;  2OAW A;  2X3W D;  2A28 A;  5IHI A;  1Z9Z A;  2RQT A;  1X27 A;  3VS2 A;  3QWY A;  4RTU A;  3SHW A;  2YSQ A;  3NHN A;  2AZV A;  2EYW A;  4HXJ A;  3M0R A;  1K0X A;  1AWX A;  1WFW A;  1SPK A;  2ED1 A;  1ZLM A;  1ZX6 A;  4AG2 C;  2P4R A;  2GNC A;  3NGP A;  1SRL A;  2DL7 A;  2K6D A;  1VYV A;  2BZX A;  2DE0 X;  2JM8 A;  3EGU A;  2LCS A;  1M27 C;  4LNP A;  1WX6 A;  1YWO A;  2KYM A;  2DL8 A;  2LX7 A;  2SRC A;  1WXB A;  2RNA A;  2MCN A;  1WYX A;  1T0H A;  1A0N B;  4GBQ A;  2A36 A;  1OV3 A;  2CH4 W;  4R0K A;  1NYG A;  1H8K A;  4Z88 A;  1UUE A;  2IIM A;  1GCQ A;  2AKL A;  1NLP C;  2EW3 A;  3VS3 A;  2LJ0 A;  1G83 A;  4CC3 A;  4F16 A;  1RUW A;  2DRK A;  1G2B A;  4DEY A;  1NLO C;  1E7O A;  2EPD A;  2BZY A;  1ZSG A;  2ESW A;  1M8M A;  4AFZ C;  1YNZ A;  2KGT A;  3KFV A;  1RLQ C;  2G6F X;  5FWC A;  3UAT A;  4OML A;  1J3T A;  1PKS A;  1RLP C;  1UEC A;  1M30 A;  4A63 B;  4AFQ C;  2K9G A;  5FW9 A;  1YN8 A;  4IIO A;  1H92 A;  1TUC A;  4RTZ A;  1QKW A;  2RF0 A;  2L3Q A;  5IHK A;  1E6G A;  1ABQ A;  1NM7 A;  2D0N A;  2FRY A;  4OMO A;  2CUD A;  1NEG A;  1VYT A;  1BB9 A;  2KE9 A;  2KR3 A;  1GCQ C;  1YP5 A;  1KFZ A;  1YWP A;  1WA7 A;  2KXC A;  2DX1 A;  1WDX A;  1KJW A;  3PVL A;  1X2K A;  5IXF A;  2JMA A;  2RMO A;  2K79 A;  4AFS C;  2LJ3 A;  1VA7 A;  2W0Z A;  1M3B A;  2KRN A;  2EVR A;  1AOJ A;  3I9Q A;  2LJ1 A;  1YCS B;  2KBT A;  2GTJ A;  1Z9Q A;  1LCK A;  4AG1 C;  2C0I A;  1Y57 A;  1UDL A;  4ORZ A;  1GCP A;  2AKK A;  1BU1 A;  1W1F A;  1ZUY A;  2BTT A;  2YUQ A;  4GLM A;  1K9A A;  1NYF A;  2L0A A;  5IHN A;  3VRZ A;  3EG2 A;  3REA B;  4RTY A;  4JPB W;  2F2X A;  1K4U S;  3H0I A;  2KRS A;  4QT7 A;  5HCK A;  1QLY A;  2C0O A;  2LQW A;  4JZ4 A;  2CT4 A;  2FPE A;  3EHQ A;  4AFU C;  1AZE A;  1FMK A;  1X6B A;  1PRL C;  2DYB A;  2GGR A;  1WI7 A;  1X6G A;  1JEG A;  1PKT A;  3M0S A;  3PVQ A;  2KT8 A;  3JV3 A;  1JO8 A;  2DJQ A;  1Y0M A;  3RNJ A;  4Z8A A;  4D8D A;  5IH2 A;  3M0P A;  2JT4 A;  1ZUK A;  2J7I A;  2EGC A;  1EFN A;  1TG0 A;  1SHF A;  1I07 A;  4RTV A;  2FEI A;  2DM1 A;  1NG2 A;  1GBR A;  1T3L A;  3ZL7 C;  2EGE A;  2L3S A;  2M0Y A;  2J05 A;  1AEY A;  4RUG A;  1ABO A;  1QWF A;  4HCK A;  4OMQ A;  3EG0 A;  2PNI A;  2HBW A;  5L23 A;  1SRM A;  4J9C A;  1MUZ A;  3REB B;  3I5S A;  1QWE A;  1W6X A;  2E5K A;  1K0S A;  4OMN A;  5I22 A;  3C0C A;  1X2Q A;  2A37 A;  2JW4 A;  2RPN A;  1M3A A;  1UHC A;  1ZBJ A;  2KNB B;  2NWM A;  2LZ6 B;  3U23 A;  2DRM A;  2O9V A;  1KIK A;  2CRE A;  3SEM A;  4ESR A;  1WXU A;  1SSH A;  2MIO A;  3UA7 A;  2LMJ A;  1X69 A;  2O31 A;  2JS2 A;  4JZ3 A;  5GJW B;  3M0T A;  2EKH A;  4K11 A;  2GBQ A;  4HVW A;  2I0N A;  2HCK A;  1B07 A;  4CC4 B;  3VS1 A;  4F14 A;  2DLP A;  1WLP B;  1S1N A;  1T3S A;  2GQI A;  1I1J A;  2ROT A;  3R6N A;  1ZUU A;  4RTT A;  1UE9 A;  2LNH B;  3VS7 A;  2EGA A;  2K7A A;  2KRM A;  3EG1 A;  3TSW A;  2KEA A;  4HVV A;  2AK5 A;  2O88 A;  1UG1 A;  2HSP A;  4ZNX A;  3H0H A;  3GBQ A;  1U5S A;  2C0T A;  1QCF A;  3EHR A;  3IQL A;  2L3P A;  4J9I A;  2DBK A;  1VYU A;  4LUD A;  3I5R A;  2RQR A;  1OPL A;  1ARK A;  3M0Q A;  1UTI A;  4D8K A;  2ECZ A;  3LH5 A;  1SEM A;  3TSZ A;  2DVJ A;  3H41 A;  2CUB A;  2ENM A;  2M51 A;  1W70 A;  1HSQ A;  3A98 A;  1AWO A;  2ROL A;  2EYY A;  2ABL A;  1M3C A;  2DF6 A;  4X1V A;  2YT6 A;  2MOX A;  2QDL A;  4LUE A;  4DEX A;  2VKN A;  2DA9 A;  3VS4 A;  1AZG B;  1H3H A;  3FJ5 A;  1RI9 A;  2VVK A;  1E6H A;  1GL5 A;  2KYB A;  2RQU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...